1ASTA

Structure of astacin and implications for activation of astacins and zinc-ligation of collagenases
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
200
structure length
200
Chain Sequence
AAILGDEYLWSGGVIPYTFAGVSGADQSAILSGMQELEEKTCIRFVPRTTESDYVEIFTSGSGCWSYVGRISGAQQVSLQANGCVYHGTIIHELMHAIGFYHEHTRMDRDNYVTINYQNVDPSMTSNFDIDTYSRYVGEDYQYYSIMHYGKYSFSIQWGVLETIVPLQNGIDLTDPYDKAHMLQTDANQINNLYTNECSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASTACIN
publication title Structure of astacin and implications for activation of astacins and zinc-ligation of collagenases.
pubmed doi rcsb
source organism Astacus astacus
molecule tags Hydrolase(metalloproteinase)
total genus 68
structure length 200
sequence length 200
ec nomenclature ec 3.4.24.21: Astacin.
pdb deposition date 1993-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1astA00
2YB9A 4JP4A 3N2VA 1R1IA 1MMPA 1RM8A 2X3AA 1GE7A 1SLNA 3DPEA 4DPEA 1D8MA 3LKAA 4H3XA 830CA 2JSDA 4H82A 1O0TA 3LK8A 1ZTQA 4IN9A 1K7QA 1IAEA 2N8RA 5CUHA 2W0DA 3LE9A 2WOAA 4WF6A 4JIJA 1FBLA 1MNCA 4DV8A 1H71P 1PWQA 1GKCA 1B8YA 3VTGA 3F1AA 1CAQA 4H2EA 4AXQA 4XBHA 5I0LA 1BKCI 3DPFA 4GUYA 2J0TA 4IUWA 4L19A 1YP1A 3NX7A 2OY2A 4ON1A 1USNA 1QIAA 1PWPA 2X3BA 1XUCA 1BM6A 2CLTA 1BZSA 1KUKA 3DNGA 1D8FA 1JAPA 4L63A 4PKSA 4PKWA 1ZP5A 2MZEA 2FV9A 2FV5A 4AIGA 3G5CA 2MZIA 2DW0A 4H30A 1HFCA 3EDHA 1Y93A 1JIWP 3OHLA 2OVXA 3KEJA 1SLMA 3Q2GA 1MMBA 2KRJA 4XM6A 2A8HA 3EHYA 1FLSA 3EDIA 1SATA 1UEAA 1C7KA 2O36A 3KECA 4AYKA 4FU4A 4FXYP 1J7NA 4IJOA 1BQQM 3LIKA 3LIRA 2K9CA 3HY9A 1OS2A 1ZVXA 4J4MA 1QUAA 1EAKA 5L7FA 1HV5A 1UTZA 2JT6A 4GR0A 4H84A 966CA 4PKQA 3SHIA 1IABA 3L0VA 4GWNA 4A3WA 4XCTA 3USNA 3B8ZA 3AYKA 4R3VA 4GQLA 2ERPA 1JJ9A 1ROSA 3ZVSA 4AUOA 1KAPP 1CIZA 1BQOA 1R1JA 3AYUA 5BOTA 1AKLA 3E8RA 3LUMA 1C3IA 3ZXHA 2MZHA 1JIZA 1R55A 2OW9A 1R1HA 5B5OA 3Q2HA 1MMQA 1BKCA 1OMJA 2X7MA 3I7GA 1GKDA 3U1RA 3ELMA 4A7BA 1D7XA 2DDFA 2OXUA 4PKVA 1A85A 1SU3A 2J83A 5I43A 3LGPA 2DDYA 2OW0A 1KBCA 4PKUA 2WO8A 2W14A 3WV3A 1OM6A 3LJGA 3HDBA 1OM8A 1XFYA 2AYKA 3N2UA 5LABA 2K2GA 1I73A 4WZVA 2MLSA 4QKZA 1PWUA 1Y0VA 1WNIA 3AIGA 1XFUA 1IACA 4GR3A 2OI0A 3I7IA 4L6TA 1SRPA 3O2XA 1KUIA 1JANA 5CXAA 1CGLA 2D1OA 2D1NA 3KMCA 1JKYA 2AIGP 3WV2A 1BKCE 3B2ZA 4JQGA 1ZXCA 2PJTA 3EDZA 3RTTA 4I35A 1IADA 1GE6A 1K7GA 4DF9A 3KHIA 3F19A 1BUVM 2XS3A 2E2DA 2JIHA 3EWJA 5I4OA 2DW1A 4GWMA 5BOYA 1ASTA 1OM7A 1MMRA 2OW1A 1CGEA 4EFSA 1I1IP 3OHOA 1GE5A 1D5JA 1DMTA 3G42A 4Q1LA 5D1TA 4HMAA 1UTTA 2POJA 3HYGA 3BA0A 3F15A 2Z2DA 1ZXVA 4JPAA 1CQRA 2XS4A 3LILA 3DWBA 4XM7A 2HU6A 2RJQA 2EROA 1JK3A 1SMPA 5D7WA 3P24A 2JNPA 2MLRA 1BUDA 3VI1A 3HY7A 2W13A 2O3EA 3DSLA 1ATLA 4G9LA 3F17A 1IAAA 1HY7A 1QJJA 3LEAA 2WO9A 4WKIA 3LJZA 2OXZA 4H1QA 3EDGA 3KMEA 2ERQA 1KUFA 4I03A 1XFVA 5D1SA 1OS9A 1DTHA 2CKIA 1G12A 5L79A 2DW2A 1R54A 1HFSA 1RMZA 3EHXA 4XM8A 1AYKA 1AF0A 4PKTA 3ZUKA 3WV1A 1QICA 1G05A 1XUDA 4GF1A 3B92A 1HOVA 4ILWD 3GBOA 3KEKA 1BSWA 3V96B 3UVCA 2L0RA 1B3DA 3RTSA 1C8TA 2OW2A 1K7IA 2W15A 3LMCA 5I3MA 4H49A 1JH1A 1XURA 1IAGA 4WKEA 2TCLA 5D2BA 1EUBA 3MA2A 1XFXA 1HTDA 3F16A 3K7LA 1GXDA 4FVLA 4H76A 1BIWA 1ND1A 4CTHA 2I47A 3O64A 1GO7P 2OZRA 3HB2P 2E3XA 1GO8P 1EB6A 4PKRA 1G4KA 1S4BP 3KWVC 3LQBA 1QJIA 5B5PA 3TS4A 3L0TA 1YCMA 1L6JA 1CK7A 2OXWA 3TVCA 1OO9A 3HBVP 5D1UA 3KRYA 1CGFA 456CA 1PWWA 2X3CA 1Y8JA 2USNA 3DL1A 1UMSA 1YOUA 3HDAP 1Z3JA 1ZS0A 5D3CA 2OVZA 4HX3A 5H8XA 1O0QA 3LJTA 3P1VA 2RJPA 4DD8A 5JMYA 5BPAA 1JAQA 1A86A 2JT5A 2W12A 3F18A 1KUHA 3HBUP 2Y6CA 1KUGA 5CZMA 1QIBA 4WK7A 3TT4A 1CXVA 2YIGA 1G49A 2Y6DA 2SRTA 1JAOA 4GR8A 2OY4A 3CKIA 4ZR5A 5I2ZA 1XFZA 2QPJA 1YQYA 5I12A 1PWVA 1G9KA 1Q3AA 4JA1A 3LQ0A 3LUNA 4FXQA 4G0DA 1UMTA 3K7NA 1I76A 2V4BA 1XFWA 1FM1A 3TSKA
chains in the Genus database with same CATH superfamily
2YB9A 4JP4A 3N2VA 1R1IA 1MMPA 3DTIA 1RM8A 2X3AA 1GE7A 1SLNA 3DPEA 4DPEA 1D8MA 3LKAA 4H3XA 830CA 2JSDA 4H82A 1O0TA 3LK8A 1ZTQA 4IN9A 1K7QA 1IAEA 2N8RA 5CUHA 2W0DA 3LE9A 2WOAA 4WF6A 4JIJA 1FBLA 1MNCA 4DV8A 1H71P 1PWQA 1GKCA 1B8YA 3VTGA 3F1AA 1CAQA 4H2EA 4AXQA 4XBHA 5I0LA 1BKCI 3DPFA 4GUYA 2J0TA 4IUWA 4L19A 1YP1A 3NX7A 2OY2A 4ON1A 1USNA 1QIAA 1PWPA 2X3BA 1XUCA 1BM6A 2CLTA 1BZSA 1KUKA 3DNGA 1D8FA 1JAPA 4L63A 4PKSA 4PKWA 1ZP5A 2MZEA 2FV9A 2FV5A 4AIGA 3G5CA 2MZIA 2DW0A 4H30A 1HFCA 3EDHA 1Y93A 1JIWP 3OHLA 2OVXA 3KEJA 1SLMA 3Q2GA 1MMBA 2KRJA 4XM6A 2A8HA 3EHYA 1FLSA 3EDIA 1SATA 1UEAA 1C7KA 2O36A 3KECA 4AYKA 4FU4A 4FXYP 1J7NA 4IJOA 1BQQM 3LIKA 3LIRA 2K9CA 3HY9A 1OS2A 1ZVXA 4J4MA 1QUAA 1EAKA 5L7FA 1HV5A 1UTZA 2JT6A 4GR0A 4H84A 966CA 4PKQA 3SHIA 1IABA 3L0VA 4GWNA 4A3WA 4XCTA 3USNA 3B8ZA 3AYKA 4R3VA 4GQLA 2ERPA 1JJ9A 1ROSA 3ZVSA 4AUOA 1KAPP 1CIZA 1BQOA 1R1JA 3AYUA 5BOTA 1AKLA 3E8RA 3LUMA 1C3IA 3ZXHA 2MZHA 1JIZA 1R55A 2OW9A 1R1HA 5B5OA 3Q2HA 1MMQA 1BKCA 1OMJA 2X7MA 3I7GA 1GKDA 3U1RA 3ELMA 4A7BA 1D7XA 2DDFA 2OXUA 2YUFA 4PKVA 1A85A 1SU3A 2J83A 5I43A 3LGPA 2DDYA 2OW0A 1KBCA 4PKUA 2WO8A 2W14A 3WV3A 1OM6A 3LJGA 3HDBA 1OM8A 1XFYA 2AYKA 3N2UA 5LABA 2K2GA 1I73A 4WZVA 2MLSA 4QKZA 1PWUA 1Y0VA 1WNIA 3AIGA 1XFUA 1IACA 4GR3A 2OI0A 3I7IA 4L6TA 1SRPA 3O2XA 1KUIA 1JANA 5CXAA 1CGLA 2D1OA 2D1NA 3KMCA 1JKYA 2AIGP 3WV2A 1BKCE 3B2ZA 4JQGA 1ZXCA 2PJTA 3EDZA 3RTTA 4I35A 1IADA 1GE6A 1K7GA 4DF9A 3KHIA 3F19A 1BUVM 2XS3A 2E2DA 2JIHA 3EWJA 5I4OA 1TVIA 1XM5A 2DW1A 4GWMA 5BOYA 1ASTA 1OM7A 1MMRA 2OW1A 1CGEA 4EFSA 1I1IP 3OHOA 1GE5A 1D5JA 1DMTA 3G42A 4Q1LA 5D1TA 4HMAA 1UTTA 2POJA 3HYGA 3BA0A 3F15A 2Z2DA 1ZXVA 4JPAA 1CQRA 2XS4A 3LILA 3DWBA 4XM7A 2HU6A 2RJQA 2EROA 1JK3A 1SMPA 5D7WA 3P24A 2JNPA 2MLRA 1BUDA 3VI1A 3HY7A 2W13A 2O3EA 3DSLA 1ATLA 4G9LA 3F17A 1IAAA 1HY7A 1QJJA 3LEAA 2WO9A 4WKIA 3LJZA 2OXZA 4H1QA 3EDGA 3KMEA 2ERQA 1KUFA 4I03A 1XFVA 5D1SA 1OS9A 1DTHA 2CKIA 1G12A 5L79A 2DW2A 1R54A 1HFSA 1RMZA 3EHXA 4XM8A 1AYKA 1AF0A 4PKTA 3ZUKA 3WV1A 1QICA 1G05A 1XUDA 4GF1A 3B92A 1HOVA 4ILWD 3GBOA 3KEKA 1BSWA 3V96B 3UVCA 2L0RA 1B3DA 3RTSA 1C8TA 2OW2A 1K7IA 3DTKA 2W15A 3LMCA 5I3MA 4H49A 1JH1A 1XURA 1IAGA 4WKEA 2TCLA 5D2BA 1EUBA 3MA2A 1XFXA 1HTDA 3F16A 3K7LA 1GXDA 4FVLA 4H76A 1BIWA 1ND1A 4CTHA 1XAXA 2I47A 3O64A 1GO7P 2OZRA 3HB2P 2E3XA 1GO8P 1EB6A 4PKRA 1G4KA 1S4BP 3KWVC 3LQBA 1QJIA 5B5PA 3TS4A 3L0TA 1YCMA 1L6JA 1CK7A 2OXWA 3TVCA 1OO9A 3HBVP 5D1UA 3KRYA 1CGFA 456CA 1PWWA 3DTEA 2X3CA 1Y8JA 2USNA 3DL1A 1UMSA 1YOUA 3HDAP 1Z3JA 1ZS0A 5D3CA 2OVZA 4HX3A 5H8XA 1O0QA 3LJTA 3P1VA 2RJPA 4DD8A 5JMYA 5BPAA 1JAQA 1A86A 2JT5A 2W12A 3F18A 1KUHA 3HBUP 2Y6CA 1KUGA 5CZMA 1OZ9A 1QIBA 4WK7A 3TT4A 1CXVA 2YIGA 1G49A 2Y6DA 2SRTA 1JAOA 4GR8A 2OY4A 3CKIA 4ZR5A 5I2ZA 1XFZA 2QPJA 1YQYA 5I12A 1PWVA 4L7AA 1G9KA 1Q3AA 4JA1A 3LQ0A 3LUNA 4FXQA 4G0DA 1UMTA 3K7NA 1I76A 2V4BA 1XFWA 1FM1A 3TSKA
chains in the Genus database with same CATH topology
2YB9A 4JP4A 3N2VA 1R1IA 1MMPA 3DTIA 1RM8A 2X3AA 1GE7A 1SLNA 3DPEA 4DPEA 1D8MA 3LKAA 4H3XA 830CA 2JSDA 4H82A 1O0TA 3LK8A 1ZTQA 4IN9A 1K7QA 1IAEA 2N8RA 5CUHA 2W0DA 3LE9A 2WOAA 4WF6A 4JIJA 1FBLA 1MNCA 4DV8A 1H71P 1PWQA 1GKCA 1B8YA 3VTGA 3F1AA 1CAQA 4H2EA 4AXQA 4XBHA 5I0LA 1BKCI 3DPFA 4GUYA 2J0TA 4IUWA 4L19A 1YP1A 3NX7A 2OY2A 4ON1A 1USNA 1QIAA 1PWPA 2X3BA 1XUCA 1BM6A 2CLTA 1BZSA 1KUKA 3DNGA 1D8FA 1JAPA 4L63A 4PKSA 4PKWA 1ZP5A 2MZEA 2FV9A 2FV5A 4AIGA 3G5CA 2MZIA 2DW0A 4H30A 1HFCA 3EDHA 1Y93A 1JIWP 3OHLA 2OVXA 3KEJA 1SLMA 3Q2GA 1MMBA 2KRJA 4XM6A 2A8HA 3EHYA 1FLSA 3EDIA 1SATA 1UEAA 1C7KA 2O36A 3KECA 4AYKA 4FU4A 4FXYP 1J7NA 4IJOA 1BQQM 3LIKA 3LIRA 2K9CA 3HY9A 1OS2A 1ZVXA 4J4MA 1QUAA 1EAKA 5L7FA 1HV5A 1UTZA 2JT6A 4GR0A 4H84A 966CA 4PKQA 3SHIA 1IABA 3L0VA 4GWNA 4A3WA 4XCTA 3USNA 3B8ZA 3AYKA 4R3VA 4GQLA 2ERPA 1JJ9A 1ROSA 3ZVSA 4AUOA 1KAPP 1CIZA 1BQOA 1R1JA 3AYUA 5BOTA 1AKLA 3E8RA 3LUMA 1C3IA 3ZXHA 2MZHA 1JIZA 1R55A 2OW9A 1R1HA 5B5OA 3Q2HA 1MMQA 1BKCA 1OMJA 2X7MA 3I7GA 1GKDA 3U1RA 3ELMA 4A7BA 1D7XA 2DDFA 2OXUA 2YUFA 4PKVA 1A85A 1SU3A 2J83A 5I43A 3LGPA 2DDYA 2OW0A 1KBCA 4PKUA 2WO8A 2W14A 3WV3A 1OM6A 3LJGA 3HDBA 1OM8A 1XFYA 2AYKA 3N2UA 5LABA 2K2GA 1I73A 4WZVA 2MLSA 4QKZA 1PWUA 1Y0VA 1WNIA 3AIGA 1XFUA 1IACA 4GR3A 2OI0A 3I7IA 4L6TA 1SRPA 3O2XA 1KUIA 1JANA 5CXAA 1CGLA 2D1OA 2D1NA 3KMCA 1JKYA 2AIGP 3WV2A 1BKCE 3B2ZA 4JQGA 1ZXCA 2PJTA 3EDZA 3RTTA 4I35A 1IADA 1GE6A 1K7GA 4DF9A 3KHIA 3F19A 1BUVM 2XS3A 2E2DA 2JIHA 3EWJA 5I4OA 2DW1A 4GWMA 5BOYA 1ASTA 1OM7A 1MMRA 2OW1A 1CGEA 4EFSA 1I1IP 3OHOA 1GE5A 1D5JA 1DMTA 3G42A 4Q1LA 5D1TA 4HMAA 1UTTA 2POJA 3HYGA 3BA0A 3F15A 2Z2DA 1ZXVA 4JPAA 1CQRA 2XS4A 3LILA 3DWBA 4XM7A 2HU6A 2RJQA 2EROA 1JK3A 1SMPA 5D7WA 3P24A 2JNPA 2MLRA 1BUDA 3VI1A 3HY7A 2W13A 2O3EA 3DSLA 1ATLA 4G9LA 3F17A 1IAAA 1HY7A 1QJJA 3LEAA 2WO9A 4WKIA 3LJZA 2OXZA 4H1QA 3EDGA 3KMEA 2ERQA 1KUFA 4I03A 1XFVA 5D1SA 1OS9A 1DTHA 2CKIA 1G12A 5L79A 2DW2A 1R54A 1HFSA 1RMZA 3EHXA 4XM8A 1AYKA 1AF0A 4PKTA 3ZUKA 3WV1A 1QICA 1G05A 1XUDA 4GF1A 3B92A 1HOVA 4ILWD 3GBOA 3KEKA 1BSWA 3V96B 3UVCA 2L0RA 1B3DA 3RTSA 1C8TA 2OW2A 1K7IA 3DTKA 2W15A 3LMCA 5I3MA 4H49A 1JH1A 1XURA 1IAGA 4WKEA 2TCLA 5D2BA 1EUBA 3MA2A 1XFXA 1HTDA 3F16A 3K7LA 1GXDA 4FVLA 4H76A 1BIWA 1ND1A 4CTHA 2I47A 3O64A 1GO7P 2OZRA 3HB2P 2E3XA 1GO8P 1EB6A 4PKRA 1G4KA 1S4BP 3KWVC 3LQBA 1QJIA 5B5PA 3TS4A 3L0TA 1YCMA 1L6JA 1CK7A 2OXWA 3TVCA 1OO9A 3HBVP 5D1UA 3KRYA 1CGFA 456CA 1PWWA 3DTEA 2X3CA 1Y8JA 2USNA 3DL1A 1UMSA 1YOUA 3HDAP 1Z3JA 1ZS0A 5D3CA 2OVZA 4HX3A 5H8XA 1O0QA 3LJTA 3P1VA 2RJPA 4DD8A 5JMYA 5BPAA 1JAQA 1A86A 2JT5A 2W12A 3F18A 1KUHA 3HBUP 2Y6CA 1KUGA 5CZMA 1QIBA 4WK7A 3TT4A 1CXVA 2YIGA 1G49A 2Y6DA 2SRTA 1JAOA 4GR8A 2OY4A 3CKIA 4ZR5A 5I2ZA 1XFZA 2QPJA 1YQYA 5I12A 1PWVA 4L7AA 1G9KA 1Q3AA 4JA1A 3LQ0A 3LUNA 4FXQA 4G0DA 1UMTA 3K7NA 1I76A 2V4BA 1XFWA 1FM1A 3TSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YB9 A;  4JP4 A;  3N2V A;  1R1I A;  1MMP A;  1RM8 A;  2X3A A;  1GE7 A;  1SLN A;  3DPE A;  4DPE A;  1D8M A;  3LKA A;  4H3X A;  830C A;  2JSD A;  4H82 A;  1O0T A;  3LK8 A;  1ZTQ A;  4IN9 A;  1K7Q A;  1IAE A;  2N8R A;  5CUH A;  2W0D A;  3LE9 A;  2WOA A;  4WF6 A;  4JIJ A;  1FBL A;  1MNC A;  4DV8 A;  1H71 P;  1PWQ A;  1GKC A;  1B8Y A;  3VTG A;  3F1A A;  1CAQ A;  4H2E A;  4AXQ A;  4XBH A;  5I0L A;  1BKC I;  3DPF A;  4GUY A;  2J0T A;  4IUW A;  4L19 A;  1YP1 A;  3NX7 A;  2OY2 A;  4ON1 A;  1USN A;  1QIA A;  1PWP A;  2X3B A;  1XUC A;  1BM6 A;  2CLT A;  1BZS A;  1KUK A;  3DNG A;  1D8F A;  1JAP A;  4L63 A;  4PKS A;  4PKW A;  1ZP5 A;  2MZE A;  2FV9 A;  2FV5 A;  4AIG A;  3G5C A;  2MZI A;  2DW0 A;  4H30 A;  1HFC A;  3EDH A;  1Y93 A;  1JIW P;  3OHL A;  2OVX A;  3KEJ A;  1SLM A;  3Q2G A;  1MMB A;  2KRJ A;  4XM6 A;  2A8H A;  3EHY A;  1FLS A;  3EDI A;  1SAT A;  1UEA A;  1C7K A;  2O36 A;  3KEC A;  4AYK A;  4FU4 A;  4FXY P;  1J7N A;  4IJO A;  1BQQ M;  3LIK A;  3LIR A;  2K9C A;  3HY9 A;  1OS2 A;  1ZVX A;  4J4M A;  1QUA A;  1EAK A;  5L7F A;  1HV5 A;  1UTZ A;  2JT6 A;  4GR0 A;  4H84 A;  966C A;  4PKQ A;  3SHI A;  1IAB A;  3L0V A;  4GWN A;  4A3W A;  4XCT A;  3USN A;  3B8Z A;  3AYK A;  4R3V A;  4GQL A;  2ERP A;  1JJ9 A;  1ROS A;  3ZVS A;  4AUO A;  1KAP P;  1CIZ A;  1BQO A;  1R1J A;  3AYU A;  5BOT A;  1AKL A;  3E8R A;  3LUM A;  1C3I A;  3ZXH A;  2MZH A;  1JIZ A;  1R55 A;  2OW9 A;  1R1H A;  5B5O A;  3Q2H A;  1MMQ A;  1BKC A;  1OMJ A;  2X7M A;  3I7G A;  1GKD A;  3U1R A;  3ELM A;  4A7B A;  1D7X A;  2DDF A;  2OXU A;  4PKV A;  1A85 A;  1SU3 A;  2J83 A;  5I43 A;  3LGP A;  2DDY A;  2OW0 A;  1KBC A;  4PKU A;  2WO8 A;  2W14 A;  3WV3 A;  1OM6 A;  3LJG A;  3HDB A;  1OM8 A;  1XFY A;  2AYK A;  3N2U A;  5LAB A;  2K2G A;  1I73 A;  4WZV A;  2MLS A;  4QKZ A;  1PWU A;  1Y0V A;  1WNI A;  3AIG A;  1XFU A;  1IAC A;  4GR3 A;  2OI0 A;  3I7I A;  4L6T A;  1SRP A;  3O2X A;  1KUI A;  1JAN A;  5CXA A;  1CGL A;  2D1O A;  2D1N A;  3KMC A;  1JKY A;  2AIG P;  3WV2 A;  1BKC E;  3B2Z A;  4JQG A;  1ZXC A;  2PJT A;  3EDZ A;  3RTT A;  4I35 A;  1IAD A;  1GE6 A;  1K7G A;  4DF9 A;  3KHI A;  3F19 A;  1BUV M;  2XS3 A;  2E2D A;  2JIH A;  3EWJ A;  5I4O A;  2DW1 A;  4GWM A;  5BOY A;  1AST A;  1OM7 A;  1MMR A;  2OW1 A;  1CGE A;  4EFS A;  1I1I P;  3OHO A;  1GE5 A;  1D5J A;  1DMT A;  3G42 A;  4Q1L A;  5D1T A;  4HMA A;  1UTT A;  2POJ A;  3HYG A;  3BA0 A;  3F15 A;  2Z2D A;  1ZXV A;  4JPA A;  1CQR A;  2XS4 A;  3LIL A;  3DWB A;  4XM7 A;  2HU6 A;  2RJQ A;  2ERO A;  1JK3 A;  1SMP A;  5D7W A;  3P24 A;  2JNP A;  2MLR A;  1BUD A;  3VI1 A;  3HY7 A;  2W13 A;  2O3E A;  3DSL A;  1ATL A;  4G9L A;  3F17 A;  1IAA A;  1HY7 A;  1QJJ A;  3LEA A;  2WO9 A;  4WKI A;  3LJZ A;  2OXZ A;  4H1Q A;  3EDG A;  3KME A;  2ERQ A;  1KUF A;  4I03 A;  1XFV A;  5D1S A;  1OS9 A;  1DTH A;  2CKI A;  1G12 A;  5L79 A;  2DW2 A;  1R54 A;  1HFS A;  1RMZ A;  3EHX A;  4XM8 A;  1AYK A;  1AF0 A;  4PKT A;  3ZUK A;  3WV1 A;  1QIC A;  1G05 A;  1XUD A;  4GF1 A;  3B92 A;  1HOV A;  4ILW D;  3GBO A;  3KEK A;  1BSW A;  3V96 B;  3UVC A;  2L0R A;  1B3D A;  3RTS A;  1C8T A;  2OW2 A;  1K7I A;  2W15 A;  3LMC A;  5I3M A;  4H49 A;  1JH1 A;  1XUR A;  1IAG A;  4WKE A;  2TCL A;  5D2B A;  1EUB A;  3MA2 A;  1XFX A;  1HTD A;  3F16 A;  3K7L A;  1GXD A;  4FVL A;  4H76 A;  1BIW A;  1ND1 A;  4CTH A;  2I47 A;  3O64 A;  1GO7 P;  2OZR A;  3HB2 P;  2E3X A;  1GO8 P;  1EB6 A;  4PKR A;  1G4K A;  1S4B P;  3KWV C;  3LQB A;  1QJI A;  5B5P A;  3TS4 A;  3L0T A;  1YCM A;  1L6J A;  1CK7 A;  2OXW A;  3TVC A;  1OO9 A;  3HBV P;  5D1U A;  3KRY A;  1CGF A;  456C A;  1PWW A;  2X3C A;  1Y8J A;  2USN A;  3DL1 A;  1UMS A;  1YOU A;  3HDA P;  1Z3J A;  1ZS0 A;  5D3C A;  2OVZ A;  4HX3 A;  5H8X A;  1O0Q A;  3LJT A;  3P1V A;  2RJP A;  4DD8 A;  5JMY A;  5BPA A;  1JAQ A;  1A86 A;  2JT5 A;  2W12 A;  3F18 A;  1KUH A;  3HBU P;  2Y6C A;  1KUG A;  5CZM A;  1QIB A;  4WK7 A;  3TT4 A;  1CXV A;  2YIG A;  1G49 A;  2Y6D A;  2SRT A;  1JAO A;  4GR8 A;  2OY4 A;  3CKI A;  4ZR5 A;  5I2Z A;  1XFZ A;  2QPJ A;  1YQY A;  5I12 A;  1PWV A;  1G9K A;  1Q3A A;  4JA1 A;  3LQ0 A;  3LUN A;  4FXQ A;  4G0D A;  1UMT A;  3K7N A;  1I76 A;  2V4B A;  1XFW A;  1FM1 A;  3TSK A; 
#chains in the Genus database with same CATH topology
 2YB9 A;  4JP4 A;  3N2V A;  1R1I A;  1MMP A;  3DTI A;  1RM8 A;  2X3A A;  1GE7 A;  1SLN A;  3DPE A;  4DPE A;  1D8M A;  3LKA A;  4H3X A;  830C A;  2JSD A;  4H82 A;  1O0T A;  3LK8 A;  1ZTQ A;  4IN9 A;  1K7Q A;  1IAE A;  2N8R A;  5CUH A;  2W0D A;  3LE9 A;  2WOA A;  4WF6 A;  4JIJ A;  1FBL A;  1MNC A;  4DV8 A;  1H71 P;  1PWQ A;  1GKC A;  1B8Y A;  3VTG A;  3F1A A;  1CAQ A;  4H2E A;  4AXQ A;  4XBH A;  5I0L A;  1BKC I;  3DPF A;  4GUY A;  2J0T A;  4IUW A;  4L19 A;  1YP1 A;  3NX7 A;  2OY2 A;  4ON1 A;  1USN A;  1QIA A;  1PWP A;  2X3B A;  1XUC A;  1BM6 A;  2CLT A;  1BZS A;  1KUK A;  3DNG A;  1D8F A;  1JAP A;  4L63 A;  4PKS A;  4PKW A;  1ZP5 A;  2MZE A;  2FV9 A;  2FV5 A;  4AIG A;  3G5C A;  2MZI A;  2DW0 A;  4H30 A;  1HFC A;  3EDH A;  1Y93 A;  1JIW P;  3OHL A;  2OVX A;  3KEJ A;  1SLM A;  3Q2G A;  1MMB A;  2KRJ A;  4XM6 A;  2A8H A;  3EHY A;  1FLS A;  3EDI A;  1SAT A;  1UEA A;  1C7K A;  2O36 A;  3KEC A;  4AYK A;  4FU4 A;  4FXY P;  1J7N A;  4IJO A;  1BQQ M;  3LIK A;  3LIR A;  2K9C A;  3HY9 A;  1OS2 A;  1ZVX A;  4J4M A;  1QUA A;  1EAK A;  5L7F A;  1HV5 A;  1UTZ A;  2JT6 A;  4GR0 A;  4H84 A;  966C A;  4PKQ A;  3SHI A;  1IAB A;  3L0V A;  4GWN A;  4A3W A;  4XCT A;  3USN A;  3B8Z A;  3AYK A;  4R3V A;  4GQL A;  2ERP A;  1JJ9 A;  1ROS A;  3ZVS A;  4AUO A;  1KAP P;  1CIZ A;  1BQO A;  1R1J A;  3AYU A;  5BOT A;  1AKL A;  3E8R A;  3LUM A;  1C3I A;  3ZXH A;  2MZH A;  1JIZ A;  1R55 A;  2OW9 A;  1R1H A;  5B5O A;  3Q2H A;  1MMQ A;  1BKC A;  1OMJ A;  2X7M A;  3I7G A;  1GKD A;  3U1R A;  3ELM A;  4A7B A;  1D7X A;  2DDF A;  2OXU A;  2YUF A;  4PKV A;  1A85 A;  1SU3 A;  2J83 A;  5I43 A;  3LGP A;  2DDY A;  2OW0 A;  1KBC A;  4PKU A;  2WO8 A;  2W14 A;  3WV3 A;  1OM6 A;  3LJG A;  3HDB A;  1OM8 A;  1XFY A;  2AYK A;  3N2U A;  5LAB A;  2K2G A;  1I73 A;  4WZV A;  2MLS A;  4QKZ A;  1PWU A;  1Y0V A;  1WNI A;  3AIG A;  1XFU A;  1IAC A;  4GR3 A;  2OI0 A;  3I7I A;  4L6T A;  1SRP A;  3O2X A;  1KUI A;  1JAN A;  5CXA A;  1CGL A;  2D1O A;  2D1N A;  3KMC A;  1JKY A;  2AIG P;  3WV2 A;  1BKC E;  3B2Z A;  4JQG A;  1ZXC A;  2PJT A;  3EDZ A;  3RTT A;  4I35 A;  1IAD A;  1GE6 A;  1K7G A;  4DF9 A;  3KHI A;  3F19 A;  1BUV M;  2XS3 A;  2E2D A;  2JIH A;  3EWJ A;  5I4O A;  1TVI A;  1XM5 A;  2DW1 A;  4GWM A;  5BOY A;  1AST A;  1OM7 A;  1MMR A;  2OW1 A;  1CGE A;  4EFS A;  1I1I P;  3OHO A;  1GE5 A;  1D5J A;  1DMT A;  3G42 A;  4Q1L A;  5D1T A;  4HMA A;  1UTT A;  2POJ A;  3HYG A;  3BA0 A;  3F15 A;  2Z2D A;  1ZXV A;  4JPA A;  1CQR A;  2XS4 A;  3LIL A;  3DWB A;  4XM7 A;  2HU6 A;  2RJQ A;  2ERO A;  1JK3 A;  1SMP A;  5D7W A;  3P24 A;  2JNP A;  2MLR A;  1BUD A;  3VI1 A;  3HY7 A;  2W13 A;  2O3E A;  3DSL A;  1ATL A;  4G9L A;  3F17 A;  1IAA A;  1HY7 A;  1QJJ A;  3LEA A;  2WO9 A;  4WKI A;  3LJZ A;  2OXZ A;  4H1Q A;  3EDG A;  3KME A;  2ERQ A;  1KUF A;  4I03 A;  1XFV A;  5D1S A;  1OS9 A;  1DTH A;  2CKI A;  1G12 A;  5L79 A;  2DW2 A;  1R54 A;  1HFS A;  1RMZ A;  3EHX A;  4XM8 A;  1AYK A;  1AF0 A;  4PKT A;  3ZUK A;  3WV1 A;  1QIC A;  1G05 A;  1XUD A;  4GF1 A;  3B92 A;  1HOV A;  4ILW D;  3GBO A;  3KEK A;  1BSW A;  3V96 B;  3UVC A;  2L0R A;  1B3D A;  3RTS A;  1C8T A;  2OW2 A;  1K7I A;  3DTK A;  2W15 A;  3LMC A;  5I3M A;  4H49 A;  1JH1 A;  1XUR A;  1IAG A;  4WKE A;  2TCL A;  5D2B A;  1EUB A;  3MA2 A;  1XFX A;  1HTD A;  3F16 A;  3K7L A;  1GXD A;  4FVL A;  4H76 A;  1BIW A;  1ND1 A;  4CTH A;  1XAX A;  2I47 A;  3O64 A;  1GO7 P;  2OZR A;  3HB2 P;  2E3X A;  1GO8 P;  1EB6 A;  4PKR A;  1G4K A;  1S4B P;  3KWV C;  3LQB A;  1QJI A;  5B5P A;  3TS4 A;  3L0T A;  1YCM A;  1L6J A;  1CK7 A;  2OXW A;  3TVC A;  1OO9 A;  3HBV P;  5D1U A;  3KRY A;  1CGF A;  456C A;  1PWW A;  3DTE A;  2X3C A;  1Y8J A;  2USN A;  3DL1 A;  1UMS A;  1YOU A;  3HDA P;  1Z3J A;  1ZS0 A;  5D3C A;  2OVZ A;  4HX3 A;  5H8X A;  1O0Q A;  3LJT A;  3P1V A;  2RJP A;  4DD8 A;  5JMY A;  5BPA A;  1JAQ A;  1A86 A;  2JT5 A;  2W12 A;  3F18 A;  1KUH A;  3HBU P;  2Y6C A;  1KUG A;  5CZM A;  1OZ9 A;  1QIB A;  4WK7 A;  3TT4 A;  1CXV A;  2YIG A;  1G49 A;  2Y6D A;  2SRT A;  1JAO A;  4GR8 A;  2OY4 A;  3CKI A;  4ZR5 A;  5I2Z A;  1XFZ A;  2QPJ A;  1YQY A;  5I12 A;  1PWV A;  4L7A A;  1G9K A;  1Q3A A;  4JA1 A;  3LQ0 A;  3LUN A;  4FXQ A;  4G0D A;  1UMT A;  3K7N A;  1I76 A;  2V4B A;  1XFW A;  1FM1 A;  3TSK A; 
#chains in the Genus database with same CATH homology
 2YB9 A;  4JP4 A;  3N2V A;  1R1I A;  1MMP A;  3DTI A;  1RM8 A;  2X3A A;  1GE7 A;  1SLN A;  3DPE A;  4DPE A;  1D8M A;  3LKA A;  4H3X A;  830C A;  2JSD A;  4H82 A;  1O0T A;  3LK8 A;  1ZTQ A;  4IN9 A;  1K7Q A;  1IAE A;  2N8R A;  5CUH A;  2W0D A;  3LE9 A;  2WOA A;  4WF6 A;  4JIJ A;  1FBL A;  1MNC A;  4DV8 A;  1H71 P;  1PWQ A;  1GKC A;  1B8Y A;  3VTG A;  3F1A A;  1CAQ A;  4H2E A;  4AXQ A;  4XBH A;  5I0L A;  1BKC I;  3DPF A;  4GUY A;  2J0T A;  4IUW A;  4L19 A;  1YP1 A;  3NX7 A;  2OY2 A;  4ON1 A;  1USN A;  1QIA A;  1PWP A;  2X3B A;  1XUC A;  1BM6 A;  2CLT A;  1BZS A;  1KUK A;  3DNG A;  1D8F A;  1JAP A;  4L63 A;  4PKS A;  4PKW A;  1ZP5 A;  2MZE A;  2FV9 A;  2FV5 A;  4AIG A;  3G5C A;  2MZI A;  2DW0 A;  4H30 A;  1HFC A;  3EDH A;  1Y93 A;  1JIW P;  3OHL A;  2OVX A;  3KEJ A;  1SLM A;  3Q2G A;  1MMB A;  2KRJ A;  4XM6 A;  2A8H A;  3EHY A;  1FLS A;  3EDI A;  1SAT A;  1UEA A;  1C7K A;  2O36 A;  3KEC A;  4AYK A;  4FU4 A;  4FXY P;  1J7N A;  4IJO A;  1BQQ M;  3LIK A;  3LIR A;  2K9C A;  3HY9 A;  1OS2 A;  1ZVX A;  4J4M A;  1QUA A;  1EAK A;  5L7F A;  1HV5 A;  1UTZ A;  2JT6 A;  4GR0 A;  4H84 A;  966C A;  4PKQ A;  3SHI A;  1IAB A;  3L0V A;  4GWN A;  4A3W A;  4XCT A;  3USN A;  3B8Z A;  3AYK A;  4R3V A;  4GQL A;  2ERP A;  1JJ9 A;  1ROS A;  3ZVS A;  4AUO A;  1KAP P;  1CIZ A;  1BQO A;  1R1J A;  3AYU A;  5BOT A;  1AKL A;  3E8R A;  3LUM A;  1C3I A;  3ZXH A;  2MZH A;  1JIZ A;  1R55 A;  2OW9 A;  1R1H A;  5B5O A;  3Q2H A;  1MMQ A;  1BKC A;  1OMJ A;  2X7M A;  3I7G A;  1GKD A;  3U1R A;  3ELM A;  4A7B A;  1D7X A;  2DDF A;  2OXU A;  2YUF A;  4PKV A;  1A85 A;  1SU3 A;  2J83 A;  5I43 A;  3LGP A;  2DDY A;  2OW0 A;  1KBC A;  4PKU A;  2WO8 A;  2W14 A;  3WV3 A;  1OM6 A;  3LJG A;  3HDB A;  1OM8 A;  1XFY A;  2AYK A;  3N2U A;  5LAB A;  2K2G A;  1I73 A;  4WZV A;  2MLS A;  4QKZ A;  1PWU A;  1Y0V A;  1WNI A;  3AIG A;  1XFU A;  1IAC A;  4GR3 A;  2OI0 A;  3I7I A;  4L6T A;  1SRP A;  3O2X A;  1KUI A;  1JAN A;  5CXA A;  1CGL A;  2D1O A;  2D1N A;  3KMC A;  1JKY A;  2AIG P;  3WV2 A;  1BKC E;  3B2Z A;  4JQG A;  1ZXC A;  2PJT A;  3EDZ A;  3RTT A;  4I35 A;  1IAD A;  1GE6 A;  1K7G A;  4DF9 A;  3KHI A;  3F19 A;  1BUV M;  2XS3 A;  2E2D A;  2JIH A;  3EWJ A;  5I4O A;  2DW1 A;  4GWM A;  5BOY A;  1AST A;  1OM7 A;  1MMR A;  2OW1 A;  1CGE A;  4EFS A;  1I1I P;  3OHO A;  1GE5 A;  1D5J A;  1DMT A;  3G42 A;  4Q1L A;  5D1T A;  4HMA A;  1UTT A;  2POJ A;  3HYG A;  3BA0 A;  3F15 A;  2Z2D A;  1ZXV A;  4JPA A;  1CQR A;  2XS4 A;  3LIL A;  3DWB A;  4XM7 A;  2HU6 A;  2RJQ A;  2ERO A;  1JK3 A;  1SMP A;  5D7W A;  3P24 A;  2JNP A;  2MLR A;  1BUD A;  3VI1 A;  3HY7 A;  2W13 A;  2O3E A;  3DSL A;  1ATL A;  4G9L A;  3F17 A;  1IAA A;  1HY7 A;  1QJJ A;  3LEA A;  2WO9 A;  4WKI A;  3LJZ A;  2OXZ A;  4H1Q A;  3EDG A;  3KME A;  2ERQ A;  1KUF A;  4I03 A;  1XFV A;  5D1S A;  1OS9 A;  1DTH A;  2CKI A;  1G12 A;  5L79 A;  2DW2 A;  1R54 A;  1HFS A;  1RMZ A;  3EHX A;  4XM8 A;  1AYK A;  1AF0 A;  4PKT A;  3ZUK A;  3WV1 A;  1QIC A;  1G05 A;  1XUD A;  4GF1 A;  3B92 A;  1HOV A;  4ILW D;  3GBO A;  3KEK A;  1BSW A;  3V96 B;  3UVC A;  2L0R A;  1B3D A;  3RTS A;  1C8T A;  2OW2 A;  1K7I A;  3DTK A;  2W15 A;  3LMC A;  5I3M A;  4H49 A;  1JH1 A;  1XUR A;  1IAG A;  4WKE A;  2TCL A;  5D2B A;  1EUB A;  3MA2 A;  1XFX A;  1HTD A;  3F16 A;  3K7L A;  1GXD A;  4FVL A;  4H76 A;  1BIW A;  1ND1 A;  4CTH A;  2I47 A;  3O64 A;  1GO7 P;  2OZR A;  3HB2 P;  2E3X A;  1GO8 P;  1EB6 A;  4PKR A;  1G4K A;  1S4B P;  3KWV C;  3LQB A;  1QJI A;  5B5P A;  3TS4 A;  3L0T A;  1YCM A;  1L6J A;  1CK7 A;  2OXW A;  3TVC A;  1OO9 A;  3HBV P;  5D1U A;  3KRY A;  1CGF A;  456C A;  1PWW A;  3DTE A;  2X3C A;  1Y8J A;  2USN A;  3DL1 A;  1UMS A;  1YOU A;  3HDA P;  1Z3J A;  1ZS0 A;  5D3C A;  2OVZ A;  4HX3 A;  5H8X A;  1O0Q A;  3LJT A;  3P1V A;  2RJP A;  4DD8 A;  5JMY A;  5BPA A;  1JAQ A;  1A86 A;  2JT5 A;  2W12 A;  3F18 A;  1KUH A;  3HBU P;  2Y6C A;  1KUG A;  5CZM A;  1QIB A;  4WK7 A;  3TT4 A;  1CXV A;  2YIG A;  1G49 A;  2Y6D A;  2SRT A;  1JAO A;  4GR8 A;  2OY4 A;  3CKI A;  4ZR5 A;  5I2Z A;  1XFZ A;  2QPJ A;  1YQY A;  5I12 A;  1PWV A;  4L7A A;  1G9K A;  1Q3A A;  4JA1 A;  3LQ0 A;  3LUN A;  4FXQ A;  4G0D A;  1UMT A;  3K7N A;  1I76 A;  2V4B A;  1XFW A;  1FM1 A;  3TSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...