1ATBA

High-resolution structure of ascaris trypsin inhibitor in solution: direct evidence for a ph induced conformational transition in the reactive site
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
62
structure length
62
Chain Sequence
EAEKCTKPNEQWTKCGGCEGTCAQKIVPCTRECKPPRCECIASAGFVRDAQGNCIKFEDCPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of Ascaris trypsin inhibitor in solution: direct evidence for a pH-induced conformational transition in the reactive site.
pubmed doi rcsb
source organism Ascaris suum
molecule tags Proteinase inhibitor(trypsin)
molecule keywords ASCARIS TRYPSIN INHIBITOR
total genus 4
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01826 TIL Trypsin Inhibitor like cysteine rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1atbA00
4M11A 1N7DA 3MQEA 2VVUL 2P16L 4ZHAB 1AUTL 1MQ6L 1P0SL 1EAIC 5JBCE 4RRXA 1WU1B 1YUGA 2PHBB 4ISIL 2W2ME 1PGEA 4ZXXL 1G2MB 2Y5GL 3N8YB 4FM5A 4E1GA 2XC0L 4Z6AL 2BOHA 2BOUA 2Y7XB 2WPIE 4ZH8B 3F6UL 3KL6B 1HT5A 3K9XA 2D1JB 1F0RB 3M37L 1IQLL 5CKQA 4RRWA 1YO8A 1ATAA 2Y5HL 4RRZA 1G1RA 1BF9A 1KLOA 1EPHA 2B7DL 1APQA 4D0FA 1IP0A 1CX2A 2F9BL 3N8ZA 2YGOA 4ZXYL 5EGMB 3KQBL 1XKBA 1L5GB 1JL9A 3OLUA 4NG9L 2XC4L 4JZFL 2J2UB 1V3XB 1EMNA 4A7IA 1ATDA 3OLTA 4JZEL 2ADXA 2J38B 2P3FL 4X8VL 1A3PA 1EPGA 1YUKB 2KV4A 3TGFA 5K0HB 6COXA 4C16A 2RHPA 4XLWA 1HX2A 3LAQA 1HT8A 4BXWA 3HPTA 3CS7L 3NTGA 1XFEA 1IOEL 2W3IB 2P93L 2W86A 4G1MB 3CA7A 4OTYA 5IKTA 1PXXA 1LQDA 4MMZB 4NA9L 4JZDL 2RA0L 1Q4GA 2UWLB 5CISA 1FF7A 3KRKA 2W26B 2H9EL 2M74A 3GCWE 4O1ZA 2VWLL 5IKQA 4Y6DB 2P3FN 1CCFA 1KLJL 3LC3B 1L3YA 2NPRA 2FLRL 2XBXL 3LIWB 4JYVL 2WFTA 1COUA 5L2ZL 1IQIL 5CKMA 4COXA 4Y71B 1YUFA 1LMJA 2BOXA 2WG4B 2K2TA 1LPKA 1HZ8A 3TH3L 1U8CB 1G2LB 2Y7ZB 1M1XB 5I46L 1NFWB 4Y79B 3SW2A 3P5BL 3LN0A 2WPKE 2WYGB 1HAEA 3N8XA 2WPLE 4AQTA 3C9AC 1CVUA 2TGFA 1SZBA 1NPEB 1FSBA 3N8WA 2VVCK 3RR3A 1EGFA 4BDXA 1PTHA 1IJQA 2UWOB 2OYUP 1J9CL 2KB9A 2XC5L 5JVYA 4LORA 3QH0A 4Z0KB 3ZYIB 4YT6L 2PUQL 1HCGB 4CSYA 2XBYL 2BO2A 1F0SB 3KQCL 1UZJA 3NT1A 1W7XL 5IKVA 2FLBL 3NTBA 2Y82B 2W3KB 5KIRA 3LTGD 3FFGL 3SOBB 3TZIA 5JB8E 1FAKL 1OB1C 2W2OE 3CFWA 3FBYA 1TLEA 1HJ7A 2WYJB 3SOVA 3TBDA 2FZZL 5FDQA 1KSNB 2RNLA 1EPIA 2JKHL 4BTIA 4ZAEB 5E8DA 1MOXC 2Y80B 3V64C 1HRFA 2VWNL 3KCGL 1GK5A 1XKAL 4XL1A 5IKRA 2KL7A 3KQEL 1NQLB 3GISX 1UZKA 3PGHA 2J4IB 1PFXL 2W2QE 4Y76B 3KQDL 3HO5A 3BT2A 3N8VA 1IQFL 4Y7AB 1FFMA 2UWPB 4BTTA 1UZPA 4OTJA 3ENSA 2FD6A 1DIYA 1WHFA 1ADXA 1FJSL 1IQML 1NFYB 3QMOA 3DEMA 2PR3B 2VH0B 1EQHA 2W2PE 2MGPA 4TGFA 1EBVA 1NFUB 2J95B 2EI8B 2VH6B 1KIGL 1Z6EL 4YZUB 2Y5FL 3V65B 1IQHL 3TK5B 1FE2A 2YGPA 4D90A 1IQNL 2Q1JB 1DVAL 2K2SB 4CUFA 2VWOL 4Z0LA 5CKNA 1B9WA 2P3UA 1EPJA 2BQ6A 1PRHA 1JBUL 1Z6CA 1LPZA 1IQKL 4X8TL 2MHPA 1HREA 2P95L 3HO3A 1LPGA 2EI7B 4MMXB 1N1IA 4LMFA 4Y7BB 3HS5A 2W2NE 2GD4A 2XBVL 2XBWL 5JBBE 2BOKL 2P3TA 2BQ7A 1IOXA 3POYA 3IITB 3ELAL 1W8BL 1RFNB 1JV2B 3BT1A 1ATBA 1IQJL 5JBAE 3F1SB 4XBMA 3EGFA 3M36L 1TPGA 1IVOC 1CEJA 4O02B 5COXA 5KN5C 5L30L 4NGAL 2J94B 3Q3KB 1IQEL 1TOZA 5JW1A 1NT0A 1IGZA 2WPME 4CUEA 2FLGA 1G1QA 3MDLA 1WHEA 2WPHE 4X8SL 1O5DL 3CENL 1DQBA 1NZIA 1ATEA 1HAFA 2P94L 2MGRA 1F7MA 1FAXL 1K37A 3SOQA 4RUTA 3QCWA 4D0EA 1CCVA 2VJ3A 1QFKL 2WPJE 4ISHL 4BTUA 3NJPC 3N8WB 3LC5B 2WFXB 5F19A 4CUDA 1MQ5L 1K36A 3ZYJB 1IQGL 1X7AL 4BDWA 1C5MF 1U67A 2I9BA 1UZQA 3Q7DA 1YGCL 3IJEB 3TK6B 3HO4A 3LTFB 2P28B 1G1TA 3LN1A 1ZAQA 2DDUA 1EMOA 1XDTR 2Y81B 4JYUL 2BQWA 3ASIA 3BPSE 4RS0A 2CJIB 3KK6A 4PH9A 3ZYGA 2BZ6L 4RRYA 2EI6B 1IGXA 2VVVL 2WG3C 5JB9E 2J34B 2OYEP 4X8UL 1URKA 3N8YA 3H5CB 3R05A 1EQGA 4BXSA 2Y38A 4YT7L 1APOA 1F7EA 2VWMK 2I9AA 5JVZA 1I0UA 1CVWL 1DX5I 2AYLA 5L2YL 1EZQB 1DDXA 1G1SA 3HS7A 3GCXE 3FCSB 2G00L 4MMYB 5F1AA 1CQEA 1P9JA 2P26A 2BMGA 4M10A 3HS6A 3U73A 1NFXB 3U7UG 1KLIL
chains in the Genus database with same CATH superfamily
4M11A 1N7DA 3MQEA 2VVUL 2P16L 4ZHAB 1AUTL 1MQ6L 1P0SL 1EAIC 5JBCE 2BT7A 4RRXA 1WU1B 1YUGA 2PHBB 4ISIL 2W2ME 1PGEA 4ZXXL 1G2MB 2Y5GL 3N8YB 4FM5A 4E1GA 2XC0L 4Z6AL 2BOHA 2BOUA 2Y7XB 2WPIE 4ZH8B 3F6UL 3KL6B 1HT5A 3K9XA 2D1JB 1F0RB 3M37L 1IQLL 5CKQA 4RRWA 1YO8A 1ATAA 2Y5HL 4RRZA 1G1RA 1BF9A 1KLOA 1EPHA 2B7DL 1APQA 4D0FA 1IP0A 1CX2A 2F9BL 3N8ZA 2YGOA 4ZXYL 5EGMB 3KQBL 1XKBA 1L5GB 1JL9A 3OLUA 4NG9L 2XC4L 4JZFL 2J2UB 1V3XB 1EMNA 4A7IA 1ATDA 3OLTA 4JZEL 2ADXA 2J38B 2P3FL 4X8VL 1A3PA 1EPGA 1KKEA 1YUKB 2KV4A 3TGFA 5K0HB 6COXA 4C16A 2RHPA 4XLWA 1HX2A 3LAQA 1HT8A 4BXWA 3HPTA 3CS7L 3NTGA 4GU3A 2VRSA 1XFEA 1IOEL 2W3IB 2P93L 2W86A 4G1MB 3CA7A 4OTYA 5IKTA 1PXXA 1LQDA 4MMZB 4NA9L 4JZDL 2RA0L 1Q4GA 2UWLB 5CISA 1FF7A 3KRKA 2W26B 2H9EL 2M74A 3GCWE 4O1ZA 2VWLL 5IKQA 4Y6DB 2P3FN 1CCFA 1KLJL 3LC3B 1L3YA 2NPRA 2FLRL 2XBXL 3LIWB 4JYVL 2WFTA 1COUA 5L2ZL 2HOXA 1IQIL 5CKMA 4COXA 4Y71B 1YUFA 1LMJA 2BOXA 2WG4B 2JJLA 2K2TA 1LPKA 1HZ8A 3TH3L 1U8CB 1G2LB 2Y7ZB 1M1XB 5I46L 1NFWB 4Y79B 3SW2A 3P5BL 3LN0A 2WPKE 2WYGB 1HAEA 3N8XA 2WPLE 4AQTA 3C9AC 1CVUA 2TGFA 1SZBA 1NPEB 1FSBA 3N8WA 2VVCK 3RR3A 1EGFA 4BDXA 1PTHA 1IJQA 2UWOB 2OYUP 1J9CL 2H9EC 2KB9A 2XC5L 5JVYA 4LORA 3QH0A 4Z0KB 3ZYIB 4YT6L 2PUQL 1HCGB 4CSYA 2XBYL 2YGQA 2BO2A 1F0SB 3KQCL 1UZJA 3NT1A 1W7XL 5IKVA 2FLBL 3NTBA 2Y82B 2W3KB 5KIRA 3LTGD 3FFGL 3SOBB 3TZIA 4A94C 5JB8E 1FAKL 1OB1C 2W2OE 3CFWA 3FBYA 1TLEA 1HJ7A 2WYJB 3SOVA 3TBDA 2FZZL 5FDQA 1KSNB 2RNLA 1EPIA 2JKHL 4BTIA 4ZAEB 5E8DA 1MOXC 2Y80B 3V64C 1HRFA 2VWNL 3KCGL 1GK5A 1XKAL 4XL1A 5IKRA 2KL7A 3KQEL 1NQLB 3GISX 1UZKA 3PGHA 2J4IB 1PFXL 2W2QE 4Y76B 3KQDL 3HO5A 3BT2A 3N8VA 1IQFL 4Y7AB 1FFMA 2UWPB 4BTTA 1UZPA 4OTJA 3ENSA 2FD6A 1DIYA 1WHFA 1ADXA 1FJSL 1IQML 1NFYB 3QMOA 3DEMA 2PR3B 2VH0B 1EQHA 2W2PE 2MGPA 4TGFA 1EBVA 1NFUB 2J95B 2EI8B 2VH6B 1KIGL 1Z6EL 2KNIA 3S6XA 4YZUB 2Y5FL 3V65B 1IQHL 3TK5B 1FE2A 2YGPA 4D90A 1IQNL 2Q1JB 2HORA 1DVAL 2K2SB 4CUFA 2VWOL 4Z0LA 5CKNA 1B9WA 2P3UA 1EPJA 2BQ6A 1PRHA 1JBUL 1Z6CA 1LPZA 1IQKL 4X8TL 2MHPA 1HREA 2P95L 2WZPP 3HO3A 1LPGA 2EI7B 4MMXB 1N1IA 4LMFA 4Y7BB 3HS5A 2W2NE 2GD4A 2XBVL 2XBWL 5JBBE 2BOKL 2P3TA 2BQ7A 1IOXA 3POYA 3IITB 3ELAL 1W8BL 1RFNB 1JV2B 1LK9A 1ATBA 3BT1A 1IQJL 5JBAE 3F1SB 4XBMA 3EGFA 3M36L 1TPGA 1IVOC 1V1IA 1CEJA 4O02B 5COXA 5KN5C 5L30L 4NGAL 2J94B 3Q3KB 1IQEL 1TOZA 5JW1A 1NT0A 1IGZA 2WPME 1QIUA 4CUEA 2FLGA 1G1QA 3MDLA 1WHEA 2WPHE 4X8SL 1O5DL 3CENL 1DQBA 1NZIA 1ATEA 1HAFA 2P94L 2MGRA 1F7MA 1FAXL 1K37A 3SOQA 4RUTA 4GU4A 3QCWA 4D0EA 1CCVA 2VJ3A 1QFKL 2WPJE 4ISHL 4BTUA 3NJPC 3N8WB 3LC5B 2WFXB 5F19A 4CUDA 1MQ5L 1K36A 3ZYJB 1IQGL 1X7AL 4BDWA 1C5MF 1U67A 2I9BA 1UZQA 3Q7DA 1YGCL 3IJEB 3TK6B 3HO4A 3LTFB 2BSFA 2P28B 1V1HA 1G1TA 3LN1A 1ZAQA 2DDUA 1EMOA 1XDTR 2Y81B 4JYUL 2BQWA 3ASIA 3BPSE 4RS0A 2CJIB 3KK6A 4PH9A 3ZYGA 2BZ6L 4RRYA 2EI6B 1IGXA 2VVVL 2WG3C 5JB9E 2J34B 2OYEP 4X8UL 1URKA 3N8YA 3H5CB 3R05A 1EQGA 4BXSA 2Y38A 4YT7L 1APOA 1F7EA 1LMMA 2BT8A 2VWMK 2I9AA 5JVZA 1I0UA 1CVWL 1DX5I 2AYLA 5L2YL 1EZQB 1DDXA 1G1SA 3HS7A 3GCXE 3FCSB 2G00L 4MMYB 5F1AA 1CQEA 1P9JA 2P26A 2BMGA 4M10A 3HS6A 3U73A 1NFXB 3U7UG 1KLIL
chains in the Genus database with same CATH topology
4M11A 1N7DA 3MQEA 2VVUL 2P16L 4ZHAB 1AUTL 1MQ6L 1P0SL 1EAIC 5JBCE 4RRXA 1WU1B 1YUGA 2PHBB 4ISIL 2W2ME 1PGEA 4ZXXL 1G2MB 2Y5GL 3N8YB 4FM5A 4E1GA 2XC0L 4Z6AL 2BOHA 2BOUA 2Y7XB 2WPIE 4ZH8B 3F6UL 3KL6B 1HT5A 3K9XA 2D1JB 1F0RB 3M37L 1IQLL 5CKQA 4RRWA 1YO8A 1ATAA 2Y5HL 4RRZA 1G1RA 1BF9A 1KLOA 1EPHA 2B7DL 1APQA 4D0FA 1IP0A 1CX2A 2F9BL 3N8ZA 2YGOA 4ZXYL 5EGMB 3KQBL 1XKBA 1L5GB 1JL9A 3OLUA 4NG9L 2XC4L 4JZFL 2J2UB 1V3XB 1EMNA 4A7IA 1ATDA 3OLTA 4JZEL 2ADXA 2J38B 2P3FL 4X8VL 1A3PA 1EPGA 1YUKB 2KV4A 3TGFA 5K0HB 6COXA 4C16A 2RHPA 4XLWA 1HX2A 3LAQA 1HT8A 4BXWA 3HPTA 3CS7L 3NTGA 1XFEA 1IOEL 2W3IB 2P93L 2W86A 4G1MB 3CA7A 4OTYA 5IKTA 1PXXA 1LQDA 4MMZB 4NA9L 4JZDL 2RA0L 1Q4GA 2UWLB 5CISA 1FF7A 3KRKA 2W26B 2H9EL 2M74A 3GCWE 4O1ZA 2VWLL 5IKQA 4Y6DB 2P3FN 1CCFA 1KLJL 3LC3B 1L3YA 2NPRA 2FLRL 2XBXL 3LIWB 4JYVL 2WFTA 1COUA 5L2ZL 1IQIL 5CKMA 4COXA 4Y71B 1YUFA 1LMJA 2BOXA 2WG4B 2K2TA 1LPKA 1HZ8A 3TH3L 1U8CB 1G2LB 2Y7ZB 1M1XB 5I46L 1NFWB 4Y79B 3SW2A 3P5BL 3LN0A 2WPKE 2WYGB 1HAEA 3N8XA 2WPLE 4AQTA 3C9AC 1CVUA 2TGFA 1SZBA 1NPEB 1FSBA 3N8WA 2VVCK 3RR3A 1EGFA 4BDXA 1PTHA 1IJQA 2UWOB 2OYUP 1J9CL 2H9EC 2KB9A 2XC5L 5JVYA 4LORA 3QH0A 4Z0KB 3ZYIB 4YT6L 2PUQL 1HCGB 4CSYA 2XBYL 2YGQA 2BO2A 1F0SB 3KQCL 1UZJA 3NT1A 1W7XL 5IKVA 2FLBL 3NTBA 2Y82B 2W3KB 5KIRA 3LTGD 3FFGL 3SOBB 3TZIA 4A94C 5JB8E 1FAKL 1OB1C 2W2OE 3CFWA 3FBYA 1TLEA 1HJ7A 2WYJB 3SOVA 3TBDA 2FZZL 5FDQA 1KSNB 2RNLA 1EPIA 2JKHL 4BTIA 4ZAEB 5E8DA 1MOXC 2Y80B 3V64C 1HRFA 2VWNL 3KCGL 1GK5A 1XKAL 4XL1A 5IKRA 2KL7A 3KQEL 1NQLB 3GISX 1UZKA 3PGHA 2J4IB 1PFXL 2W2QE 4Y76B 3KQDL 3HO5A 3BT2A 3N8VA 1IQFL 4Y7AB 1FFMA 2UWPB 4BTTA 1UZPA 4OTJA 3ENSA 2FD6A 1DIYA 1WHFA 1ADXA 1FJSL 1IQML 1NFYB 3QMOA 3DEMA 2PR3B 2VH0B 1EQHA 2W2PE 2MGPA 4TGFA 1EBVA 1NFUB 2J95B 2EI8B 2VH6B 1KIGL 1Z6EL 2KNIA 3S6XA 4YZUB 2Y5FL 3V65B 1IQHL 3TK5B 1FE2A 2YGPA 4D90A 1IQNL 2Q1JB 1DVAL 2K2SB 4CUFA 2VWOL 4Z0LA 5CKNA 1B9WA 2P3UA 1EPJA 2BQ6A 1PRHA 1JBUL 1Z6CA 1LPZA 1IQKL 4X8TL 2MHPA 1HREA 2P95L 2WZPP 3HO3A 1LPGA 2EI7B 4MMXB 1N1IA 4LMFA 4Y7BB 3HS5A 2W2NE 2GD4A 2XBVL 2XBWL 5JBBE 2BOKL 2P3TA 2BQ7A 1IOXA 3POYA 3IITB 3ELAL 1W8BL 1RFNB 1JV2B 3BT1A 1ATBA 1IQJL 5JBAE 3F1SB 4XBMA 3EGFA 3M36L 1TPGA 1IVOC 1CEJA 4O02B 5COXA 5KN5C 5L30L 4NGAL 2J94B 3Q3KB 1IQEL 1TOZA 5JW1A 1NT0A 1IGZA 2WPME 4CUEA 2FLGA 1G1QA 3MDLA 1WHEA 2WPHE 4X8SL 1O5DL 3CENL 1DQBA 1NZIA 1ATEA 1HAFA 2P94L 2MGRA 1F7MA 1FAXL 1K37A 3SOQA 4RUTA 3QCWA 4D0EA 1CCVA 2VJ3A 1QFKL 2WPJE 4ISHL 4BTUA 3NJPC 3N8WB 3LC5B 2WFXB 5F19A 4CUDA 1MQ5L 1K36A 3ZYJB 1IQGL 1X7AL 4BDWA 1C5MF 1U67A 2I9BA 1UZQA 3Q7DA 1YGCL 3IJEB 3TK6B 3HO4A 3LTFB 2P28B 1G1TA 3LN1A 1ZAQA 2DDUA 1EMOA 1XDTR 2Y81B 4JYUL 2BQWA 3ASIA 3BPSE 4RS0A 2CJIB 3KK6A 4PH9A 3ZYGA 2BZ6L 4RRYA 2EI6B 1IGXA 2VVVL 2WG3C 5JB9E 2J34B 2OYEP 4X8UL 1URKA 3N8YA 3H5CB 3R05A 1EQGA 4BXSA 2Y38A 4YT7L 1APOA 1F7EA 1LMMA 2VWMK 2I9AA 5JVZA 1I0UA 1CVWL 1DX5I 2AYLA 5L2YL 1EZQB 1DDXA 1G1SA 3HS7A 3GCXE 3FCSB 2G00L 4MMYB 5F1AA 1CQEA 1P9JA 2P26A 2BMGA 4M10A 3HS6A 3U73A 1NFXB 3U7UG 1KLIL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M11 A;  1N7D A;  3MQE A;  2VVU L;  2P16 L;  4ZHA B;  1AUT L;  1MQ6 L;  1P0S L;  1EAI C;  5JBC E;  4RRX A;  1WU1 B;  1YUG A;  2PHB B;  4ISI L;  2W2M E;  1PGE A;  4ZXX L;  1G2M B;  2Y5G L;  3N8Y B;  4FM5 A;  4E1G A;  2XC0 L;  4Z6A L;  2BOH A;  2BOU A;  2Y7X B;  2WPI E;  4ZH8 B;  3F6U L;  3KL6 B;  1HT5 A;  3K9X A;  2D1J B;  1F0R B;  3M37 L;  1IQL L;  5CKQ A;  4RRW A;  1YO8 A;  1ATA A;  2Y5H L;  4RRZ A;  1G1R A;  1BF9 A;  1KLO A;  1EPH A;  2B7D L;  1APQ A;  4D0F A;  1IP0 A;  1CX2 A;  2F9B L;  3N8Z A;  2YGO A;  4ZXY L;  5EGM B;  3KQB L;  1XKB A;  1L5G B;  1JL9 A;  3OLU A;  4NG9 L;  2XC4 L;  4JZF L;  2J2U B;  1V3X B;  1EMN A;  4A7I A;  1ATD A;  3OLT A;  4JZE L;  2ADX A;  2J38 B;  2P3F L;  4X8V L;  1A3P A;  1EPG A;  1YUK B;  2KV4 A;  3TGF A;  5K0H B;  6COX A;  4C16 A;  2RHP A;  4XLW A;  1HX2 A;  3LAQ A;  1HT8 A;  4BXW A;  3HPT A;  3CS7 L;  3NTG A;  1XFE A;  1IOE L;  2W3I B;  2P93 L;  2W86 A;  4G1M B;  3CA7 A;  4OTY A;  5IKT A;  1PXX A;  1LQD A;  4MMZ B;  4NA9 L;  4JZD L;  2RA0 L;  1Q4G A;  2UWL B;  5CIS A;  1FF7 A;  3KRK A;  2W26 B;  2H9E L;  2M74 A;  3GCW E;  4O1Z A;  2VWL L;  5IKQ A;  4Y6D B;  2P3F N;  1CCF A;  1KLJ L;  3LC3 B;  1L3Y A;  2NPR A;  2FLR L;  2XBX L;  3LIW B;  4JYV L;  2WFT A;  1COU A;  5L2Z L;  1IQI L;  5CKM A;  4COX A;  4Y71 B;  1YUF A;  1LMJ A;  2BOX A;  2WG4 B;  2K2T A;  1LPK A;  1HZ8 A;  3TH3 L;  1U8C B;  1G2L B;  2Y7Z B;  1M1X B;  5I46 L;  1NFW B;  4Y79 B;  3SW2 A;  3P5B L;  3LN0 A;  2WPK E;  2WYG B;  1HAE A;  3N8X A;  2WPL E;  4AQT A;  3C9A C;  1CVU A;  2TGF A;  1SZB A;  1NPE B;  1FSB A;  3N8W A;  2VVC K;  3RR3 A;  1EGF A;  4BDX A;  1PTH A;  1IJQ A;  2UWO B;  2OYU P;  1J9C L;  2KB9 A;  2XC5 L;  5JVY A;  4LOR A;  3QH0 A;  4Z0K B;  3ZYI B;  4YT6 L;  2PUQ L;  1HCG B;  4CSY A;  2XBY L;  2BO2 A;  1F0S B;  3KQC L;  1UZJ A;  3NT1 A;  1W7X L;  5IKV A;  2FLB L;  3NTB A;  2Y82 B;  2W3K B;  5KIR A;  3LTG D;  3FFG L;  3SOB B;  3TZI A;  5JB8 E;  1FAK L;  1OB1 C;  2W2O E;  3CFW A;  3FBY A;  1TLE A;  1HJ7 A;  2WYJ B;  3SOV A;  3TBD A;  2FZZ L;  5FDQ A;  1KSN B;  2RNL A;  1EPI A;  2JKH L;  4BTI A;  4ZAE B;  5E8D A;  1MOX C;  2Y80 B;  3V64 C;  1HRF A;  2VWN L;  3KCG L;  1GK5 A;  1XKA L;  4XL1 A;  5IKR A;  2KL7 A;  3KQE L;  1NQL B;  3GIS X;  1UZK A;  3PGH A;  2J4I B;  1PFX L;  2W2Q E;  4Y76 B;  3KQD L;  3HO5 A;  3BT2 A;  3N8V A;  1IQF L;  4Y7A B;  1FFM A;  2UWP B;  4BTT A;  1UZP A;  4OTJ A;  3ENS A;  2FD6 A;  1DIY A;  1WHF A;  1ADX A;  1FJS L;  1IQM L;  1NFY B;  3QMO A;  3DEM A;  2PR3 B;  2VH0 B;  1EQH A;  2W2P E;  2MGP A;  4TGF A;  1EBV A;  1NFU B;  2J95 B;  2EI8 B;  2VH6 B;  1KIG L;  1Z6E L;  4YZU B;  2Y5F L;  3V65 B;  1IQH L;  3TK5 B;  1FE2 A;  2YGP A;  4D90 A;  1IQN L;  2Q1J B;  1DVA L;  2K2S B;  4CUF A;  2VWO L;  4Z0L A;  5CKN A;  1B9W A;  2P3U A;  1EPJ A;  2BQ6 A;  1PRH A;  1JBU L;  1Z6C A;  1LPZ A;  1IQK L;  4X8T L;  2MHP A;  1HRE A;  2P95 L;  3HO3 A;  1LPG A;  2EI7 B;  4MMX B;  1N1I A;  4LMF A;  4Y7B B;  3HS5 A;  2W2N E;  2GD4 A;  2XBV L;  2XBW L;  5JBB E;  2BOK L;  2P3T A;  2BQ7 A;  1IOX A;  3POY A;  3IIT B;  3ELA L;  1W8B L;  1RFN B;  1JV2 B;  3BT1 A;  1ATB A;  1IQJ L;  5JBA E;  3F1S B;  4XBM A;  3EGF A;  3M36 L;  1TPG A;  1IVO C;  1CEJ A;  4O02 B;  5COX A;  5KN5 C;  5L30 L;  4NGA L;  2J94 B;  3Q3K B;  1IQE L;  1TOZ A;  5JW1 A;  1NT0 A;  1IGZ A;  2WPM E;  4CUE A;  2FLG A;  1G1Q A;  3MDL A;  1WHE A;  2WPH E;  4X8S L;  1O5D L;  3CEN L;  1DQB A;  1NZI A;  1ATE A;  1HAF A;  2P94 L;  2MGR A;  1F7M A;  1FAX L;  1K37 A;  3SOQ A;  4RUT A;  3QCW A;  4D0E A;  1CCV A;  2VJ3 A;  1QFK L;  2WPJ E;  4ISH L;  4BTU A;  3NJP C;  3N8W B;  3LC5 B;  2WFX B;  5F19 A;  4CUD A;  1MQ5 L;  1K36 A;  3ZYJ B;  1IQG L;  1X7A L;  4BDW A;  1C5M F;  1U67 A;  2I9B A;  1UZQ A;  3Q7D A;  1YGC L;  3IJE B;  3TK6 B;  3HO4 A;  3LTF B;  2P28 B;  1G1T A;  3LN1 A;  1ZAQ A;  2DDU A;  1EMO A;  1XDT R;  2Y81 B;  4JYU L;  2BQW A;  3ASI A;  3BPS E;  4RS0 A;  2CJI B;  3KK6 A;  4PH9 A;  3ZYG A;  2BZ6 L;  4RRY A;  2EI6 B;  1IGX A;  2VVV L;  2WG3 C;  5JB9 E;  2J34 B;  2OYE P;  4X8U L;  1URK A;  3N8Y A;  3H5C B;  3R05 A;  1EQG A;  4BXS A;  2Y38 A;  4YT7 L;  1APO A;  1F7E A;  2VWM K;  2I9A A;  5JVZ A;  1I0U A;  1CVW L;  1DX5 I;  2AYL A;  5L2Y L;  1EZQ B;  1DDX A;  1G1S A;  3HS7 A;  3GCX E;  3FCS B;  2G00 L;  4MMY B;  5F1A A;  1CQE A;  1P9J A;  2P26 A;  2BMG A;  4M10 A;  3HS6 A;  3U73 A;  1NFX B;  3U7U G;  1KLI L; 
#chains in the Genus database with same CATH topology
 4M11 A;  1N7D A;  3MQE A;  2VVU L;  2P16 L;  4ZHA B;  1AUT L;  1MQ6 L;  1P0S L;  1EAI C;  5JBC E;  2BT7 A;  4RRX A;  1WU1 B;  1YUG A;  2PHB B;  4ISI L;  2W2M E;  1PGE A;  4ZXX L;  1G2M B;  2Y5G L;  3N8Y B;  4FM5 A;  4E1G A;  2XC0 L;  4Z6A L;  2BOH A;  2BOU A;  2Y7X B;  2WPI E;  4ZH8 B;  3F6U L;  3KL6 B;  1HT5 A;  3K9X A;  2D1J B;  1F0R B;  3M37 L;  1IQL L;  5CKQ A;  4RRW A;  1YO8 A;  1ATA A;  2Y5H L;  4RRZ A;  1G1R A;  1BF9 A;  1KLO A;  1EPH A;  2B7D L;  1APQ A;  4D0F A;  1IP0 A;  1CX2 A;  2F9B L;  3N8Z A;  2YGO A;  4ZXY L;  5EGM B;  3KQB L;  1XKB A;  1L5G B;  1JL9 A;  3OLU A;  4NG9 L;  2XC4 L;  4JZF L;  2J2U B;  1V3X B;  1EMN A;  4A7I A;  1ATD A;  3OLT A;  4JZE L;  2ADX A;  2J38 B;  2P3F L;  4X8V L;  1A3P A;  1EPG A;  1KKE A;  1YUK B;  2KV4 A;  3TGF A;  5K0H B;  6COX A;  4C16 A;  2RHP A;  4XLW A;  1HX2 A;  3LAQ A;  1HT8 A;  4BXW A;  3HPT A;  3CS7 L;  3NTG A;  4GU3 A;  2VRS A;  1XFE A;  1IOE L;  2W3I B;  2P93 L;  2W86 A;  4G1M B;  3CA7 A;  4OTY A;  5IKT A;  1PXX A;  1LQD A;  4MMZ B;  4NA9 L;  4JZD L;  2RA0 L;  1Q4G A;  2UWL B;  5CIS A;  1FF7 A;  3KRK A;  2W26 B;  2H9E L;  2M74 A;  3GCW E;  4O1Z A;  2VWL L;  5IKQ A;  4Y6D B;  2P3F N;  1CCF A;  1KLJ L;  3LC3 B;  1L3Y A;  2NPR A;  2FLR L;  2XBX L;  3LIW B;  4JYV L;  2WFT A;  1COU A;  5L2Z L;  2HOX A;  1IQI L;  5CKM A;  4COX A;  4Y71 B;  1YUF A;  1LMJ A;  2BOX A;  2WG4 B;  2JJL A;  2K2T A;  1LPK A;  1HZ8 A;  3TH3 L;  1U8C B;  1G2L B;  2Y7Z B;  1M1X B;  5I46 L;  1NFW B;  4Y79 B;  3SW2 A;  3P5B L;  3LN0 A;  2WPK E;  2WYG B;  1HAE A;  3N8X A;  2WPL E;  4AQT A;  3C9A C;  1CVU A;  2TGF A;  1SZB A;  1NPE B;  1FSB A;  3N8W A;  2VVC K;  3RR3 A;  1EGF A;  4BDX A;  1PTH A;  1IJQ A;  2UWO B;  2OYU P;  1J9C L;  2H9E C;  2KB9 A;  2XC5 L;  5JVY A;  4LOR A;  3QH0 A;  4Z0K B;  3ZYI B;  4YT6 L;  2PUQ L;  1HCG B;  4CSY A;  2XBY L;  2YGQ A;  2BO2 A;  1F0S B;  3KQC L;  1UZJ A;  3NT1 A;  1W7X L;  5IKV A;  2FLB L;  3NTB A;  2Y82 B;  2W3K B;  5KIR A;  3LTG D;  3FFG L;  3SOB B;  3TZI A;  4A94 C;  5JB8 E;  1FAK L;  1OB1 C;  2W2O E;  3CFW A;  3FBY A;  1TLE A;  1HJ7 A;  2WYJ B;  3SOV A;  3TBD A;  2FZZ L;  5FDQ A;  1KSN B;  2RNL A;  1EPI A;  2JKH L;  4BTI A;  4ZAE B;  5E8D A;  1MOX C;  2Y80 B;  3V64 C;  1HRF A;  2VWN L;  3KCG L;  1GK5 A;  1XKA L;  4XL1 A;  5IKR A;  2KL7 A;  3KQE L;  1NQL B;  3GIS X;  1UZK A;  3PGH A;  2J4I B;  1PFX L;  2W2Q E;  4Y76 B;  3KQD L;  3HO5 A;  3BT2 A;  3N8V A;  1IQF L;  4Y7A B;  1FFM A;  2UWP B;  4BTT A;  1UZP A;  4OTJ A;  3ENS A;  2FD6 A;  1DIY A;  1WHF A;  1ADX A;  1FJS L;  1IQM L;  1NFY B;  3QMO A;  3DEM A;  2PR3 B;  2VH0 B;  1EQH A;  2W2P E;  2MGP A;  4TGF A;  1EBV A;  1NFU B;  2J95 B;  2EI8 B;  2VH6 B;  1KIG L;  1Z6E L;  2KNI A;  3S6X A;  4YZU B;  2Y5F L;  3V65 B;  1IQH L;  3TK5 B;  1FE2 A;  2YGP A;  4D90 A;  1IQN L;  2Q1J B;  2HOR A;  1DVA L;  2K2S B;  4CUF A;  2VWO L;  4Z0L A;  5CKN A;  1B9W A;  2P3U A;  1EPJ A;  2BQ6 A;  1PRH A;  1JBU L;  1Z6C A;  1LPZ A;  1IQK L;  4X8T L;  2MHP A;  1HRE A;  2P95 L;  2WZP P;  3HO3 A;  1LPG A;  2EI7 B;  4MMX B;  1N1I A;  4LMF A;  4Y7B B;  3HS5 A;  2W2N E;  2GD4 A;  2XBV L;  2XBW L;  5JBB E;  2BOK L;  2P3T A;  2BQ7 A;  1IOX A;  3POY A;  3IIT B;  3ELA L;  1W8B L;  1RFN B;  1JV2 B;  1LK9 A;  1ATB A;  3BT1 A;  1IQJ L;  5JBA E;  3F1S B;  4XBM A;  3EGF A;  3M36 L;  1TPG A;  1IVO C;  1V1I A;  1CEJ A;  4O02 B;  5COX A;  5KN5 C;  5L30 L;  4NGA L;  2J94 B;  3Q3K B;  1IQE L;  1TOZ A;  5JW1 A;  1NT0 A;  1IGZ A;  2WPM E;  1QIU A;  4CUE A;  2FLG A;  1G1Q A;  3MDL A;  1WHE A;  2WPH E;  4X8S L;  1O5D L;  3CEN L;  1DQB A;  1NZI A;  1ATE A;  1HAF A;  2P94 L;  2MGR A;  1F7M A;  1FAX L;  1K37 A;  3SOQ A;  4RUT A;  4GU4 A;  3QCW A;  4D0E A;  1CCV A;  2VJ3 A;  1QFK L;  2WPJ E;  4ISH L;  4BTU A;  3NJP C;  3N8W B;  3LC5 B;  2WFX B;  5F19 A;  4CUD A;  1MQ5 L;  1K36 A;  3ZYJ B;  1IQG L;  1X7A L;  4BDW A;  1C5M F;  1U67 A;  2I9B A;  1UZQ A;  3Q7D A;  1YGC L;  3IJE B;  3TK6 B;  3HO4 A;  3LTF B;  2BSF A;  2P28 B;  1V1H A;  1G1T A;  3LN1 A;  1ZAQ A;  2DDU A;  1EMO A;  1XDT R;  2Y81 B;  4JYU L;  2BQW A;  3ASI A;  3BPS E;  4RS0 A;  2CJI B;  3KK6 A;  4PH9 A;  3ZYG A;  2BZ6 L;  4RRY A;  2EI6 B;  1IGX A;  2VVV L;  2WG3 C;  5JB9 E;  2J34 B;  2OYE P;  4X8U L;  1URK A;  3N8Y A;  3H5C B;  3R05 A;  1EQG A;  4BXS A;  2Y38 A;  4YT7 L;  1APO A;  1F7E A;  1LMM A;  2BT8 A;  2VWM K;  2I9A A;  5JVZ A;  1I0U A;  1CVW L;  1DX5 I;  2AYL A;  5L2Y L;  1EZQ B;  1DDX A;  1G1S A;  3HS7 A;  3GCX E;  3FCS B;  2G00 L;  4MMY B;  5F1A A;  1CQE A;  1P9J A;  2P26 A;  2BMG A;  4M10 A;  3HS6 A;  3U73 A;  1NFX B;  3U7U G;  1KLI L; 
#chains in the Genus database with same CATH homology
 4M11 A;  1N7D A;  3MQE A;  2VVU L;  2P16 L;  4ZHA B;  1AUT L;  1MQ6 L;  1P0S L;  1EAI C;  5JBC E;  4RRX A;  1WU1 B;  1YUG A;  2PHB B;  4ISI L;  2W2M E;  1PGE A;  4ZXX L;  1G2M B;  2Y5G L;  3N8Y B;  4FM5 A;  4E1G A;  2XC0 L;  4Z6A L;  2BOH A;  2BOU A;  2Y7X B;  2WPI E;  4ZH8 B;  3F6U L;  3KL6 B;  1HT5 A;  3K9X A;  2D1J B;  1F0R B;  3M37 L;  1IQL L;  5CKQ A;  4RRW A;  1YO8 A;  1ATA A;  2Y5H L;  4RRZ A;  1G1R A;  1BF9 A;  1KLO A;  1EPH A;  2B7D L;  1APQ A;  4D0F A;  1IP0 A;  1CX2 A;  2F9B L;  3N8Z A;  2YGO A;  4ZXY L;  5EGM B;  3KQB L;  1XKB A;  1L5G B;  1JL9 A;  3OLU A;  4NG9 L;  2XC4 L;  4JZF L;  2J2U B;  1V3X B;  1EMN A;  4A7I A;  1ATD A;  3OLT A;  4JZE L;  2ADX A;  2J38 B;  2P3F L;  4X8V L;  1A3P A;  1EPG A;  1YUK B;  2KV4 A;  3TGF A;  5K0H B;  6COX A;  4C16 A;  2RHP A;  4XLW A;  1HX2 A;  3LAQ A;  1HT8 A;  4BXW A;  3HPT A;  3CS7 L;  3NTG A;  1XFE A;  1IOE L;  2W3I B;  2P93 L;  2W86 A;  4G1M B;  3CA7 A;  4OTY A;  5IKT A;  1PXX A;  1LQD A;  4MMZ B;  4NA9 L;  4JZD L;  2RA0 L;  1Q4G A;  2UWL B;  5CIS A;  1FF7 A;  3KRK A;  2W26 B;  2H9E L;  2M74 A;  3GCW E;  4O1Z A;  2VWL L;  5IKQ A;  4Y6D B;  2P3F N;  1CCF A;  1KLJ L;  3LC3 B;  1L3Y A;  2NPR A;  2FLR L;  2XBX L;  3LIW B;  4JYV L;  2WFT A;  1COU A;  5L2Z L;  1IQI L;  5CKM A;  4COX A;  4Y71 B;  1YUF A;  1LMJ A;  2BOX A;  2WG4 B;  2K2T A;  1LPK A;  1HZ8 A;  3TH3 L;  1U8C B;  1G2L B;  2Y7Z B;  1M1X B;  5I46 L;  1NFW B;  4Y79 B;  3SW2 A;  3P5B L;  3LN0 A;  2WPK E;  2WYG B;  1HAE A;  3N8X A;  2WPL E;  4AQT A;  3C9A C;  1CVU A;  2TGF A;  1SZB A;  1NPE B;  1FSB A;  3N8W A;  2VVC K;  3RR3 A;  1EGF A;  4BDX A;  1PTH A;  1IJQ A;  2UWO B;  2OYU P;  1J9C L;  2H9E C;  2KB9 A;  2XC5 L;  5JVY A;  4LOR A;  3QH0 A;  4Z0K B;  3ZYI B;  4YT6 L;  2PUQ L;  1HCG B;  4CSY A;  2XBY L;  2YGQ A;  2BO2 A;  1F0S B;  3KQC L;  1UZJ A;  3NT1 A;  1W7X L;  5IKV A;  2FLB L;  3NTB A;  2Y82 B;  2W3K B;  5KIR A;  3LTG D;  3FFG L;  3SOB B;  3TZI A;  4A94 C;  5JB8 E;  1FAK L;  1OB1 C;  2W2O E;  3CFW A;  3FBY A;  1TLE A;  1HJ7 A;  2WYJ B;  3SOV A;  3TBD A;  2FZZ L;  5FDQ A;  1KSN B;  2RNL A;  1EPI A;  2JKH L;  4BTI A;  4ZAE B;  5E8D A;  1MOX C;  2Y80 B;  3V64 C;  1HRF A;  2VWN L;  3KCG L;  1GK5 A;  1XKA L;  4XL1 A;  5IKR A;  2KL7 A;  3KQE L;  1NQL B;  3GIS X;  1UZK A;  3PGH A;  2J4I B;  1PFX L;  2W2Q E;  4Y76 B;  3KQD L;  3HO5 A;  3BT2 A;  3N8V A;  1IQF L;  4Y7A B;  1FFM A;  2UWP B;  4BTT A;  1UZP A;  4OTJ A;  3ENS A;  2FD6 A;  1DIY A;  1WHF A;  1ADX A;  1FJS L;  1IQM L;  1NFY B;  3QMO A;  3DEM A;  2PR3 B;  2VH0 B;  1EQH A;  2W2P E;  2MGP A;  4TGF A;  1EBV A;  1NFU B;  2J95 B;  2EI8 B;  2VH6 B;  1KIG L;  1Z6E L;  2KNI A;  3S6X A;  4YZU B;  2Y5F L;  3V65 B;  1IQH L;  3TK5 B;  1FE2 A;  2YGP A;  4D90 A;  1IQN L;  2Q1J B;  1DVA L;  2K2S B;  4CUF A;  2VWO L;  4Z0L A;  5CKN A;  1B9W A;  2P3U A;  1EPJ A;  2BQ6 A;  1PRH A;  1JBU L;  1Z6C A;  1LPZ A;  1IQK L;  4X8T L;  2MHP A;  1HRE A;  2P95 L;  2WZP P;  3HO3 A;  1LPG A;  2EI7 B;  4MMX B;  1N1I A;  4LMF A;  4Y7B B;  3HS5 A;  2W2N E;  2GD4 A;  2XBV L;  2XBW L;  5JBB E;  2BOK L;  2P3T A;  2BQ7 A;  1IOX A;  3POY A;  3IIT B;  3ELA L;  1W8B L;  1RFN B;  1JV2 B;  3BT1 A;  1ATB A;  1IQJ L;  5JBA E;  3F1S B;  4XBM A;  3EGF A;  3M36 L;  1TPG A;  1IVO C;  1CEJ A;  4O02 B;  5COX A;  5KN5 C;  5L30 L;  4NGA L;  2J94 B;  3Q3K B;  1IQE L;  1TOZ A;  5JW1 A;  1NT0 A;  1IGZ A;  2WPM E;  4CUE A;  2FLG A;  1G1Q A;  3MDL A;  1WHE A;  2WPH E;  4X8S L;  1O5D L;  3CEN L;  1DQB A;  1NZI A;  1ATE A;  1HAF A;  2P94 L;  2MGR A;  1F7M A;  1FAX L;  1K37 A;  3SOQ A;  4RUT A;  3QCW A;  4D0E A;  1CCV A;  2VJ3 A;  1QFK L;  2WPJ E;  4ISH L;  4BTU A;  3NJP C;  3N8W B;  3LC5 B;  2WFX B;  5F19 A;  4CUD A;  1MQ5 L;  1K36 A;  3ZYJ B;  1IQG L;  1X7A L;  4BDW A;  1C5M F;  1U67 A;  2I9B A;  1UZQ A;  3Q7D A;  1YGC L;  3IJE B;  3TK6 B;  3HO4 A;  3LTF B;  2P28 B;  1G1T A;  3LN1 A;  1ZAQ A;  2DDU A;  1EMO A;  1XDT R;  2Y81 B;  4JYU L;  2BQW A;  3ASI A;  3BPS E;  4RS0 A;  2CJI B;  3KK6 A;  4PH9 A;  3ZYG A;  2BZ6 L;  4RRY A;  2EI6 B;  1IGX A;  2VVV L;  2WG3 C;  5JB9 E;  2J34 B;  2OYE P;  4X8U L;  1URK A;  3N8Y A;  3H5C B;  3R05 A;  1EQG A;  4BXS A;  2Y38 A;  4YT7 L;  1APO A;  1F7E A;  1LMM A;  2VWM K;  2I9A A;  5JVZ A;  1I0U A;  1CVW L;  1DX5 I;  2AYL A;  5L2Y L;  1EZQ B;  1DDX A;  1G1S A;  3HS7 A;  3GCX E;  3FCS B;  2G00 L;  4MMY B;  5F1A A;  1CQE A;  1P9J A;  2P26 A;  2BMG A;  4M10 A;  3HS6 A;  3U73 A;  1NFX B;  3U7U G;  1KLI L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...