1AU9A

Subtilisin bpn' mutant 8324 in citrate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYCGSNVKVAVIDSGIDSSHPDLKVAGGASFVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPCASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPAKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSICSTLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large increases in general stability for subtilisin BPN' through incremental changes in the free energy of unfolding.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Serine protease
molecule keywords SUBTILISIN BPN'
total genus 103
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1au9A00
4ZOQI 1EA7A 1UBNA 3DVRX 2WV7A 3I34X 5AVJA 1ST2A 1SCAA 2HD4A 5AMXA 4NE9A 1S02A 1WVMA 4OV6B 4KPGA 3P5BA 3TI9A 4JP8A 1AK9A 1WSDA 3WQBA 2PWAA 3QFHA 4AKSA 1SCNE 2E1PA 1GT91 1NLUA 2Z2ZA 3DE5X 3GT4A 1Y34E 4CG0A 4DJ5X 1YU6A 1Y33E 1SBIA 2W2NA 5JXGA 1V5IA 1CNMA 1Y9ZA 1SCBA 3ZXXA 1BJRE 1IC6A 1XF1A 4Z2AA 1SIBE 4BWGA 1JEAA 1SH7A 2Z58A 3AFGA 4J94A 1TM1E 2PYZA 3LPDA 5CW1A 3A3OA 3VHQA 3D43A 1DUIA 3A3NA 3VSBA 2WUVA 5I9SA 2WWTA 5ARCA 2GKOA 5FAXA 3GCXA 5FBZA 1Q5PA 1GA6A 2PMWB 3DE6X 1SVNA 3D9QX 1SBCA 1T1EA 4C3VA 1PFGA 1MPTA 2IXTA 2X8JA 1SIOA 1YJCA 1TK2A 3DW3X 3GT3A 1TECE 4NE7A 1AU9A 1GCIA 1SUPA 2SNIE 4KB5A 1S2NA 3WHIA 4HX2A 1Y3BE 3OSZA 1KE2A 1IAVA 2X8JB 3DE3X 4OMDA 1BH6A 3LPCA 2DQKA 2XTJA 1ZVKA 2DP4E 1Y3CE 3H42B 2SBTA 1KE1A 1GTG1 1KDYA 2ST1A 3TECE 1C9MA 1TO2E 1T1IA 1GTL1 3SICE 2P4EA 4FONA 1WMFA 2W2MA 3DE4X 1KDZA 1TM4E 1SUCA 5AQEA 3BGOS 3EDYA 3QMPA 4KG7A 1SBNE 2HPZA 2Z57A 3I37X 3AJ9A 5ARBA 2V8BA 5K7SA 1S01A 2XRMA 4NMXB 3GCWA 4H6XA 4M1ZA 2Z2XA 1P7VA 3ZXYA 3I2YX 1PJ8A 1Y48E 3DW1X 3T41A 4ZARA 1SUDA 1TMGE 4RYDA 1C9JA 5FFNA 3DYBA 1YJAA 1P7WA 1SCDA 2ZWOA 1A2QA 1AF4A 1SCJA 1TM7E 1Y3DE 3DDZX 3WIUA 2B6NA 2Z56A 3DE2X 1OT5A 1SIUA 2ZRQA 3QTLA 1GA1A 1THMA 2W2OA 3SQOA 1YJBA 1TO1E 1PTKA 1R0RE 2ID4A 2Z2YA 4CFZA 3PRKE 1Y4AE 1PEKE 2W2QA 3Q5GA 1ST3A 4LVOA 1NDUA 4C3UA 1C9NA 1P8JA 4I0WB 1SN7A 4CFYA 3I30X 3VV3A 5B1EA 1VSBA 1NDQA 3EIFA 5ARDA 3VYVA 1TM5E 1AQNA 2PRKA 3BX1A 2SECE 2PQ2A 3UNXA 1AH2A 1WMEA 1MEEA 3DE0X 1KDVA 2SICE 5JXHA 2QTWB 3DE1X 2PKCA 1AVTA 1R6VA 1SBHA 1WMDA 1AV7A 2IY9A 2TECE 3DVSX 1Y4DE 3F7MA 3LPAA 4GI3A 4OMCA 4DZTA 1DBIA 1SELA 3HJRA 4LVNA 4DWWA 3CNQS 1GA4A 1GTJ1 3AJ8A 3F49S 1BE6A 1EGQA 1T1GA 5JXJA 3DVQX 1HT3A 1V6CA 1Y1KE 5AVKA 3L1KA 1CSEE 2DUJA 1C3LA 3VTAA 2G4VA 1OYVA 1SUAA 2WUWE 4WOBA 1Y3FE 2Z30A 3LXUX 2ZWPA 4H6VA 1GNVA 2W2PA 3A3PA 1SBTA 3BPSA 3TI7A 1TM3E 4YN3A 4HVLA 3EE6A 3WIVA 3PTLA 1R64A 1SPBS 1ZVJA 1SUBA 4MZDA 2PWBA 5SICE 4H6WA 3CO0S 3DWEX 5JXIA 1LW6E 4K8RB 3Q40A 3DE7X 4AKTA 3F7OA 1BFKA 4WOCA 5JMOA 2ID8A 1BE8A 3VV2A 1OYOA 4B5LA 1BFUA 1SUEA 5B1DA 1GNSA
chains in the Genus database with same CATH superfamily
5EEGA 3E1GA 2RBKA 4M1SA 4OK6A 2OG2A 2LBPA 4HDQB 4KAAA 5AM4A 3A6LA 3PDWA 1VG8A 2WI8A 1U8UA 1LNQA 4GL4A 3GVHA 3K16A 2NZUG 4ZVPA 4UM7A 4MV4A 3ENNA 4L5IA 3RTBA 3MAAC 2QX9A 3DZIA 2E6KA 2CLOB 1PFKA 4EMSA 4DA4A 2E82A 5HKAA 4M0FA 4Z0PA 4MS3A 3PS9A 1YA6A 4W5NA 4PSUA 4EHHA 2G9ZA 3PF9A 4KQMA 2WOOA 3IODA 1W73A 5PGMA 4FVTA 3B6IA 5H8WA 3EZ7A 5HRAA 1Z2PX 3ZI4A 3QU4A 3LA6A 3N0TA 1NRWA 1ZBQA 1AXEA 1FTSA 3FYUA 3NDPA 3MRXA 4CLEA 3TNYA 4HO1X 3ZQKA 3GDFA 3DXXA 3EEOA 1G3IA 4MDFA 4JHXA 4FHZA 4KQ9A 1N3BA 5CYFA 4BNVA 3MRVA 1M2OB 3AF2A 3UCEA 1FZQA 1Y42X 4MR7B 3BBPA 3GEIA 1ZD9A 1MOQA 1A3CA 1GU7A 2JZOA 1U7XA 1KP2A 4TMZA 5BSUA 4IQ4A 5HG0A 1RJ9B 3IMEA 5AK3A 5I4CA 5KWSA 1VL5A 1GYPA 4DR7B 4CT4B 4EW1A 3DOOA 2ODPA 1SKYE 3P0HA 4OQQA 3RDPA 3IP9A 4LK2A 1Y5RA 1SXJA 3GP3A 4D80A 1CJUC 2JS7A 1NMSA 2WNIA 4JU8A 1FYEA 1PG5A 3OIUA 1ZHOA 2IU6A 2B8JA 5BV7A 2A78A 2FK8A 4G5GA 4NEHB 2XQKA 4O4HB 5K09A 1SCDA 4UDXX 3QVKA 3M6LA 4IGIA 4QECA 4S12A 4MW7A 2GF0A 2CZQA 2JIZD 4MR9B 1BEEA 1OGIA 2FE4A 3FMPB 1XD2A 4JP3A 4ZVSA 5LWHA 1VSVA 4V0QA 3UG6A 3W8NA 3EJWA 4QYWA 1QM5A 5EPUA 5CCBA 3TH5A 5LD2B 3Q5GA 4CMIA 2PYIA 2ENWA 1WMAA 2D0IA 4GZ3A 4GSLA 5I4IA 5IZCA 5IP5A 3GMSA 1R0ZA 4KQWA 4O02B 4JJ4A 5K8JB 4R05A 2GAAA 2NXCA 2SECE 4G26A 3HJFA 4P82A 1Y8QB 4LSGA 2HIHA 1V3QE 3K6JA 3FZNA 3LBIA 3Q8KA 3AHHA 5LB4A 1ZLYA 2CUTA 1CUIA 3P5SA 1T5LA 1KSJA 3PNVA 3AFMA 4ND4A 1IVSA 4IO1A 1QC5A 3ESCA 2J4DA 2WSYB 1TADA 4D4HA 2VYVD 3N05A 1OGYA 1W2GA 3MWDA 1K3UB 5JVDB 2QM8A 1HE2A 4PGMA 4CDMA 3FYCA 1KQ3A 2YN0A 4KXXA 1ZJ4A 4FN5A 3VDQA 4BX3A 4C2BA 4D3XA 3W5DA 4E1VA 3C5HA 1D1SA 2RONA 3VZCA 1JZQA 5IABA 3LT2A 2CC2A 3I01A 5HE8A 5J9FA 4MUNA 3M4JA 1Z0UA 3Q4GA 5K9ZA 1JECA 5F3WB 5A4AA 1R4ZA 1XEFA 2IXEA 1PR3A 1I5EA 1LW6E 1VYUA 4K8RB 5I7FA 3WGTA 4D26A 1O6BA 1JLHA 2P90A 4RY2A 3KEMA 1OX5A 1Z74A 1H94A 1WCV1 1JJIA 4OHWA 4DANA 1CZUA 3QF4B 4A7PA 5TGDA 2XJ4A 2PMFA 3L7JA 4EJ2A 4KREA 4OXXA 4OV6B 4LOIA 1BGVA 1MTZA 5THKA 3X1WA 4D46A 4JMLA 1K5HA 4O4HA 4N9QA 4YAFA 1CQZA 4U9UA 4ZREA 1E9SA 2XVYA 3GPIA 5GJVC 4AMVA 3E1KA 1H3EA 2E3JA 3HO6A 1SBQA 3IR5A 1J21A 3EEQA 1E1RA 3ETJA 2ZAIA 3QLJA 5D7BA 4TKVB 1CD5A 5LDGA 3RARA 3T7DA 1N9KA 4KYTA 1T4MA 4QGAA 1J99A 4GHWA 2VSNA 5AIBA 3WWPA 4INOA 5HOEA 2X0FA 3LECA 1XCMA 3AEQA 3K4HA 2Y1LA 1VHDA 5EZQA 1MO4A 2VKQA 1WDKA 4CDRA 3MJVA 2JF0A 1A77A 3ABIA 2H2DA 4GC9A 2DHCA 3IE0A 4N18A 5IAJA 4BCDA 4C01A 3O7WA 1UCFA 2AK2A 2DXIA 2Q62A 5FNZA 1NSTA 4MR7A 2CXOA 3W8FA 5A7FA 1A8HA 3VC1A 6PFKA 1KAOA 4I5EA 1ACMA 5JARA 1HNNA 1G5TA 2KW5A 5C7YA 4UC0A 5FULA 5JCOA 3ZLVA 3SX2A 3SQNA 1Z5WA 4LYDA 1L8QA 8ADHA 2PN1A 2QTNA 4XRRA 2YC2C 2ZE8A 1NUPA 5J1TB 4BNWA 5JMWA 1A9OA 2V7BA 3MWDB 4ZOLA 5J40A 5SYMA 2HU2A 3CWCA 3D7MA 3WGNA 2HWWA 1JIIA 3TFOA 2GILA 2ZI4A 4EG6A 4YPFA 3AUAA 2QUZA 5EP2A 3WLOA 5JJLA 2LGJA 2O19A 3E58A 4YMIA 5A04A 2AF4C 2CFCA 2JGKA 2QPAA 1JEDA 3KXKA 1DNPA 4RWZA 5FL7A 2O07A 5TEWA 5A4IS 1MC4A 1SRRA 2JAUA 3OO0A 4XKJA 3QG1A 2Q0XA 2W7TA 3VVBA 3AW8A 2E48A 2OBMA 2VPIA 2YOHA 3AL3A 3HJTA 1Y5MA 1KOGA 1ZR4A 2JFFA 4K88A 5EWMB 5LP1A 3BRWA 1TNDA 4MYSA 4AN4A 4HLQB 1CJTC 2A7QA 4QARA 2QD1A 4D8VA 1ORIA 2VPYA 3WOHA 1W0JA 4MAAA 1QG0A 4LHXA 4CT0A 2LWIA 5HRUA 1N2GA 1ZCJA 1JLLB 3A2LA 3DBLB 5A6SB 4KOAA 2BFWA 2C8LA 3EMKA 3V9PA 3ZDDA 1XVAA 3NKFA 3BGSA 3WLTA 4DJJA 4KZPA 1U11A 1D0VA 3MRTA 4PLYA 3WYGA 1H3FA 3VR4H 3DD1A 1TM5E 4I1RA 3BX1A 3W78A 1NU8A 1ONNA 1T8TA 2IL1A 4JUIA 4E2FA 4OHYA 2ATIA 2FPPB 4B3FX 1D2AA 1GL7A 1RU3A 5JVDA 5ESWA 2IZ1A 1HDGO 4RQAA 4YBZA 3L4EA 4C0SA 3AY7A 4IINA 1L8XA 3KJNA 3ZS8A 5HYVA 5IAGA 1SU6A 4DXDA 3MTIA 1A9RA 3AB7A 3LC7O 3HRHA 3LQYA 3PPXA 1XVTA 4AJJA 5C1OA 1EXWA 3SY8A 4UM9D 1XQXA 1AT1A 4RDHA 3GRRA 3RRZA 4EGQA 4O08A 4WZAA 4Y6LA 1A7JA 3RV3A 4GE3A 3AYXB 1SKYB 4G1VA 2FMFA 4DR2B 3ILXA 3LX6A 3MWFA 3AVYA 2B2CA 5DISB 5CDTA 2O8BB 2A30A 5A02A 4AS1A 1E2HA 4E88A 5C3MA 3QE9Y 2OTCA 4HJRA 1XTUA 2PANA 4BV3A 2FUKA 1WUKS 2OMKA 3EC7A 1BFUA 1Z5ZA 2G83A 5K6AA 2W4MA 4LUCA 4R7GA 4ZPXA 3BXPA 3C5CA 2ZT5A 4F2GA 4IXMA 4G65A 1S02A 3HS3A 3I6IA 4NYMQ 1FPMA 3TINA 3KELA 1ZSYA 2AKYA 3I83A 3P96A 4CJXA 1J09A 4LMPA 4UZFA 4ETWA 4ANFA 3QITA 2P62A 2WJGA 1KAMA 4N5MA 4PYNA 5DNWA 1HE5A 4BNXA 5IFKA 2WRZA 4GLBA 4V1CB 1H6BA 3H6HA 4CEIB 2PHZA 1XKXA 4WINA 4OMFG 2DSNA 3IO5A 4MQ5A 5A6VA 3S6JA 1A9SA 4I14A 3TFWA 3FG9A 4FHCA 2AG6A 3L0PA 5TC4A 1A5BB 2EHDA 5FOWA 4BFXA 3JYPA 1VCMA 3DB1A 4CMBA 4QAQA 3ZWDA 5EUQB 5FWXA 5EJEA 3CNLA 4YAKA 1J2UA 1C1XA 1UDCA 2EOAA 2X8JA 3BHIA 4PLFA 4I81A 4DA7A 3VH1A 1AK2A 3R09A 1P73A 2MYTA 1FU4A 3R0JA 3TW8B 4TZKA 3JZFA 3E7XA 2XCOA 4FOSA 1E2EA 3U62A 3N39C 1Y8CA 1KETA 5JVDF 3OZTA 3NHSA 1KQOA 2ALJA 1YKGA 4IOLA 5H1YA 1Z88A 3E6AA 3KJZA 4YJGB 3NDRA 2J8ZA 4ZJUA 3VFDA 3AP1A 3TJRA 3ZVLA 4UMFA 1BXKA 2NACA 5EIHA 4DTIA 3SQMA 4JQSA 4WE3A 5IMSA 3JSXA 3LRXA 4KNVA 1NUSA 4DQ0A 2N1MA 3S81A 2VUSA 1ORDA 1WLYA 3CV3A 4XGQA 5IW8A 4QFDA 1FFCA 4OLBA 1FTNA 5A3RA 4PQGA 4YVFA 1CETA 3SIWA 2JVJA 3FYSA 1NOKA 2ZE6A 4M1YA 4X1YB 1DC5A 3UT6A 4AUEA 3C8ZA 4EY4A 1I0ZA 2KLBA 5BVGA 4G2TA 1RQNA 4QGBA 4UE6A 3DJYA 5DSXA 3V1NA 1VYVA 4EO9A 1EFDN 1LQTA 2VUUA 4PZAA 6GPBA 1BU5A 4F56A 1W0KD 3I8XA 3TDKA 4DIKA 2X40A 5IZCC 4HH3C 2G5CA 3FZGA 4V0ME 2PZAA 4C0AC 3O4JA 3T9FA 3L6RA 4WX2B 4FJ1A 1T5HX 3RC2A 2BGTA 2FN8A 1DCFA 1FPQA 3K9FC 2XCSB 4LYFA 3R5TA 1KO5A 2OEPA 4TN1A 1EFCA 4JI4B 1JQDA 4E21A 3HGTA 1PSZA 2A0KA 1C3OB 2WA1A 4OJKA 4X71A 4L85A 4BGUA 3I2JA 1T25A 2RE8A 1TCVA 2UYHA 3G1WA 1Z8FA 2QSYA 4UZSA 3TOSA 2DTDA 3DQPA 1ENOA 4QFMA 1L5RA 1G8MA 4C1BA 3W5AA 2OV4A 1U3UA 1QYXA 1UMCA 2YXDA 3GLQA 4D4IA 1PE0A 3DPIA 3SJCA 1KFCB 1Z2EA 1I01A 2VYVA 3A1NA 3OETA 4G56A 3UB4A 5KTMA 5JALA 4S1TA 4C14A 4YREA 3H4TA 1C4XA 3CX8A 4BQSA 5KWEA 1ZC4A 3DOEA 3NWOA 4BLQA 4CR7A 1EFRD 1KI9A 2R7KA 4AYTA 4TLDA 1ZGJA 1GFSA 4U0KA 4WV3A 3E61A 5FUBA 4NBWA 4QT4A 3Q2OA 4F5WA 2XMGA 1KH3A 1WB9A 4ZQEA 2PMKA 1XMVA 2CL0X 2FFJA 2CKDA 3KOXA 5ER6A 3SHVA 5TSDA 1YQWA 4PONA 1QKIA 1PD0A 4PX5A 4R8KA 1JJVA 1EJ6A 3KFVA 1XZNA 5AI5A 3C74A 4DLKA 4IDGA 3KCNA 2P67A 5DW0A 3IUMA 4OUDA 2NMVA 1RHKA 2WTNA 4O4JB 1IAQA 2YKGA 3LM8A 2EQAA 2ACEA 4EB8A 4ZYVA 1FU8A 1JFFA 4MI3A 4BX8A 2VTVA 4AUNA 1Z36A 1SXJC 4WDRA 4TXJA 5B57C 1GZDA 2VXBA 2K4MA 4FILA 1GFWA 4CMEC 3AF5A 4L8WB 1IHYA 2FZLA 5AI4A 4ND3A 3WWZA 1LCIA 1SC4A 3QVWA 5REQA 2M6KA 1JVBA 2QI9C 1F0KA 1EG2A 1E3IA 2EZUA 2I1WA 3F96A 4P86A 2I2DA 4U2CA 4YK7A 4JYZA 1QG6A 4L9SA 2FGKA 4YMHA 3DHEA 2REXB 3P97A 5KYYA 3VSCA 4Y67A 2XT6A 3TL3A 4PTLA 5AK4A 4KITB 4KR2A 1M3SA 2FPKA 1VI6A 3EUAA 2FSGA 3NKLA 3DBRB 3C4VA 5I4BA 4MVJA 1G7RA 5F4BA 5HDQA 3TFQA 2HRBA 3P0JA 2WTMA 2XQFA 2AQIA 2B37A 2D06A 2VQ3A 3JQAA 2MYUA 3FOBA 1MW8X 1PWEA 4R3WA 5AW7A 4C2UA 3LCCA 2H1VA 4MVJD 3QPBA 1UZMA 3ONNA 4FFPA 4TQUS 2BGIA 1XALA 4EA8A 5I47A 3NGLA 4YMUA 1COWD 1QONA 1J9ZA 3T3OA 2EQBA 4O0MA 2PRSA 2PWZA 3TQSA 3TIFA 4E6PA 2Y76A 1B4DA 2XA9A 1FFAA 3DYBA 3KAKA 3PHCA 4N39A 3ZX4A 2OSVA 3IHLA 1JYFA 1NBHA 2CD7A 5F78A 3R24A 3URMA 2I6GA 4R8VA 4XM0A 2O2HA 4QJ5A 4GGMX 3KJFA 2ODQA 3TTSA 2CUNA 2P9EA 4CUJA 4L4SA 4K28A 3HVRA 1PJBA 3CRRA 2VCEA 5DNEA 2P9HA 2W58A 3EWNA 3WL4A 1JR6A 1WQ3A 1R12A 4IUDS 3WQRA 3AWIA 1RQ7A 1E4OA 3D8TA 1N7JA 2F7SA 3UK2A 2ZPUA 3K0HA 3TKYA 4L4ZA 4OPMA 4YP1A 4K40A 3TSZA 5D3KA 2XODA 1NAHA 3LWZA 3DTYA 5E6SA 4KCGA 1FX0B 4H4CA 4JJEA 5F33A 3OCUA 1DAFA 2NUPB 2ZAGA 5IPFA 2IY9A 2ASVA 2KJQA 2WZBA 1F48A 3OX1A 4FZ5A 1TYEB 2NTNA 1ZRMA 2VDJA 2NTEA 1H65A 2YV2A 3N0XA 1Z15A 2BEWB 4X6LA 3RFCA 3RKSA 3EUWA 4DEXA 2EV9A 2BR5A 2EP7A 5GWXA 1IHXA 4BHTA 2IS1A 3ANLA 3BWBA 1G7SA 2XDQB 4BQNA 3BHNA 4KXQA 4Z7QB 5G0WA 1A8UA 2HFKA 5AJTA 1DAOA 2JH8A 3W4JA 3VA7A 2NXNA 1D2CA 1JHMA 3BWEA 1Z26A 2BFDB 2YVAA 4JVNA 4LZNA 4B32A 1Z5OA 1KP9A 1GPBA 1RAEA 2EZ4A 3CO0S 1VI2A 1MN6A 1XZLA 1FY2A 4DB4A 4OQMA 4Z0TA 2Y1EA 4BO7A 4CDNA 4Z1MD 1XDSA 5ICMA 1PDVA 1YIOA 2R87A 1JLKA 1O6ZA 1SCUB 1SOVA 4RH1A 4EQ6A 2MMGA 3M89A 2P79A 4ZAGA 2NSLA 4B7ZA 2OB1A 2PGJA 1QCCA 3W5IA 4UBJA 5EC8A 1XZJA 2ETXA 6LDHA 4U9IS 5H4HA 4NONA 4BZWA 2B1RA 2F64A 3F4BA 1XUOA 4EI8A 3IB6A 5AM1A 4PZZA 2NXWA 3PE6A 3BGIA 3FX2A 1GZHB 1NR7A 3ZY6A 2VPZA 2BKLA 3QKUA 3ET4A 1H5QA 2ZU6A 3D6MA 1QWOA 1SZJG 3CMMA 4IOMA 4YASA 4C0WA 4DS3A 5I7WA 2HU7A 2PKQO 5BSGA 5LMCA 3L8GA 1RQXA 4R6WA 2C5EA 1H42A 2GKOA 4Y98A 3LX8A 4A2PA 1R0WA 3R0XA 4HN4B 4M3NA 4LFAB 1IUPA 1CC1S 1G8JA 5E9AA 1RP1A 4UVEA 3SK0A 4JWKA 2P6MA 2Q8NA 4MQFB 4BMCA 2NNLD 2OO5A 1JTVA 3SF8A 3G3EA 4KACA 3IQZA 5A71A 2FW1A 4RZXA 1G2IA 4CI0B 2XOXA 1J70A 1M2KA 2JIQA 2G7MC 4MVJH 3LHIA 3QU5A 4MVJG 4WESA 4BASA 1ADGA 2C5BA 3IJ5A 5EJ7A 3RYFA 2TMGA 3AI3A 1UWKA 4V02A 3PVSA 2PY6A 3V4SA 5DNUA 2HX1A 4RABA 1L2TA 5DM2A 3S3TA 4EI9A 3J80A 2PBRA 2REQB 2JLBA 4HX9A 1W87A 2YZMA 2WEKA 4KQ1A 4N3AA 4UCXA 4RFVA 4CM4B 3QJ5A 5AVZA 4Q00A 1TRKA 2WV9A 3GUYA 3FNIA 3AB3A 4MKHA 3AEZA 4BWFB 1FFBA 1MB0A 1J42A 4OQLA 3R0ZA 4UHHA 3ZVMA 4RVGA 1T9CA 1Z4OA 4FEGA 1D2NA 2XT0A 3T9DA 5KOJB 2ZYIA 4IH9A 1E3JA 3PHJA 5CGQB 3QPCA 2Z6QA 4OK5A 3RE1A 1AMUA 5CEEA 3VV3A 1I2DA 3EVGA 2PT6A 1IDN1 2NU6A 4FYPA 2JHAA 3KAPA 1B6RA 4YMVA 4Y0AA 2XBUA 1BMTA 2DBQA 1T35A 1T34A 3CH6A 4IW3B 1IEXA 1ZISA 3WL5A 1C14A 4RTRA 3WGIA 1YDFA 5HGJA 1J90A 4KPYA 3B2EA 5JT1A 2HY7A 1MEOA 1N9GB 3CS3A 1WUHS 3I5AA 4JEIA 4G5FA 5BV1A 3WC4A 4MUBA 3BCRA 2HA5A 2P40A 4L5AA 5C8YF 5JPDA 2GQ0A 3S8YA 4BBAA 2FX3A 4KVAA 4C0BA 1DQYA 2B4TO 1TKAA 1UM9B 2HWYA 3B6EA 4HDNB 3IXMA 4JSRA 4YNBA 3VTAA 1SU4A 1R3UA 4EF4A 2OCLA 1ZIOA 2CMKA 4AS3A 3ZDAA 3OZWA 4JJGA 1PEYA 5F5LA 3BCSA 2H7XA 2R8PA 4PSDA 1RNLA 1XDGA 2ZVDA 2XCRB 3GEEA 3SAJA 3CY6A 1PI3A 3IVGA 5A3QA 3FTQA 3K1YA 1E89A 4MIOA 2J9FB 3IV9A 3Q98A 4UFNA 4IKEA 1Y1TA 3AG5A 1MG0A 1XI2A 1SUEA 4DQVA 2QBYB 4A2CA 1KIAA 1KMNA 1SXJB 1MX9A 1US8B 3FI0A 4ZQCB 4M9QA 4LRWA 1DG1G 1A9XA 1JXQA 5DCLA 3BZUA 4BO3A 1OIXA 4LVCA 4J4HA 2OXCA 3IIKA 5TR9A 1ADJA 1SHTX 3DWFA 4P7JA 1RRKA 3FJOA 2C61A 1BZYA 4X7MA 5FIUA 3FF4A 1KZ4A 2VZEA 1HGXA 4EW6A 3TLKA 1OZAA 1F2UB 1B41A 2GZDA 4FLFA 3R0IA 4QASA 4YQEA 2FZVA 1SB9A 1T6YA 4Q16A 2ZXFA 4BVEA 2WWVD 2J41A 3LGSA 4L0QA 4RWEA 4LBYA 2PX8A 3ZJ5A 4QVGA 2CJWB 5K4GA 1WZUA 4OM8A 5IYZF 3REQB 2NW6A 2XV1A 5CHEA 1JR4A 2CJYA 2IIPA 4N0QA 2Q49A 1NN1A 3KNZA 1GA6A 2QLNA 3CZQA 2QQEA 5FL3A 3ZE6A 4GX1A 2AS0A 2ZZMA 2CJXA 2IXTA 1KGSA 4G0ZA 4L0DA 4REQA 1Z9BA 1ZNWA 2A1TR 4PBRA 4BNUA 4YI3A 2WPDA 5B30A 3U2QA 2SCUA 2C2WA 2R2GA 1P1BA 2VUTA 4LQCA 1RWKA 4UVIA 4O4JF 2AGVA 2E4YA 5FL7D 4CKWA 3P71T 3FWNA 1GQYA 3CWZA 3FBWA 2ZRHA 4KXVA 3ODGA 4ISCA 2V0CA 5F2NA 4RHCA 1H8HA 4JSTA 3O83A 4P84A 1N5RA 4HGYA 2PUEA 3DKIA 4ZK6A 2HWXA 3ON5A 1BMFD 1I30A 4DF3A 5DWDA 4C3ZA 3FOZA 3HACA 3QWIA 1GPUA 1TAQA 2EP8A 3WK6A 4OHZA 2AL7A 5FWNA 1Q83A 3GJ7A 4RXUA 5UKDA 1D0IA 1JN0A 5JFGA 1ODCA 4FYYA 2UUAB 2Q2OA 3OQIB 4JU9A 4L57A 2BKUA 1YI8A 3FMGA 4D4MA 4DPLA 5LOVB 4OBWA 3GQBB 1AF4A 1I7QB 2JBAA 4WJKB 2G36A 5TMDA 3AKDA 3QF4A 3NKVA 1F6BA 2Q4TA 2V4UA 1N6IA 3LDFA 3B8HA 4HB4A 4EQZA 1OA1A 1CYEA 1XTKA 2X1HA 3PFKA 4YMWA 1ZSVA 4GKVA 4B75A 1RXYA 4QO8A 1CUCA 4R9VA 4Y2SA 5E7JA 2VPTA 5CMLA 3AESB 4WECA 3C7KA 1G1MA 2C78A 4CFYA 4TZ0A 3OFSA 3G02A 1ZD5A 3N2NA 4IDCA 4FGSA 4LDJA 2GUWA 4AZWA 2JD0A 1DU4A 2VZ8A 3CX7A 4DLSA 4OHPA 2PKCA 2H85A 1L7XA 3F90A 1HFJA 1AQ6A 2WIGA 3U9LA 5A5DA 1C7ZA 1IY8A 2XZOA 1GNRA 4CQLB 1Y0BA 1VSQA 4FMCF 4PR3A 5E8RA 4KRXA 4BNNA 1QGZA 3M33A 3NTXA 3H8WA 3SVTA 4FEYA 2QD5A 2Z43A 3GVCA 4CU2A 4DBVO 2YJNA 2GNAA 4NICA 5E38A 3VH2A 1HNXB 2E37A 1AM4D 3AI2A 4KIUA 5KSYA 2YYYA 3ICCA 1NI5A 1UMBB 2WW8A 3EGDA 3LUAA 4I1UA 2R7MA 5IM4A 5KTRA 4KN5A 4IIJB 2PUAA 1XNJA 3E9EA 2PGLA 3M34A 5B1SA 4XJXA 3HZOA 3WK8A 2CT8A 4XCXA 1MH1A 4HN2A 3ME5A 2CDNA 1RQ2A 4JBGA 3DV9A 4HNQA 4C07A 2O1SA 4ENRA 1TIPA 1MA0A 1T8SA 4YJDA 4R68A 1BXRA 1T8UA 2YWFA 4W5WA 3L4BA 1F2UA 2HHLA 4KO4S 2W6MA 1XRMA 2RKWA 3OG9A 4KBYA 5KPJA 2VTBB 4BLOA 3GL9A 4HDOB 3FW1A 2PR2A 1R50A 1G4HA 3LK6A 2XCLA 4PSCA 1E1CB 1OXTA 4R6XA 4G8CA 2B8TA 5EJ2A 4ZT4A 4PQFA 1XCGB 4OUDB 5CW1A 2JLVA 2LNDA 3UJ3X 4X00A 3SHTA 1DAMA 1VL1A 3DL2A 1W35A 1FDOA 2Z2KA 2AFIB 5DTQA 1LDBA 3WX0A 4LZOA 3Q1KA 4Y8VA 1NY5A 1JS1X 1S8NA 2ODEA 5CPFA 5DBIA 5FV7A 4H7IA 5AVXA 4L4UA 5HK9A 1F12A 1T6ZA 5CDSA 2WWFA 1P2BA 3VUFA 1XPRA 2J5KA 4ZVLA 2J48A 2WDZA 2QTLA 3DE3X 5JAQA 3UTCA 3HLKA 2SKCA 4E33A 4MYCA 2VRNA 3Q9LA 4HNHA 1B1CA 2Q21A 4GDMA 3QLUC 5FDFA 2JFQA 1PR0A 3AL2A 1Q2XA 2FJUA 2FN3A 1ZK2A 2J46A 1TJ3A 1N5LA 2HUNA 1RS0A 3JWPA 2BZ1A 4I46A 2AOUA 4M2LA 5JWRA 2C5AA 1RAAA 4JVLA 1XA4A 1NTOA 1QG2A 4RY8A 4TKUB 4G36A 1ZQ9A 1IEQA 2WPNA 1LC3A 3DZHA 1P9LA 4C20A 4JASB 4R8RA 4UUNA 4A8TA 3TNLA 5KOIA 5JD6A 3THWA 4RJ2A 3CGWA 4BZXA 4UNIA 1PGOA 4IQ8A 3VAZA 2QVYX 2P75A 2JIOA 1MXHA 3CEMA 4GLJA 1KQNA 5CITA 4RF4A 4YCSA 4YCCA 4GYYA 1QTRA 3KVNA 1XEWX 3MCAA 4NLLA 4CU5A 4UXIA 4G5OA 1CUXA 2HFJA 3QIAA 2CVPA 1ML4A 2OT3B 4LOAA 2PH5A 4I4IA 1ZGZA 4HRYA 1FMJA 1N7IA 2VAPA 2XEXA 3WGZA 1IEWA 1WEHA 5E4YA 5D3ZA 3IXLA 5J2TF 4DCJA 1QQ5A 2A14A 1LPNA 4C05A 2WB4A 3FE2A 1VKRA 4QDUA 2AFVA 3NC0C 3W9UA 5CA1B 2YHBA 3JQ8A 3PHLA 4LF4B 4KR6A 3HADA 4E6EA 1L3CA 5JAIA 1RI4A 5E6SB 3O8BA 4DWWA 4HG2A 5K8UA 1EVJA 1QIHA 4WW0A 5A7HA 1V1MA 1XTVA 1W9MA 4DV5B 4H1HA 1L5ZA 4JLJA 2H08A 2H5IA 4A27A 4DDWA 4ZRDA 1XJCA 3WHPA 3FDXA 1IG3A 3R3SA 1BDIA 1D3AA 2WOJA 4BNMA 4MA5A 4J9VA 4D99A 1Q0TA 5ALFA 4OBEA 5CH5A 1XN4A 3DCJA 2PCJA 4FLEA 2HRCA 4J0JA 1WUYA 1YKSA 4WWHA 2XKAA 1J4AA 4BQOA 2ACVA 4V1CI 1EJBA 2DJ5A 1R8JA 1T3HA 3TCKA 3ZKWA 3KPYA 1OBOA 3EXG1 1LEHA 1F4LA 2FSVC 2I9PA 3GXOA 4BBZA 1NLZA 4PLPA 4CLHA 5C8VA 2GJ4A 1NP3A 3TR0A 2XZLA 3FFAA 4LJLA 2LTAA 4KPGA 4EG7A 2GN9A 3MHTA 1ETHA 4IJUA 1VRVA 3BXZA 2NU9A 4TZTA 2W6IA 1T8PA 2YW2A 1UKBA 2V0NA 5SZJA 3WRWA 2DLCX 1FSPA 2V6FA 4HUQA 2HEGA 1L4EA 1BNCA 1T2VA 1L6IA 3ZEAA 1M5TA 4J94A 3QU9A 5FFMA 2BFEB 1ND5A 4QO7A 4ZDIA 4R98A 4BNHA 1E1RD 3PQ4A 2QE6A 5B3JC 2UYCA 3T4EA 3C6BA 5B58C 3AIMA 4JLKA 3ULKA 4M0KA 3K8YA 2BOVA 3GUVA 2P4UA 3Q9NA 1UJNA 4BP9A 5FOUA 4FZVA 1QAQA 2HMYB 1ZCAA 4NXNB 2DOKA 1SOMA 1OREA 1MNQA 1YRWA 2INGX 2YV5A 1IBSA 1HL7A 3LG2A 2WZCA 3LY9A 4EVIA 1F60A 5KVVA 1C80A 1ZNYA 1T43A 5C46F 3CVUA 2XMCA 4LY9A 4EJSB 3FCCA 5D85A 2RHCA 3TW4A 1Z75A 3GG2A 3GW8A 4QYIB 1GNQA 2HL6A 2G09A 2PS0A 4YDRA 5DF1A 4CMAA 4NR0A 4LRYA 4YP9A 3OQOA 3V42A 4F12A 2IP1A 2DPYA 3BRSA 3IT0A 5HUHA 4RHYA 1Z2CA 1YZNA 2K6GA 5HVNA 1NG9A 1YFLA 1A69A 1O9HA 4HB0A 3PQDA 4PPYA 5KYUA 2F3QA 3LUJA 2HJVA 2VC2B 1IM5A 3FFXA 2JFUA 3QQ5A 3INGA 4RORA 3EIHA 4H2DA 3EARA 2VJOA 4HATA 2H07A 4GX5A 3S2ZA 4OX9B 1OI7A 4GPIB 3NTRA 2E89A 3SX4A 2QE7A 2QPOA 1DKNA 5SZIA 1B0AA 2C84A 2CWDA 2E4VA 4FBLA 5DBOA 3ZZ1A 3F4LA 1EFLA 3G2HA 4G1BA 2EGHA 1ODKA 4V0OA 4DV1B 1MORA 1LSUA 3THOA 3RVDA 2GSWA 2A7XA 4R2HA 4ZI5A 4E22A 3CZAA 2RIPA 3PNLA 2OL4A 1E3TA 2LE0A 4EF5A 3OZCA 3GA0A 1QKJA 1VJ1A 4LHVA 3F1KA 2QTWB 1PQYA 3VJMA 4FYMA 1YS1X 1JX6A 3UK6A 3WGLA 4D9KA 4WZBA 4N7JA 2LXNA 4HK4A 3ROXA 5HP4A 3P2IA 5CLIA 3AFHA 3EOBI 5CGZA 3F5QA 5EI5A 3O31A 3IAS1 4JYPA 5CFLA 2XMPA 3TOZA 1Q0SA 3I0NA 2P9FA 3ZWXA 4QJIA 3DAYA 3OU2A 3B52X 4JUFA 2J0UA 1WV0A 2ZM6B 2WMNB 1Z82A 4Q4HA 5G2OA 1LVUA 4QT0A 1VG1A 2FPRA 3ETCA 4BKMA 4W9RA 2HBYA 1UM9A 3OLYA 2C95A 4HDNA 5A5FA 3KQTA 1SUBA 1OFUX 4QLBA 1DIOB 1P4RA 621PA 1VZ3A 2PNFA 5A1TA 1R8SA 5LYJB 1O6GA 4OJNA 1SFRA 1U3FA 3GJ3A 1N8SA 1YGPA 1QJCA 2JFBA 3U3MA 3V55A 1AA6A 4KFCA 5AIAA 1WHTA 3HJHA 3VNSA 3OM0A 4CKBB 3F3SA 1DBVO 3BMNA 1EA7A 2LIVA 1XA0A 2XMSA 1AGXA 1OPXA 1XXHB 1EM6A 3FB4A 5AXAA 3VOTA 5DX8A 2VYNA 4YDSA 2ZBGA 4XVHA 3P52A 2P9BA 1UZNA 2BKAA 3D8HA 4I19A 3T7KA 4XQ9A 2NYVA 2E1PA 2SHKA 2V6MA 4FOLA 2ZG6A 4I36A 4K9MA 2R4QA 1ULAA 3QH4A 3K0SA 1O95D 2OCPA 2VWHA 1X7XB 1YR7A 3CUYA 4FQ5A 4Q9JA 3TTVA 1PR9A 1WU8A 3QFFA 1U7HA 1I4LD 1JBEA 1GAWA 3HEAA 2TMKA 3L04A 3U17A 4BQEA 4M53A 3BH6A 3F6BX 3TW0A 4HSGA 2F67A 1ZUHA 2QP4A 1EVYA 2GJ9A 4OJMX 2EBUA 4TRJA 5SZKB 5CYGA 1HT1E 1ISRA 1M0WA 4M0DA 1NLMA 2YYSA 1RWVA 3DE6X 1GFZA 1TF5A 3QE2A 4B47A 4YT5A 1G38A 1CP3A 2MINA 1CLUA 1ZYUA 1QPGA 3LKVA 1E20A 4IX1A 3HDVA 2QLTA 2O3TA 4OIFA 1CW2B 2QRUA 2QMEA 2E0IA 3IUSA 2IA5A 5BV2P 3PUXA 1BE0A 3QBTA 4RESA 2RGXA 4GIBA 3PIRA 1Y6JA 4UQPA 1JKFA 4EPXA 4EUHA 2A9VA 1TQ6A 3CLVA 3ZHZA 5JADA 1S1CA 3C70A 4ECAA 3O74A 1UAGA 4OX9Y 5AT1A 4C21A 1DMSA 5T4BA 1POWA 3OOYA 5JS6A 5IDWA 2A2ZA 5JHGB 1FUEA 1C8VB 1NYTA 4FI3C 1SOAA 4FR5A 4Q21A 1W36D 2OPHA 4F85A 1EJ0A 5C8YB 1RMYA 3Q0IA 4ZYZA 1V4VA 4XVUA 3RR2A 4WACA 1E7WA 2PVSA 4LF7B 2Q3BA 3T7TA 1XRQA 7REQA 2BMEA 2Q9UA 1VMKA 2Y1XA 4FC6A 3SP1A 5HIAA 3AKCA 3W7VA 1BW9A 5KDLA 2EFYA 2ODBA 3LUDA 3NXSA 3T1OA 3ZCPA 1P0PA 1OXMA 4Y1RB 1A98A 4AXXA 4AD8A 3EZ9A 4J0DA 5A4MS 3LNCA 2JK0A 4K05A 3TN7A 4NYMR 2WAYA 3FUWA 4QTZA 3OBBA 1Y7LA 3UT0A 1GCGA 3DS8A 2W4IA 3MLBA 1OLXA 2CVHA 3DLPX 3BILA 4OGWA 5KNLA 3KPWA 2GS9A 4QODA 2PZKA 4PZLA 1XZQA 4Q1DA 1WR8A 3W04A 2QWXA 2ZSAA 4YCNA 3TLCA 2X77A 4INJA 4XIGS 4DM7A 2I4OA 3I5XA 4L3WA 3O2QB 4REOA 1CVRA 2DQZA 3BZBA 4N5NA 2R4TA 2FP3A 1E6KA 3X2FA 2XXJA 1P29A 3GPDG 4ND6A 4OHMA 2UVPA 1J56A 1RRFA 4WBSA 3UGJA 2AWOA 1U7UA 5KHLB 1GQFA 1OXBB 2NUAA 5JDCC 4ODIA 1ZVJA 5HTOA 2I3BA 2I65A 1HTTA 1R6AA 3PX2A 2HCTA 2R6CA 2RBGA 4G0PA 5DP2A 4IGEA 1IJEA 2WF9A 1LVGA 3QVGB 5U1PA 3T3EA 1MJFA 3L41A 4O3MA 1QIJA 1A5SB 1S0UA 3A37A 4MVJF 4Y2JA 3LJKA 2V7XA 2B8EA 2ZIAA 3L6BA 4HAXA 4R69A 1GNSA 1E1DA 2W8BA 1VCHA 5HDBB 1PYGA 2HZ7A 1EH5A 2UYOA 2K7FA 1SUIA 3HB7A 1E9AA 3C41J 2CYCA 1JXMA 1V4BA 3LVRE 4M89A 4PLHA 3ZNNA 1DO2A 4HXFB 1HTWA 1QDLB 2QUAA 2XXBA 1E2QA 3TDNA 4F9EA 4PTZA 1G2PA 4V39A 1EP9A 2G63A 4E5NA 1P1RA 1VLVA 3FVWA 5ALYA 1SCBA 2VPPA 3REFA 4N7RA 4KXMA 4QU0A 2PSDA 1KL7A 3KR0A 4U3JB 1KERA 1N2ZA 1QBGA 1XR3A 4JVMA 3S2UA 3T35A 1JHDA 4OM7A 2PYZA 1N8KA 4IIXA 1QGUA 3UB3A 1EUCA 2I3ZA 1Q1AA 3SEQA 1CB0A 2RGWA 3D0QA 1E62A 3K20A 2CNLA 3LCMA 3OZBA 1F5NA 4LBWA 3BCHA 2IBTA 2V3VA 2A5JA 3IKLA 4RV4A 1IPHA 2H4FA 2PJUA 2QLLA 4DY4A 5LXTF 3D9QX 5KX5A 1T1EA 2C88A 4CKEA 1XTJA 1Z37A 3WNDA 2VP3A 3QKWA 4GRDA 2HJRA 3A6HA 4YRBA 3T1HB 1N2OA 2FEKA 2E18A 3RS3A 1K7FB 4Q66C 2X0RA 5EPEA 1UK9A 3BN3A 1NQXA 5L6MB 3BGWA 1E4YA 2P2SA 2JBHA 3KUKA 2SBTA 1DC7A 3LHFA 4H1UA 4K2HA 4C2AA 2YOFA 1HBJA 1Z6PA 3Q8XB 3M6UA 4TTTS 4LZWA 1BCRA 4PZ0A 5A62A 4JS0A 1O95C 2YY6A 3DKVA 2V8BA 3NPMA 2XRMA 1ZXBA 3QNMA 3GWGA 4FDAA 2BFAA 1JJFA 1WSBA 3GRPA 3ORYA 5HFNA 3UF0A 1FRNA 2GM3A 3H1GA 4HDMB 3C6ZA 3RCBA 5CLJA 4TVBA 4NBVA 7REQB 5LZ4A 2JVKA 5EE0A 5JUWA 1L4FA 2XWSA 2DB3A 2D1QA 4Z0HO 1WNTA 4TKUA 1WBDA 2CN1A 3MGKA 1USUA 2PBFA 4QPZA 1FRVA 3VKUA 2ZSHA 1J07A 3HJUA 3V3TA 4INPA 4LQDA 3GLIA 3RAEC 1XDUA 1V8ZA 2A0UA 1RJFA 3GJ8A 1YB4A 4FD2A 1F7VA 1XE3A 3D1LA 4JXJA 5JJ5A 3BCUA 4H4DA 1RXSA 3CFYA 3FIJA 4INZA 4V3CA 5I9NA 2AW5A 1EE9A 3JD2A 2AYYA 3EA0A 3KUCA 4CR8A 2CB0A 1PCXA 3A31A 1UJ2A 3UJBA 4G97A 2WU8A 2CMDA 3M1IA 3VHRA 4GI3A 1C9KA 1JDJA 1Z8DA 2Q2VA 1D09A 2QMQA 1TYCA 1Y8RA 2QN1A 1IOWA 1IRXA 2XTAA 2FUG6 1UC5B 2EU8A 3EH1A 3F9RA 4YGXB 2IF2A 5G3ZA 5KAPA 3CPJB 1Z0JA 4UMVA 5J63A 3TM4A 5JISA 3KAQA 1B1AA 1FDTA 1Z39A 4GKAA 3FKJA 3ZD9A 1YZYA 1DV1A 2H5EA 3EVZA 4KLZA 3VSAA 3ZUPA 4CG2A 1PNOA 4RKWA 5C1PA 2BONA 1NF3A 4MZDA 3CRMA 1UC8A 2AJCA 1C8LA 3A26A 2A35A 3DOUA 5CFMA 5FWDA 1IXRC 1W29A 5JCJA 3RT9A 4RTKA 1IN7A 1NI4A 1NWCA 4HLDA 3OE1A 1Q1QA 5DHQA 4F4DA 5IKOA 1WDTA 1HFKA 1TQ2A 1J2JA 2FU5C 2AOTB 2FR8A 2ID9A 5EMJA 4JP8A 2EF1A 2AUNA 4ZD6A 5PNTA 3SWWA 2O54A 4ZA2A 1C30A 3OOJA 3RGWS 1KJQA 4MVJE 2FUNB 4YI5A 2VYFA 5JANA 3BWYA 4LJSA 2WIBA 1XF1A 2PA0A 4DQDA 2ZR8A 4KC0A 4MULA 4RD1A 1B8PA 5TS2A 5JAPA 3ELBA 1MOSA 3EGEA 3VZQA 1KMIY 2A94A 2M6SA 3U1BA 4US1R 5JYEA 4MS4A 3SC6A 4I50B 2BFEA 4YRCA 1ZD8A 4OQ4A 4BVJA 5BUCA 1A9QA 2IXFA 2GZ3A 4R54A 4Z8YA 3H9QA 3IALA 1L0BA 3KV3O 5K0FA 1KK1A 2Q1TA 2BKVA 2WU1A 3VDNB 3LUBA 5K6RA 5IUNC 1OI3A 1K7EB 5EA2A 1KFEB 2KLHA 3DHYA 3ETNA 4EMUA 3ZBTA 8MHTA 4RTJA 2C4UA 5FOXA 1AB5A 3RU9A 5LKAA 2J3JA 2PCLA 2H6EA 4IUCS 3SHQA 2OD9A 4TZ6A 1V35A 1KZ7B 1XWIA 4EPVA 2B34A 2VK1A 1W5FA 4FGKA 3MD0A 1I3CA 3PITA 4BV9A 2QTBA 4EFDA 5EY5B 5K7SA 4S05A 2NZ2A 2VTDA 2W2XA 1HH4A 3SBXA 2O6HA 3VOAA 4D9IA 2PRZA 1C41A 3DW1X 3AR9A 3DP9A 3GYGA 3SIXA 3NTVA 5GM2A 4PNEA 3AWDA 2G76A 5DHTA 4B3BA 2GCPA 5JEDA 3STTA 1YJAA 1QU2A 4QPJC 5U4QA 2VF7A 3AVPA 2P1RA 5IJ9A 5BRNA 5BW8A 4F92B 5K4AA 4Q1BA 3TDMA 5LLDA 2HDOA 1XIVA 2XT9A 3K4QA 1FZTA 1P7CA 2Z3VA 4BN4A 4BO6A 4ENUA 1Z2DA 5C9ZA 1ECGA 1P17A 1P18A 3FPGA 4ZMSA 5CB0A 3MOIA 1B73A 1ZK1A 3C16C 2ZRAA 5JI3E 1C9NA 4G37A 3TRFA 1H2HA 3VYTB 4LHSA 1NUUA 5IDYA 3U6KA 2VTBA 1VE3A 4WCFA 2FGJA 3COJA 4P81A 1JPVA 2CLMB 4EHFA 2PU7A 3KXIA 1LNSA 2BI7A 4MGKR 4EJ6A 1I2MA 2Q3MA 1GP2A 3L18A 3L8YA 2Y71A 2QAGB 4RPGA 3G49A 3LIIA 1LTKA 1R8YA 5HMMA 1G8HA 3SXUB 2IPMA 4I50A 2HQOA 4WOJA 5FJJA 1E1MA 1C9EA 3MBIA 4GOJA 4HLUC 5L3ZA 1JLRA 2JLQA 2PD6A 3CF2A 3DWIA 5E9WA 4ZCPA 5TQ0A 3UWMA 1Z25A 4ZEVA 2BSQA 1ZU4A 1AG9A 1JYEA 2VQSA 3WISA 3U4DA 4C0QC 4UAGA 3T99A 3O1JC 2C04A 2HM7A 2RJNA 4DKXA 4GKKB 1SPBS 3I9JA 3HXOA 5KYWB 1STOA 2ZKIA 1X2EA 3KKNA 1AUXA 4QICA 1P62B 1Y89A 3D1VA 1G3MA 2N75A 1B8NA 2DZDA 1R8QA 2QMOA 1NIJA 5EPOA 1Q7GA 3VDXA 1GG2A 4FFLA 3S2YA 3IILA 4KL8S 3PQ6A 4L3OA 2VJQA 1U2DC 1PZXA 4JT9A 1BQEA 4ARCA 5DTRA 3SZRA 3CXUA 3ITNA 1M83A 3G2MA 1E79D 2EG5A 4KFUA 1XXHA 4LNUA 4PC1A 1QYCA 2NAPA 1J5XA 2QZZA 4KYVA 3KUDA 5KNBD 2Q50A 1SULA 3LE8A 4H7EA 1QZUA 1M1YA 1RFGE 1Y9ZA 1WULS 1YS6A 2VXYA 3MMXA 4L0MA 5AHRA 2DY1A 2EXXA 1MEJA 3F78A 3LT0A 1EK5A 4MS4B 3AJDA 1ORRA 5AKLA 4JZKA 2XVXA 1QYRA 4ZKDA 1NVBA 2GCGA 3JTMA 1N6LA 3KXLA 3T7AA 1IRIA 1Q6YA 4ZTZB 3BMOB 4RX1A 3O8DA 1EX7A 4KPEC 3KL4A 4UU0A 2NO1A 2C8VA 3AR5A 3QTTA 3UK7A 4Z7NB 2G8LA 4JLWA 5F3DA 1RWBA 1HNWB 1P1IA 3D8SA 2E6UX 3ITKA 3O03A 1X7HA 1KJ9A 1VHTA 1SHUX 5ILOA 4FSXA 4MDYA 5DCYA 3LO5A 4UJ3A 3JQGA 4YAJA 3TVTA 1O57A 3NWJA 1QGYA 1UANA 2X14A 2XA2A 1DBPA 3P2OA 1QTNA 4TKLA 4QPNA 3SXUA 3ASYA 3F3YA 3T9EA 5IU6A 3HB9A 4ZC1A 3HM9A 4YV0A 1GQOA 1L8LA 2EEPA 3P20A 2G07A 2QRMA 3NEPX 3OZUA 4D9NA 4N3GA 3LPMA 1Q7RA 4RVFA 1FFYA 1IM2A 4A0QA 1G20A 1GRNA 1VC2A 4NSNA 3EGXA 2C31A 1IN4A 3U0VA 2QNIA 4NH0A 5KQLA 3FWYA 2JLZA 3BB4A 4IEFB 3RS5A 2XWBF 1X8JA 2VSFA 1Z8NA 2JAHA 5IJ9B 2X1VA 4MUXA 2AOXA 2C5HA 2WJHA 2VNJA 2WWGA 1S3GA 1PV1A 1GRRA 4MLZA 4X0EA 4LJRA 2H3HA 2RI0A 3SZ3A 3CB4A 4RFLA 1JU3A 2ARKA 2B6NA 1FEZA 1B6TA 1ECLA 2RGNC 3O3NB 1UJ5A 1K88A 2FVXA 3KS9A 3V3KA 3ZIAD 3QFRA 2BZSA 4IJMA 4A10A 1SD1A 1LTQA 4F4IA 3S1AA 2CNBA 2YJZA 4LVOA 2NNWB 4FS3A 2XH8A 3WL7A 2A9JA 3GJXC 4TSFA 1JUDA 2GASA 2GN2A 3AK4A 5JCXA 3F6EX 2VJLA 3DFKA 1SBZA 2OCGA 2F00A 1Y9JA 3BWMA 6REQA 3O8CA 4R81A 4IV0A 1GPNA 1D2MA 5JS7A 2Z4RA 1EUDB 2IS2A 5E95A 5A7GA 4MX8A 2CLSA 1ECFA 2UZ4A 5CH3A 3ZCUA 4K87A 2Q5FA 1QP4A 1SQ5A 1PGJA 5E4JA 4FSDA 3ZDEA 4GW3A 1MX5A 1VMEA 2PH1A 2Z3ZA 4C7XA 3T1QA 5EHXA 4GP9A 4GXTA 4HEA1 1G6KA 2WUEA 1RJ9A 5ESXA 3ZDXB 3GLFE 3W9YA 2VATA 2IYWA 4BRSA 1QHIA 2VH1A 1M1YE 2BJWA 3C87A 3GP5A 4LDQA 4WXHA 2EBHX 1M74A 4NU0A 5B4TA 4RFSA 3VR4D 3FZYA 1GZ5A 5KOHA 1UPFA 4JL6A 2H1HA 3AEXA 5CIWA 2VIIA 5AVVA 1N4DA 2PSEA 3MMNA 4DFDA 3ZK7A 2R751 1SKMA 4MUKA 3U9SA 4E03A 1YDHA 3CINA 4MUMA 2PX3A 3MWJA 4B3CA 4B80A 5ALQA 1PNRA 4QDOA 3ZWBA 2BFBA 3PKIA 4FHFA 4AKTA 3O1HB 4CKYA 1QO0A 1JQJC 3ZYZA 5AVRA 2JD1A 2OBFA 4S3MA 4IKPA 2FDCA 2JFZA 2C00A 1IUNA 3EDOA 3R8CA 2B82A 3C8MA 1QZZA 2I91A 3EHDA 1AY0A 2HBZA 1V3VA 3SLKA 3JRXA 1TMYA 4OA8A 3WV4A 4HNSA 4S1NA 5J2TA 1J9EA 1HLGA 3F1LA 3WTCA 2ACWA 4GBJA 3HKBA 3RWBA 2C2YA 5M2QA 3GDGA 1LX7A 4TT3A 1ZUIA 1N78A 3FVVA 5F77A 4CV2A 2CKMA 4G5XA 1CIVA 4C0XA 3LC1O 4UM9B 4OU5A 4S1VA 2R6AA 1Z06A 4ZO9A 1U02A 2NU7A 2YY7A 1QRDA 1TVMA 3QVMA 1XFAA 2LCIA 4R1QA 5E6UA 1OAKA 4DRZA 2QZPA 4HC4A 4UPDA 4J8PA 5FADA 2Q27A 1O0SA 4WTOA 5ECDA 5DMHA 1LZKA 3NAQA 4RAQA 3IT3A 3O8QA 1OX4B 3FKQA 3UKDA 2PEZA 3W5SA 4EMTA 3BXXA 1AQYA 4HD8A 2XTMA 4NBNA 4WZBB 3M49A 2A88A 2WAAA 4Q4DA 3PLRA 1YH3A 5GONA 1QV9A 3S7TA 2X9GA 4ZZIA 4GU5A 4MYDA 2XTJA 2OC9A 1ZRHA 1N5KA 2ZT6A 3DMHA 1GVHA 1VDZA 3G9XA 3RU3A 1BVHA 1XHEA 2C8KA 2Z9DA 4YY3B 4D9FA 3KFXA 1EYZA 5P8WA 5I9IA 5C1DA 3ZDFA 3UMFA 2QUKA 3BMCA 2XQIA 2XUHA 5CVCA 5DW3A 4R16A 4QJ4A 1YZFA 4DCVA 2P0YA 4DL9A 2FLWA 3PUJA 1TJ5A 1RKVA 1SXJE 3I2YX 2Y2UA 4W7SA 1UM8A 3ONFA 2R00C 3M2TA 2B30A 2JCVA 2PX5A 1UJ6A 2QRNA 3ZE7A 3GLIE 2ZOSA 4O8ZA 3BK2A 2W11A 1CDOA 4Q3LA 2HREA 3DDZX 2OK8A 4LIPD 2Z56A 3LYUA 1FP4A 2DFDA 2JJMA 4BFTA 4DLWA 5TVKA 1W4BA 1JP7A 3ICWA 4BN0A 3MGAA 3E4DA 3QA3E 1AJEA 3JZIA 4BVBA 1JB9A 2OGWA 3OFVA 4XCQA 4AQDA 4AJNA 2Q9BA 2WY2D 3CLKA 4WXRA 3I2GA 3TQIA 4R71A 2I6XA 721PA 1Z2OX 2ZRPA 1VHLA 1MB2A 3RTAA 2KI5A 3DDSA 3HR8A 1PRYA 3RNOA 4JGBA 3S44A 1NYRA 5LLSA 2AZXA 2WG2A 1Q20A 4R1UA 3H11B 3F7MA 1JQ3A 1MJ5A 3MPUA 1YT5A 3WLEA 4PICA 1OT3A 3U5TA 2B1QA 3F49S 3I4CA 3TB6A 5KNDD 2C7OA 1M7HA 2QM7A 4B4UA 1O94D 3K5PA 3GFTA 1NM5C 4FXOA 4KN9S 2IE0A 2C3UA 4BAUA 2DUJA 5EJIA 2HTEA 4R1SA 3UGQA 2Q5IA 4DE5A 1UEJA 4JEUA 1QRAA 3OTWA 4PGAA 2JJYA 4V0NA 3L6UA 1WLSA 2NOAA 4P34A 3AP2A 4JYBA 3K9CA 1JI0A 1RHRA 3B85A 4NECA 4OVKA 4FCVA 4YJFB 5AJYA 2WHPA 4D9EA 3E9RA 4ZCLA 1FBNA 1LRJA 4FFMA 4IWYA 3NORA 5KHAA 5T8KC 1UXOA 3GFOA 4RVOA 4BO2A 4OHCA 2HT1A 1ST2A 1IL0A 3BBLA 1U8CB 1U0EA 2VA9A 3PIDA 1EWKA 3KEFA 2QT0A 4ZT3A 5KKCA 4WOKA 3QXCA 1T2EA 5FNVB 1KQPA 3R76A 3EWAA 5DO9A 4F93B 4ZODA 3BVPA 4M1WA 3ZW8A 3EIUA 1RE1A 5KVSA 1NUAA 3DTVB 3QUSA 3MWKA 4YAUA 4ZZ3A 4OOEA 4D74A 2XQVA 3JQ6A 4BECA 3NLLA 2EL7A 1NVMB 2EAUA 4DT1B 5DRTA 4YXWD 1UPXA 1X19A 3ZTYA 1KS2A 2O57A 3ZJTA 5CYOA 4GPZA 3AW9A 3GXBA 3ZXUB 1IY9A 4DV6B 2H5JA 1T4GA 2C2ZA 3GCDA 3OQ6A 4UZEA 5DFAA 4YLYA 5KTKA 3NAMA 5LN1A 2I7VA 2QVGA 4URUR 1ICEA 1DTEA 2MJLA 3WHIA 3JAMA 1OH6A 5M3BA 3GOQA 1O3YA 1EVZA 1EMDA 5BMVA 2A0XA 4Q4CA 1JWLA 4M36A 1GV0A 4TL8A 4QUAA 1KDYA 2GPWA 4BQQA 2Q6VA 1Y4UA 1N6NA 4JB3A 2ZYRA 4M1OA 4R0NA 3R9XB 4J1SA 3PGLA 4NBKA 5L3QB 1K6JA 2UVPB 1CFJA 1W4ZA 4WY5A 4FC7A 1G41A 4HZGA 2YZNA 1U0LA 2H16A 2W6JD 1XZGA 2GT1A 3NIFB 1FBTA 4LWPA 1ZWLA 1F3LA 1FP4B 3QVLA 4IDOA 3N7UA 2I2BA 3T3PB 4DJAA 3G0BA 1J8MF 1QK5A 1VLHA 4CMHA 4TLBA 3D5EA 3DLAA 5IUJC 4Z54A 1SM4A 2VHCA 2A0WA 4HKTA 2CLEB 4NVRA 1ZICA 1V5WA 2ODNA 1DQSA 5ALPA 5IRCD 3WL3A 1Z0KA 4J16A 3HB5X 4UCFA 4HNVA 1E2PA 1QXSA 1AZTA 3NHAA 3MTJA 2RHJA 4ZV7A 1SOUA 3A11A 4RCVA 2YQZA 3GRAA 3NR2A 1EK0A 5H70A 4JEMA 4QEZA 1Y80A 2LR0A 5HEKA 1BYUA 4X95A 3ZJUA 2HT6A 4F8EA 2HNBA 1W0KA 4JC8A 4NG5A 5IKMA 2Z4SA 1P44A 3R5SA 2V4MA 4M0UA 4MTLA 4AURA 5EJ5A 3DBVO 3OQNA 3KTOA 4YRMA 1WMDA 1EFRA 1C3XA 2PX2A 4ITRC 5DNCA 4IOJA 2OKCA 4EHKA 5DV9A 2JLCA 2Y67A 1UMKA 3CTMA 1IY1A 1LBSA 1I1HA 3ND7A 4K46A 4AQYB 4DMLA 3VYUB 3HN2A 2D54A 3EPKA 1OIVA 1B3BA 1Z6GA 4OSEA 2HJSA 4DBLC 1XJWA 2VNHA 4W99A 2K5UA 1I4EB 4ICIA 2MT9A 2JGDB 3UCXA 4YN3A 4GI2A 3QZUA 1H8EA 4RPHA 3FROA 4NATA 1R0BA 3E18A 3W5CA 1QFYA 4OK3A 4WVLA 2CZGA 2QD2A 3HYCA 5L7YA 2WUDA 1OWNA 2IUFA 3IPRA 3F98A 3M5DA 4C5BA 4DA9A 3AHJA 3LCVB 4C7OB 4B43A 1N1MA 1NN3A 3P0FA 1QKKA 4LECA 2AYZA 4ZOQI 4EABA 2IYTA 3W79A 1Z47A 1C9YA 1PGQA 1E5QA 4FZ3A 3W6UA 3FDFA 4OQDA 5CA0F 5CFRA 1TU3A 3PJFA 5CNJA 1E5DA 2IE8A 2R2AA 3L05A 2IUUA 3S55A 4BQPA 5KQGA 4LF9B 1X1RA 2NP6A 2O2JA 5CXXA 3VNQA 5ALKA 3I9OA 2VRBA 3MS4A 1BSVA 2XF2A 3QTBA 3BQNB 4MW6A 4RZSA 4W6QA 3SPXA 5FQOA 5FUYA 3T7CA 2FRDA 2YFQA 4ZEOA 4BLSA 3DUWA 2FUEA 2FPMA 3AIOA 4GPTA 4XB1A 4ZV4A 1DIBA 3HXQA 4UBMA 3EVDA 3IBCA 1U6IA 3G5TA 3N76A 5KPDA 2G72A 4ROSA 4XI9A 3TTXA 2OHXA 1X1QA 3INTA 5BOSB 2F59A 3PNSA 4DSNA 4B6SA 2CV2A 2B8WA 1ZNQO 1L5LA 1E2BA 1ONSA 1NUTA 2I1VB 3G2QA 1TK2A 2VJMA 5KVQA 3VAAA 5CFQA 5ITSA 1DADA 4MINA 4K5QA 5CDYA 4HNGA 2FEXA 1EU1A 1K7XB 1D8TA 3KBOA 4EUEA 4AJKA 4WFKA 1ILEA 5JXWA 3R9XA 2LD4A 2QAJA 1PL7A 3P9IA 4L1KA 3TECE 1RAHA 3K9HA 5BV8A 5DSTA 1VE7A 2UUCB 5F2OA 2NYAA 3I4FA 1QYVA 3HXLA 4MK4A 4RK6A 3EDYA 1I14A 3BHMA 1RPTA 3KZVA 4G5SA 4X93A 2H9IA 1DQRA 4Q6BA 2BEJA 3BL8A 3H3FA 3MIIA 4LCJA 1YBMA 1QH8A 3L0DA 4OQFA 3OJWA 2VOJA 5BR7A 2IYFA 4G0YA 1I1OA 2P9CA 1R0CA 4JX8A 4A6PA 2IH4A 1TTPB 3IQWA 4PFQA 1J0AA 5IAAA 3QJYA 1KYTA 3R6DA 4HWSA 4MWTA 1HZZC 2OBXA 4FEEA 3FPAA 2BGMA 3TLBA 1VBKA 4MRAA 1Q7EA 3C6QA 2IP4A 5HF6A 4EHAA 5BN3A 5HJEA 1V71A 1EUZA 2WAMA 3OX4A 3AKYA 4Q6WA 4ADSG 4B35A 3KSAC 1LFDB 4RQUA 3B3AA 1EQUA 1D6JA 1GVNB 3PRHA 5F1PA 4B9EA 3X43A 4WKNA 2CLDX 3R3WA 2AXPA 5T4EA 2Y77A 4MI1A 4QG3A 1OWPA 3I52A 1L4YA 5I7UA 3FWZA 4JL5A 3RG2A 6CHYA 1XBTA 2DTXA 2IU0A 1PU2A 2Q4DA 4FW8A 4F3CA 2VHQA 4IQGA 3T1YB 6REQB 3C48A 5ICFA 1YB2A 4EGAA 4ND5A 1ZNXA 1L7MA 1JQEA 5ALHA 5FV4A 1KJNA 5KB3A 2CHFA 4NOKA 1HY3A 1V39A 5BOSA 1T5IA 4IZHA 4U6NA 4M9RA 4EG5A 2YWDA 4BP1A 4DSUA 4K9QA 2FQQA 1I1QB 2VJMB 4HMQA 5CDHA 4D8XA 4P33A 4BGEA 3UM9A 5KDOA 2YXEA 3B89A 4OHBA 1J49A 1E60A 1FRQA 2ZSBA 4WXYB 3ZGNA 4C1NA 4EATA 4M0PA 3OEEA 1IHOA 3DZFA 5I8ZA 1FNCA 3ICVA 4BJ5A 4C4AA 1MO5A 3O1IC 4GEKA 4FE7A 2G4LA 1ZA2A 2IDJA 3FAZA 3GJ0A 5D5QA 4I1VA 2QVLA 4MHSA 1ICIA 5BN3B 1T9HA 3V1UA 4GOKA 1I5OA 2H2WA 4OIMA 1NQOA 7YASA 2IZ5A 2WHQA 3OA2A 4XLZA 1C7JA 2OFXA 2I2AA 2R8EA 3IPXA 4IJQA 1IZ7A 1IY2A 1ZDMA 3BTOA 1T5BA 1R88A 4I8DA 2CBXA 3R9KA 3WFZA 4QXQA 5IVHA 4IJ6A 1P0CA 2NSDA 1G21B 3CUEF 3B9PA 4LHWA 1BWSA 1GPJA 1YL5A 3LF1A 4FT2A 1F9AA 4KQ2A 3V9AA 3NDBB 1W4AA 4HP8A 2VAMA 4L76A 4PG7A 1XZHA 4PXAA 2J6IA 3VU9A 4FSHA 1RC8A 4FWIB 2YWJA 4J0CA 2WJ4A 2CD9A 5AJVB 4KQFA 1ARZA 4V1CA 3INNA 4WA8A 4HDKA 4P9NA 1VBNA 3RJ5A 4E09A 4Z6KA 4KOEC 3DWGA 2AEFA 1UT8A 2QDKA 3KQYA 3LUGA 3LQQA 5C1BA 2WHEA 5K03A 2VBGA 1IZZA 1OLOA 1V6SA 3PEWA 5F4ZA 1GKLA 2XDQA 4IKOA 2J5RA 3R8XA 3UMGA 2W48A 1FUYB 2OGUA 4KO3S 4UTRA 2HK6A 4IJWA 1KRHA 2J9GA 3HDHA 3HJAA 3HRKA 3IQXA 4KX5A 4LJ9A 2IYNA 3DTNA 1ZRSA 3I64A 4JLOA 4P35A 2BRUC 1Z3CA 1GPWB 1IIBA 1P0MA 1OH5A 4JMPA 3T95A 5IT9A 2Z1MA 3SFVA 3BXGA 1J8FA 3GFVA 1WBJB 4J3JA 1XZMA 4V0MA 1OTYA 2EKBA 3C4JA 3EA4A 2VHUA 3Q7TA 5ALMA 4MPTA 2J4CA 4UOEA 4N5LA 2EFHB 1N7HA 2AEEA 2ZRNA 3HUTA 4LTNA 1BXGB 4RELA 4ABYA 2I6QA 4WK0B 5AM2A 3KLBA 3RBXA 1FQWA 4HWKA 2FWIA 2HIMA 3Q0TA 4G1MB 3UZUA 4ACBA 1U7ZA 2I7XA 4A03A 3QHPA 3FOEC 3P4YA 2Z83A 3UMRA 1XVUA 2XUPA 4QIHA 1DS6A 4RSRA 3VVMA 4M1KA 1EBFA 3QOWA 4ND2A 4IXNA 1H8HD 4YMLA 1JA0A 1DIGA 3IDFA 2WG0A 4CEJA 2P9GA 2B6HA 2GD1O 1JIVA 3WMFA 1FRZA 1FFWA 1PYOA 2PUWA 3FUCA 4GOND 4D0SA 2PZEA 3O26A 3BIXA 1G59A 3CLHA 4XDHA 1R18A 1XD8A 3VYVA 3IBTA 2AVDA 2BDTA 1QDEA 1ISHA 1K6XA 3JVVA 1DXHA 2PXHA 4WKBA 2GK4A 2P2GA 1KEKA 3ZNQA 2F62A 3VU9B 2DPLA 1WX1A 2PZFA 1JQ5A 4TMVA 2OZKA 4X24A 3ZD7A 1M34E 1YUMA 2JKYA 4LJAA 2ZANA 2PGNA 3LBYA 1T36A 3V1YA 1VQ1A 1MJHA 2B8NA 3Q87B 3HYLA 3WIDA 2IZ6A 3G0OA 1ADFA 2JGNA 1Y3FE 4TWAA 3S29A 1M6EX 1UBSB 4QOJA 3P2EA 4FGWA 4ER7A 3HWRA 2E21A 3HNOA 4H9GA 4ZYYA 3LW8A 3ELUA 3SC4A 4L7VA 3DWEX 4P0TA 1TVKB 4WI1A 3OTOB 4H0FA 4M83A 2JLYA 1NC1A 3INYA 3K5IA 3BFJA 5EFZA 2HLHA 5TNXA 1KY4A 3VV2A 3WLSA 5BQXA 4O59O 3TBHA 2I6SA 2B9VA 1I3KA 1D5CA 1XCOA 4PV7A 4EIWA 3EJ6A 1DIHA 2DR0A 5FBWB 1S96A 5DWVA 3QOXA 1BC5A 1R5OA 1U7PA 3VHXB 4DSAA 3TL2A 4LE1A 4LY6A 4RL6A 3UHPA 3W6OA 5LUAA 5B3LA 1UP6A 4KRGA 2JC3A 2Z8ZA 5CNMA 2PS3A 3F7TA 4HGPA 3OM8A 4ZALA 4HAVA 4HDKB 4MPPA 1JEAA 4P93A 1QHFA 4CLRA 2F55A 1G21E 4KW7A 3TBFA 4RVDA 4A9AA 1UBGA 3GLHA 4ZGBA 2R0QC 3PNKA 2JGLA 4TKVA 1SHJA 1KO8A 1JPUA 4AKHA 1CQJB 2O1XA 4KR0A 4NPCA 4BXOB 2BYTA 4V03A 5AHKA 4BZZA 4K2AA 4Z3DA 2P9TA 1CV2A 4P58A 1PJ4A 4TVSA 3RYIB 3OTGA 1Z2AA 1THZA 2OZLA 4I99A 4MRSA 3T6KA 3NJ4A 3HVHA 4FFNA 4N48A 4KQXA 1UF9A 1AKWA 3VI4B 4ZO4A 2IYUA 4HZIA 4FYJA 4V0SA 2O0LA 3A4MA 3R77A 4K6CA 1RZRD 5ES4B 5J4HA 2XRZA 4JYCA 4B1FA 1VJGA 4K03A 1QIKA 1HL3A 3JARB 1KDZA 3WJ1A 2I3AA 4CF6A 2DCUA 5AW8A 2Y4OA 1KJZA 2F9LA 2X9VA 1EVLA 3CTPA 2BVNA 4W1SA 2Y8EA 4RVUA 4BO5A 4N7BA 3U3XA 4JB2A 3N2KB 4YQZA 3WO0A 2RHLA 4YJ2F 2BFOA 3WJAA 3WV5A 4YWHA 4DIOA 3THYB 1EE1A 1QH0A 2VYQA 4RCZA 2HF2A 2AG0A 4CL8A 1XP8A 5DYNA 3B7GA 3QI7A 1KZGB 1Q12A 1E5VA 4FGZA 4WZ6A 4CDGA 1AKQA 2Q8PA 1DOAA 5JV5A 3ZE1B 4JI0B 4DVJA 3OPQA 3QFSA 5KQRA 1JTEA 1L4HA 3FR7A 4I1YA 4XD7D 4B44A 2EYUA 1GRCA 4ZI7B 1YVPA 3SBOA 2CXQA 4LGMA 1LDYA 3F3MA 3FDZA 5BN4A 1JSCA 1SXQA 2J1LA 1M72A 4HWRA 2PL5A 1JRLA 4R0MA 3PC3A 1M2NA 3NWBA 3FGNA 5BSMA 4ALMA 4ENWA 4YRNA 4ZVRA 1B6SA 3H5NA 1ZFNA 5CEFA 4EYSA 5FEUA 1OB2A 4X45A 2QX6A 4PIVA 3TSCA 4B84A 1OHHD 5HQ3B 1H2RS 1NSFA 1SCIA 2MWMA 3KQWA 4DR1B 2ECOA 5GZ3A 2ZE5A 3W34A 3O0TA 3EGIA 2C1EA 2HXSA 4CETA 2Q0SA 4BWVA 3AY3A 3U4QA 4YCLA 4NMLA 4BVFA 4QBKA 4PE5B 3QEOA 1OFVA 1KDOA 5HFJA 1G3UA 1EXMA 1PR1A 1T2AA 2VJNA 4LCBA 5CUQA 3FSJX 1ZITA 3KHKA 4KRYA 4EFKA 1FW6A 3PUKA 2VBCA 5JS8A 2GARA 3KEOA 3E9YA 4W8OA 3N2GA 4EVRA 4TV8A 3GU3A 1ZMXA 1IN8A 3B1YA 1XLWA 1T9DA 4KYIB 4ZOBA 3ZBUA 4I4TF 1MAHA 2HQRA 4O4LA 2QVZX 2DTEA 4AF6A 3QX3A 1N32B 4LE0A 1AXGA 3BA1A 3IMKA 3NWEA 2C2HA 4XQCA 4GVLA 4HVCA 3QE0A 5HQTA 1RQGA 2XLCA 3WSVA 2WQ7A 1XPUA 2VP5A 4BMOB 5I6DA 3TUJC 4HDSB 1LLUA 4C7VA 4M1QA 2ABWA 2XUQA 1THGA 4KNYA 2QP3A 5HRCA 1SCAA 3DC7A 5IF3A 4QVKA 2DYKA 1F51E 1QAOA 3ZY5A 4G4GA 1U2QA 5JC8A 2AE1A 2R6HA 1XK6A 1QMGA 2FI1A 4IDDA 4F4CA 3DAOA 5KSWB 2JLAA 4EL0A 1QMPA 2CFRA 3L0ZA 3L7DA 2QRKA 3IHWA 3R3YA 4ERNA 4AN1A 4YIHA 3OZAA 2B7CA 4RQBA 3VAYA 4MWZA 3I58A 5EESA 1P0FA 1X2BA 1CR4A 4WNYA 5CDUA 4DPKA 2BMAA 3AEKB 4ZOLF 3A4VA 3BQMB 4IDQA 4K8OA 2ESRA 2VHTA 4JUBA 3JVDA 4NAUA 4E08A 2YFYA 1X1AA 3HKCB 4X61A 1T6NA 1IMOA 1XJQA 4XX0B 1E2GA 3AX6A 4Y2RA 3VH4A 4URHA 1KAQA 2POQX 4EG1A 1NOIA 3A7EA 4FFBA 1RI1A 3F6SA 1FFSA 2X8JB 4KAJA 5E1BA 2W6JA 1RYFA 2OHFA 3FTPA 1DAIA 1DJNA 2CYAA 4XUDA 1GGNA 4EY8A 5FRDA 3KUUA 3RYFB 2EG9A 1MOPA 5KBYA 3EZNA 2QP9X 1ZBDA 2I22A 4LZZA 1SKBA 3N2KA 4UDYX 2ZBUA 1LQUA 1FYVA 3DHVA 3G2NA 2X7JA 3ZLBA 5HF8A 2OYRA 1GD1O 3W5BA 4PHGA 1PJQA 1ZWKA 2PKXA 1MDBA 4CM4A 1PFVA 3IX7A 1G8GA 1LBQA 3DDNA 2WKQA 1O5IA 3UXHA 3VO8A 1GXSA 5KMGB 4BGDA 2PJRA 1QH8B 3LBAA 1IBRA 5K2MA 2QG9A 4MZXA 1PT6A 4PG6A 2QR3A 4CYMA 5KOJA 2G7ZA 4KFSA 4MGIR 3WLQA 1FSSA 4H3KB 2WU0A 3A36A 3CKMA 3HKEB 1Z2NX 4WN3A 4FQ8A 4UTOA 5G0UA 2NU6B 5ALWA 1AKUA 4MJ7A 3U7GA 3AO0B 2X1LA 1D6MA 2ZI9A 2ZULA 3U3DA 4COKA 2DWPA 5C34B 1OZHA 5H81A 4Z3KA 2HCFA 2QGNA 4FE3A 1KDVA 2FVYA 1N6KA 2DULA 3KKMA 2PIDA 4XIFA 4U7DA 5HUJA 3EBPA 2WDPA 3L7YA 5ETJA 5LU8A 3LUPA 1W5TA 5FTJA 4HB2A 1NR1A 4TTJA 2BCJQ 4L8LA 4KEAA 2VQDA 2DWUA 3SNKA 3ANMA 4ESOA 1N2HA 3LT5A 2Q1XA 4EYGA 1AKYA 2YS6A 3A1UA 2AC2A 2ZI7A 3IV6A 3QLUA 1TM3E 3STXA 2E7ZA 2IHYA 3PEUA 1HK7A 4XWGA 4EZEA 3RAFC 1RACA 4U7WA 3Q3JB 2Y9PB 3CT6A 1XTTA 2Q2WA 3L7IA 3GGDA 3MJCA 3Q40A 4AP6A 3UOAB 3C6XA 2HRRA 3PNBA 4L4YA 4BNLA 4CMGA 4QA9A 2GBPA 4HEQA 3WMRA 2OCBA 4EUNA 5ERGB 5LUBA 1H4TA 1P9WA 2X2PA 5K0TA 4DJDC 2HD4A 2Z98A 4TYQA 2WKWA 1ZKMA 3CLUD 3F5DA 4NFSA 4ZGWA 3GAFA 3RROA 1MT3A 4L73A 1E8NA 3FLMA 2MMCA 3RV4A 4PO3X 4CKCA 4LHZA 5K51A 4HRAA 4ZAWA 3UAOA 4OHFA 1EWTA 1JSRA 5BR4A 2BP7B 5IDXA 3LFHA 3TIIA 3LDGA 8LDHA 2YW9A 4U2FA 2QYOA 3A2KA 5I7HA 1R4AA 5LQDA 3OESA 1KQGA 1HE8B 2J3IA 3OQJA 5FAXA 1U99A 1Z4KA 4GL2A 5BOVA 4LEIA 2IH5A 1Z4PX 1Q21A 3ILHA 2Q46A 3A10A 3WB9A 3KR1A 1CUGA 3PWZA 4UNNA 5KU7A 1NGSA 2IS4A 3I28A 1U9ZA 4U7PB 2A5DA 2DKFA 2J87A 3NI2A 2JBWA 4AKEA 5T6MA 2RCYA 2MSCB 3BDAA 3AV0B 3V4LA 3VPCA 5ABPA 4G01B 5FBLB 2DP4E 3CSDA 4KQIA 4ZT7A 1OU0A 3DVLA 4HADA 4MYRA 2KQUA 2IW1A 2XWQA 4TYWA 2DHDA 1U2ZA 3AF0A 4ASUD 3PUIA 3IVAA 4A1FA 1GXSB 1S01A 1X92A 1PWHA 2DBZA 4OGFA 3ROKA 3ZHOA 5BV0A 5HF9A 3NPAA 3IOMA 1EIWA 3EUEA 1VRCA 1ZH4A 3Q7IA 1NKVA 4RHUA 5CM2Z 5DM4A 5DT9A 5AO9A 2O8BA 2I8AA 4OHVA 4Z4HA 3CEAA 1V2GA 4TV9A 5FFNA 3F9IA 3NUGA 1VMDA 2Y92A 5CA1F 1YCHA 1SIUA 4UXHA 4P4TA 3T7SA 3RFUA 4BKQA 1IXSB 4UBIA 4QVIA 3W90A 2ISQA 4B2PA 3VC2A 1TO6A 3ZWNA 1GU1A 2QUBA 3VQTA 4BGIA 5JOQA 3RSFA 4QYTA 2BR4A 1QOQB 2IHZA 3FIUA 4E7PA 1WXHA 3GG9A 1ZA1A 3FBGA 1F8FA 3C6MA 3O3CA 3P32A 1VOTA 4L15A 5D3QA 3O2SB 1UK7A 4RACA 3REGA 1Z7GA 5B1EA 1JQKA 1USKA 1Z6AA 2R6R1 3W2GA 4CEIA 1SCKA 1Z0DA 3P0RA 4UKDA 3UA3A 2DBYA 3LP6A 3O4FA 3EOAI 3ZGXA 3ZUGA 2W6ZA 5JXHA 3PGKA 5JEEA 2CGEA 4DSOA 4BVGA 5KYYB 2POCA 4H08A 2C4TA 2J9ZB 4RTMA 2ZUSA 4NQRA 4AJ1A 3I45A 1EGAA 1UBJS 1AUOA 1J20A 3BWDD 3LSYA 3A1FA 4E5KA 3R9WA 3ZNPA 4MWSA 1VIMA 2F3TA 1O8CA 2F9FA 4MV6A 2WLTA 2VNIA 3EFBA 2W2PA 1U2PA 1G9SA 1ZH8A 5JE8A 1G2OA 1NXXA 3CCCA 2ONKA 1MA3A 4HFJA 4A6EA 1ZJJA 5JY6A 4V0RA 4OJQA 1J5EB 4YUWA 4W1RA 1W30A 3R3XA 2Q6TA 5GJCA 1Z4IA 5AR1A 3H2ZA 2QVCA 5EERA 4BFVA 5BMVF 4IIGA 1XU9A 1VPWA 4PX2A 4C4PA 3ZDCA 2ZK7A 1BHJA 3QKTA 1MJGM 4OKIA 4G67A 3QENA 1CTQA 2JIRA 4IIVA 4MVJP 4F96A 1RJDA 2LIPA 1NVEA 2G80A 1ISSA 1TQ4A 2QJOA 4QUGA 4PO1A 4Q19A 3OFJA 1BX3A 2UYYA 1W48A 3SHFA 2GJKA 2B7LA 5JCOC 2FN4A 1D2GA 1T6BY 3RYHB 1QFJA 2RGCA 3H13A 4RLSA 2ASEA 4NS4A 3KQNA 1MABA 2GMWA 3NOVA 2X2FA 3N70A 3N8KA 3ZWYA 2XF8A 1Z08A 2EJBA 5EWLA 3L0IB 1W5AA 1O4VA 4WCVA 3DEYX 3HRIA 3X1DA 4DA0A 2NZXA 3LL4A 1GNPA 1SKQA 3M4YA 3NHJA 1CFZA 2WKPA 4J1QA 4J49A 2O52A 5B1HA 1U9JA 3I4LA 1B26A 4Q1EA 1T3LA 4POAA 3AEUA 3Q5DA 4MQEB 4B7CA 2LPMA 1SU8A 3RRMA 3TPCA 2P27A 4YQYA 3QEAZ 1VCOA 2WF7A 3E4CA 1MZVA 2YIJA 3FNFA 5ICGA 1OI2A 1L8AA 2C2KA 3AJEA 3CX3A 4J29A 3PDIB 5HFAA 4EHJA 4YP5A 2IV7A 3QNWA 3FYUC 5TPWA 4H7JA 1M2OA 2EF0A 2WU3A 3SF8B 3G9QA 5G02A 4RPCA 3ZWPA 2JH9A 1WEKA 5D6NA 3UANA 1DUSA 2AQHA 3BGOS 5EQJB 2VP4A 3NB0A 4OQPA 3X44A 3MB8A 4LKOA 4IIYA 3F8TA 4PU0A 4Y1EA 4YCDA 3RUEA 4DA6A 3IA2A 5FORA 2NN3C 4AQ7A 3C3XA 1MIOA 1H05A 4KGDA 4PTYA 3TMYA 3K0AB 2X3YA 4WY2A 2A0FA 2O7NA 2ZJ2A 4D4GA 3WNVA 1N6OA 4OJTA 4LDPA 2P8SA 2WNSA 1HYBA 4XSGA 2W2KB 1RCFA 4AY3A 3P45A 1GL3A 5IBPA 4UPEA 1M7BA 1TT5A 1NBAA 1XMJA 3A70A 3ZNOA 4O2BF 3SZOA 4MCIA 2D5IA 3T4UA 3S5JA 4ZI7F 3MTBA 3SFZA 3C3EA 5DGDA 4XSHA 1WPGA 3E7WA 1I2BA 1JT2A 1MEEA 1NE2A 2WFLA 2JGAA 3NIDB 4MR8A 4EP1A 1KF0A 3ODPA 1XMXA 4R9SA 2HHHB 4QULA 1NT2A 4XASA 1U5BB 1ZGHA 1RBMA 3IKJA 3L77A 4TRNA 4RY0A 5HQ3A 1DL5A 4EG4A 2ZIXA 1ZH0A 5IN5A 1UMCB 3I1JA 2E4AA 4NTZA 3RSQA 5E1OA 5F1OA 2VLIA 1TRHA 1S4MA 4D6YA 3U4QB 1QC5B 3VTFA 1E6LA 1JHQA 2IH2A 4JITA 4DQLA 1JWAB 1IQUA 3OEHD 2QXTA 2GDZA 1SZPA 1YV9A 5D87A 5HGXA 2GCEA 1JW9B 1U1CA 2D00A 2PUTA 1RWMA 5CAEA 3BTSA 3CNHA 3DMRA 1GRQA 3JSAA 3SR3A 4G9EA 4F9TA 1YQ9A 3P8ZA 3EDCA 4I6GA 2C5FA 1E9EA 3CZ5A 1Z13A 4IMIB 3VPBA 3C97A 4W7IA 1AA9A 2YS7A 1H2ZA 3H3XA 1ZXXA 1YZHA 2BFFB 4FYHA 4Q3KA 4JI6B 4YUYA 4A8JC 2X0KA 1CY7A 4UHFA 5HA5A 3SQWA 4W5RA 4EVSA 4GXNA 1GAXA 4L22A 3AVXA 4CG0A 4WNAA 2PH3A 2CNWA 5KEIA 3GD7A 2G1KA 1W49A 5CU7A 4B8ZA 4DQUA 3AVWA 5CT9A 5H80A 2X41A 1NAIA 4KVFA 3C3JA 3I12A 3M82A 1R27A 1FDIA 4OHUA 4QM6A 4R51A 1PS8A 1A8SA 2HSJA 2NV0A 3JTEA 2P9QA 2AZTA 3ORRA 3GMDA 1MD9A 1IB6A 3AVQA 1V7ZA 3VNRA 4JD5A 3JRNA 4KR3A 3JWGA 5LXTA 4HQRA 4D0RA 5CJPA 2BH2A 4G8DA 4P5PA 3DBHA 5CURA 3T5MA 4WKPA 1TYBE 2YXPX 1U3CA 3HYSA 1JU9A 4B5KA 3CMCO 1OFHA 4DNFA 2ZVJA 1VPLA 3KZ1E 2IP2A 5AW6A 1RYDA 3HFJA 1GQQA 4FBMA 3D0OA 3VKVA 4EHDA 1J8DA 5B58T 4AJIA 4PFSA 3T5CA 5L40A 1ZJWA 1CQPA 4DYHA 2FR0A 3MTEA 1R7RA 2OWEA 2QXYA 3JQDA 1CZNA 5I5GA