1AUOA

Carboxylesterase from pseudomonas fluorescens
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
MTEPLILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQAPTRPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKRTGIDASRIFLAGFSQGGAVVFHTAFINWQGPLGGVIALSTYAPTFGDELELSASQQRIPALCLHGQYDDVVQNAMGRSAFEHLKSRGVTVTWQEYPMGHEVLPQEIHDIGAWLAARLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of carboxylesterase from Pseudomonas fluorescens, an alpha/beta hydrolase with broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords CARBOXYLESTERASE
total genus 73
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 1997-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auoA00
1CUZA 2O2GA 1MN6A 4ZRDA 1OCEA 4W1QA 4BYMA 1L7RA 2WHQA 3H2KA 5C81A 4QA9A 4W1PA 5AO9A 1GKKA 2QMQA 4C6HA 1R1DA 2XQJA 3STVA 2HDWA 2XMGA 3OOSA 5ESRA 4P93A 3BF8A 1VA5A 2DSNA 3QPCA 5AI6A 2WUEA 4A23A 1IUOA 4IHAA 5AOBA 4MJ3A 5FXMA 2AJ8A 3I2GA 2XMDA 3DL4A 3KWFA 1A7UA 3M81A 1LPNA 1HBJA 4L72A 1XZGA 2Y6VA 4ZGBA 1WB4A 4L0CA 1EB9A 4K5QA 4TGLA 2G4LA 3U1TA 2OQIA 3TJMA 4EY8A 1VLQA 3ZLTA 4KE9A 2FX5A 5KWIA 4OYLA 1XRMA 2PSHA 3FLAA 2BAGA 1MAAA 1VE6A 3STYA 3C43A 1UOQA 1XRPA 2RI6A 2X5XA 3D59A 4OPMA 3O4HA 5JANA 2HADA 4U2EA 3WYNA 1CUJA 3F96A 5IVIA 5K3FA 3EQ7A 4DTCA 4MWSA 1XZIA 3D0KA 5T4HA 4HZGA 1PV1A 1W4LA 1P0IA 2WIKA 2PU5A 4GDMA 5AOCA 1IVYA 2J4CA 5ALNA 4Q3OA 4XX1A 1QTRA 5LKRA 5DLPA 2O7VA 1NU8A 4B9AA 3G8YA 4HS9A 4EUSA 4Y2RA 1D07A 1HDEA 1W6RA 1CVLA 3PDCA 3G9ZA 5AIBA 4GEGA 2Y2VA 5E4YA 2XQKA 3UMJA 1MO2A 5AK5A 3V1KA 3S8YA 2PSFA 5LZ9A 5EHQA 2BGRA 2JIDA 3C6XA 3QITA 1SCQA 2QM0A 1P0PA 4I3FA 1YS1X 5CH8A 1XRNA 1AGYA 5JAHA 3I2IA 2GYWA 3DYIA 2OCIA 1THTA 2OAEA 3F8SA 3SC2A 5AKIA 2XUPA 2QXUA 5LLSA 3AILA 1WCYA 2ECFA 2CB9A 3H18A 5JALA 2H1IA 2JF0A 1EI9A 2QR5A 2V96A 4BVKA 3GROA 3EBLA 2JGJA 1QE3A 4TVKA 2OGTA 2CMFA 4OSEA 1ISPA 1WPRA 5AKEA 1R9MA 5FP0A 4ZWNA 2XB6A 5ALSA 3W9UA 4UHEA 5BWBA 4LIPD 4B0OA 5K3FB 2BFNA 3FVRA 4TPKA 1ACLA 3FYUA 5ALLA 4PO3X 4UUQA 1VE7A 3OPMA 3H1AA 4Q82A 1K6EA 3QZUA 5AOAA 3LP5A 1YA4A 1LGYA 1VXRA 1O6FA 5FLKA 3WL5A 3HSSA 4Y7DA 1CR6A 5K5EA 4CCYB 5E2IA 2XUKA 2QS9A 1IZ8A 1N1MA 2EDAA 4PNZA 5KWJA 4UBMA 3QMWA 2VJCA 4X95A 2HA2A 5AK6A 5AKYA 3FCXA 3WK6A 4UBNA 3ESAA 4IH4A 4E11A 1QIKA 4DLNA 5AKGA 4B6GA 4QE3A 1QJ4A 1BU8A 1CUBA 4ARAA 1XZKA 5EFZA 1FSSA 3WIOA 1OILA 4W1RA 3DKRA 3BIXA 2HFKA 1FFCA 3CN9A 3EQ9A 4UBJA 3AUKA 1W52X 3V48A 5A2GA 4ETWA 1H2XA 4BTLA 1GZ7A 1J2EA 4HRYA 2WLSA 2XMZA 4J0HA 4DNQA 5JZ9A 1S8OA 5I8PA 3H2JA 2I03A 4Y2YA 3DL7A 2I3DA 5F4ZA 2PL5A 4LXIA 1GQSA 4B7ZA 2XDWA 2GBGA 4Y2SA 4AX4A 2O2IA 5ALZA 3STUA 3D2BA 2PBLA 2ZJFA 5DYWA 2H7CA 2AXEA 3QM1A 4BP8A 4O08A 2WG0A 5JD6A 1VZ2A 1FFBA 5AK4A 4B85A 3CXUA 2B20A 3G0IA 4HXGA 1YB7A 4J0GA 4MQLA 3E0XA 4AN0A 1WHTA 5FOQA 2Z3ZA 5LKAA 1YCDA 2W6CX 1EDBA 3O4JA 4GXNA 3AFIA 1WHSA 1XKLA 4QDTA 3BJMA 3A2NA 2OCGA 5ALVA 5BOVA 1BCRA 3RLIA 5AP9A 4G8CA 5DTJA 3F97A 4KJXA 3IURA 2WQZA 4CIBA 4IH1A 3FYUC 4FDMA 1BEEA 1CQWA 1YS2X 4WFJA 5AI4A 4JNCA 4BATA 4UBOA 2OGZA 5HKBA 4PQEA 1F0PA 5HFNA 4E15A 2I3ZA 1CUCA 4QWMA 1NU6A 3BJRA 2Z3WA 3WA7A 4BAZA 5DYYA 5CH3A 4X6YA 2C5FA 1UT6A 3HACA 4H7IA 3WKBA 4F60A 5FUMA 1XZHA 5FDFA 1SOMA 1ACJA 4JYPA 3W9BA 2DR0A 5JD5A 1YA8A 3R3WA 2XT0A 4FNGA 4UHHA 1EVQA 4L3WA 1MX5A 3FBWA 5AHXA 5D3ZA 5HQ3A 2JGEA 3E3AA 1QOZA 2QOEA 2YH2A 4KRXA 1JKMA 1CUXA 1J06A 4UBKA 5LZ2A 5JAPA 2HRQA 2WSLA 3WIBA 3IBTA 2AJDA 3I2JA 4DIUA 3L1IA 3C5VA 2QT9A 3FSGA 4X00A 1W75A 4DGQA 4FFWA 4MWTA 1XQYA 1GXSA 5ALWA 4LXHA 1CUIA 2XUGA 2Z8ZA 4X3CA 1A8QA 1EDDA 1TCAA 1MX9A 1U65A 2V97A 1JMYA 2ZJ6A 4PSDA 1WB5A 4AMYA 2HU5A 2VAXA 2I78A 3HRHA 2WG2A 4BBZA 1TCCA 2WG1A 3AJAA 1JI3A 1DU4A 5T4FA 2YXPX 4LYDA 4CIAA 2Q0XA 4S0XA 3EIOA 4DMHA 3F67A 1G42A 3I6YA 5K3CA 3HEAA 1QIHA 4CCYA 1UK8A 2ZYRA 4OU4A 2IX9A 3NOXA 4UFNA 3PFBA 5AKKA 2HRRA 3PF9A 4WDRA 4MYSA 3ESDA 3I1YA 2OQVA 2PSEA 1ZD4A 1XZBA 4NS4A 1J1IA 2ZYHA 4E46A 4P92A 4KAFA 1VA4A 1X70A 2EDCA 3RARA 3LLCA 2QJWA 4RGYA 3VISA 1G4HA 4KRYA 1DT3A 3I1IA 2WFLB 3WL8A 4G8BA 5HQ3B 5BV7A 1ZJ5A 5EHXA 4XWGA 2C0PA 2OXEA 4FBLA 4QDOA 2C5GA 4OB8A 4OD0A 5CW2A 2QKYA 4EBBA 4FHZA 4LKOA 4FLMA 3FCYA 1CUHA 3O95A 5ALHA 2JEZA 2QUBA 4AO6A 1EA5A 3W2TA 3I6ZA 1BE0A 3DD5A 5CT4A 5AM3A 2AJBA 1JJFA 1Q83A 2AJCA 3QMMA 2ACEA 2EEPA 3DYVA 5C8XA 2ONCA 2VEOA 5ALOA 4BVLA 4BVJA 4M0FA 3WYDA 4N8DA 1SCKA 5AK3A 5IKXA 3HLKA 1CUGA 2WIDA 2XUHA 4H18A 2OCKA 2IITA 3HC7A 4AQDA 1UK6A 2JEYA 3R3YA 1CRLA 2R11A 2H7XA 4IO0A 5AH0A 4Y2VA 4XIIA 1JMKC 3AZOA 5HZGA 1QIFA 3FYTA 4X6XA 3IVMA 3RKSA 1WB6A 5AM4A 5C8VA 1GPKA 4JH0A 4G4GA 1LPOA 1UOOA 2HA7A 3H1BA 1KU6A 4KE6A 1ZICA 3WLAA 3C87A 4U2FA 4U2CA 5IVDA 3DEAA 3O0DA 2XQGA 3WJ1A 1K63A 5AI8A 1XZFA 1H23A 1QIGA 3X3HA 1CLEA 4Q05A 3H0CA 2HA4A 1XQVA 3WA6A 2XMCA 2B4KA 2VQ6A 1MJ5A 3HXKA 4MQMA 5AICA 1XROA 3G9TA 4G1FA 3A2MA 1BS9A 1QO7A 2FJ0A 3NGMA 3W05A 4J0IA 1ZIXA 1QIMA 4KYVA 5ALFA 4OB7A 4EY6A 3BDVA 4RE6A 4UHDA 2CKMA 1O6GA 2XUIA 5JATA 1UKBA 5ALQA 3E1GA 1K4YA 3WK5A 1EB8A 4Y9SA 1CFJA 2CEKA 4FMPA 4UFOA 1LPMA 2HA5A 4PSCA 2ZYIA 4Z49A 2AJLI 1SCIA 3GFFA 1BN6A 4H7KA 4OCZA 1QONA 3WWOA 2WJ6A 3FOBA 3H04A 3W04A 4B0PA 2B61A 1EINA 3M82A 3M83A 4K6HA 1ZI8A 1ZJ4A 1JJIA 4C01A 1EK2A 4B84A 4BC1A 4QDZA 4UPDA 3OC0A 4P08A 4U2DA 3C6YA 4OB6A 3TEJA 3DNMA 1QIIA 5FPPA 1VKHA 4Y2JA 1MX1A 3FVTA 5D3KA 4K6GA 1LZKA 3SK0A 5LZ7A 1W76A 4CG2A 3B5EA 2XE4A 5HF6A 2HA3A 2HL6A 2XLCA 4C4XA 4CFSA 1UK9A 5A71A 1UFOA 2OPHA 4I19A 1KU0A 3LIPA 2ZVDA 4BZZA 4Y2UA 2GZSA 4X93A 1QGED 5EGNA 4Q3KA 5DNVA 1CV2A 2PUHA 1IUNA 1CUDA 4BDTA 3IUNA 3IUMA 4X91A 3HJUA 2GBIA 5ALXA 4CG1A 2QTBA 2WU4A 5HFAA 5EI5A 4AZ3A 1L7AA 1GPLA 5ALIA 2PVSA 2LIPA 4FOLA 5DNWA 2XMQA 2HA0A 1Y7HA 1DTEA 2HHAA 4H7DA 1K8QA 1R3DA 2BCEA 3G0BA 6YASA 1I6WA 1QZ3A 3WMRA 1AQLA 1ODCA 3ILSA 3MUOA 1EXWA 1R88A 3WK9A 4A16A 1ZGCA 3VVLA 2XUOA 2Y1KA 5DTIA 4X94A 1ZOIA 4FLFA 5J3JA 2RGUA 4MEAA 2X8BA 1DQYA 3SX4A 1MNQA 2DCMA 3VJMA 3ZPXA 5CRIA 3DOHA 5LIPA 2WUFA 1QFSA 1R4ZA 2FUKA 2QXTA 3KSRA 4ITVA 4BAGA 2DQYA 5T4EA 3I28A 2XQIA 4H7HA 1EDEA 4DMCA 4FTWA 1WM1A 2HU7A 1EK1A 4HXFB 4J0KA 3O9MA 1ZI6A 4DNOA 1Z68A 4CI9A 1CIJA 3KXPA 1RWQA 3GELA 1A88A 4GBGA 1A8UA 4Q34A 4ZXFA 5K3BA 3LS2A 5K3DA 4F0JA 1Y37A 2BGNA 4GLBA 1X2BA 3I6MA 5K3EA 2WFMA 3SWWA 2WILA 1ORVA 1EH5A 1P0MA 4P9NA 1XZJA 3B12A 1DX4A 3O9VA 5LZ5A 4Y2TA 3WWEA 4KE8A 2XUJA 4BB0A 3BF7A 4XVCA 3WL6A 1EHYA 2W22A 1UKCA 5CT6A 4DNFA 3V1MA 4M0MA 1MPXA 1LPAB 1E8DA 1USWA 4UBLA 5AJHA 5AM0A 1ZIYA 1FFAA 3VVMA 4D9JA 5DJ5A 4CG3A 1Q0ZA 2XMRA 5AKXA 1J07A 5H3HA 4JYMA 5EHNA 3GA7A 3N2ZB 1IZ7A 1DT5A 5JARA 4BAUA 3QPAA 5ALPA 1TK3A 3G9XA 5HKAA 2C4HA 1AC5A 4WDQA 3WI7A 2RIPA 5JAOA 4J0CA 4UHBA 2JGLA 1RYYA 5I9IA 4QDUA 1XZDA 3A70A 4KAAA 2J3DA 3BXPA 4H7EA 1XZCA 3VJLA 3MUNA 3F9CA 2XI4A 4M0EA 2HFJA 3A2LA 1H22A 4AO8A 4QWWA 4WCVA 3WWCA 1F6WA 1XLVA 2VTVA 5JASA 1VXOA 1CUEA 3QBJA 4N5IX 1YAHA 3GBSA 3LIIA 3BE8A 1P0QA 4KR0A 1NX9A 4RE5A 4WFIA 3WZLA 3DQZA 5I7UA 2OG1A 2WUDA 2ZSHA 3H2HA 2JGMA 4G9EA 5AM5A 4H35A 2ZJ7A 5JZSA 3N0TA 4HRXA 1N5MA 3C6ZA 4WY8A 4X7BA 3K9BA 1UXOA 1B41A 5AI0A 4W9RA 5IVKA 1E3QA 4BE9A 1G66A 4UFPA 1CUVA 4NZZA 4OUKX 2O7RA 1BN7A 4K2AA 1BROA 2BKLA 4JEIA 4C4YA 2DHDA 3H2GA 2PM8A 5JZBA 1ETHA 4G5XA 2H7YA 1F0NA 2QRUA 2WUGA 4HVTA 1H2WA 3DCNA 4NMWA 4Y2PA 3KOOA 2PUJA 3VJKA 4PF1A 3PI6A 1TQHA 4X71A 1IMJA 1UOPA 2HIHA 2XMBA 4IH9A 4QEKA 4OU5A 2PSJA 5A62A 4BRSA 1XRLA 3B3QA 3G9UA 2WKWA 4PV7A 4X92A 1CPYA 3TRDA 3STXA 2BUBA 2HM7A 2VSQA 3OURA 1YASA 1EX9A 1HQDA 3C5WP 5AM2A 1LLFA 1MNAA 4G4JA 3MVEA 1L7QA 5SYNA 1ZGBA 2WFZA 1LBTA 1YAJA 1EVEA 3R40A 4YX9A 3IUQA 4J3JA 5A7GA 1ZD3A 4UBIA 1U2EA 1YB6A 2WJ4A 3G0DA 1H2YA 4K6KA 3UUEA 1HLGA 4X97A 3FAKA 4W1SA 2JGKA 2XUQA 4BE4A 4FWBA 1C4XA 2VAVA 1Q84A 1UWCA 4HAIA 4CCWA 2XLBA 1QIEA 4AB1A 1YR2A 4W63A 1C7JA 3L1HA 3CN7A 2BUAA 5AI5A 4X85A 2GBFA 3G0GA 1MAHA 4DMKA 5A6VA 3C45A 5FRDA 5LZ4A 4RNCA 5JAUA 3ANTA 2VATA 4V2IA 3R3XA 5ALJA 1VJ5A 4WY5A 4U2GA 3WZMA 4DYHA 5CBKA 1CQZA 2ZSIA 3P2MA 5E4JA 2NW6A 2RAUA 2WU3A 3IUJA 4F21A 3FSGD 1XFDA 2GZRA 5K3AA 5DWDA 3S2ZA 4B9EA 2G5PA 3DLTA 2DQZA 3PF8A 3PFCA 4N8EA 5AKZA 3EF3A 5HCUA 3HYSA 5ALKA 5D7BA 1DWQA 3OM8A 2V9ZA 2RHWA 4G4IA 3R3ZA 3DKKA 1F8UA 4AXBA 4OYYA 1T4MA 3V1NA 3D2CA 2R8BA 4DM7A 3PE6A 5AKHA 1FJ2A 1Y7IA 2ZYSA 3BL8A 1TAHA 3TGLA 1X2EA 1YSCA 3PICA 2PKYX 5LP1A 3WJ2A 3ZLVA 1UK7A 3G7NA 3R3VA 4B81A 4U2BA 2VT7A 3G0CA 3JWEA 5KBYA 1U8EA 1H2ZA 2CJPA 3I2KA 3WKCA 3C8DA 3ANSA 3EQ8A 1QLWA 5EIHA 4FBMA 4MEBA 3D4LA 3IB3A 4GWLA 5AIAA 3U0VA 4EY4A 2XUFA 2GBCA 4Q1VA 3H19A 5ALUA 5JIBA 2QVBA 1MU0A 3ZV7A 1JU4A 1CUWA 1BCSA 3D3NA 5D6OA 2VT6A 3FLEA 5ALYA 4XJVA 5LZ8A 3AIKA 1AURA 1R9NA 1HPLA 1XKTA 3CCCA 3G02A 1R50A 1GPNA 5JADA 2X76A 3PUIA 3F98A 4GI1A 3STWA 1OXMA 4FFVA 2HA6A 4B82A 2Z8XA 3GZJA 1KEZA 4J0JA 5DNUA 3O4GA 1DX6A 4YK7A 4ZREA 5HF5A 3Q0TA 1XQXA 4IQ4A 1TIBA 2WFLA 3PUHA 5JYCA 2YASA 4EA6A 3IDAA 1MT3A 5ALGA 2Y6UA 4C87A 3YASA 2WIJA 2J3QA 5EHZA 3HABA 2PPLA 2D5LA 1ODTC 3VDXA 4Q3LA 3WQHA 2CZQA 5A7HA 1PJAA 3WKDA 1PFQA 2ORYA 3D7RA 3RM3A 1JT2A 4ZI5A 5C8ZA 1FFDA 1CUYA 1AKNA 4AZ0A 5T4BA 1XZLA 4UHFA 5CXXA 3L1JA 1QTIA 3HZOA 1E5TA 4N5HX 4N8SA 5HK9A 1DINA 3FLBA 5AM1A 5HF8A 4J7AA 2VJAA 1XQWA 1GGVA 2DHCA 1AUOA 1UKAA 2WIFA 5IVHA 2WIGA 2ACKA 3V9AA 3R41A 4RPCA 4H7JA 1DWPA 1XRQA 1U4NA 1AZWA 3AIMA 2G63A 3T52A 5CT9A 4YPVA 4X6UA 4J0DA 3WWPA 4WFKA 4Y2XA 5E4TA 5CH5A 4BCDA 2PX6A 1LBSA 4E14A 3M3DA 4G8DA 1LPPA 4FLEA 3JYHA 3I2FA 5DYTA 4B83A 2H9YA 5EIEA 5CT8A 2JBWA 3BIWA 2G5TA 4AO7A 2V98A 1ZD2P 4A5SA 4C88A 4BDSA 5AKLA 3E4DA 1C7IA 2J4FA 3OG9A 2Z5GA 3R0VA 2UZ0A 4HXEB 4EY5A 3KD2A 2GYUA 4F5ZA 5AKJA 1HL7A 4QZVA 3STTA 1E66A 1M33A 1XZEA 3D5EA 2GYVA 3O4IA 3C8HA 1CUUA 2XQFA 2JGIA 1THGA 3C70A 4PW0A 5YASA 3WK8A 3BDIA 2C0QA 3VXKA 4QLOA 5CURA 4LYEA 1W1IA 3RK4A 3ZLUA 1N5RA 4QDXA 3AZQA 2OGSA 2WHPB 4BZWA 3ED1A 3ESCA 4BC0A 1SFRA 5EIAA 3D2AA 5HK8A 3WK7A 1GQRA 1HKHA 4DMFA 3AINA 2WJ3A 4YASA 1N8SA 4KE7A 3CCBA 3VKFA 1ZD5A 4FKBA 5CTAA 3C6BA 3H17A 1GKLA 3NUZA 5ALRA 5FKJA 1WOMA 3MGAA 2PU7A 4LXGA 4EY7A 1QIJA 2K2QB 3IIIA 2ES4A 1JU3A 3QH4A 1TCBA 4GHWA 4NVRA 1UZAA 2Y2UA 4H0CA 3QVMA 1GT6A 4AN1A 5ALTA 3ICVA 3R3UA 1XZAA 2CBGA 4KACA 4DSZA 3WKEA 1QO9A 4PSUA 1Q0RA 3V1LA 5FV4A 2VJDA 1CUFA 4BRZA 3NWOA 1E8MA 5KREA 3JW8A 3QMVA 3ESBA 1XRRA 3ZI7A 1B6GA 1T2NA 3DOIA 2VJBA 1VOTA 3WK4A 4AMZA 1E89A 3FNBA 4HTAA 4LHEA 2VA9A 5FPQA 2VF2A 5LYYA 3HI4A 3I2HA 4BCCA 1RP1A 4EZIA 4I4CA 3DJYA 3WL7A 2E3JA 1IUPA 3W06A 1LNSA 1TKRA 4DNPA 2WHPA 2C7BA 2PSDA 4EB0A 2JGFA 2QZPA 1SC9A 3QYJA 3BWXA 4WJLA 2WM2A 3A6ZA 2RHTA 5JD4A 3LCRA 2RONA 2QJRA 5CXUA 2HU8A 1LPSA 2D0DA 1VZ3A 4ZV7A 1LZLA 5ISMA 4GECA 1LPBB 5CT5A 4H7FA 3IA2A 2FJPA 2BUCA 1JFRA 3ZWQA 1FFEA 1QFMA 4GW3A 2ROQA 2OAGA 4ROTA 4L9AA 4C89A 1ZI9A 3ICWA 2WTMA 4X90A 2CUTA 2OLEA 5HF9A 1G5FA 4KEAA 3AIOA 3K2IA 4B80A 3DS8A 4JUIA 3GUUA 1BEZA 1BRTA 2IIVA 5SYMA 4EHBA 4ARBA 2QUAA 4C4ZA 1CUSA 1DQZA 4H77A 1XLWA 3WKAA 4BTVA 1A8SA 1AMNA 3QPDA 1AX9A 4QNNA 5C7YA 3H2IA 1CUAA 4INZA 2XMSA 2B9VA 5BWCA 4QLAA 1ORWA 5ALDA 5ALEA 4BCBA 4MYDA 3OTQA 3FYUB 3KDAA 2DFPA 3AZPA 2XUDA 4UHCA 2C58A 5ALMA 1JJBA 1E8NA 3UUFA 2WHRA 1K5PA 4BP9A 4FNMA 1CEXA 4DSAA 3KWJA 2P8SA 2DHEA 1ODSA 1QIDA 2XUAA 3T4UA 4Y2QA 5A7FA 7YASA 5AI9A 3K6KA 3WWDA 2BJHA 4ZV9A 3DDUA 5CMLA 2OCLA 3Q8WA 2O2HA 1MTZA 1XLUA 3IULA 1WPXA 5IH7A 3FWHA 4MXDA 1XZMA 4J03A 2YYSA 4G9GA 4KAJA 2WTNA 1TRHA 1DWOA
chains in the Genus database with same CATH superfamily
1ESZA 2V0GA 4KVGA 1UPTA 2O2GA 2O2JA 4NEGA 5E9JA 5CLGA 2ODPA 1XN4A 2JFPA 2PA0A 2QPLA 3D7NA 3EGXB 3KXKA 1GL9B 2VNHA 1PTKA 2IZ7A 3JSAA 4NDAA 3RBXA 4KXWA 5IS2A 2C2XA 4PYJA 5FTKA 1GSAA 1IHYA 5JWOA 2JGDB 4N01A 3DPSA 5G0TA 1M2FA 2D7JA 1EFRA 1KY3A 1NAHA 3EY9A 5DHAA 4PYNA 4DQDA 3H2KA 1NOIA 3ISTA 4G0WA 4KTVE 4PGHA 3QBTA 4B3GA 3LOUA 5HRUA 3JYQA 4PHFA 2Q7OE 3K1AA 1ZSVA 4NU8X 1CX9B 1EVYA 5LM3A 1OXSC 1AN9A 1WE2A 5DI3A 1DAGA 1H2HA 3A4IA 3V6LA 4DC9A 4W8GA 3CUUA 3L7BA 1MGPA 3VR4A 4BFXA 3AHDA 4MPDA 4L8VA 3OZXA 3PJDA 4HSEA 2XQJA 3PNVA 1A2QA 3MGCA 1KDTA 2GEVA 2HDWA 3O83A 4S3MA 3RYFA 1Y3IA 2ZIGA 4O8ZA 2I6XA 5HJEA 2YJZA 1WO8A 3EXIA 1E77A 1V8BA 3G0OA 1RZ3A 3BCHA 1WXXA 2C99A 2W2KA 4GRDA 4IXNA 4RADA 3TLEA 1J6UA 1AK1A 1M7HA 1U11A 2XNKA 1MX3A 1YDMA 2E4UA 1F2UB 5ESRA 5F98A 1Z0DA 2DUWA 3QWAA 4JL5A 3WIEA 1IRXA 4HDRA 2SHKA 4X6LA 1LRKA 3FX2A 5CFPA 2YN2A 2JVJA 3C6KA 1R6DA 4ZRNA 5CYOA 4POOA 2I91A 2JS7A 2FMTA 4QGFA 3OWOA 2X0EA 4AJKA 5B5SA 3KZKA 3TECE 2WUEA 1L5ZA 1LSJA 1NZDA 2NAFA 2JGAA 3AQIA 3F2VA 1GPH1 1AS3A 2O50A 2QIPA 1DAKA 1YL5A 3WQRA 4HJRA 4MJ3A 4OAPA 2E6UX 2QMOA 1XTSA 4YLEA 3KWFA 1A97A 2DFLA 1WVMA 1TJ3A 1YTLA 3PIRA 2F48A 4HSGA 4KQ2A 1KP2A 1LDMA 1LPNA 1YUMA 2W48A 4QYXA 2R86A 1NBEA 3VZSA 1V8PA 3HKCA 1UBMS 1BS2A 1XZGA 3CEAA 5DW3A 1KEVA 2W4IA 4E5PA 5B7GA 3MCAA 3NEAA 4XR4A 1GSHA 5TMBA 1OV6A 3D9QX 3DTVD 3UG7A 3VR4D 4MVJP 1EB9A 4K5QA 1IN8A 2Z56A 2H2FA 3Q3IA 5B1IA 1XEFA 4DLWA 1U7WA 1U80A 1XHLA 3WNQA 2JFYA 1X8JA 1ZM7A 3MW8A 3U1TA 4Z9YA 2P3OA 1DEHA 1HORA 3NBQA 1VSTA 5JJBA 3PRHA 3DV0B 1AN0A 4GOKA 1JQDA 2WY2D 4II3A 3AUTA 5DBFA 3ZLTA 3KJQA 1PFVA 2FRXA 5B7NA 2CMDA 4KE9A 2ZWAA 1G2PA 2OV1A 5ECYA 1KHHA 5FLXA 1M9NA 2PSHA 5AW9A 4ZHQA 2I6TA 5CTJA 4B5KA 8ABPA 3MSXA 4Q24A 1VE6A 2BI4A 4QTUB 1PZGA 3SEZA 2OVFA 4DWJA 2QTRA 2CVQA 4H6VA 2RI6A 3OMXA 3T1YB 3AL2A 4JOSA 4QNMA 2VKTA 3EQ2A 1V7ZA 4BU1A 4OPMA 3NKLA 3O4HA 2XJ4A 3REFA 2CEAA 2OK7A 4R31A 2YXNA 5FA6A 5J2TF 5IC5A 2NO7A 4XM1A 5J9FA 1N7IA 2W6JA 3F96A 5K3FA 4EYSA 5C32A 2Z58A 4QUKA 3REQB 4JC0A 3MK31 1NMQA 2GO1A 4LZNA 4BP1A 3KU1A 5HBGA 1Y1SA 2Q1YA 3THYA 4LY0A 2Q8PA 4RKEA 1GRCA 4LRTB 3V2GA 4M9CA 4YLYA 4F45A 8ADHA 2ZSUA 4IX1A 4FB5A 2R84A 3N8DA 4GDMA 4I9NA 4HTFA 3AKEA 2ET6A 5I7WA 3Q88A 1K4MA 1RBMA 3G2NA 5ALNA 5KAPA 2NP6A 1IC6A 5LKRA 4W8HA 2FHSA 3P27A 2FWNA 2VWHA 4WD3A 2VTBA 1SD2A 2UXBB 3VOBA 4IOMA 4D45A 5K9ZA 4B9AA 3G8YA 4KWCA 2B78A 2VPXA 4EUSA 3THWA 3JYOA 1D07A 4YP7A 3S1AB 2O8BB 3S7ZA 4B3MB 3O47A 1VJDA 3P4YA 3U3OA 1JHMA 5DBHX 2DR3A 2FOIA 4J2TA 4LHSA 1DBWA 2DFVA 5E4YA 3IHWA 3Q3VA 2RGNA 3KE9A 2ISQA 4RKYA 2YQ4A 2YFYA 4WH0A 4J9UE 2P8JA 2VDWA 3HQ4O 3KLOA 2FMHA 4ER7A 1PJLA 5BR4A 1SKMA 3DA8A 2GPYA 3QFSA 1MT0A 1J8MF 1T8PA 5CUQA 2H1LA 3QFCA 4DV0B 1CXZA 4S24A 2PTGA 4L4XA 3U3RA 1RWBA 2RGAA 4YAWA 5CLFA 3OEEA 3BIFA 1Q1BA 2NM0A 3F9IA 1CS0A 3HJFA 3FNHA 3S2GA 3G8CA 3L0ZA 4I9FA 2A33A 1P0PA 1LJUA 1HRKA 3J7TA 1C4KA 4UE3S 2Y0DA 3UN1A 2DTEA 2Q3CA 3LYLA 1XRNA 3L8YA 3PRJA 2C78A 4HC4A 3AB3A 3O82A 1AGYA 5JAHA 5ITZB 3DYIA 4MV7A 3FSJX 2K7ZA 4AP9A 3H1GA 3D02A 1YJ8A 4EW3A 4JXJA 2CLIB 3M9LA 4N6NA 4OP3A 3WRWA 1TJYA 4RZ3A 2OD2A 2XTNA 3IBYA 4WNAA 4NFSA 3PTAA 3O5AA 5AKIA 5ES3A 3HJGA 1WUIS 2VRWA 3AQ4A 4IO1A 1P1HA 3W7VA 5BURA 5DLDA 1KMHA 3MMSA 1NSYA 2QXUA 3AK4A 3MTBA 1N2CB 3PUWA 5IMBA 3QVSA 4JOBA 4JXKA 4LCBA 4RDIA 4YVFA 3KLBA 2B35A 4EYQA 3Q3CA 3QGMA 1BFKA 1YHYA 1LXCA 3UXYA 1VPWA 1K06A 4C6TA 1PQYA 1Y9DA 2CB9A 5EMNA 3H18A 2JD1A 1QTNA 4BNDB 1U7DA 1GCAA 2BVNA 3SHVA 2YHIB 5JY6A 5B55A 1PQUA 4M98A 2V96A 3IO5A 3PPYA 1OWLA 1L7OA 4EP1A 4LJRA 3KYCB 3EBLA 3OZSA 3WLOA 2FZLA 4G24A 1TEZA 3KYBA 4R68A 1A9PA 4ZWNA 1T34A 1TM7E 4L78A 3LPMA 4GPEA 4C21A 3I72A 4EJ0A 4I2VA 4KQGA 5JECA 5JDIA 4UHEA 1JLLA 3OCYA 2OB1A 1Q7CA 4I2NA 2FW0A 1GCOA 1M5TA 4C3OB 1E7SA 4B0OA 3ITNA 3KOYA 1GZHB 3EOZA 4F9FA 3TTYA 3FVRA 1ACLA 4MPPA 4WZBE 5G1PA 2Q9CA 2PRIA 1D0SA 1H3FA 5ALLA 5KO2A 1TPYA 2AD5A 4DG8A 2DKNA 1HLPA 4QJ5A 1RHUA 1Y3CE 3DZDA 1ZS9A 3DBVO 3VSDA 3W8RA 2O05A 5FF9A 2XV1A 3OPMA 4IJVA 4HDQB 4BASA 3DKPA 2A4MA 1XTJA 1MV8A 1YHNA 4CKXA 5LIRA 2BE9A 5AOAA 2C84A 4O4LF 4RXTA 4BRWA 1WKBA 1O0SA 2R62A 3HYLA 3INYA 4MLCA 2QX6A 4XPIB 3OIUA 4OQDA 4TRNA 3VKVA 6REQA 1T9KA 3UMBA 2XD4A 3V6MA 2R65A 5KOJB 3QWBA 5LBUA 4DIEA 1P2GA 4OX9B 3WL5A 1ZAKA 1BHJA 4Y7DA 3PX7A 4B7UA 2Q99A 3KQHA 3AEUA 4JU8A 3OU7A 1KAOA 1AV7A 4ZPJA 1XAHA 4G37A 5DHUA 3GEBA 4DQLA 2QS9A 3HTXA 2QD2A 1N2GA 2JLCA 3NHLA 2NT3A 4PNZA 1UJBA 1PR2A 2OZLB 3T41A 4HVCA 4J1QA 2A0YA 1X1EA 2H63A 3HVUA 4UBMA 4OI1A 5FPKA 5TRTA 1R0CA 5F3DA 1U2PA 4KW7A 4CKEA 2D5IA 3EPKA 3HCAA 3IAEA 2O0LA 4RTSA 1SULA 3LQ1A 4RK6A 4HADA 1OWMA 4W5RA 1AF7A 3DL0A 3F90A 1OX4B 2D00A 5AK6A 3WLSA 3FCXA 1I3KA 3DMFA 3I62A 1RSZA 4JLBA 4DIOA 4U02A 5I7RA 2WV9A 3EIEA 3EMDA 3L2OB 1QDUA 1ZD8A 3IAM6 4IH4A 5CFNA 5SZJA 2YXEA 4I4IA 4QATA 1VMEA 2NT4A 3OJLA 1S5PA 2XZLA 3QLVC 3FPHA 3ISJA 4RZXA 3SC2B 2JAOA 1ZM3A 1RBYA 3KB1A 3KE8A 1P61B 1ZGZA 4NDNE 5AKGA 4B6GA 3MTJA 4LN1A 5E6SA 2KS6A 5IYZF 3ZNPA 3VZQA 4GX1A 4QTTB 3PSAA 3I6IA 3KZXA 1RCUA 2QTZA 4R98A 4C7BA 4DQKA 2AZMA 2WZBA 1E2IA 2H2IA 4ARAA 2V4MA 4XGKA 4XYGA 5EFZA 4HWTA 2MU1A 3EXHC 3MBKA 5HKOA 2JH3A 1FYEA 3U19A 1IY1A 4GT1A 5KOYA 1SHJA 1NVFA 5A02A 4DS3A 3L7OA 3DOEA 2XTZA 3P4XA 2XNHA 3T5TA 2HXYA 1G5HA 2WP8J 1E94E 3BIXA 2VP5A 1AMOA 1WP4A 1B43A 1O96B 5IAAA 3O4RA 3U3MA 3HMQA 4A7PA 1O9BA 2W2TA 1A04A 1NXVA 4UUOA 3VZPA 3MB5A 1W87A 4D99A 1OTYA 5TQ0A 2IH2A 1II8B 2ONKA 2Q5EA 1NMEA 3L0OA 3ZY3A 3FXAA 4MUYA 2W2XA 2ZBVA 2ZRQA 4WXHA 3GZTB 1KMNA 4AS2A 3B6IA 4TZ0A 1T3LA 1WCXA 3ZVLA 5A2GA 1QJCA 4LC9A 1MRZA 1SWVA 2PD4A 1KEUA 4ETWA 1H2XA 3K16A 1B4DA 2X4DA 4BO0A 4NG5A 5C4GB 3VYVA 1D6MA 1O7JA 1J1ZA 4HRYA 4F6CA 5JMPA 3C8ZA 4BQNA 2WLSA 2DETA 3G5MA 4RHXA 3AW9A 1OYYA 3CY6A 1JQKA 2FW6A 3PKJA 3QE3A 4TMZA 3SJ7A 1DO0A 1S8OA 2PVCA 2W0MA 1KYIA 5E1DA 2I03A 5JZ9A 3L1KA 1ID1A 3O3NB 4TKZA 4Y2YA 1E58A 4UNSA 1C0EA 2E5FA 2PH5A 2ZKLA 2P1RA 4PO8A 1XU7A 1NJ1A 1RAGA 2CCGA 1YFZA 2YTZA 2GFIA 5CP8A 4QSHA 1DUIA 2BR3A 3W1WA 4LXIA 2CGEA 1XCJA 1IAVA 4UDOA 4JVLA 1OE0A 1VL2A 4BV3A 3VJRA 4ZJPA 3BA1A 1NTRA 4ZT7A 3ELWA 1Z17A 3OPNA 4DL9A 1X1BA 2X9GA 3MTGA 3P0HA 4JJ6A 5DB4A 5CDYA 2BBSA 4TMKA 2I1LA 1H1LB 3ILVA 4BNYA 3CZPA 4R4JA 4QPZA 2AE2A 1WDWB 1D03A 2PBLA 4KGZA 4ASUD 4BFZA 4DMMA 5DYWA 2Z4RA 4KMSA 4BV2A 5CFQA 3QM1A 1LK7A 2GDJA 2HBYA 3OQ1A 4O08A 4RYLA 4BP8A 2FZGA 4D4LA 5JSFA 2CXOA 1PUXA 1R10A 2Z09A 3QU9A 4IM7A 1A5SB 4IWXA 4NE7A 3ZGOA 1AKEA 2ECKA 3A6KA 1EG7A 2C5BA 1H6AA 1XXHB 4KQMA 4ESHA 3IE0A 4AFNA 2ZYWX 2V74B 3A36A 4KVZA 1FSGA 2QVLA 1OYWA 2OYCA 2FDXA 3ON5A 5B3JC 4MQLA 4KWHA 2O20A 3HO1A 1UP7A 4AN0A 1WHTA 2X8WA 1LI4A 5KTSA 5I7SA 4XI9A 1RZUA 3AXTA 3I8OA 4HWSA 3A6EA 1KK2A 4TYNA 3P7MA 6GPBA 1W5SA 4QDTA 2I9PA 1N1DA 3FR7A 3SZOA 4Z3KA 4TQ9A 1XB2A 1I2AA 1MAUA 1QCCA 3C5CA 2RGXA 4CIWA 2GM5A 3E5NA 1QR6A 2YY7A 4GRAA 2AOUB 3GAMA 1V1MA 4ABYA 4HATA 2AFIA 3MT7A 1SWWA 1Z4JA 3NZEA 4XWYA 3IRUA 5BYKA 3IURA 3DEZA 4A03A 3AI7A 1H2EA 3M49A 4AF8A 1Q0TA 1LCIA 4HUQB 1E6KA 2Q2OA 3HUEA 1F20A 4LY3A 2WV7A 2NTVA 3AKYA 5U9CA 2JLZA 5L8VA 1K4KA 1T4GA 3LH5A 1OXKB 2YMLA 1ZEJA 3ZW7A 3BMXA 3CSSA 4PQRA 5D85A 2EKQA 2X58A 3GWZA 3WGTA 3L1UA 4AJNA 1L0BA 5CYGA 4I4TA 5EP2A 1ZHOA 2VK2A 4Y6SA 3VPSA 1PYGA 2X1HA 2NYAA 2RHLA 3BH6A 2VDMB 2OOSA 1Y5IA 1Q57A 2ZGVA 2ZRJA 3BRWD 1CQXA 1H1LA 2ZS7A 3IJRA 4Y6OA 2I3ZA 5ADHA 4UNNA 3JQAB 3RUCA 1E9RA 1V5WA 1R16A 1VB5A 3DZGA 1NRWA 1Y3AA 2GZMA 4BYGA 1UPFA 1O97D 4EENA 3HBAA 1VMKA 3PP8A 4J76A 3BJRA 4IINA 3D3WA 3OAAA 2TMDA 2AFHA 1BWSA 3T3DA 3QF4B 5JSUA 4EEKA 1M6HA 2HQRA 4JI2B 1P9NA 3ICOA 2O19A 2ZM5A 2VYVD 2PNJA 4CV3A 1UT6A 2XSZA 3FPKA 1GGKA 1TTTA 4L9RA 1OFUA 3WKBA 4F60A 1XQ9A 1XZHA 2Q07A 3OA0A 4DIKA 5IZCC 2FPOA 4AUEA 1MJHA 4HP8A 5EZYF 4Z1MD 1ACJA 4QFMA 5KQLA 3W9BA 1KK3A 5JD5A 1TO6A 3K31A 4GI3A 1VHJA 5H4GA 1KTIA 1PJBA 2V7UA 2WAOA 2EP7A 2XT0A 3AUYA 4FNGA 3DAPA 2JIOA 4RM3A 4TWIA 3C85A 5EWMA 5FI3A 1KQGA 1CJUC 2Y93A 1XTUA 2C8JA 2IEDA 1H2RS 3FBWA 4IOLA 1M1NA 4Y1RB 3E2PA 1Z2PX 2QOEA 4JI7B 3QE4A 1ZCBA 1JKMA 2GN6A 2XJ9A 3KTAA 3NC4A 4TQAA 3ZQ4A 1RC0A 4DSOA 3BD9A 1MMFB 4JP2A 1S2OA 2QRQA 4M22A 1F7VA 1V3VA 1ENYA 2OV2A 5JAZA 2XYVA 3H2YA 2CHVA 4UNPA 1E20A 1NXWA 3A11A 4HUQA 2BT4A 2YOFA 4DIUA 1HMYA 2V6BA 5TPZA 3C5VA 2OHFA 3B9RA 3JVEA 4NFLA 1W75A 4TZKA 1QG2A 3E8SA 1XBTA 2H9IA 4GQBA 3BS4A 4KIFA 4M76B 3SM3A 1CZNA 4O63O 3T35A 2DFNA 1XTRA 4FFWA 2IYYA 4Y7CA 1NVGA 2X0JA 1EBBA 2ZW9A 2QSYA 3FMIA 3WDMA 3RADC 3P9KA 1XPRA 1YB5A 4LXHA 3T5CA 2XUGA 3ZUPA 2WYVA 2XOKA 4BWVA 4TLLB 1M2KA 1NBMD 2CCJA 4X3CA 5IF9A 3MINA 2WJJA 2WVHA 4RKRA 1FIUA 1XNQB 4F3NA 1GDHA 3LZCA 2A9QA 1Z6GA 3BWVA 3KKOA 3P9XA 2V97A 1CRQA 4Z86A 1WB5A 4LK3A 3NFRA 1YR6A 4CMIA 5KS2A 3TRHA 1D0VA 1ODJA 1HKUA 2VAXA 3QI7A 2AEMA 1HT0A 4UD6A 2XDQB 1WD5A 4WW0A 3DHWC 4LTDA 3H83A 2AFHB 4FS8A 1ADYA 2HLPA 4V3BA 2GEUA 4D3FA 2NUTA 3A1SA 2PKEA 1YS9A 1M54A 1FYFA 3D3QA 4MR8B 1BXZA 2AN4A 4TT3D 5DM0A 4BBZA 4EX7A 8AT1A 2KW5A 5AXAA 3K9NA 1QKJA 3WGHA 3AJAA 2EBFX 3DE2X 2KBEA 1JI3A 5T4FA 5LU8A 4W5NA 5YASA 1G6Q1 3HKCB 2Q0XA 2BTQB 4S0XA 2CXTA 3RS2A 2P5YA 5EPOA 4DMHA 3AJRA 3RQIA 1XMOB 4P7KA 2O59A 4KODA 3NBUA 1NNSA 2BEVB 1JP7A 3RO7A 3VBCA 2IYSA 2C1EA 3ZHXA 3Q3JB 2JVIA 3KQTA 3UMRA 3NLLA 1RJ9B 1HE4A 1V37A 1YOBA 4FDVA 4NQRA 3ZGNA 2JK1A 2XODA 3VSBA 3BB1A 1O08A 4CCYA 5ITWA 3PIIA 3HB4X 2D5BA 1TCVA 4JU9A 4KHZA 2DLNA 3O0TA 4P4LA 1CP2A 5GJBA 1UH5A 2GF9A 1TKCA 2WPNA 3A14A 2GRUA 3PFBA 4LWOA 1P29A 3TSYA 4YCLA 2BFWA 2ZB4A 1HTBA 3PF9A 2B1IA 3Q2OA 1NQWA 1NGSA 3PLNA 4MYSA 2NWQA 3T7SA 2WK1A 2JJMA 4B3JA 2NLOA 3BJEA 3F71A 3BEDA 4G0QA 3R5SA 2R2GA 3UIEA 1QVZA 3FKSA 2O3UA 3Q5DA 1E96A 4DCMA 4KKXB 4NHEA 2HEGA 2QLBA 1Q1GA 2OLKA 3IAS1 5ESDA 2Y27A 2EDCA 3RARA 1UBHS 1E69A 2HNBA 5LQKA 1VSVA 4CTNA 4FYMA 2Z2KA 4MWEA 3TH5A 5CXQA 1RFGE 2SCUB 3I3SR 2F64A 2Q9UA 1K27A 3RUAA 5A0VA 4G8BA 4A6DA 3VBEA 2QSZA 1MG0A 4EJMA 2EZUA 5JFTA 3N74A 1JLKA 3BTSA 3L0YA 1Q7EA 3N0XA 4O6VA 3P26A 2QLTA 3D7MA 3JQFA 3V2HA 1S2MA 2R6AA 1G7TA 4L6IA 1AZTA 3GLFA 1TZMA 2FOLA 3N2IA 3G2IA 4MVYA 3ZQ6A 1KWGA 2RIRA 3N2KA 3ZBPA 5CW2A 2X2OA 3DUFA 3EEFA 1OJ7A 3Q3EA 2DBZA 3THSA 1EFUA 4X54A 1GADO 5TSDA 1H9AA 2CL7X 3AY3A 3NRBA 4L9WA 1XVUA 3KZ1E 4N3BA 2YUIA 1FLVA 3O95A 5ED4A 2PA3A 4W9NC 1DAPA 1YFKA 2ZR8A 3O03A 4AWXA 4AUMA 2O8NA 2PLNA 3ER6A 3R6GA 3T7RA 4NAUA 3AI2A 1C9NA 4FNOA 1BE0A 3FG9A 5CT4A 4D9KA 1T2VA 3ZJVA 3GJZA 1MORA 3NX4A 2Q3EA 1Z8NA 2EEPA 4D57A 1M2NA 3NUQA 1DGQA 4N76A 3DW3X 5ENZA 2QW1A 2BM9A 2ZAMA 2Y67A 1WSWA 2OHIA 3T1TA 1KPIA 3BD7A 3DAFA 2WDZA 2C8LA 2JD2A 2HCBA 2O0MA 3L5KA 3WY9A 4KQHA 5IKXA 4JUFA 3ZCRA 2VDRB 3HLKA 4WQMA 1CCWA 4A0SA 2WIDA 4KP7A 2W6MA 4WLEA 3W7AA 3FFTA 5GVRA 3PEWA 3HGQA 1V8OA 3PGVA 1NM5C 3R0ZA 3RVKA 2NPFA 3BTOA 2AW5A 3AH8A 2D2FA 2RHRA 4OOFA 2Q1TA 3CW8X 3R6TA 5C8DA 3TQFA 2BGLA 2FKAA 1P5RA 4FVTA 4PIPA 5A2QA 1TRKA 3AM1A 2VK1A 4Q4HA 4FOSA 2JEYA 4MIKA 3RREA 3PPIA 1Z88A 4XSGA 4WCFB 2WB2A 1XPOA 3R3YA 4CTMA 4AY5A 2DUNA 1NBWB 2NXWA 4AJ9A 2BEKA 1RRFA 3SNHA 3WJAA 2W00A 5L45A 3JAWA 1U2RA 2VSXA 4HKTA 1AKUA 3MIIA 4OJNA 1L3BA 1SXPA 2Q27A 4JUDX 1USIA 2I1VB 3L5OA 3QK7A 2R6DA 3QLUC 5HXAA 2RD2A 1QIFA 3RFXA 3EQ6A 4TUYB 2G06A 2BFPA 1XL0A 3RKSA 3FMVA 5H68A 1WB6A 2J0UA 3UWSA 4LF4B 3ORYA 3JQBA 1G3MA 4F1WA 1I5EA 3CG0A 4C76A 4HN9A 2YW9A 2OQRA 1RKQA 2IQIA 4DRXB 1D0IA 3WLAA 4CEIB 2FEKA 2V7WA 3MS4A 4E2ZA 4EO9A 1IHOA 4WZZA 3CO5A 1N5LA 2QYTA 2WVAA 4IUDS 4QEDA 5IVDA 1FJGB 2Q5QA 4GMDA 3NWPA 4PYIA 2R7NA 4J0FA 3NP9A 3LDFA 4UW9A 4F9GA 3NNNA 1SUCA 3WJ1A 5AQ1A 2QHXA 1K63A 2MT9A 1O77A 5AI8A 4AT1A 5A9RA 1ORIA 4TRRA 1WEHA 3H5OA 4RTPA 1UPAA 1Z0FA 4OF4A 4U7WA 5BUQA 1Z8DA 3C7DB 2P9GA 1CLEA 1ZMOA 2M1XA 1WW3A 2CVOA 3JWPA 1QU2A 3M6VA 3HPRA 2GYYA 4X1KB 1Z36A 3O3OB 2JI7A 4P54A 1ISMA 2RK6A 2YW2A 2X4IA 1HUQA 3L8DA 4OK3A 1OR8A 2ZTUA 4FDTA 5KNCH 1DFGA 3UMMA 2XMCA 2B4KA 2VQ6A 3F4LA 4ZZ2A 3HR4A 2J09A 1DKUA 1RAAA 2DX7A 4QREA 4YQYA 1KK1A 5BSMA 1QZZA 5HJ7A 1B00A 1JR2A 1ZCAA 3HKBB 4MQMA 4AD8A 1U0RA 5HHTA 5KHLB 1RHJA 4PLZA 5AESA 2OZEA 3OEHA 3R4CA 1XTQA 1BS9A 2QRLA 2ZTMA 4YJ2A 1TM5E 2FJ0A 3NDBB 2AOTB 3IMKA 2C96A 4B6SA 1HG0A 1CDZA 3U4DA 3GGJA 4YRZA 3PE3A 3W05A 4KK3A 4HB3A 3QENA 4IX9A 5J2UF 5GINE 4BUJA 1JSCA 2LTAA 3GEIA 4KYVA 3MTEA 4QFCA 2WF5A 5GADl 1MQ9A 3LA8A 4WXEA 3NBMA 6Q21A 1PGNA 8ATCA 3KXIA 1XTBA 2VRBA 1ZG3A 2OZLA 2ILTA 5G1NA 5KOIA 5EHGA 1Y8CA 1TF2A 1DRUA 1C9MA 1PEYA 2H52A 2Y76A 1GIAA 1P77A 1MAVA 3IHTA 1VDMA 2I6SA 1ZNZA 4NFYA 1VHLA 4PSAA 4YXFA 1XVLA 3EZ2A 4OL9A 2OLJA 3RFTA 5IN4A 1B14A 1L5GB 4UFOA 4FMPA 4AI6A 2VAPA 4GKVA 1EGQA 3I9LA 5G41A 3OPYB 3H1EA 4RH1A 4LXYA 4B33A 2NZVG 4D8YA 3RUIA 6LDHA 1Y6ZA 2NUBA 1UXHA 2PKQP 4W5JA 4R1TA 4UEKA 4LOIA 5GM2A 3GT0A 3GFFA 2PH1A 1BN6A 4C4RA 2C9MA 4HEA6 4Q7EA 1JDUA 1OV4A 5H9WA 4OCZA 1YZVA 2C04A 2EW8A 3T3NA 1L2TA 2YN4A 4KCGA 5K51A 3M82A 3WLJA 4A92A 1BDJA 1E5QA 1Z16A 2NADA 5FL7A 4AIIA 4Q3AA 5CYPA 3W8DA 1TMYA 5C8YA 4LS3A 3UPDA 4EJSC 3THXB 1TK2A 3KVRA 1ZCJA 2XYGA 4F3KA 4C01A 2NVBA 1H93A 5EUQB 4J1TA 1ORRA 3D8HA 2FZ4A 1U7XA 3BRWA 3AVVA 1O2DA 1W85A 1DKRA 1DQRA 2PX0A 4HI0E 4UPDA 5C4IA 1DCTA 4KQJA 4MGHA 3C6YA 3TEJA 3IRVA 1HE8B 1QH0A 4KQKA 1PJ3A 2H4ZA 2O8VA 4XIFA 2WAMA 5F64A 3WGIA 3K0AA 1XNGA 1LZKA 2IXDA 1HF3A 2O07A 4CMEA 2H00A 1FFWA 2W2PA 1FYVA 3CB4A 3DV9A 1JZSA 4GG1A 2Q2WA 4JB2A 3GYGA 3LU1A 2QORA 4KUHA 1EQAA 3RTCA 4MK4A 1PR4A 2FG7C 1A5AB 3DE3X 2RHHA 4EGAA 1E3MA 3I9V1 1T9DA 3DWIA 4EG1A 3OCXA 5K05A 3FM9A 1DDOA 5AVZA 3GA0A 5DGCA 1E62A 2CHEA 2SECE 2AZDA 5JH7A 3PXBA 4EHDA 2PL3A 3RU7A 1BGVA 2I7XA 3DVAA 4BZZA 3DZCA 4H6WA 1QGED 1UMBA 4ID9A 2I9KA 1XD2B 1JIXA 1URPA 2YUTA 2A5GA 3JARA 4EQ6B 2PUHA 1Y8RB 3KAKA 5H1YA 3KB8A 4I46A 1NW5A 3FCSB 5KNDA 2H2WA 1TQ4A 1D4AA 5AJWA 1YDFA 2WIBA 4L7VA 2XT9A 5BYAA 1SD5A 3WDLA 5IFKA 3KV1A 2C5EA 4HAYA 4XB1A 4X91A 4GOOD 3HJUA 2GBIA 1Q3KA 3NNDA 2PKRA 2B25A 3DMPA 3I12A 1JAYA 3LPLA 3LCUA 3O9ZA 1ZQ1A 2GTPA 4WK4B 3SOZA 2WU4A 3VPBA 4E2FA 3FI0A 3MERA 3O21A 2WC1A 3H8JA 5EWJB 1IK4A 5KVSA 5ALIA 1PW5A 3GQBB 5BV2P 3MOSA 3R8FA 1Y9ZA 1HFWA 3GZ4A 3LQKA 1PZNA 2XMQA 3Q1KA 1C9YA 2YWEA 3A32A 3MC1A 1U0HC 3O92A 3JD2A 1J5EB 2J4DA 2P2LA 2W6PA 2W2OA 3CS3A 2IVZA 1Y7HA 2J5RA 3E1KA 5AD1A 4JITA 1HE3A 2HHAA 4R1NA 3RC8A 1YL6A 3TS1A 6PFKA 2IELA 4V2UA 2ID4A 5L3RA 4F1JA 2PX2A 1MHTA 5JG7A 3J7AC 1K8QA 3G0BA 2XIQA 1RU3A 1ZN8A 4R83A 5FUYA 4D92A 3HCWA 2CLKB 1I6WA 1SK8A 1P7YA 1QZ3A 1UPUA 2EYUA 2I3BA 1TTPB 3NAMA 1L5FA 3WYFA 5CB4A 2ZDHA 4MX8A 5B4UA 2OORC 5ERGB 1RRCA 3CPEA 1ODCA 1QE5A 4IDBA 1IG0A 4JX9A 5KYYB 2HNKA 2VLBA 2W6JD 4XCXA 1PL8A 3IDSA 3VSCA 3E1SA 4UTXA 4MKGA 1P6UA 5TQJA 3OZVA 3WK9A 4BOYA 5JROA 1U3VA 4ZVQA 3PFNA 3B36A 5DTIA 1MZPA 2FPIA 1E3JA 3A58B 2VP3A 3SDZA 3Q7PA 3O73A 4XM0A 2RGUA 3SG0A 2C95A 3BK1A 4BVBA 4RENA 1SIWA 3EYWA 1AKRA 1FDIA 3RKRA 2NV0A 5FR1A 2V65A 1X1TA 3FJ1A 4WZBB 4I1VA 3EG9A 1U6KA 4HG2A 2LKCA 4XWOA 2DCMA 3VJMA 2GLXA 1NPTO 4E5VA 5FB3A 1AK2A 3DOHA 2C97A 3W1EA 1NASA 4EX6A 1DWUA 4JI4B 5CVUA 3QLVA 4L51A 3LC0A 2BHRA 1CK4A 4L57A 9LDBA 2DTDA 2JLUA 3OY2A 1T0HB 4IIBA 1L1RA 1WULS 4BAGA 3HDVA 2DQYA 3AB8A 3TNYA 3GHYA 3MNFA 3AU8A 5J47A 5K8IA 1CZHA 1ZCFA 2D54A 2XQIA 4H7HA 1JVSA 3SKVA 3T7IA 1GGEA 4S04A 2GLUA 4DMCA 3IE1A 3PT9A 2OP0A 3TOSA 2CXXA 2HU7A 1GR0A 1L8XA 4FSDA 1EK1A 2OYRA 2PTHA 3TXXA 5EG5A 2B8EA 4RY2A 1ZI6A 2XGGA 2YX1A 3KVNA 2ONJA 4DNOA 7REQB 2A4KA 2ZRGA 5AW3A 4EF6A 10MHA 3URMA 4TLBA 3PC4A 2O8CB 1RWQA 1RKBA 3QOXA 1ZY2A 2VZ0A 4XWTA 1C8LA 1A88A 4GBGA 2PXXA 3A4LA 3S8MA 3D6JA 3UMYA 4XIYA 4V0OA 5K3BA 4EG7A 4H1UA 1IUKA 3PC2A 4HAWA 4F0JA 1ZGHA 1Y37A 1WY5A 1A96A 2W2VA 5GZ3A 3KZCA 4GLBA 1YDGA 4BX0A 4M1OA 5KSPA 1NMYA 1S8NA 2W90A 4HZUA 2JZNA 3IDOA 3NOQA 4HNSA 4QOGA 5CLLA 5TF4A 1LNQA 1RQGA 4C4SA 1P45A 1QR2A 4PYKA 2A0UA 3LKDA 4J4TA 1N1GA 4JP8A 1JDSA 1FMLA 1YCFA 2HREA 4GGOA 2F9FA 3TCKA 5B2FA 1G21A 2HMSA 4UOEA 2WILA 1OB2A 3A3OA 1YZGA 1IXSB 4LJ6A 4AXXA 4C4PA 4TYYA 4OHUA 4P4TA 1IJKA 1V47A 4REQA 1DX4A 2QN7A 3ITDA 4Q1AA 3CLRD 3FCCA 4HQLA 3ZVRA 5GTDA 5HSGA 3BYZA 5LZ5A 2BH9A 5JMOA 4QGBA 2HXSA 1T8UA 3MFYA 2XUJA 2X1LA 2NUPA 3P9SA 2O7NA 3JQAD 4Q7JB 4BMZA 3FCOA 4GDFA 4MYTA 1KI8A 2I22A 3LO8A 3D3EA 3BG5A 2JIPA 4DA7A 3BFVA 3BF7A 3UCXA 3DPIA 3RNLA 1E2LA 3S5UA 4EW2A 1UQRA 3LRTA 4ZEXA 2ONYA 2VHQA 4EW1A 1GGMA 2W22A 3KC2A 3V4OA 2BCGY 2XNDA 3ZCTA 4RTJA 4AY6A 2R25B 1TIKA 2GN2A 3LCMA 2IE8A 1X7WB 3UJ3X 4S05A 4AY4A 5DTEA 2BMEA 4M83A 4U4AA 2ZRAA 3OZFA 1WZEA 2IGTA 1QMGA 1DBQA 1USWA 4UBLA 4ZVLA 2PUCA 2YY5A 1NR5A 4Q4AA 2NZWA 5AM0A 3OJOA 1MPTA 4O0MA 5I01A 1QG4A 5DJ5A 1NSTA 5CEEA 3K0BA 1JFLA 3M6MD 5B6PA 2XMRA 4PPYA 1Q20A 3KSDO 2C3OA 4NZMA 3T54A 4GBED 2JATA 3CHYA 5H3HA 3ESYA 3PUZA 2WJAA 4ZKEA 1UODA 3TW8A 3AHJA 3N2ZB 5LNK6 3BT7A 4J91A 4EPYA 3T4EA 5JARA 5JW6A 1K5HA 3HGMA 1PLLA 2BTQA 5ALPA 1N25A 1TK3A 4TXMA 5HKAA 4MVJG 4HH0A 2ECQA 1K97A 1PWZA 2GN1A 4ND5A 2CFIA 3QYFA 3L7JA 3CXRA 3AGQA 4WDQA 3N2LA 1YD7A 3MT9A 5E4FA 3PUYA 2H3HA 3EGVA 1MQAA 2F1KA 2I87A 2F8LA 4REQB 3TLCA 5FCDA 4MS4B 2I76A 4JK3A 2CLOB 3IB6A 2O48X 2OV4A 4KAAA 2J3DA 1CNFA 3BXPA 3TIVA 2JNWA 5ITSA 3ABRB 1FF9A 3LUBA 3TQOA 5C2JB 3HP4A 4JBGA 3NETA 3JALA 2WMYA 1BG6A 1L4NA 1VG1A 3KEGA 2Q6LA 1VIDA 3N86A 5G4LA 1NBAA 2I1QA 2PL9A 3N8GA 2O7SA 4C04A 2IGBA 5FWDA 2IDJA 3CJQA 5J40A 4M8KA 3FD8A 2ODAA 2B9EA 2OAP1 5EZYB 4QL3A 3FNIA 3TKAA 4RTRA 3SNKA 4AO8A 4QWWA 4WCVA 4JJAA 5F5XA 1AQUA 2C9ZA 5HGJA 3U4GA 2WJVA 1NRIA 1YQUA 3VO1A 3MN1A 2IBTA 1F6WA 1GZ5A 4DR7B 1DV1A 1CQJA 4MA4A 5JASA 1B2RA 4ZO9A 1OAAA 1ZRNA 1V48A 1Y6RA 3UMVA 1YS6A 3PUVA 3QBJA 3HJHA 2O2EA 4EGSA 2H4XA 4C0BA 2F1RA 3M6IA 4K9NA 4M36A 3KSBC 1IWPB 2I2XB 2JD0A 4PC6A 3IKVA 4RE5A 4TL6A 3RSFA 3HUDA 3QYAA 1L5QA 1N57A 3WLRA 4TSKA 4B4VA 1QFJA 2ZSBA 3EH2A 4D2IA 3DQZA 3HA7A 3HCBA 4C43A 2VDOB 5I7UA 2OG1A 3ZK7A 5C5IA 3GF4A 3V1UA 4V0SA 1TM3E 4DOMA 2WUDA 2ZSHA 2BYTA 3L7DA 5CX1B 1QP0A 1E1NA 3AR6A 3H2HA 4QM7A 4OQXA 5AM5A 5JH7F 3C41J 1NUTA 2IYPA 3HDJA 3GLIE 3AF5A 2W93A 1W5EA 2CD7A 1NVVQ 2AA3A 5DSZA 4AZ3B 3FF1A 3VC1A 1N5MA 3I9OA 4R3UC 1A9XB 1BJKA 2OSVA 3JQ8B 4GIBA 2JGDA 4QJIA 1PZHA 3CPHA 4YFYA 3SI7A 3K5WA 4LQDA 4UM9D 4YAEA 4WY8A 3G5TA 5I5GA 1O0BA 4GQAA 3L7KA 3L8CA 3HZZA 2YWCA 3PHBE 1BHO1 1U3UA 4QULA 4XB6B 5DE3A 4EGJA 4DUZB 2L82A 4MB2A 4W9RA 4IHJB 2XVMA 2JC3A 3I9MA 2OHOA 2J6CA 3JWGA 3ORSA 4QVIA 2YZNA 1JKXA 1JA9A 1PR9A 3V2UA 3AR9A 3NHJA 1Z25A 4NZZA 2R8RA 4O25A 1NWCA 2O7RA 4UHKA 2DXIA 3UMFA 4MA5A 1I0LA 3JZDA 3L3BA 5BPFA 5LQAA 4RGBA 1CYDA 1PDVA 1QC5B 4QXQA 4YJ3F 4OMFG 4C4YA 4EJFA 2R8YA 4OMDA 1XYYA 1XP5A 2D0OB 4DM3A 1OFVA 2YWJA 3C3CA 2CK3D 3GLVA 3W2FA 4F3YA 1PJZA 1VGRA 4NP6A 2PD3A 2G25A 4ZYYA 3PNPA 4I9GA 2HV9A 2Q3JA 4BQRA 4I5EA 1H2WA 2PLFA 3DCNA 2NACA 2NNWB 4R9NA 3HJNA 4Y2PA 3BULA 2HHHB 3DDZX 1CQJB 3RCBA 2WMNB 3NEJA 1PV2A 3SBDA 5E9WA 3K70C 2OCBA 1G19A 2D2XA 1U9IC 1A5BB 1HEYA 1TNDA 1A95A 2FMIA 4HNAA 2BMAA 1TQHA 3ESZA 2QTWB 4O3FA 1XFAA 4HNHA 5FI0B 5A4IS 3DEIA 4G5OA 4NOLA 1W93A 4KQ9A 4O2AA 1O87A 4TSFD 4UCXA 2JFQA 4UAUA 4G41A 3O8QB 4OK5A 3FRJA 1I3OA 3PXCX 3LC7O 3QG1A 3GJ0A 1U3WA 2QZJA 1PT7A 2DC1A 2OMEA 3HXOA 2E1RA 1SKBA 2BEJA 2WKWA 3PNQA 4IAOA 1F48A 4NMXB 3VR5A 4X92A 2CVFA 2XEDA 5C35A 4Q12A 4FDLA 5CX1A 3NCHA 3IVGA 1CPYA 2AN5A 2I33A 4K9MA 3CV3A 5FI1B 5NULA 2BUBA 3VR2D 2XNJA 5CX4A 2PWPA 3BD6A 1YRQA 2AMVA 1YXMA 3PNKA 2FV8A 2ZVJA 1E99A 4UUBA 4OH1A 4RW0A 4ENVA 5BO5A 1V2GA 1LLFA 1F6BA 1ENOA 1Z13A 4G4JA 1XEWY 2WKQA 3F8WA 3D64A 3LUKA 3MVEA 1T1RA 5JI2E 5M2QA 1IMOA 1PG5A 3UMGA 3GNSA 4CQNA 2BR4A 1TJ4A 3T3IA 5BN4A 2P5UA 5EXTA 1E2GA 4PAOA 1ZGBA 2G9VA 2WFZA 3DM5A 1BSVA 3QPVA 2HSWA 2PG3A 1E7YA 2CBXA 2UVQA 3QEMB 1S0UA 3DFZA 3E7WA 4ZTBA 4L5IA 1YA6A 2GAJA 4S1TA 3SIWA 3WC4A 3ETNA 3ZH2A 3TLZA 4EBFA 1WNFA 3PG5A 3DLCA 4QYTA 4RTQA 3W5DA 1ZLYA 3R40A 1IEWA 4YX9A 3CBGA 3W3AH 4J3JA 5E8RA 3C2QA 1UC4B 1NF2A 4KRFA 4UBIA 1JB1A 5AHRA 4HQOA 5TC4A 4EOGA 3ESQA 1IHDA 2ADMA 5EJ9A 2O8FA 3UJPA 3RRMA 2W6IA 5A05A 1P0CA 3EW7A 3VR5D 1GZVA 2W83A 1YULA 5LQMA 4G5RA 4HEA1 3J80A 3HPQA 3C3WA 1F5NA 5D51S 3CF4G 3S27A 3RRZA 4X97A 3TBKA 3FAKA 1LTQA 1QH8B 3IL2A 3ZI0A 2UUAB 2DYKA 1BS1A 2H1CA 2JGKA 3M6LA 1MCZA 4FWIB 5IBPA 4G36A 4DPKA 3K1TA 1C4XA 2VAVA 4ZYXA 5THQA 3I9NA 1K6JA 1F2TA 1UWCA 1KDVA 4LJYA 4URVR 1YS7A 4DARA 1GRQA 3IT0A 3LYHA 4HH4A 3S6JA 3TJZA 5JXJA 2C2KA 4BMYA 4AZSA 2CV0A 4H3KB 2Z9CA 1I1NA 3GJXC 3PPXA 3WRXC 4CV1A 3R5FA 1PFWA 2ZT7A 3NC1C 5JSKA 4JX8A 2CF6A 1VG8A 2JRCA 2R1VB 2XKBA 4PG6A 4WKCA 5L3QB 2BUAA 3HFSA 4JP5A 4ROSA 3RVPA 1JIIA 3M8KA 3IP6A 1UFKA 2GBFA 5EL0A 2PWAA 2LW7A 3GEMA 5FI5A 4EABA 4DKJA 3FDIA 4E32A 3MJSA 1KAEA 1M6EX 1QB7A 5FRDA 5A6VA 5LZ4A 5DASA 3AKZA 3NO4A 3QOYA 2PUFA 2F3TA 1Y34E 3EZ6A 2GZ2A 4I3GA 2EZ8A 5BVHA 1YR9A 2CLMB 2COKA 3QP9A 1H8HA 1HE2A 4R9RA 4K8RB 5DCWA 5GONB 4AP5A 5JAUA 3D8RA 3K0EA 3CQ9A 2EAUA 4TKVA 3D3JA 3BTVA 4B09A 2P9TA 2QM3A 4RGQA 2NO4A 4U2GA 3WZMA 4EFMA 3DBHB 4HWGA 5CBKA 1B1CA 1RXVA 1VSUA 1WUHS 1IJEA 4JP3A 1HZJA 2NW6A 2WU3A 1K7YA 2A3RA 4HDMB 1ZSNA 3FHTA 3ZHSA 4IKEA 2X5JO 1EFLA 4MI1A 3A6LA 4KK4A 3UPTA 4ETMA 5A9TA 2H92A 2CL6X 1W8DA 3AYZB 3EVEA 4I08A 4MW0A 4NJEA 1RTTA 2H2HA 4HLQB 3MOGA 4Z4GA 2MINA 3S2ZA 4EEZA 5MN4A 1L5SA 4ZFNA 3UK7A 2G5PA 1RWPA 1UEXC 2BF7A 2I66A 3OT1B 4N6GA 5KNBD 1NF8A 4TLAA 3PF8A 5AKZA 1OYOA 3EBPA 4WNAB 3OQJA 2JHGA 1AQNA 4YCJA 1NV9A 1UBGA 4H27A 3U62A 2VPZA 4RHUA 2AT1A 3OM8A 2HEIA 3T0GA 1ZVVA 4IFTA 3DHYA 4IZHA 3W8EA 1GEEA 5JSYA 1N77A 3ODPA 4FR0A 3DKKA 3UHOA 4AXBA 3EEQA 2DBRA 2GUWA 3JSXA 4EUFA 2B4RO 1BDBA 1WG8A 5FPYA 3QEJA 3DVAB 1YDWA 1GPJA 1T2AA 1LRJA 4LY9A 2FFRA 2JJYA 3ZV3A 3UFXA 1VSQA 3FWKA 4Q21A 2H2GA 3D2CA 4AG3A 1RHRA 2E1PA 1IEVA 1Y8RA 4U3JB 5AKHA 4N18A 4CMGA 4BLSA 4LDRA 4JWKA 3WNCA 3U48A 4YJFA 4C5AA 3AESB 1NE7A 1FJ2A 5EUCA 2P2YA 4G0NA 4KR3A 1TAHA 3MJEA 1X2EA 4I36A 3PICA 3T5DA 4Z8YA 1M7BA 4ID3A 5LP1A 4BNUA 3DMDA 3X1XA 3WRXA 1UK7A 2IK8A 3U6BA 2IHKA 1IBCA 2VKQA 3NHMA 4Z0TA 3SS7X 4B81A 3LBAA 4FJ0A 4PWYA 2HSEA 4UMFA 4KGVA 5EP1A 3OOJA 1RYEA 1I9CA 2A59A 3G0CA 4GKBA 1TUIA 4P80A 1QWOA 1H0SA 4ND6A 4BKUA 4EL5A 1NONA 1UDCA 2RI1A 1U8EA 4YWHA 2H4HA 3HV0A 2FZWA 3OQMA 1V5FA 2CJPA 4W5HA 1XDSA 3HWX1 2B5OA 4RJIA 4MINA 2QN3A 5KTRA 5K4GA 1EGVB 2QN2A 4DJEC 1PL6A 3OBIA 2WYOA 1H69A 2I2BA 1J0XO 1DIRA 3B53X 4HS4A 4DILA 2JJ2A 5L51A 3ANSA 4EHHA 3EQ8A 2ZKIA 4Y0AA 3K20A 4FOTA 1QQTA 3IEMA 1QV7A 2UKDA 4V39A 2SKEA 4IIFA 3JWIA 3CGWA 1ILEA 3IB3A 3LK7A 4FJ2A 3AETA 4LVCA 4NEHB 1L4HA 1TYCA 2XUFA 2COEA 3E8MA 2D1YA 2IT1A 3N6XA 5A3VA 5REQA 4BV9A 2QVBA 1F0YA 4QAQA 1G8HA 2GF2A 1JU4A 2HMUA 3LD9A 1VCOA 3L9WA 2KE5A 3BCRA 1TJNA 3GY0A 1ZK2A 1I4LD 3O4FA 4I14A 5KSOA 2BFDA 3LE8A 3LX8A 5J5VA 3DZ8A 4OQPA 4H60A 4NPCA 3GNQA 3QFTA 4XJVA 4Y6PA 4MRRA 5LZ8A 4ERXA 3CJTA 3AIKA 3ZCUA 3U09A 3R0JA 5JDCC 2ADOA 1XKTA 1TOAA 5KYWA 2ZBGA 3CCCA 3G02A 4PC1A 1LLQA 3UAXA 5KPJA 1QYWA 5TIIA 1JEYA 3OFKA 3PUIA 4HRAA 5KC8A 3HNPA 4GI1A 1W36D 3D1VA 3STWA 4FFVA 1TPZA 1SOAA 3F1LA 4ZT4A 2RAPA 3O3MB 1WDLA 4GZ6A 2R00C 1KDZA 1D4ZA 4WOKA 2Z98A 2OXIA 5B3AA 1HNZB 4YPFA 1YRAA 1H0KA 1P4GA 1RWNA 2YXLA 1LRLA 1SHZA 5JCZA 5LMZA 3CBQA 5L7TA 1A1VA 4QUIA 4LK2A 5HF5A 4J16A 3F3KA 4W7IA 3U7JA 1TUGA 1E1YA 5DLQC 5AW0A 4QX6A 3ML1A 1QLHA 2CLCX 4Y0NA 1B8VA 3H2BA 4IQ4A 3ZJYA 4US0R 3AFHA 3ICEA 2WFLA 1ZSYA 5CA0A 2JI8A 2YASA 3PU6A 4M0UA 5G0WA 3UB3A 1ONNA 1SNYA 5EKDA 4Q9JA 1MT3A 3FPEA 2O2XA 2ZFUA 1YV9A 4KYTA 3IQXA 3BVPA 2C20A 3O26A 2YJTD 3Q98A 4JT2A 2WIJA 3TI9A 3BD8A 3YASA 3IAHA 3N0WA 2FSGA 4K6CA 1U1FA 3AG5A 5HW0A 1XMPA 4ZAWA 3V8VA 5EHZA 1M5RA 3NIBA 4QLBA 1LBIA 4NC9A 3HABA 3ZWOA 2MSLA 1U28C 2E49A 2IU4A 1L8QA 3KJZA 4Q3LA 5JMWA 3G59A 1I4WA 3WQHA 1EHIA 4NMHA 2CZQA 1Z0UA 4JJKA 1DIHA 1T8RA 4D9FA 1Q92A 4B6RA 2B7CA 4AM8A 3KOWA 4ITUA 3WKDA 2O6HA 3LXMA 5FWYA 1GNVA 3D7RA 1DFHA 1E9BA 3RM3A 1NIPA 3PC3A 4ZIRB 3LC2O 1JT2A 1YOVA 1YFLA 3NGXA 4ZI5A 3RRYA 5C8ZA 5ULLA 1M8JA 4YUWA 1CUYA 4CFYA 5BW4A 4NLLA 3O7MA 4IIJF 2EOAA 3RAGA 5DX0A 1A8IA 2B82A 2GJ8A 1PR1A 3N28A 4Y8VA 1M6YA 2PQ6A 4RDXA 2QTTA 1OIVA 4B6QA 3GJ3A 4YRJA 2JFZA 4TUYF 1KMQA 4CKWB 3HZOA 4PG4A 3TKYA 4N0EA 3UAWA 1UWVA 4W9MC 1FCJA 4DVGA 5JAQA 5BSHA 3CLSD 4G01B 5GP1A 1JG7A 4H0NA 1DINA 1MC5A 2HRZA 3P97A 1AGXA 3E23A 3FLBA 5I7FA 4NJMA 3NWEA 3NRCA 4BN4A 5IZ4A 1N8KA 4Q4LA 1ECJA 4H9GA 1QRTA 1V4VA 3GXOA 1RXEA 5G3YA 5HMLA 2OBBA 1KEKA 1U94A 4EVRA 1C7RA 2LUOA 3TZCA 5HF8A 1TF7A 2CJFA 3GFPA 4XQGA 3COJA 1PWYE 1F8FA 3Q2IA 3H6HA 2A8YA 3FVQA 4I6JA 1FQKA 2C8VA 1K6XA 1HQKA 1VL5A 3GCDA 4JJIA 5FBRB 2JARA 3NHRA 1P2VA 2CBZA 4OQLA 1OA0A 1QP8A 3OEHD 2XCTB 1NLFA 3FHLA 3DMNA 3LHIA 4D4KA 3ZD7A 2ACKA 5H70A 1JKJA 4UXJA 5E2AA 4BE7B 2P67A 1I5OA 4HEQA 4Q7KA 4U00A 2BGUA 4KU4A 4H7JA 4OXXA 3RIMA 4NMLA 2KHZA 4BO3A 1DC4A 5KQMA 1IN4A 1JAZA 1I4DD 3A6FA 4MULA 4X20B 1U4NA 5F35A 2DP4E 2UZAA 3ZVKA 1IEQA 4R9VA 5HQJA 4ZYWA 3V2IA 2SKDA 4JBLA 4YWJA 3EVAA 1FZQA 2R1UA 3HLTA 1ZK4A 4L08A 4XGNA 3TZQA 2WF9A 2V6GA 3RF7A 5HOEA 1ZVKA 2CL0X 4E3ZA 4LHYA 4MUFA 1S2NA 5AJVB 2UV8A 4WN9B 3O31A 4JGIA 5DSTA 1KSGA 2QLJA 2VF5X 1SG9A 3H9UA 3EDQA 3F74A 5AXCA 3BXFA 3RFVA 2ZB8A 2ETXA 2YJNA 3KPUA 1P2FA 1UC5B 2L18A 4AJPA 4EB3A 5BNWA 2QRZA 4LXXA 4MQEA 3TDMA 4Y2XA 3VYWA 2UDPA 3OE4A 1O4VA 2IHTA 5FOTA 1B1AA 5LUAA 1R6XA 1RXIA 2BTOA 1W2WB 1T0BA 4KFSA 2G6BA 1L7NA 2HK6A 2RGDA 1KYVA 5DT2A 1NNUA 3RWMB 2AF3C 1BW9B 1LBSA 4HFRA 3ZYCA 4IQ0A 3RFUA 4KITB 3TK1A 3WRYA 4E14A 1YT5A 1AXEA 2D2VA 5DIFA 1A4XA 5D1HA 1VPVA 3I2FA 4I0WB 4BNTA 4D0NA 1HEUA 3TQQA 1FSZA 2DF8A 1VGVA 3AB7A 4B83A 1M73E 1VHTA 4RVGA 1SVKA 3NHBA 3TBFA 5EIEA 5CT8A 1MF7A 4CMIB 2FUNB 4JQZA 4XGIA 2Z6QA 1TYEB 5B1YA 3QF4A 1E6MA 4U39A 5IG2A 2POQX 1ITZA 5JHGB 4AO7A 2V98A 3LX6A 1J7JA 2H8GA 5G4KA 2PJRA 1JYSA 1W88A 5AW1A 3VOAA 2FPPB 2G70A 3RH0A 4BDSA 4F12A 4TTIA 5KOHB 4AJJA 2PYZA 2WWYA 2BOVA 1C7IA 2ZRCA 1N2BA 2C4UA 1BJRE 3QKRA 3NIDB 1JTFA 1X92A 4BXOA 3FWNA 2SICE 1M8PA 1Y1KE 4NCHA 3P9RA 1XA3A 4RK1A 2WJGA 4A0GA 4EY5A 3CLUD 1GGJA 2Y77A 2W43A 2QE7D 4YAGA 1GAEO 4MV3A 2O3SA 4A91A 1HL7A 3BAFA 2C57A 2QMUA 4L8GA 1KIMA 1P39A 2F3SA 2HCFA 4EVIA 4XWKA 1ZR2A 2G9RA 1M10A 1NFFA 1KVSA 2PZEA 3GLKA 3UWMA 1KK0A 1XZEA 3Q6IA 3T1HB 4OHKA 1UIMA 1PEAA 2W2NA 4LOAA 2XZOA 2LPMA 1NXXA 4YUXA 4KR2A 2EKZA 2EJBA 3P5SA 4DDVA 4PW0A 1HSOA 4CU5A 2V4ZA 3ZDYB 4Q4JB 1CRPA 4FUTA 4ZOLB 3CT6A 2JFOA 2Y4NA 2JBAB 1P1KA 4LGYA 3EZNA 2RC6A 3C1AA 5FTLA 2NYUA 1Z08A 3W5AA 5IYZA 3ITKA 4G3XA 7ADHA 2EQAA 2F90A 4E5SA 1SA0A 2EL7A 2VHXA 3T12A 1TXGA 4BNVA 2XRYA 2P65A 1VJRA 1Y7PA 3VPHA 4A8TA 2B36A 3W90A 3I09A 1WMFA 4Z1MA 2YJ6A 4NL4H 2WHPB 3REGA 1NN0A 2P62A 4QJ3A 5HIAA 4BO6A 3FKQA 4PS1A 2CN1A 2QR2A 5EIAA 4YYZA 4DB4A 4ZALA 1BGWA 1UBOS 2WWIA 2ZYGA 1QYVA 1GQRA 2FN7A 3D8UA 3RC3A 1N5KA 4BIIA 3R5JA 4HNVA 4UTNA 4DMFA 3KUDA 3NT5A 5G0UA 1PSWA 2WJ3A 1LI5A 1Q1NA 3R2JA 1AO0A 1N8SA 4KE7A 1E98A 1O03A 2G88A 2GA8A 4MYRA 3VKFA 1AKQA 1P9OA 4CIDA 4QT4A 4YHHB 3TLJA 5JRJA 3PGXA 3R24A 2OHGA 5CTAA 4ZQIA 1NNEA 3CLTD 1GKLA 4R7ZA 1XN1A 5K20A 2EX0A 1M1XB 3PX2A 3J81A 4B34A 3UJDA 1WCV1 3NH9A 1PZMA 4PYRA 4PGFA 2AFVA 2G36A 5DIZA 3KALA 1WOMA 2ZVPX 2PU7A 2FSSA 3OIVA 4OQQA 1QIJA 5BNFA 2K2QB 4MO9A 1P3JA 3RASA 1XTIA 3OF5A 3ER9A 3AHFA 3JR7A 2IYZA 5AHOA 5ENDA 1MXFA 2FH5B 2XD9A 3D43A 4BEWA 2J0SA 4NVRA 1QK3A 2JFNA 3QVMA 5BSUA 3PQ7A 4X24A 6ADHA 3ICVA 3GN2A 2XEXA 4KRGA 3WHKA 5JRDS 1SCUA 1OF1A 1UMCA 1CDDA 2CBGA 4RZHA 4BO5A 4D6YA 3IPCA 4KIJA 5IX8A 1FTQA 5EZQA 4K8OA 4CCSA 3WKEA 3C74A 3LAWA 3EGIA 1AGRA 5JTTA 2PRJA 1QO9A 2ONZA 1AK9A 1OLUB 1UM8A 2FI1A 3V1LA 5JXIA 1I5RA 2VJDA 1CUFA 4JFAA 2NUAA 4BRZA 5BSWA 2GN8A 2IYUA 3A9SA 1E8MA 3FOZA 3PITA 5KREA 3LOQA 5HJ5A 5MGBA 1VLMA 2JJ2D 1E3WB 3R4VA 4M46A 1KZ4A 4ND1A 3CGGA 2FLVA 5L3VA 4JJEA 1EVLA 2WA2A 3NYQA 1Q2XA 3IP7A 4S0ZA 1PTJA 3SR0A 1Q50A 5J5CA 1LNZA 4OKIA 2H16A 4JC8A 3SF8A 3C98A 2VDLB 1IXRC 3DOIA 2QD1A 5ILOA 1NW7A 2ZB2A 3ZV5A 5FWAA 1VOTA 3UHPA 1WD7A 3A06A 3CUSA 3LWZA 4FEYA 2WNSA 4PNPA 2QD4A 4AMZA 1CKEA 4KWIA 3L04A 5BW8A 3DAOA 1PQWA 4YROA 1CBUA 2PRZA 4B2PA 3X2SA 5I3ZA 3QUSA 2ZYDA 2KLHA 2RHGB 4BEBA 4LE0A 4WV3A 3E9DA 2VF2A 4DCUA 5LYYA 2IL1A 3JR3A 3ENKA 1I6KA 3VPAA 1R9GA 2RGBA 2YL2A 5HVNA 1WQ3A 4ZZ0A 1L4KA 4E03A 4ZMBA 1F3OA 1GN8A 2IIPA 4JIMA 2F4NA 2YWRA 2W71A 4LCEA 1V8DA 5B3JA 1FUYB 2E3JA 4ZDKA 1IUPA 3H9EO 3R9XA 1LNSA 1DVRA 1JIQA 1HDXA 2RJOA 3I76A 1O8BA 3VFDA 2C0CA 3BRSA 4TV8A 4ZAYA 4DJFC 4F2PA 5DXFA 3E3OA 4IIVA 3UZUA 1GG5A 3EWAA 1U3DA 3C5HA 1SC9A 2YBDA 3NKFA 5FBWB 2JCSA 1RVDA 3LXUX 3LT1A 4PTZA 3KTDA 1V9SA 1GDTA 4FYYA 1T3SA 2AZXA 3H99A 3A6ZA 2QZ9A 1W19A 2BZ1A 3Q40A 3E7DA 1VIAA 2HPVA 3TMYA 4AZ0B 1NXSA 5JR3A 4RV9A 5JD4A 3H9QA 4CTJA 4MOWA 3LCRA 2VNIA 3VZDA 3Q5GA 4OBXA 1Q14A 3IBFA 4M9UA 3ANXA 3IOEA 1NFRA 4P38A 5DKFA 2ZPTX 5DTQA 4AKTA 5CXUA 2V7XA 5CDGA 1FRZA 721PA 3WB1A 4A0RA 1S96A 2QL9A 3TM5A 1NW6A 2EWVA 4GO1A 5JS1A 2JHPA 4GOLD 3VH3A 2P2NA 1E3WA 1E32A 1JR4A 1I3NA 3FF4A 3GL9A 2A3NA 2H08A 1IVSA 3H97A 5EOVA 3OD5A 3GP5A 1A50B 1F4VA 3GMDA 3UQZA 4ZOEA 2D59A 3SX2A 4DLTA 4DQVA 2HPZA 3EUWA 3DPUA 1JAHA 3T0IA 2UUPA 2GTIA 4D43A 1KZ9A 1BYIA 3PA6A 1X8LA 3DB1A 3G2LA 2DSTA 3NAQA 1GHTA 2FRDA 2V7BA 4AS3A 3IEIA 1QRSA 1WMAA 4ZEOA 3I1FA 2Z5VA 4A6XA 1GU1A 4UREA 2RJ3A 1UPXA 4P58A 3K0KA 3GB9A 2LE0A 4K28A 3SSOA 1SIOA 4NH0A 4MYUA 1X7XB 3KJFA 4MCIA 1J2TA 2XWQA 2B0JA 3GLGE 4R9UC 2FRVA 1RXSA 2CFTA 4EYEA 3SVLA 4NFHA 4C4AA 2EX1A 4FI3F 3U0BA 4C89A 4BJHB 3B6MA 3HFRA 4WK2B 3WBKA 1ZI9A 2C83A 3KQLA 4FKMA 3PC7A 3Q5EA 3E61A 4M54A 3RUDA 4A0QA 4GC5A 2G7ZA 3RVLA 2CUTA 1UBFA 5HF9A 1G5FA 3BORA 3GCXA 4FMDF 4YAIA 3MMNA 3VUEA 3OZEA 4DKXA 1B8OA 1GZDA 5BUZA 1T36B 3K2IA 4N6OA 4I55A 4NYMR 4HQFA 5I7AA 3IT2A 1Y0BA 1MOPA 3IEPA 4OXYA 4QAJA 3WWYA 3OJWA 4OIMA 2R6GA 1RC8A 1KBOA 1I7DA 1BRTA 1DRJA 1KVRA 2IIVA 2VXYA 5SYMA 1XVAA 2EX4A 2GXUA 3SYNA 2TMKA 3TVYA 2ZCJA 1CUSA 1D2AA 1EU1A 4LTMA 4RU1A 4X5OA 1CEYA 3WBBA 3DMHA 2PMFA 4MVJM 1G16A 4PRZA 4GL4A 4BTVA 1O97C 4WGGA 2DOKA 3PZBA 2F55A 3QVXA 3DYBA 3X43A 4MNTA 1AX9A 2WKRA 1LDNA 2L0XA 2WYIA 3AETB 3FYSA 4MUGA 1JWLA 2AQKA 1M5UA 1LDEA 4LISA 5FH9A 1I33A 5KHOC 1B6RA 4WWHA 1TC2A 1Z7YA 2FFBA 3ENQA 4KKVA 5T3UA 1ORWA 5JC1A 5DMXA 4PN3A 3NBKA 4BCBA