1AUOA

Carboxylesterase from pseudomonas fluorescens
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
MTEPLILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQAPTRPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKRTGIDASRIFLAGFSQGGAVVFHTAFINWQGPLGGVIALSTYAPTFGDELELSASQQRIPALCLHGQYDDVVQNAMGRSAFEHLKSRGVTVTWQEYPMGHEVLPQEIHDIGAWLAARLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYLESTERASE
publication title Crystal structure of carboxylesterase from Pseudomonas fluorescens, an alpha/beta hydrolase with broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 73
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 1997-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auoA00
4OU4A 3WIOA 5K3DA 3WYNA 4U2DA 1JMKC 3HC7A 2O2GA 5KWJA 3W04A 4G4JA 4UBMA 5CXXA 2OCLA 1IVYA 2QRUA 2WG0A 2WUEA 5E4TA 4CG2A 5AOBA 4KE9A 1ZGCA 2WQZA 3PFCA 1MX5A 3CN7A 1HQDA 4J7AA 3I28A 2WJ3A 3LLCA 1QTIA 2D0DA 1WPXA 3BIWA 3KWJA 1EB8A 1YS1X 3STWA 5D7BA 1R50A 4KE7A 2O7RA 2Y6VA 3FLAA 4E15A 3WMRA 5DLPA 3WKEA 1MX9A 4PNZA 5EI5A 4WDQA 5C8ZA 3R3VA 2HADA 1EA5A 2DCMA 3G0DA 5JASA 1E8DA 1VOTA 4P08A 4KAFA 3TEJA 4AXBA 3OOSA 5ALSA 2G5PA 5AKGA 3HACA 2OGTA 4BC0A 1BRTA 2DHCA 4B0PA 2G5TA 2WG1A 3DLTA 3E3AA 3DL4A 3X3HA 5KREA 5AKLA 1MO2A 2XUDA 1VE7A 1ZJ5A 2FUKA 4UBIA 1HLGA 4GECA 4UBOA 1UWCA 1VA5A 3GA7A 3K9BA 4X90A 3WK5A 2PX6A 1TIBA 3EF3A 1UKBA 5K3FA 4BB0A 4C01A 1DQYA 3WA7A 3AJAA 1AUOA 4J0GA 1M33A 2FX5A 4LXHA 4K2AA 3ZV7A 3PICA 2WIDA 2XUKA 2XUFA 2PVSA 1EDEA 3FAKA 2RI6A 1XRMA 1ZD4A 3E4DA 2JGFA 5AI5A 5AOAA 4TPKA 1N8SA 3AZPA 2WHQA 3EQ8A 2QMQA 2WTMA 5HF9A 3QYJA 1FJ2A 5FDFA 3FVTA 3D2CA 4RPCA 2XDWA 1LLFA 3WL8A 2QZPA 2RGUA 5EHXA 1USWA 1CUBA 3JWEA 4OB8A 4G9EA 1GPNA 4KYVA 3F98A 4Y2RA 3D7RA 1T2NA 4C4ZA 3G9ZA 2XUGA 4HVTA 3EQ9A 1VA4A 4DIUA 3ICWA 4NMWA 5AKHA 3D2BA 4GHWA 2OG1A 1GKKA 1ZI8A 4BTVA 4UBJA 5D3ZA 2WFLB 4IH9A 4UHEA 2G63A 3HRHA 2ZJ6A 4W9RA 2DHEA 3DOIA 5AM4A 2PSHA 3WWPA 2V97A 1MAAA 2YH2A 2GYUA 5AK4A 5DNUA 1GQSA 4JUIA 1FSSA 4UHFA 1QE3A 3A6ZA 5CT8A 3IUQA 4X85A 2AJBA 2JGMA 3O0DA 5BWCA 4FBLA 4QDZA 5A71A 1UT6A 2QUBA 1BROA 2FJ0A 3KWFA 4J0IA 3AFIA 3R3UA 4X6XA 5IVIA 4B9AA 4ZGBA 1LPSA 3WK6A 2PKYX 2DFPA 4KEAA 4DMCA 1QJ4A 3D4LA 4BTLA 4H35A 5ALPA 4DMHA 3JYHA 3AINA 1XZMA 1JI3A 2BAGA 4Y2TA 5DYTA 1AX9A 5AO9A 4GEGA 2X5XA 5ALZA 4GXNA 2CBGA 4BDTA 5AM5A 3G02A 3VISA 1O6GA 1LZKA 2C5GA 2XQFA 4WJLA 1TRHA 3FYUA 4FNGA 3R3ZA 3RK4A 4AMZA 3EIOA 2JGKA 1GGVA 4DYHA 5IKXA 4OCZA 1PFQA 4CCYA 3P2MA 2XUAA 1VZ3A 2Y1KA 3PF9A 3R40A 4CCWA 5LKRA 1ZD3A 4WCVA 4X71A 3STVA 4A23A 4F0JA 5HFAA 2ZYRA 3IVMA 1HDEA 4LXIA 2PSEA 4XJVA 1XRNA 2XMRA 1CUUA 2OCKA 3SK0A 3WJ1A 4F60A 1XRPA 4BRZA 5E4YA 1DQZA 2BUAA 2WUDA 1XZIA 3MVEA 3V1LA 3H2JA 1RWQA 4W1SA 4DSZA 1W1IA 5EIEA 2AJ8A 1LPOA 2VEOA 4B82A 1NU8A 1MPXA 5FLKA 2RONA 1LPMA 4QDUA 2IX9A 3DEAA 3LS2A 4CI9A 4HZGA 1EVEA 2QOEA 4EY7A 3G9UA 1DT5A 3O9MA 3R3WA 4DNQA 3FBWA 3DQZA 1AQLA 4ZRDA 4GDMA 1S8OA 3I2KA 4FFVA 4P92A 1ODSA 2Y2VA 3BJRA 2GYVA 4BC1A 1GT6A 2WIJA 2HA6A 1QIDA 2XQKA 1QIEA 3HI4A 5ALLA 1CUAA 4INZA 1UFOA 3SC2A 2BGNA 1ORVA 4C6HA 3IA2A 4H0CA 4HXEB 5KWIA 3IBTA 5HQ3A 3SWWA 3QPCA 2XUIA 3S2ZA 2IIVA 1OILA 5AOCA 4J0HA 4X00A 1CUDA 3V48A 3WKCA 4DLNA 1F0PA 4K5QA 2ORYA 3H17A 3WKDA 3R41A 4JYPA 2ZJFA 4RE5A 1TCAA 1BN6A 2VT7A 3WZMA 3D3NA 3VKFA 1QIIA 5EGNA 1C4XA 1C7IA 5CT9A 1CUZA 4QDOA 1UOQA 1SC9A 1YS2X 3M3DA 3AIKA 1Y7IA 2XMDA 3AZQA 3I1YA 3NOXA 2ZYHA 1UK9A 3HYSA 1Q0ZA 1EI9A 2QKYA 4RE6A 1VKHA 4ITVA 1N1MA 5ALOA 1HPLA 2WG2A 4KRYA 3DS8A 1DINA 2H9YA 5C81A 3VVMA 3O4HA 2JEYA 1O6FA 4FNMA 5EFZA 1DX6A 2QUAA 4L72A 4H77A 4EHBA 4Q1VA 2QJWA 4DM7A 1U4NA 1EHYA 5HF8A 1K8QA 3DJYA 5T4EA 4MEBA 5LZ7A 2AJDA 3WK4A 1C7JA 3N2ZB 2ES4A 1SFRA 1UKCA 1XKTA 5A62A 3WWEA 2V9ZA 3QBJA 2EDAA 2OCGA 1YASA 5K5EA 1AGYA 1JJFA 1W52X 4WFKA 1VXOA 1XROA 5ALGA 2QM0A 2XLCA 2GBGA 3QITA 3WWOA 2DQZA 3IIIA 3IUJA 1BCRA 2JGIA 4Y2JA 1QO9A 4BBZA 3ANSA 3C8DA 4BATA 2WILA 1H22A 1ZJ4A 2BUCA 4UHHA 5BWBA 5A7HA 5HKAA 2CJPA 3WZLA 3YASA 1TQHA 3O4IA 1RYYA 4B81A 1GPLA 3VJLA 3PUHA 3W9UA 2X76A 3DL7A 4PF1A 4G8DA 2NW6A 5LZ9A 3M82A 2VSQA 4QEKA 2PU5A 1N5RA 3V1NA 1CUYA 1R88A 1LGYA 4N8DA 1CR6A 1E8NA 3M83A 5I8PA 3EQ7A 1XZLA 2VF2A 2R11A 2WFMA 1QIJA 2V96A 4AZ0A 3G0GA 3DD5A 2XMSA 4H7JA 5T4HA 2C58A 4DSAA 1DT3A 2HA5A 3QMVA 5FKJA 2I03A 2HRRA 3T52A 4NS4A 3H18A 3GROA 4C88A 4FOLA 5C8VA 1R9MA 1XZJA 1IUNA 2BJHA 3V1MA 5AJHA 4U2FA 4N8EA 4PSCA 4IH1A 5ALYA 1SCKA 1UK7A 4CFSA 4FWBA 1J07A 4J03A 3VJKA 2AJCA 5JZSA 4BDSA 4KRXA 1WB6A 2Z3ZA 5IH7A 1GQRA 5K3AA 4X97A 3QMWA 3HZOA 4AO6A 1CQWA 2XUQA 3ZPXA 4H18A 1BS9A 4EB0A 3I2JA 1THTA 5ALFA 3WK8A 2WIKA 3I2HA 4BAUA 3IUNA 3O95A 1XKLA 2WUFA 4I4CA 4UFPA 4GLBA 5FPPA 4LIPD 5LKAA 1K63A 2VATA 2XQIA 4OUKX 3O9VA 2WHPA 3WI7A 1QIFA 5AK6A 1XRRA 1ZOIA 2WSLA 5JANA 1WCYA 2BUBA 2P8SA 1WB4A 5EHZA 4IH4A 1THGA 1QOZA 1YA8A 5ALKA 4ARAA 2PBLA 4DNPA 5ALUA 2CUTA 5D6OA 3DNMA 2HA7A 3O4JA 4J0KA 2XUHA 3IDAA 5C7YA 2EDCA 5CH3A 1TAHA 4YK7A 2JIDA 3BIXA 4G5XA 2VQ6A 5AI9A 2FJPA 5CRIA 1GXSA 1P0IA 5JD4A 1WHTA 2HRQA 2OQIA 1XZFA 4UFOA 3PI6A 1IUOA 3BF8A 3MUNA 1CUXA 2AJLI 4Y2YA 4B80A 5ALXA 2I3ZA 2O2HA 3ESAA 1X70A 1MTZA 1IUPA 4QA9A 2B20A 2PSFA 3F67A 4Y9SA 5FXMA 3C70A 2H7XA 5A6VA 2PUHA 1L7QA 2VA9A 1LBSA 1L7RA 4Y2XA 2DQYA 2RAUA 4H7IA 1J06A 1LBTA 1QFSA 1RP1A 1XZHA 5AKEA 4MEAA 1ZIYA 1VLQA 4UPDA 5AM3A 2O2IA 2OCIA 3ZI7A 3WL6A 2Z3WA 5CH5A 2GBFA 3TRDA 4JYMA 1ORWA 3PUIA 3G8YA 3N0TA 1P0QA 4XWGA 5AK5A 4XIIA 4WY8A 3NUZA 5KBYA 1H2ZA 3BDIA 1UXOA 1QFMA 5CW2A 2HU8A 1U2EA 2ZYIA 2CKMA 1FFDA 1EDBA 1EXWA 5LYYA 1D07A 4QE3A 1ISPA 4OPMA 5K3BA 2WU3A 1J2EA 1XLUA 2ZJ7A 3G9XA 4Y2VA 3FSGA 4GWLA 5E2IA 5AM1A 4GW3A 3IUMA 1ZI9A 3FCXA 5ALNA 4IQ4A 5AM2A 4J0JA 3CXUA 4AX4A 1CUFA 1E89A 4N8SA 4BAGA 2WIGA 4FLMA 1YAJA 1YSCA 1BEZA 2YXPX 3WKBA 4BP9A 5ALJA 1NU6A 1UOPA 3FYTA 2OGSA 3STXA 3H1AA 2HHAA 5DWDA 1BCSA 1MX1A 3RARA 3I6YA 4I19A 3HJUA 5AKIA 3RLIA 1R1DA 5FOQA 1CUEA 1E8MA 4HXFB 2W22A 4I3FA 2Y6UA 3LCRA 2B61A 4BCBA 1A8QA 1BN7A 2QXTA 3FYUB 1ACJA 5LZ2A 5AI0A 4B84A 1FFEA 3BF7A 1OCEA 4OYYA 4B6GA 4FHZA 3WJ2A 4C89A 3F96A 4EA6A 1DX4A 2GBIA 1G42A 4K6GA 5LP1A 1T4MA 1HL7A 5AKJA 1MJ5A 4DGQA 3O4GA 2J4FA 5JAPA 3FCYA 4WFJA 2ACEA 5JD5A 4G8CA 1EX9A 2GZRA 3STYA 3A2LA 2ROQA 3D5EA 1MNAA 2W6CX 3FYUC 1IZ8A 3AZOA 4ZI5A 1CUVA 5JZBA 4X6YA 5K3EA 3ICVA 1Z68A 1R3DA 4HAIA 2GZSA 2J3QA 3STUA 4FTWA 1UK8A 3ZLUA 2HA0A 4X94A 4B0OA 1WM1A 3QH4A 4U2CA 2JBWA 3MGAA 4YPVA 5IVKA 2BFNA 2VJAA 1VXRA 2WFZA 3NWOA 2ONCA 5AI8A 1YR2A 4PSUA 3WQHA 1A7UA 2JGJA 4K6HA 2C5FA 3W05A 4J0DA 1B6GA 4MXDA 2X8BA 4M0EA 1CPYA 2G4LA 2XMCA 5JIBA 5FPQA 1JMYA 3AUKA 4BP8A 5JAUA 2JGLA 1G4HA 2RHWA 2HFJA 4C4YA 4YX9A 2QTBA 2HM7A 5AIBA 5AKYA 2E3JA 4ARBA 3FLEA 4KACA 3F8SA 1W6RA 3CCBA 5JAOA 4X95A 1JU3A 1YCDA 1VZ2A 3BE8A 1ETHA 2XMQA 1CUSA 4Y2SA 1UOOA 1E5TA 5HF6A 1K6EA 1R4ZA 1AZWA 2CZQA 5YASA 3H2KA 1XZEA 3CCCA 1JT2A 1JJIA 3I6ZA 5CH8A 4BAZA 5CTAA 3RM3A 5FRDA 3C5WP 1CUIA 3WIBA 1EK1A 4M0FA 2ECFA 2XQJA 5JAHA 1ZD2P 3C6YA 3FSGD 3VDXA 2ZYSA 5BV7A 5C8XA 4UFNA 1E66A 5J3JA 5ALEA 4HXGA 2PSDA 5AH0A 4FDMA 1WOMA 4WDRA 1AURA 3GELA 4AO7A 3EBLA 4XX1A 5DJ5A 4S0XA 3C45A 3DCNA 2PSJA 4JEIA 2HU5A 4E11A 3U0VA 3I2GA 4EY4A 3WK9A 3MUOA 7YASA 4PO3X 1PV1A 1KEZA 3L1HA 3FOBA 3B5EA 2ZSHA 4FBMA 2Y2UA 4FMPA 1XQYA 1IZ7A 2HL6A 4AO8A 5HFNA 2EEPA 3AILA 4FLFA 5AHXA 2PL5A 5AI4A 4PV7A 2HA3A 4Y2PA 4AN1A 4BZZA 2WKWA 5SYMA 1QTRA 2XT0A 4QNNA 4QDXA 1DTEA 4X93A 4BCDA 1ODCA 1XQVA 4ZREA 5CBKA 3VVLA 5JZ9A 1EINA 1QIGA 2WUGA 4BVLA 1GPKA 4QZVA 4A16A 3OTQA 4H7KA 3E0XA 4OD0A 2H7YA 3C87A 1ZIXA 4EY6A 5DNVA 1G5FA 4QLOA 1WB5A 1F0NA 2OAGA 5BOVA 4BYMA 2BGRA 1EH5A 1LZLA 2XMZA 1YA4A 1Q83A 5A2GA 3KOOA 3S8YA 4HTAA 4OYLA 5H3HA 3AIOA 4AZ3A 2XMGA 3QZUA 2WHRA 3KD2A 4MYSA 3OG9A 1FFAA 2QXUA 4OSEA 2OPHA 5FP0A 2HU7A 5ALHA 5AICA 5JD6A 5CXUA 2Q0XA 2J3DA 3WYDA 1JKMA 3GZJA 3VXKA 3T4UA 4UBKA 2OAEA 2B9VA 1YAHA 4KR0A 1X2EA 4CG1A 2QVBA 5AKZA 1MN6A 4AN0A 1EDDA 4B7ZA 4BRSA 5DTIA 4H7HA 4X7BA 2PUJA 4BE9A 2HDWA 4Y7DA 4D9JA 2GBCA 3PF8A 5I7UA 5DYYA 3H2HA 1LPNA 1LNSA 4C87A 4B85A 1L7AA 4MQLA 2WJ6A 4BE4A 2YASA 3BDVA 4FFWA 2RHTA 2UZ0A 1PJAA 1Q84A 4KE6A 4JH0A 1ODTC 4FKBA 4X6UA 4E46A 3G0IA 5HK8A 2R8BA 5HK9A 1XZAA 1XZDA 2HIHA 2PPLA 4KAAA 3I1IA 1CUHA 1JJBA 4H7EA 3K2IA 3RKSA 1QGED 2WHPB 4UBNA 2HFKA 4PW0A 4ZV9A 1CUWA 5EHQA 2O7VA 4X92A 3D0KA 1XQXA 3F9CA 1P0MA 2JGEA 4OU5A 2QS9A 5IVDA 1CIJA 1LPPA 3I6MA 1MNQA 2C7BA 1F8UA 1H2YA 2WIFA 1R9NA 2K2QB 3I2FA 4LXGA 1VE6A 2WTNA 3K6KA 4UHBA 5T4BA 3ESCA 1I6WA 5CURA 3ILSA 5JATA 1MAHA 4UHDA 1LPAB 4W1PA 3UUFA 5ALMA 3V1KA 3HXKA 2I78A 5K3FB 1GKLA 1EB9A 2QR5A 3WWCA 1KU0A 1HKHA 1MU0A 4U2GA 2XE4A 2VJDA 4AB1A 3B12A 4UHCA 2XLBA 1SOMA 1ZICA 2GYWA 3M81A 2BCEA 4KAJA 1QIHA 1ACLA 1U8EA 3OURA 5AKXA 3WLAA 4Q82A 2OQVA 2BKLA 5ALDA 3PFBA 4AMYA 1DWOA 3Q0TA 3GFFA 2VTVA 2Z8XA 1KU6A 1XQWA 5EIHA 2QJRA 1UZAA 2C0QA 5AP9A 5ALTA 3H1BA 5JADA 1BE0A 3Q8WA 3G0BA 2OGZA 3HSSA 3FVRA 4Y2UA 4Q3KA 5LIPA 1A8SA 1ZD5A 1JU4A 1W76A 2OLEA 3DYVA 3QVMA 4MQMA 3B3QA 3U1TA 3BL8A 4NZZA 1QONA 4X3CA 5LZ8A 4CIAA 2D5LA 3QPDA 4N5IX 4MWSA 4H7DA 4J3JA 4GI1A 3IURA 4PSDA 5AIAA 3DOHA 4QDTA 4EUSA 5LLSA 3KDAA 3DYIA 4IO0A 2B4KA 2H7CA 3H19A 4B83A 3H0CA 4BVKA 1CV2A 4CIBA 5F4ZA 4X91A 5JYCA 5A7FA 3H2GA 3WKAA 4NVRA 4DTCA 5DYWA 3IB3A 4U2BA 3UUEA 4AQDA 4L3WA 2OXEA 2WFLA 3PE6A 3WA6A 1CUCA 3BWXA 1EK2A 1WPRA 3C6BA 2J4CA 1UKAA 1N5MA 2XB6A 3ZWQA 3L1IA 4HRXA 5ALQA 2XUOA 1X2BA 4EBBA 3FLBA 3LIIA 4W1QA 3UMJA 3HLKA 2PU7A 1F6WA 2IITA 2XQGA 1IMJA 4Y2QA 1YB7A 4L9AA 4A5SA 2I3DA 4W1RA 4OB6A 4G4IA 3QPAA 4F5ZA 2WLSA 2WM2A 2RIPA 2LIPA 4WY5A 1ZGBA 1CVLA 5CT5A 4OB7A 6YASA 3G7NA 3LIPA 5FV4A 3A70A 3C5VA 3OM8A 2PM8A 4UBLA 2XUPA 1WHSA 1TKRA 5HF5A 2ZSIA 3ESBA 4C4XA 1NX9A 3PDCA 1AC5A 3DKKA 1OXMA 4CCYB 4FLEA 1E3QA 4CG3A 1G66A 4HS9A 3STTA 3D59A 1XLVA 3LP5A 4P9NA 1DWQA 3NGMA 1A8UA 5I9IA 4PQEA 3WK7A 5DNWA 1B41A 4EZIA 2Z5GA 2HA4A 1TCBA 3CN9A 1XZKA 3H04A 5CMLA 3W2TA 4Q05A 1CUGA 4WFIA 3TGLA 5JALA 4P93A 1W75A 2QT9A 4EY5A 3WL5A 5FUMA 3ANTA 5EIAA 1CEXA 4N5HX 2CB9A 1LPBB 3TJMA 4W63A 5D3KA 5AM0A 2WJ4A 5AI6A 4B9EA 3SX4A 4UUQA 1QO7A 4V2IA 3H2IA 4U2EA 5E4JA 2VAXA 3G9TA 3OC0A 5ALWA 4ROTA 1SCQA 3DDUA 1FFBA 2VT6A 5LZ4A 5DTJA 1A88A 1XLWA 4O08A 2ZVDA 2XI4A 3E1GA 1UK6A 1XRQA 2AXEA 2CEKA 4E14A 5CT6A 4HRYA 3IULA 1Y37A 4RNCA 2DR0A 4TVKA 1TCCA 3ESDA 1BEEA 5LZ5A 1EVQA 4Q3LA 4MYDA 5HQ3B 3FWHA 3C43A 4Q3OA 5JARA 3L1JA 5CT4A 1QLWA 4DMKA 3WL7A 3F97A 2JEZA 1XZBA 4DMFA 5A7GA 4ZXFA 1CFJA 3W06A 1XZCA 1XRLA 1XZGA 2XMBA 3VJMA 3KXPA 4TGLA 5EHNA 1MT3A 3C6XA 1H2WA 1QZ3A 1U65A 5HCUA 3R0VA 2XUJA 2C4HA 5ESRA 3JW8A 5ALVA 1P0PA 3ED1A 4QLAA 1VJ5A 1XFDA 2DSNA 4Z49A 2HA2A 1YB6A 1CQZA 1FFCA 4IHAA 5ALRA 4ZV7A 4G9GA 5T4FA 3G0CA 4MWTA 4H7FA 4LYDA 4JNCA 1H23A 4QWMA 4KJXA 2Z8ZA 1DWPA 4G4GA 5ISMA 2C0PA 5HKBA 3HEAA 3QMMA 5AK3A 1Y7HA 3OPMA 4BCCA 4BVJA 3QM1A 4G1FA 3GUUA 4J0CA 4K6KA 1QIMA 3D2AA 3C8HA 2DHDA 4XVCA 1W4LA 4F21A 1TK3A 4GBGA 1CLEA 4ZWNA 1SCIA 5ALIA 4RGYA 3W9BA 3R3XA 4EY8A 3GBSA 1AMNA 4M0MA 4DNFA 3DKRA 3A2MA 1QIKA 4LYEA 4G8BA 1K5PA 3FNBA 5AKKA 4LKOA 1H2XA 2JF0A 2VJBA 1J1IA 5K3CA 4YASA 1JFRA 1DU4A 3I2IA 1HBJA 4DNOA 1CRLA 1BU8A 5SYNA 2VJCA 3BXPA 4KE8A 3KSRA 1AKNA 4BZWA 4LHEA 1CUJA 3R3YA 3A2NA 1ZI6A 2VAVA 3ZLVA 3C6ZA 5IVHA 3HABA 1K4YA 2WU4A 2ACKA 4L0CA 4ETWA 4QWWA 4MJ3A 3AIMA 5HZGA 2CMFA 3ZLTA 2H1IA 1Q0RA 1GZ7A 4Q34A 3V9AA 3WWDA 2YYSA 2V98A 3BJMA
chains in the Genus database with same CATH superfamily
1RM5A 1LLUA 1R9GA 2JI8A 4C08A 2TMYA 2EWVA 1BH6A 3LSTA 2VZ9A 3JRNA 1YL5A 3BGIA 4KXXA 3O8NA 4U2DA 4IJVA 2FW8A 2QJFA 4X1KB 4YRKA 1AGXA 1VMDA 4QHTA 1DMSA 5KWJA 4GWKA 1FK8A 1IFXA 1NMZA 3HFSA 3PXGA 4PAWA 4HNGA 2ZBQA 1UDCA 1LD3A 5CXXA 4ZZ2A 1KJYA 2OCLA 3GXBA 4WKOA 3EZLA 3VPCA 4AS3A 4OBWA 4TM8A 3LLSA 5EJIA 2O4UX 4ZHQB 1ODJA 3O75A 2BEVA 3R7SA 3UIEA 4EW1A 4EGJA 3CKLA 5AOBA 3GRVA 1LWOA 4OP3A 1XTQA 2CLCX 1FYFA 4BNFA 5A0FA 5AQ1A 4FMCF 4QLBA 1H3NA 4IDQA 2N3ZA 4QT4A 3OPXA 2B3TA 2A1UB 4LYGA 4WWHA 3OE7D 2QDKA 3OIWA 4GM1A 5F1KA 5CVTA 4MULA 2BEWA 3S81A 1QP8A 2ZATA 2B5VA 4JKOA 4QFDA 4K0RA 1KJIA 1U80A 1UC9A 4P4GA 2IPNA 1SKYB 4QKQA 1DJMA 1U8TA 2X2OA 3PDWA 1QTIA 2BEUB 2R62A 2ZRFA 2QXYA 1E96A 5JNUA 1WF3A 3O93A 1GNQA 5JQGB 1T29A 5HDBB 1YS1X 3PA6A 4H17A 9MHTA 1DG9A 2PX5A 4LRWA 2VQSA 3LQ2A 3R8CA 4QDJA 3U5TA 3QUQA 2BZ1A 4W8GA 3AEKB 1NRWA 3D5TA 4LE0A 4A0FA 3WNZA 2JHFA 2Y6VA 2CLFB 1X8KA 4RU1A 4E15A 4HMPA 1GTZA 1JSZA 1L3BA 4JBLA 1IB0A 1S89A 1T10A 4QPJC 5CM2Z 3RYIB 3JQGB 4PNZA 2WZDA 4PTLA 3M3HA 1JI0A 2DC1A 5C8ZA 1EK0A 3R3VA 3UAYA 4LTMA 1I36A 1GZHB 1OD6A 3IP9A 1EDZA 4DC1A 4IQ8A 2W93A 3JZAA 2FZGA 2HREA 1P2UA 2QI9C 4ZC8A 5MHTA 1YKGA 3MGBA 2DCMA 4ZVRA 1YQEA 3DBIA 4RVOA 1F0YA 4DZTA 4BYGA 5FOWA 2BEKA 3G0DA 1ECLA 1SHZA 1DBVO 3SJCA 2C1XA 3CNQS 4DYVA 1IQUA 1U1GA 4DLXA 4EY3A 1IZ0A 1Z2EA 4R2KA 3W2EA 4QBKA 1Z5OA 2CFIA 3NBUA 4G0VA 2YWHA 3G6KA 5AVSA 1EYZA 3HNRA 2WJAA 2VHQA 2W2OA 4NAVA 1TAQA 2I4RA 3OOSA 4PVCA 5REQA 2H4ZA 2DFKB 3GR6A 5LUBA 4BGIA 1YR1A 4IILA 4ZT6A 2Y3IA 5ULLA 4NU0A 4B45A 4C0AC 2G5PA 5CVJA 3NANA 4WK0B 5AKGA 3UF0A 4ZYXA 1D8TA 5JSUA 3HACA 2DULA 5MN5A 1N5OX 4ZVVA 1ADBA 2QJTA 4OHZA 2PMDA 1ONOA 4OMDA 3IPCA 3F73A 3PKJA 2WG1A 3DLTA 5BWMA 1N77A 5DTEA 4N41A 3AETA 4Y0VA 2HTFA 3DL4A 3ZV4A 5FBKA 3U3ZA 3NTLA 1GGJA 3AUYA 3C15C 3II6X 4INAA 2ZJ2A 4IZ6A 4YAWA 1ES9A 5AKLA 5E7JA 5B55A 4Q24A 1JEEA 2P2NA 4JJIA 3ZDQA 4MW9A 4CM4A 1VE7A 1AGNA 5KYNA 5LA6B 3KB6A 1H8HA 4GI2A 2PZBA 2HBQA 2FUKA 2OD9A 3UMRA 4UUBA 1R5JA 2FW0A 3ZJ4A 4ZOQI 3QEAZ 4LRXA 3FDXA 1VA5A 3HVIA 3I64A 5H59A 2C77A 4ZZ1A 1X1SA 1IE3A 3JQ7A 5G3YA 1P61B 3LUFA 3FWPA 3K9BA 1YVEI 3F0TA 3PQ4A 2G8LA 1JEJA 3B5IA 3HZRA 4FEYA 1E7WA 2IP4A 4JROA 3TZQA 3HDTA 3Q11A 2PX6A 1KL7A 4XSGA 4YPOA 2VTBB 2XGJA 4B3GA 1UBGA 2J3KA 4BB0A 1DPGA 2CNWD 2AYXA 1DBSA 3BX1A 4G5YA 1C3LA 1T8SA 4WUVA 5KNBH 1GPBA 2I76A 5DK4A 5IN5A 2HR1A 1D2RA 4K26A 4PQRA 1A95A 1L4NA 2EBWA 2FX5A 5CVUA 3RE1A 1E5QA 1WLYA 1XL0A 1LS6A 1OSNA 4W4TA 3PICA 2GSWA 3C7AA 4N9QA 2XUKA 1QOQB 1QH8A 1UJBA 3C0KA 1NHGA 2H06A 1EDEA 3HMKA 3IRVA 2RI6A 2C9CA 3OX2A 4V3BA 4H31A 5KKAA 1TUEA 3HUEA 3CBQA 3BA1A 5C52B 2PK3A 3KYIB 1X92A 2HRDA 1N8SA 2JFPA 4JCOA 4YJHA 1VSVA 2EBHX 4RA9B 3OLZA 1A72A 3I52A 3PFNA 4S1WA 4CKEA 3EQ8A 1Y3AA 1HE5A 1A71A 3HKEA 4F4FA 1FS6A 1U2DC 2V0NA 4G5QA 2WTMA 4CMIB 4PX9A 1N2CA 3PJFA 2R6DA 2IT1A 2ZS8A 4KIGA 4LSGA 1D1TA 1FJ2A 4LJ4A 5HCNA 4JR1A 2EW8A 4QX6A 4AY4A 4DR2B 2ZJZA 2XCIA 1XVUA 4LJRA 2IE0A 2H59A 3KE9A 4KGDA 3HV0A 2XSZA 5KVSA 4IGKA 2G0TA 3DZ8A 5DOVA 3T0GA 1V2GA 5DH9A 3RUCA 1FQKA 3WGMA 3FOZA 1UBJS 3H9GA 3UGKA 1OZGA 3LNTA 4B3RB 2IYZA 1RAEA 4BUJA 3C85A 1GG5A 3H86A 2RGUA 3LUBA 1E1CA 1USWA 2P9QA 1Z5PA 5G40A 1NVBA 2J3EA 2VT2A 3HR4A 3JWEA 4OG2A 2PIDA 1JE1A 3KPJA 2REQA 4AUMA 4OB8A 1OFGA 4G9EA 1EFUA 1GPNA 1YS4A 4J0FA 1VJ1A 3D7RA 1HR0B 4FYHA 2OFOA 4C4ZA 2FUG1 2LZ0A 1OLOA 4RVHA 3CZMA 3RIGA 4XWWA 2XUGA 1V7ZA 5FIUA 1E3JA 1BQEA 1SUIA 2WD8A 4LUCA 5EKUA 2HN9A 1JUDA 1NI5A 5CITA 1VA4A 5KKNB 5AKHA 3N8NA 5F2EA 3D2BA 4GHWA 5F76A 1NVAA 4OV6B 4U2KA 4BNKA 1NDQA 1GTMA 1KVRA 4I8IA 2C7RA 2I6FA 1ZI8A 4CL3A 1XCGB 3R4VA 3U7QB 1AA6A 2P90A 1VI5A 4L5IA 2Y68A 1SCUB 1C3EA 1QGAA 4KIUA 4KQXA 2G63A 1X15A 1PKEA 3HRHA 2ZJ6A 4P5PA 4BVGA 1QQBA 1XMVA 2QQEA 1A8HA 1HMYA 5KTRA 3TFQA 3K0EA 4HQKA 4B2PA 2HEGA 1FP6A 1ZNYA 1ZGJA 4AVYA 4H16A 4FNOA 5AVUA 4DQ0A 3BTUA 2QN2A 3QELB 4OMCA 1C7EA 2O0KA 1T6YA 2YH2A 1KNQA 3GQVA 4KNWA 4TZ0A 3L7BA 2V7VA 1W25A 4J16C 3IVXA 4IQGA 2CCJA 2IXEA 3IPAA 4PYNA 3HJBA 4RD6A 4JUIA 1IN6A 5G0WA 3OM1A 2F6RA 1E3EA 3C3WA 4JR2A 1EZ4A 3UK2A 2AMLA 2CLOB 3BORA 4TT3A 5EMMA 3LBYA 4OO3A 3IUQA 1R3UA 5A06A 1Z7YA 3A4NA 1F7VA 3H1PA 3SYTA 1TADA 3EBPA 3Q4GA 4FBLA 1M73E 4PS1A 3IQGX 3NH6A 4Z5XA 1BXGB 4MMXB 3GJ6A 1T43A 2X5OA 1BROA 2FJ0A 2WM8A 1EMDA 3AFIA 1RXYA 3R3UA 3R44A 4J0IA 4REQA 4X63A 5C7LO 3NHKA 1C9EA 1CHDA 2WT9A 3V42A 1MOPA 4BJ1A 1HT0A 4K9OA 2YVLA 2QUHA 3F5DA 4HF7A 4W9MC 1KE1A 4TWJA 4EABA 5EN4A 5BVHB 3BICA 3HCBA 1EWVA 1V11A 2DFPA 4KEAA 5EIBD 1VL8A 2Q7OE 3KQVA 3QKRA 5IS2A 4B43A 4BTLA 3ZVNA 1T8RA 2I3BA 1FMJA 1V43A 2Q1YA 2PGOA 4BNYA 2P6NA 3JYHA 3AINA 1WXDA 1XZMA 3INYA 3JQBC 1U4SA 2BAGA 5JC8A 4IHJF 4B7UA 5FUWA 1FPMA 4EUKA 4GQBA 2NOAA 4B8YA 4PS0A 2VPPA 2W71A 1AX9A 5CW1A 3ZW8A 1X7DA 2ZYWX 3SP1A 1WKCA 4KR2A 2AE1A 1KBZA 4E5SA 4BNTA 1Q7BA 4GOMD 3KWMA 4L2IB 2HWYA 1GU1A 3Q3EA 1OYWA 5ILOA 2E4VA 5HOQA 5LQRA 3R9WA 3G02A 4HUJA 4I36A 1O6GA 3PPXA 2C5GA 1Z4LA 2MIIA 4MPRA 5JCZA 1X7GA 3UMYA 4DDHA 5T3UA 2X58A 3HGQA 4X1YB 1SUEA 3FYUA 4C76A 3Q3HA 4G67A 3M5WA 1T9AA 4UU0A 2EERA 1OI7A 2H1VA 3ROGA 1LQ2A 1GGVA 2G3YA 3HCPA 2A9FA 1R0RE 5COBA 3GFQA 4ES6A 3SXJA 5IKXA 2PLFA 1SC6A 1VKOA 2YXEA 3CQ9A 1SZPA 4DM4A 621PA 4V0NA 4TRMA 5BW6B 1Z0JA 2XUAA 4HDMA 2JFWA 4N7JA 3SBDA 1PL0A 2J67A 2W2MA 3VFDA 1WJGA 3QKIA 2QV0A 5DLDA 4DF3A 2ZUFA 2Y1KA 1ZD1A 3QVWA 3L7KA 2GBLC 3EJWA 4LF7B 1MQSA 1W44A 1ZD3A 2A8YA 3STVA 2PZGA 3M4NA 2C4MA 4F0JA 3IELA 2HY7A 1DLJA 3EH2A 3HUFA 3PT9A 4FN5A 4EP1A 2Q5EA 1GFIA 4LXIA 2PSEA 3ETEA 1STOA 1TNDA 4QXAA 1KDOA 5F2OA 5JMTA 5BOSB 2YJ3A 4F60A 1MC1A 3SU8A 1IPHA 3VOTA 1XRPA 2MHCA 1IHPA 3M6AA 1T8PA 3DAGA 2XZPA 4UMDA 4ZO6A 1RKXA 3PTAA 3MCAA 2RAVA 3SQNA 4GVXA 4BP3A 1XZIA 1Q7TA 1UODA 3GARA 2CZCA 1I32A 2AQHA 3H2JA 2I1LA 1UMBB 5EYPB 1HNNA 2EQBA 1NP7A 3BMOB 1W1IA 4BGDA 4X5OA 3HK2A 1P19A 2VDUE 3K1JA 3AB8A 1LPOA 3TW6A 1JR3E 4ZOLF 1XWFA 5A4KA 2UUAB 3GGGA 1MPXA 2LTAA 4F9EA 3EIHA 5ECWA 1SXJC 1PCXA 5LYJA 1LPMA 3EAGA 3S2FA 1W9HA 3M4JA 2FPKA 1HFWA 4QDUA 4AK9A 4QQNA 4P54A 1G5IA 3DHYA 1WETA 1LA2A 2GHIA 2OOSA 3LS2A 1DG1G 1E2UA 3AG5A 3CRMA 3HLYA 3PWTA 4RK0A 3KQSA 1HOXA 3I6BA 2QOEA 1DKUA 1US8A 1Z0KA 2NN3C 4KJZA 4MKFA 4QGGA 4JJFA 1Z39A 3O2NA 4MGEA 4A1OA 3FE2A 3O9MA 3LNCA 1A2KC 5EG5A 3BD7A 3K0HA 5F7XA 5BN4A 1EFPB 2TS1A 4I08A 1DO2A 3G5LA 4MV7A 4PFSA 2VDOB 3DBHA 4QU9A 5FPHA 3DJFA 3FBWA 5JCXA 1N2HA 1R8SA 2QGFA 2W2NA 3WDSA 5BRJA 3EFOB 1IXYA 3P32A 4KUHA 4BMOB 1EUCA 4ZOAA 2G28A 4ZRDA 3TOXA 3ZC3A 2AKEA 1WKBA 2HSJA 4BVAA 2ID8A 5J43A 5EWMA 1K6MA 2BGTA 2NU8B 2ZU6A 3V32A 3P7MA 2QX6A 1JIKA 5KYUB 1ODSA 4LC1A 4YJFA 2PX0A 1FU4A 3BJRA 5I7AA 2RGEA 3OLVA 4DUGD 2GYVA 4EO4A 2ECQA 5TQ2B 1QIDA 5KTOA 3MQ2A 2HSWA 1Z08A 1IEQA 2I0FA 1S2MA 4Q4AA 1OTHA 4Y8VA 4HAWA 3V8PA 2MSLA 5IW8A 5IK2A 1G8MA 2GCOB 3ZBQA 3CNHA 1A1VA 2YWBA 4Q9AA 5ALLA 2BR5A 3PRJA 2F3UA 3T5CA 3BGSA 3NHRA 5HJ5A 2VP2A 3VU3A 3GJ0A 3CR3C 3ESXA 1ORVA 4UCFA 2FR1A 5LBTA 3H75A 3KHSA 1BTOA 3N5KA 2DJ5A 2HZBA 3H5RA 4FI3C 1CZNA 3C5HA 4RIHA 4KGZA 4UUPA 5BPHA 1FRQA 3QPCA 4WLNA 2X8AA 3ZNNA 2YV1A 3KOMA 4G26A 1JDJA 4ZC1A 4L78A 1ZWLA 1I01A 5AOCA 1I2MA 2PGXA 1G21A 3DV0A 3SR4A 3HCOA 1S2NA 4GZ3A 1J8VA 5EKSA 4DIKA 1KI1A 3HY4A 4G01B 4TXNA 4BHTA 2H1LA 2SICE 5I48A 1AXGA 1MIHA 4R6XA 4BO5A 4EYKA 2GPJA 2F59A 1VLVA 3V7YA 3H17A 2VDKB 3WKDA 2CNLA 3R41A 3E7DA 4W7SA 2E7ZA 4ND1A 1A76A 2ZJFA 1E9SA 4RE5A 2Y76A 5LJLA 4YA6A 3RROA 3JWHA 4BX0A 2PMCA 1IOWA 3K4PA 3QU4A 4UATA 3F5MA 3CX8A 4RANA 5EGNA 3VKFA 4E94A 2J3JA 5CT9A 1KETA 4LHZA 2CLEB 1SCDA 3WGNA 4QDOA 4TWRA 4D3YA 1KO8A 1YS2X 3KR1A 3AG6A 4Z99A 3M3DA 4MR9A 3R7FA 4HWTA 4KDRA 4ERXA 4EHDA 5IRCD 3MJDA 2OV3A 3NDBB 3LUDA 1DHRA 2WSSD 1CDDA 1MVOA 1ZJYA 1Q95A 2CLLB 2IEDA 3AZQA 2J9FA 3FTQA 3HNOA 3I1YA 4FFRA 4WIAA 2ZYHA 1UK9A 4CQMA 5L6MB 3U44A 3D8HA 1U7XA 4ZT4A 1I6MA 1QSGA 1MC5A 2AR0A 4FCVA 2D2EA 3AEUB 2VQEB 2FDCA 1H3FA 1ICEA 1MFPA 1Y6RA 4NBNA 4NBTA 4RM2A 4XDYA 5DXAA 1PJRA 3UMVA 4ITVA 3WSWA 1N1MA 3BK2A 2GASA 2Y1LA 4FXOA 1HPLA 1QF9A 1XAGA 4WL0A 1U8XX 3PNLA 2XUZA 3R09A 4H2DA 4L5JA 4JJ4A 5D51S 4L0MA 5A05A 2C2XA 5TY0A 3VTAA 2Q4OA 3DS8A 4KK4A 4CJXA 3BMNA 4HSGA 1AG9A 5GTDA 5HZHA 1RPJA 1HTBA 3GA0A 1S8FA 4TTPA 1F12A 3VVMA 5C81A 5E3IA 5EMNA 4M9UA 3QUSA 2JEYA 4Q4JA 3RREA 3F7TA 5EFZA 3N2IA 3DT8A 2E18A 1NOIA 1Q21A 4LJLA 4DW8A 1BD3A 1PHPA 1XZNA 2YVUA 5JBIA 1YZHA 4U63A 2HUNA 2RBKA 3K6JA 5HIIA 1Y7PA 5D85A 4IIYA 2YBEA 4Q1VA 1OLUA 3U19A 4L07A 1V8OA 4DM7A 1E2MA 1SC3A 2BHSA 1HDOA 2Y99A 1H69A 3DJYA 4HQNA 4XJTA 3THSA 4MVJI 2AJDA 1ZVKA 4BMSA 4I9FA 4DCOA 1XPJA 3V4OA 4GR5A 2NPFA 1UKCA 3W5CA 1NNUA 3NPAA 4JBIA 4DA9A 3E5NA 3TG8A 3H7AA 2V9ZA 3TKAA 4E4YA 3RCBA 4DIOA 3GA5A 1JR6A 1NVVQ 3CLKA 4KXFB 4OQ4A 2VOEA 4J49A 3MJRA 4AUNA 4CL8A 2WKSA 5DSTA 4IXMA 4GOKA 1RWOA 1H2HA 1SG0A 1F2VA 1XMXA 1YASA 2FR0A 3B52X 1RHKA 1NW5A 3B9BA 4J6EA 3AH8A 2ISSD 1YZKA 4WOKA 4WOCA 4M87A 3NTVA 4M1MA 3CB4A 4DIEA 2ZE7A 3GUYA 1JJFA 4NDNE 3BJIC 3TTTA 4E2WA 5BP7A 4GI5A 2NXJA 1MRSA 4NFHA 1LK0A 1XX6A 2XVMA 1ICIA 1C80A 1T2UA 4R1MA 4LNAA 3W90A 2PZLA 1RTKA 1AS0A 1Y89A 1ZZEA 3A1SA 2QM0A 3IMEA 2PS9A 5FFFA 5JVDA 3GDOA 1T3GA 3WNBA 1U1CA 4ZTUB 4BVFA 1EEHA 3LDGA 1WBDA 2CHFA 2P30A 3DR3A 3WWOA 3E7WA 3WHPA 1OT5A 4HC4A 5C9ZA 3NV7A 1RYBA 2RHGB 3E4CA 4G0ZA 1JS1X 3UTCA 3FZQA 1YT5A 2IPXA 2J32A 2B1GA 3IIIA 3HGMA 4KYIB 1F2UA 3U13A 2GN0A 1F3LA 2VNHA 3BXOA 4LFCB 4AYWA 4DKXA 3JYOA 3DEKA 5K8VA 1W87A 1ESCA 1UBRS 3FRIA 5JH7F 5EKDA 3THXB 1EP3B 4BATA 3JD2A 4DT1A 2WA2A 4RMIA 1HFKA 1PGJA 3JWJA 4EFDA 2VDVE 5A7HA 5A5DA 5HKAA 5J1SB 4CWAA 1DNPA 2XCQA 3IBCA 5EZQA 1TQHA 4MHOA 5I7FA 2D5CA 1QVVA 2PEZA 3AXTA 3KZCA 2P4EA 3ACDA 1O95A 3IVGA 3UT6A 2WAOA 1RKQA 4KNVA 4YRIA 1C1XA 1KMMA 1NA5A 3LY9A 4RUKA 4EI7A 5JNRA 3WS7A 1KAOA 5KPJA 4E31A 2A9RA 5HRUA 1ZM2A 5I7HA 3TUZC 1N5LA 5ER9A 3REQA 2DH6A 3DL7A 3NXSA 5FR1A 3SC3A 4MV8A 4O2AA 1H8EA 2OWEA 1DAKA 3BXFA 4PWYA 3TW0A 2XIJA 4F3NA 5AVYA 2P6OA 4HDCA 3NDIA 4WHMA 1SU4A 2IZ6A 2V5UA 5F5XA 5I5GA 7GPBA 5E9QA 2G80A 1TAUA 1VFPA 2AEMA 3DM9B 1N2EA 4XD7A 5I8PA 1WY7A 4GPEA 3UWDA 3EQ7A 3MS2A 3TQCA 3ENWA 3RC3A 3TF5A 4AKTA 2NT3A 4ESOA 2UYGA 3K3PA 2VJMA 5AHWA 2XMSA 1N75A 3VVBA 3AF5A 1NR7A 4E4RA 4DSAA 1GDTA 3KSMA 4M76B 4YO8A 1DT3A 3RFUA 4H1TA 5IT0A 1D1PA 2VH1A 5EZ5A 2OXFA 2XCUA 2YCLA 1RPTA 2I4LA 5FKJA 1HM5A 1VIAA 2X5NA 4MTCA 3CSUA 4ENTA 4BWGA 1PQPA 2HDHA 2OR3A 5IBRA 1GCOA 4X7BA 5JS2A 1G38A 1A9SA 2YHIB 1UJMA 2NO0A 3A06A 1E6KA 4GBED 1FCJA 3I0MA 2YZ7A 1RVV1 2GCEA 1EUZA 3RLFA 1FDSA 3CVOA 4EJSC 2CBZA 1N9GA 1KP3A 1XZJA 5EXEA 5FWNA 5AJHA 4JLDA 3TXAA 1Y8AA 4C20A 3WAJA 1WS6A 4N8EA 3WZ2A 2P1ZA 4BO9A 1QF6A 1C41A 1ZP6A 1YZQA 1M2OB 1SCKA 4X1KA 1EWKA 4PZLA 4FWBA 1XTKA 5ALYA 5HBRA 5KCMA 3ZVLA 3GT4A 4BUZA 1NLMA 1FZQA 5B1DA 4KRXA 1G7SA 4P7FA 3KO8A 4JGIA 1PJTA 4KQWA 4QYWA 1GQRA 3FHJA 4KO8A 4LGCA 3ZU6A 4DM3A 2FSHA 2MSDB 1IDN1 4A6PA 5JI3E 4H6XA 1N8NA 3RS5A 4DZRA 3IIJA 3VR3D 3VZQA 4MS3B 1J2YA 1EHCA 3FYDA 3H13A 2JFZA 4QRHA 5FLEX 1MBZA 2CE2X 2A1UA 2I34A 2XNJA 5GAJA 4CM5A 2KSQA 1LTKA 1PRYA 2ZRIA 3BCHA 3GOQA 3MQFA 3L4KA 1U02A 2BDUA 3I2JA 2J6IA 4C7BA 1YKFA 2B7BA 3QY0A 4II3A 4UD2A 2IXAA 4YQZA 2I2CA 4CV3A 4GE0A 5T41A 3AUAA 2GNPA 3DC7A 5M04A 2CFSA 4GO1A 4FGZA 1ABEA 2BEUA 2WF5A 3IQIX 3KEFA 4Q6WA 4Q9IA 3UT0A 3FOCA 2ODNA 4IZHA 5LD2B 2UYHA 3M70A 4B3DA 2GD2A 2CWWA 3FMOB 2Y0DA 2AWNA 4JMLA 1E20A 1QG2A 3A9SA 3AERB 1M2VB 2QQFA 2Z2JA 2VYVA 3AEKA 4GLBA 4IZOA 3T7JA 3IEMA 1VHJA 2O0LA 1FNSA 4M38A 4QATA 4RLQA 2DPXA 2XBLA 3MBIA 1QAOA 2AEFA 4OUKX 3ZBTA 1XC7A 4OAPA 3EGCA 4G5HA 3RYIA 4FC6A 3JQGA 3TQHA 3WI7A 4DVJA 2XZOA 2OZPA 4YEDA 3RBZA 2A7XA 3K4QA 3K9WA 4MPJA 2QN6A 5JANA 4HV4A 1A5BB 1Q3KA 4PLTA 2WEKA 1A82A 3T15A 3ZGNA 5H02A 1LF5A 1QGZA 4AJKA 2BUBA 1R9JA 2H9IA 5LXTB 1QPZA 3ZDCA 1THGA 1E18A 2C9BA 3KL4A 3GRRA 4JVMA 2R1UA 4H0NA 4HQFA 1TC1A 4TV9A 1UPBA 4HEQA 4XR4A 5ALKA 1CWUA 2FN9A 3A1FA 1YZYA 4D56A 2ZUDA 5D6OA 1W85A 2QDXA 4Z0TA 1ZGZA 5GP1A 3JQAA 2VKQA 3H5WA 4RHCA 3VSAA 1PSWA 1M3SA 2FCAA 3E18A 3QYPA 3ZY3A 3NJ4A 3C4JA 3QFFA 4MUKA 4NJEA 4Q7QA 2IV7A 5HS6A 2XUHA 1YMQA 4FGSA 4IGEA 4LHXA 4IMPA 4RABA 1PJ2A 1BU5A 2AOTA 3KB8A 4FE7A 4YK7A 3WMXA 3ZUPA 1H2BA 3BIXA 2V5AA 2VQ6A 1G20A 3NBMA 3ZS8A 4YRAA 4BX9A 1AH2A 2B94A 3E3NA 2W7TA 3PNQA 4YRNA 3FDFA 1RXCA 4FFMA 4WZAB 1GXSA 2QP9X 2ZG6A 4J4TA 2JK0A 4B6QA 3K8OE 2J9ZB 2ZDHA 2ZSJA 1JQBA 3ZZNA 2VYNA 1RQNA 3OQNA 1D1SA 3TD2A 5ENZA 3H9JA 5FNVF 2P9JA 4U7DA 3EPKA 2QM7A 4JBNA 2JJ1D 1Z8NA 4XB1A 3EZNA 1MX3A 5IF3A 4A26A 1VRWA 1SUDA 2VCHA 3P9XA 4QA9A 4MB0A 2B20A 2OECA 3L0ZA 4RTNA 4JWTA 4LC0A 3F67A 2VJOA 4MKZA 5KOJA 1YQWA 1FLAA 3ND6A 2ATIA 4ZALA 3NGXA 2CUZA 3QLEA 1Z26A 3IAFA 4P3OA 2DSTA 4JQSA 4JLVA 1GTG1 2ZSKA 4M9CA 2Q5IA 1LBSA 4FYXA 2EBFX 2GEFA 2RAUA 1CZLA 3ETJA 1UJNA 3DEIA 5TV2A 1KBQA 1EXVA 1V3VA 3HEBA 3BGDA 1GOTA 4HY3A 1FP7A 1NN1A 5J5CA 3H5OA 4W5TA 2AZDA 5KSZA 2D5AA 4L8WB 3HJAA 1GTVA 1XZHA 2HDNB 4A4DA 4D5GA 1E2EA 2R96A 3TLBA 3LOPA 4MIOA 3TX6A 4GXTA 1D8AA 3U7HB 2QR3A 1VLQA 1Y6JA 1GUYA 3NX4A 4UPDA 5EHGA 4RA9A 2WMOB 3RSHA 4U7JA 2AI3A 4LTDA 2Q5OA 2ARKA 2HOQA 2TMKA 3X1WA 1VIVA 2AK2A 4CMIA 3BS4A 5B30A 5CXQA 5I7EA 1L5YA 3T7DA 1Q3TA 2K5UA 1NNLA 1X80B 3PNMA 3WBBA 4BO7A 4XM2A 3O2SB 1EK5A 1NC3A 3QEJA 2GBFA 5FAXA 4QPPA 4Q5IA 4JYMA 5DBHX 4FN4A 4M4SA 5TGDA 2C8LA 1ORWA 2WTXA 1F6DA 1XNGA 4D9EA 1X9GA 3N0TA 4ENRA 1NKSA 5IWCA 1RIFA 3B6ZA 1BFUA 4PNPA 3ZK7A 3FLMA 2EZUA 3A1DA 1Q17A 3KXIA 4UDYX 3WGZA 4D3ZA 2UVQA 4DXDA 1XIVA 2E5FA 3NUZA 4TQAA 1KJWA 1J4AA 3FFWA 4MP3A 2REBA 2Z09A 3GDWA 2YDXA 4MJ7A 1KWKA 1UXOA 3A3NA 2H29A 2OUIA 3SF8A 4YUWA 2H2FA 3IVRA 3SVTA 3ZZ1A 1QFMA 3IKVA 1A4XA 1ZONA 2VSYA 4GEKA 2H4HA 3GFGA 4OJNA 4RZUA 2HU8A 3N5CA 1LFAA 1Y5NA 2FR8C 3ENZA 4R1LA 3ZWBA 4RMNA 1UFQA 1RLTA 1R8YA 4CIVA 3M6IA 1TMKA 1QHSA 3FPBA 4QNRA 3WBJA 5EXPA 4EVQA 4CN9A 1ISPA 3BXGA 2BR3A 3P71T 3CUKA 3S2SA 3FCEA 3UMCA 4ZTZB 2WU3A 3K70B 2BTQB 2ZJ7A 4QXOA 4YJ2F 3ZCQA 1WULS 3FSGA 1BSVA 3WISA 1NW6A 4JYBA 3HL4A 4Q9KA 4EPRA 3K73O 4MUEA 1AN0A 3K5HA 4Q00A 3U7QA 3FCXA 4EUFA 5JNLA 4JC5A 3OOWA 2BISA 4QXMA 3SHWA 4BVHA 4P53A 3HWWA 5AM2A 2WJIA 2X6TA 2ZIFA 4BNNA 4HG2A 3ODGA 4XIFA 2XCSB 2CDNA 4W8OA 2VHJA 3OPNA 1QMPA 3F9IA 3KWLA 3QELA 1JA1A 4AMUA 5JMWA 3UMMA 1RADA 1L8XA 3WLLA 2HNKA 2VNIA 2WIGA 4XARA 5FPYA 3L0IB 1YAJA 4FLMA 4INOA 2NVUB 3H87A 3NONA 1FXWF 1GRNA 3WKBA 4AMVA 4F9FA 3PX2A 3EZYA 5DISB 5K4AA 3OA2A 3FYTA 1SHLA 3EG5A 4Q9LA 2Z6UA 3C74A 1Z0DA 5FL7D 4MGZR 3P4XA 2IS2A 5JSQA 4NCNA 3K09A 3SR3A 2XA1A 4AJ2A 4EPXA 5DWDA 1NPYA 1XNJA 4HEHA 2Q41A 3I9LA 1BXGA 2ZEJA 1Z63A 1C9MA 1R5OA 2BCGY 2JBAB 3USZA 2AFIB 1MX1A 5TB5A 1TMOA 1VMIA 2GK3A 2V6MA 5D3MB 1YU9A 3DBRB 3VDRA 3TE7A 5EIXA 1UQUA 2GN1A 3B13B 2ECOA 3NHWA 1YZTA 2ZYUX 1L7MA 3MINB 4MUXA 5AKIA 4ZT3A 3ONWA 2FPWA 1YOVB 1Z17A 2UYYA 1DI0A 1CETA 5TMPA 1NF3A 5BVHA 1R1DA 4MRRA 5DBFA 1XDGA 1GA1A 3KAQA 2GD0A 2RHJA 4E0BA 4WY2A 2VYFA 2YN0A 4QIHA 4FOPA 5TGTA 1TJNA 3M34A 4I3FA 3UHFA 4H4CA 1OXXK 3AMVA 3EG9A 2EJVA 3GEMA 1ZCZA 2C94A 2X19A 4XXHA 3PFWO 3DM5A 2DPMA 5AI0A 4N3NA 3QW2A 1CJBA 1J56A 1V9SA 2IUTA 2QYOA 2V98A 2OKGA 3BSFA 4I5DA 1ZUIA 2JFQA 4M1OA 4R9RA 3T9BA 5BNIA 4G23A 1YRYE 3EVEA 4NLLA 2PFSA 1OCEA 4OHUA 2FXVA 3NORA 3PYLA 3SSAA 2OESA 1BYUA 1Q0LA 1MFZA 1RAGA 1RYEA 2WU0A 1JIXA 3H3JA 2QV7A 3KLOA 3OT5A 4PRZA 4RZXA 4WOJA 5IHXA 2O0HA 4FZRA 1A9XA 1QMGA 3PR1A 4D2IA 4OP2A 3B1JA 1FP1D 3KXKA 1R5BA 4EPYA 2GBIA 1G42A 4QVIA 5LP1A 4NZOA 2A4KA 1SY7A 3EZ2A 4RZ2A 1I94B 4LEIA 4ER7A 3OCJA 1XN4A 3QYFA 4CM8A 4XQEA 2Q99A 4Z2AA 2X15A 4L22A 1V4VA 5JAPA 2AOWA 2BGJA 3FCYA 4E88A 3Q5GA 2XD9A 3C3DA 3NWEA 1JXOA 4XRGA 3X43A 3IBFA 3ZV6A 4DCGA 1M6NA 3O2QB 1TVMA 5JD5A 1QV6A 2X6RA 3VTKA 4G8CA 2VDWA 1XRJA 1VL6A 2GZRA 3STYA 2C7PA 1JGTA 3T9FA 1O8CA 4AWXA 1XSEA 2BW0A 3PX7A 2Z2XA 4RZIA 2OOKA 1PWXA 3A2LA 4P3KA 3WGLA 1H9CA 4JP3A 2D7DA 2W6CX 2VUSA 3FYUC 1QCCA 2C54A 4IL5A 4CGZA 3W77A 3G2JA 3K9HA 1ODKA 2FSPA 2JLXA 3X1JA 4EA9A 3IMCA 3DBLA 4CN8A 1E9CA 1UEJA 3FPKA 4HNUA 4RDCA 2QRMA 2P4HX 3W1VA 5KIAA 1XD9A 3DDCA 4KSYA 3QJ5A 2AUMA 2HT6A 5C4GB 1KSGA 4BPBA 4M6WA 1RM3A 5LLTA 4AY5A 2J3QA 2XYRA 1SB8A 1LK5A 3STUA 5EYPA 2YYYA 3ZLUA 3VPDA 2IU4A 3NC1C 3T7KA 1T13A 1RACA 2HA0A 2NT4A 3K72B 4K87A 4MQUA 4ZQBA 3VO1A 1W4RA 3UK6A 3U9LA 1SBZA 5LLDA 5MGBA 3M49A 1TZ2A 4Y1RB 2V7QD 4CKBB 1J0XO 4LSMA 4QRDA 1NPDA 3I45A 2YC2C 1CY6A 2H57A 2GN6A 3OQOA 2VDLB 4NBKA 2GO1A 3UT5A 4TMWA 5DVZA 4PSUA 2PRSA 4MVJE 4ZVMA 5A4FS 3P4YA 4IJUA 4IHJB 5EKXA 2OCAA 4ZYWA 5EJ5A 1TEXA 1EVLA 2D8AA 1GCIA 1Z6TA 4K6HA 2BVNA 3OUUA 2HPAA 4O5AA 4R8KA 4URHA 5CDHA 3AF6A 5JPDA 1GZSA 3BTOA 3IQZA 3N8DA 4IUYA 4J91A 4KQHA 1LEHA 1B6GA 2FWAA 2O8NA 4UEJA 1EFPA 1JL3A 2VP9A 3RANA 1D4ZA 3A6FA 3EFOA 3EGDA 4M0EA 3CX6A 2ZIAA 2Q1TA 3EIFA 2IGBA 4IIGA 3RWMB 4E33A 2ETVA 2XMCA 2ZPUA 3EEQA 3RUIA 1V6AA 2Q2WA 2E5WA 4PR3A 4WVLA 3FMPB 3F78A 4LHYA 1E3MA 4C2BA 4BP8A 4ZCQA 4YCLA 3OEED 5JAUA 2B82A 5KYUA 1BS1A 2H9AA 4MCAA 4LXYA 4R40A 1N5DA 2NUPB 1TU4A 3PPIA 2CFRA 2JS7A 2YUIA 3EVNA 2P78A 4JGGA 4MKRA 5TQ2A 3B7PA 3GGSA 4C4YA 1B1AA 1BQ3A 4C2TA 1PTKA 3G5MA 4K6FA 421PA 3QPVA 4MRNA 3B7WA 5AIBA 5AKYA 5GVSA 2DJIA 3FLEA 1T5SA 2ZJ4A 4KACA 5CJPA 5DF1A 2WY2D 5A3JA 3WAGA 3MZ0A 1W6RA 3HBNA 4Q03A 4PG4A 4Q9NA 3ASVA 2ZSUA 3ET5A 4K86A 1OYOA 3H83A 2W8BA 4CODB 3ZTYA 1JIJA 1THZA 3NR2A 3QA3E 1ECCA 4V2UA 3H97A 1F48A 2VDNB 4HGRA 3CLRC 2QK4A 4O8CA 1I10A 1GG2A 5GONF 2E49A 3P2KA 3NDJA 1M75A 4JD5A 5ECGC 4AICA 1PKXA 1VZ2A 3HCEA 1WW3A 1E0JA 3AC0A 3R5FA 3PIIA 4LF4B 5G0SA 1CUSA 3DWFA 4NTZA 4D81A 5JEEA 1DO0A 3MMNA 2EYQA 3Q9UA 4GT1A 4ZZIA 5HF6A 1K6EA 3NYRA 2V9PA 3P2EA 3OJXA 3QG5A 5FD8A 2P9HA 3PWSA 3U9TA 1T3LA 1ZNWA 4J0EA 4WXMA 2PQ0A 3LUJA 5FT9A 3ZYCA 3CCCA 1JJIA 3KOYA 3L4BA 4XLLA 5CH8A 4ZOLB 4BAZA 4TKLA 4UREA 1LUAA 5KAMA 1FS5A 2VUIB 3DHVA 4R1QA 2RH9B 1NAIA 3IO3A 3NHJA 3VR4A 3LC2O 5FRDA 3O38A 2ZAOA 1WXFA 2FWPA 4Y6OA 4EPTA 5FTMA 1NBMA 5KC8A 1CW2B 4HCJA 1OYVA 1NV8A 2GKGA 3KU4A 3DXXA 4MCHA 5LR6A 3JCZA 2R4TA 4C30A 3PNVA 1I4EB 2P91A 3QVSA 4KOAA 2ECFA 2JLZA 4F72A 4F1WA 2OTCA 3N0XA 3T9AA 1ADCA 1RRCA 2CSXA 2ONJA 2H1CA 1P2VA 1ISRA 5C37A 2CT8A 4NCAA 1KORA 2F64A 3C8MA 1Y1RA 3K1AB 1Y1KE 2BHNA 3OU7A 3EPRA 1EWRA 3KJFA 1Q0QA 2QSZA 2RHCA 4XUGB 2QD5A 4IEEA 4W6ZA 5J3JA 5ALEA 1VLJA 5CLLA 5HRCA 3CNEA 3LL7A 3RRNA 4M60A 5BW8A 1BVRA 3MXOA 5CM8B 3BGWA 1VSBA 3UAOA 1WOMA 3T1TA 2QLLA 2WP0A 3LVBA 4NZPA 1MOZA 3A32A 4UDNA 3GELA 4NU6A 1QPBA 2X6QA 1FRVA 3FA2A 1UZUA 2H4WA 1WSDA 1ZK1A 4IIJF 1V0JA 4WACA 4YP0A 3OZIA 5DJ5A 3S5JA 4C03A 5KOIA 3C45A 8MHTA 3DCNA 4R51A 3CKYA 1AGPA 1G7CA 3Q5EA 5B2ZA 3S27A 3TPCA 3AWIA 5CDFA 3KKQA 2XB2A 2FWRA 1T25A 3LW8A 1CJSA 3KG2A 1KE2A 3MM4A 4PC1A 1P31A 1PUXA 2HO5A 1T8YA 4E11A 2H3HA 2OFWA 3T3DA 1X6VA 2FE4A 1VBNA 4XTRA 5K0GA 4YXWD 4IFIA 1NJSA 1UEIA 2PL9A 2FA9A 3GD7A 4Z7QB 1USUA 1ODIA 4RHTA 2PT5A 1KEZA 2GPAA 4WZBB 4NOKA 1V5IA 1OUMA 2QF7A 4BMNA 1S2DA 2QI9F 3O9ZA 3DE3X 1V8DA 1M1NB 5BSTA 4ZCMA 1P72A 2TRSB 4QBTA 1HF3A 1G4UR 1G5QA 2O8EA 1BCRB 3EC2A 2WR8A 2FPMA 3TS1A 4B6OA 3D4BA 2QZ4A 3AILA 2HIAA 4P4LA 1JHZA 3C6QA 2PZMA 3KSDO 4O2RA 4R1NA 3VGPA 4PV7A 1VSUA 4ENSA 4Y2PA 4OQEA 1AD2A 1EGVB 3UUWA 2R60A 1LDYA 2CCGA 3NNNA 1OGJA 4QNNA 5BT8A 3HDJA 4QDXA 3QTTA 3N7AA 4X93A 4KQ6A 2W83A 3AR4A 2JFGA 3MTJA 1KYQA 1ODCA 1CP3A 3MT8A 3X1DA 5IYZA 2YOFA 3LXRA 5JZ9A 1MXHA 4XZ3A 3I62A 1L7EA 4XVQA 1IZZA 2WRZA 1GPKA 4MUHA 4BVLA 1HE3A 4GX5A 2ZIVB 1NUAA 2EAUA 1AQYA 2ZIWB 3M2PA 4I9NA 3WMWA 1JR2A 3N58A 4NQRA 1DUIA 2FI1A 1POXA 3SLGA 4Q4LA 2VHEA 4KYUA 4RF2A 4QDKA 4BEBA 4C14A 5LQJA 3Q0EA 1XVTA 3CEAA 3H2BA 1Z13A 1BFKA 1NJ2A 3K0BA 5IG2A 1N6KA 1XOIA 1YDWA 2H6EA 2HU2A 1PF7E 2WF8A 4I2VA 5HMLA 4YT8A 1I5OA 1E2KA 2VWGA 4FIDA 4B35A 1EM6A 2OGUA 4R01A 1A77A 4BYMA 4MWZA 2HJVA 1RC8A 1ZMRA 2WIAA 5L7WA 1PJSA 1EKXA 1Z74A 2JJ8A 4RIEA 5CFZA 1LZLA 1FS4A 1DBRA 1AZLA 1T1GA 2QJOA 2WWFA 4AZ0B 1T91A 4L8FA 4ZYLA 2WAXA 4ROSA 3FNQA 2QRVA 4S12A 4F9TA 4V39A 3ENVA 2I62A 1W48A 3R7WA 1LV8A 1JW9B 1OC2A 2P9BA 2XMGA 6AT1A 2X9VA 4Y6SA 3QZUA 3PTLA 4O2LA 3L49A 1DC8A 3NRCA 5KYKA 3RSSA 3U4MA 3T1HB 3Q9LA 1WY5A 3PUXA 3GWGA 4E03A 1TJ5A 3PXXA 3ANLA 4C21A 4KO4S 5FP0A 1O95C 1X38A 4JDUA 1CS0B 1G55A 4DCJA 2Q0XA 5JLAA 1XTIA 1X42A 3OCCA 1JKMA 1G4AE 3RS9A 4ND6A 2PVCA 3P19A 4KKXB 1BD4A 2WE8A 5A0TA 2O07A 4NU8X 3AESB 4JB2A 3WG9A 5AW7A 2B9VA 4GD3Q 1YAHA 1TM4E 2B69A 2WYIA 1X2EA 3G82C 3QI2A 3SEAA 4RF3A 1MH9A 1ISGA 4P7JA 3BCUA 3WYCA 4CG1A 2AE2A 2CVQA 1OXVA 3ASZA 3DQQA 1MN6A 3AUJB 2RJ3A 3DF9A 1N2IA 4AN0A 2PX3A 5DSZA 1OROA 3WB1A 3KPYA 3EZ9A 3FMIA 1EDDA 3MTIA 2VJKA 3ZE8A 3E81A 4TTVA 1R6UA 1T5IA 2BHRA 3T41A 1W4AA 2IUEA 3WO0A 5LQCA 4Y2HA 3MT7A 3TBKA 3D6AA 1E6UA 4TSFD 4KV7A 1JLRA 2KE5A 1GQFA 3D4NA 4S0ZA 1I2DA 3EGXB 4M1WA 1IHOA 1ZGGA 4O29A 4TS3A 1NRXA 3VPGA 1PP4A 3KJNA 4FYPA 2WIBA 1LNSA 1CYEA 2J9RA 3VZSA 3QRWA 2F90A 3EFBA 2PUAA 1EVKA 4KZPA 4RTRA 1P4RA 5L51A 2YASA 2XF2A 3BDVA 3Q85A 4FFBA 3QXJA 4TRRA 5JH7B 4HKTA 3C1UA 2ZSEA 1J6UA 1JB1A 1R4MB 1PJAA 3CO5A 3PPVA 4RADA 1DDIA 3NBKA 1K4MA 1RQRA 4G63A 3B36A 1XE3A 4X6UA 5T6MA 3W79A 1RZRA 1ABBA 2X3UA 5EJ6A 2GCGA 1N2ZA 2JKZA 3OU2A 3RSZA 5CDSA 2PT7A 3CF2A 3EPLA 2BMEA 3L84A 1E79A 1SQ6A 5C46F 5HK9A 1XZDA 3SHFA 2VDPB 1UMDB 3PGLA 2JGNA 4B3JA 1B23P 3THYB 4ENWA 2HV8A 2XIQA 2PGAA 2PMFA 4B74A 4RZQA 3K2IA 4I50F 1SKMA 1IN7A 1TZKA 3RKSA 4BLSA 4DQXA 3K9QO 2RI0A 1B15A 1HC7A 1O6CA 2CF5A 2WHPB 3IOBA 3TIXB 4IINA 4PW0A 1WAMA 4DAEA 5B6IA 2D5BA 4ER0A 2D1FA 1UBTS 1YB5A 1XJCA 2O7VA 3M6UA 3PZRA 5BUQA 4DV7B 3A1UA 3IIKA 1P2FA 2BI8A 4GZ6A 4KR9A 7ABPA 2DY0A 3F9CA 2JGEA 5JI2E 3DTVD 1I4OA 2BGIA 1YDFA 2ZUTA 4EK9A 2CN1A 1LPPA 5BXQC 4KWHA 2RHRA 2QD1A 1F8UA 1C8VB 5LMNB 1TGYA 3FY4A 2JCVA 3IOEA 4P8RA 3TW4A 5F33A 2QW1A 1DKMA 3DMPA 2K2QB 3ZD8A 1ZN8A 4CTKA 3I2FA 5IUJC 2ZR8A 4I5GA 2BKVA 2C99A 2W2VA 4X62B 1PTJA 2H54A 2NTYC 5H82A 5BSEA 4MUMA 2NMVA 4H1WA 1S3IA 4QAJA 2WT4A 5T4BA 4C07A 1N2JA 1I6WA 4MVJG 4BQRA 4CNBA 3UFXB 3KTOA 3GRAA 4FHFA 2E5LB 3RODA 4JHLA 1MAHA 4OQYA 2OQRA 4KXLA 2PZJA 1Z6YA 3H42B 5K3OA 1JA0A 3I9V6 1ILEA 3V1KA 1QJCA 3HXKA 2D4AA 2DQKA 5CVCA 5FOVA 2GETA 3L82B 3M5CA 5K3FB 2DF8A 4IF6A 4INJA 3REFA 1ZWKA 3LRXA 4DQKA 4MYCA 1XAJA 3BEDA 3ELYA 3V8VA 3R8FA 2OYRA 3K0AB 2NU6A 3P2IA 3RADC 2VRCA 1ISIA 2B7CA 2QLBA 4IIUA 1IJEA 4KO3S 1E6CA 5KWVA 3J81k 3R5JA 5C1OA 1I3KA 4H3HB 4XYMA 4AB1A 4DLSA 1ONPA 2BKXA 4KGXA 3D1VA 1GADO 3JTEA 4C0SA 3AL0C 1ZICA 4LQCA 1T2FA 1V1JA 3M81A 4M54A 4RDIA 4WZAA 5LD2C 1CZRA 2BMDA 3T3MB 1O1YA 3ONDA 4PRYA 3MWEB 2NXEA 3VSDA 5TS2A 4TX1A 4BJ6A 4RMJA 1K5HA 1A9OA 3I5AA 3F3SA 5D1NA 5AKXA 2C4UA 3PZBA 1M83A 2VG8A 1N6OA 2A5GA 1NUTA 4G09A 2OQVA 5ALDA 2IPAB 4B32A 2QX7A 1EJ2A 2Q2NA 5LBUA 1DWOA 3Q0TA 5DBGA 2ZE5A 1NNI1 1QYXA 1U0LA 2NVBA 3MERA 2BI4A 2OO5A 3P45A 2I5PO 4K6MA 3WFJA 1E1RD 2GN2A 1QH9A 1SH7A 3KB2A 1AKMA 2RB5A 4TKMA 3PEYA 2XECA 1UZAA 1P45A 2E4YA 1ZHHA 2MDTA 1AV6A 4NRDA 1BE0A 3TRHA 1JDSA 1XUOA 4JVOA 2W0SA 4EG5A 3Q7TA 4ZEXA 4HL6A 2I2XB 5EJ7A 3LXXA 2F1HA 1J7JA 4H1VA 4KUGA 4PPGA 4Y2UA 2ZZKA 4TVOA 3TTSA 4Q3KA 3VOSA 1XNQB 3QXSA 4PLWA 1R4NB 2VZ8A 1ECJA 2QNRA 3DWEX 3LP8A 1ONBA 4YTEA 4D57A 5BV0A 2BBSA 4KBGA 1RQ2A 3AM5A 3GVHA 3ROKA 3L0SA 4LAFA 3G1UA 4NDZA 1RMQA 3S1AB 3VSBA 3DYVA 2O8CB 4IXNA 1XEWX 2JLSA 2Y4OA 2AHRA 2J31A 1HYGA 3D3EA 4LJKA 2XITA 3EW7A 2FPIB 1VPEA 2B0CA 3B1VA 4JEMA 4LK3A 3TQTA 1XBTA 4DB2A 2JFYA 3CF4G 2ZSDA 5D8DA 3EC1A 2LVBA 4X3CA 5AVZA 5LZ8A 1IBMB 4DC9A 4O0LA 1ENYA 5C7OO 2B4RO 2H1RA 1GCUA 4H4DA 1ZA1A 1GL6A 3ESZA 5EUBA 3G8AA 2A57A 2WVHA 5D5HA 4B31A 1DGQA 1GWNA 1U3GA 1KKLA 1X80A 2FZ5A 3DVAB 3EXIA 4GI1A 4K6OA 3T4EA 3U26A 3EUAA 4BP1A 5AIAA 4V0MA 1PJCA 3C2QA 3R5HA 3CLSC 2JLUA 5K8LA 4QDTA 1J8QA 1NOJA 2CJWB 2ZYAA 5DGIA 3RU2A 4EUSA 1Q44A 3KDAA 1WCIB 1RMTA 1Q1QA 3B9RA 3DYIA 3E05A 2Q0HA 4BFCA 3UJHA 1NI4B 5I9SA 2B4KA 1J2TA 4DRXB 2GOYA 2QTNA 1XCPA 4YH1A 1SZCA 3M3PA 3DP7A 4R5HA 1NL3A 4YJ3F 5DI3B 5F4ZA 3W7VA 3H2GA 5A7FA 5JECA 4FM9A 1HDCA 1NXOA 1XXHE 2VP4A 3TSOA 3U60B 1MC8A 1WP9A 1G0NA 4TYWA 1FP2A 2IYQA 2YIJA 3FTDA 3I9KA 4NVRA 1RHQA 4YI3A 5DYWA 4U2BA 2WTAA 5K51A 5H8WA 1FSGA 5F3WB 2OT3B 3LZDA 4L3WA 2ASEA 5F52A 2D06A 2OL4A 2XB8A 4FZ5A 4BNJA 2WFLA 4LOLA 1ULUA 3UFBA 2NO4A 4KODA 2I2BA 2QN1A 3PQFA 4GZ5A 4JXKA 2QX8A 5FNVB 4B48A 1WPRA 1NVUQ 1VPVA 2I2AA 3IEUA 2B2NA 1SHTX 2XB6A 3A14A 1WUJS 2BTQA 1ULHA 1DKPA 3DFMA 2QLJA 1F5SA 5C7IO 1LQUA 1II8B 2F62A 1GGMA 3EIXA 4KLRA 1FC0A 4TS4A 2ESRA 3KKMA 1GG8A 3O8QB 1XTJA 3FLBA 3FKSD 3B9PA 1S9HA 3UBMA 5KNCA 3ABRB 1SWWA 1JLMA 1OHHD 3LIIA 3Q3GE 3UMJA 1OXBB 2UVDA 5J2TF 4DBZA 1MDBA 4P58A 4NYMQ 4MW6A 4Z4FA 2PU7A 2WTUA 2DBQA 1NYQA 3A04A 4BMXA 2YBDA 3RDPA 1OBCA 1O9BA 4U3JB 2ZRCA 3AKEA 2QG9A 4BLQA 1JEQB 2XQGA 1IL0A 1AV7A 3AEXA 4XEHA 4Z9YA 4GG1A 1C4KA 3W5AA 1WXWA 4MYUA 3OFSA 4OB6A 5EXSA 4RJJA 4NBLA 5SZHB 2Z9CA 5JWHA 1YI8A 1W35A 1TIPA 4F5ZA 1LJUA 4TRJA 2NSJA 2PQMA 3H6KA 2IH4A 2NU7B 5JJ5A 3HRIA 1EQ2A 2NVUA 1P9OA 4IMRA 1WZEA 1ZGBA 2X2FA 5CT5A 5IM5A 1M8KA 1V1RA 4M37A 6YASA 2PKEA 3LIPA 4MKXA 3ZOZA 5FV4A 1DCFA 2BE9A 2CD7A 1KI3A 1VMAA 4NHEA 1UPAA 2Z57A 3TOZA 3VM6A 3K9FC 2ZSIA 2WB2A 1U0RA 3DFFA 4C4XA 1Z6AA 4DY4A 1K68A 3IHLA 1JAXA 2AFIA 3ITEA 1TO2E 3D5QA 2XHZA 3MTDA 1N0UA 4CV2A 4G8JA 4YCNA 2D2FA 4IEIA 3DBRA 5D3MA 4E5VA 2RGYA 1BS2A 4OJQA 3MPOA 4TKVB 3EXG1 5IJAA 1F06A 1YOVA 2KB0A 1MRNA 3GFOA 3DKKA 1L5RA 1NYTA 2P2GA 2R9VA 2RIRA 4JN6B 2G4CA 4KN6A 1A97A 3THOA 3K0KA 2R4UA 4FLEA 1R8XA 4CG3A 4YMSA 2IU3A 4FHEA 2FYTA 3E48A 3MCWA 3D59A 3G9QA 3LGSA 3IT0A 3M1LA 3I83A 6REQA 2NZ2A 4H3SA 3AL2A 1RAAA 2I29A 3AFMA 1RJGA 4RW0A 3VR2D 3MN1A 5KU1A 3AHFA 5IM4F 1C0IA 5GGXA 3NYWA 1KFCB 1RFGE 3DGEC 1TK9A 4LJ5A 3SJBA 3W5BA 3LBAA 1RLOA 3MBOA 4RTSA 5DNWA 4EI8A 5ITSA 1L1QA 5JSZA 3I76A 2GA8A 3SQXA 2JIQA 3EXFA 2IEBA 1CCWA 3ICOA 3H04A 5EJEA 4OLBA 1TFUA 3ETCA 4YJ2B 3W2TA 4MO2A 5E2AA 4LRSB 1C8BA 1XEAA 1FQJA 2ORIA 3KQUA 4HLCA 1OW3B 1HI9A 2GS9A 3K35A 1X3SA 2I7XA 4WADA 1KH3A 3A4VA 1KIFA 3FPLA 1O3YA 1W75A 3GMIA 4EATA 2QT9A 4EL0A 1E6MA 1TM7E 3E9YA 4IJKA 2Z2KA 4NPAA 4EY5A 5FUMA 2A2ZA 3TAXA 4XEUA 4V0KA 4EB6B 2IZOA 3ZXIA 5HE8A 5JSKA 1K66A 1Z5VA 3THWB 2VQ3A 3O8DA 1N8KA 4GC9A 4RYLA 4WERA 4QOSA 4PYOA 5IC5A 4MPPA 4F3CA 4MW2A 4N5HX 4IDFA 4EDHA 1M0TA 2CB9A 2PLWA 5D5PA 3PX3A 4P34A 3NO4A 1GRQA 5LMUB 2QORA 3HKBB 3VR6H 1LJ8A 1VJTA 2ZYDA 3H5IA 3R0IA 1G1MA 2GPNA 5AM0A 5SZJA 5CB4F 3PTZA 1RWVA 3Q8LA 2JD0A 1VIMA 5AJXA 1ODFA 3WL4A 4B9EA 4G1VA 5HOEA 5J2UF 4JP8A 4ACAA 4JV5B 1DJPA 2GSDA 4UUQA 2WAAA 1QO7A 4V2IA 3HB0A 5LUAA 3OPYB 3DP9A 2ZCUA 3M8KA 1C7ZA 1DZ3A 1IDOA 1WMBA 2RGXA 4LZZA 5E4JA 5KTNA 2X4LA 4J0QA 2VAXA 3ZY6A 5HS4A 1JQEA 3B6KA 2QB5A 2RARA 3Q8XB 3EMDA 5AJZA 1JZQA 1JDNA 3C98A 5ALWA 3CW8X 2FRDA 3P96A 4N7MA 4NV0A 3W8EA 2YHSA 2BFPA 2HSZA 3S68A 5DE3A 4F5DA 2POQX 1JHAA 1GSAA 3DDUA 2BLLA 4IX1A 4RPIA 3I5UA 5LCXA 1OIVA 3K6SB 2W2LA 1JB9A 1ML3A 4LZOA 7REQB 1R0KA 3EIEA 3ICEA 1Y9EA 2PH3A 2FPLA 4P36A 2IV2X 3S3TA 1Z3IX 3SBXA 5TQVA 3T6KA 3UJ9A 2BSQA 1JLHA 1U0HC 4Y1RA 1M2KA 4QELA 1UK6A 2HMSA 3DWIA 5K01A 1W59A 3LGAA 2XRFA 2TSYB 4KGVA 1XRQA 5KVQA 2CEKA 3RVRA 5C1DA 4YCSA 1T0PA 2WFAA 5CT6A 3TLCA 2ZJ1A 3VSCA 1W7AA 3IULA 2RGRA 1Y37A 4RNCA 2J07A 2DR0A 2YQ5A 4KXVA 3AM1A 5GVRA 1LQTA 4JNKA 1A2OA 4O2BF 3JQCA 2JCBA 3ESDA 4TM7A 4WA7A 3ITNA 1DQPA 2XX3A 1Y6GA 3TNFA 3VZDA 2XOXA 4MYDA 4CVNA 5HQ3B 1Y3HA 4HR7A 1ULZA 4MQ6A 2M6LA 4KPYA 1RE0A 3FN4A 4Q3OA 2EFYA 3QFRA 4KTVE 4WK4B 5JARA 2PFKA 4PCAA 6NULA 4D45A 2XTAA 4MCIA 3WNQA 4IG9A 3P5BA 4Z4QA 3TZCA 5LJIA 2XZLA 3LBNA 1GKUB 4QT0A 1U4OA 1W5BA 1M6EX 4I4LA 4WECA 1QFJA 3ZY2A 1IAQA 1NFFA 1ZN7A 4HH0A 5P8WA 4XIJA 3EGVA 2GM4A 3GFRA 3D6NB 4C7OB 3KTAB 1H6BA 2V1XA 2O1WA 2WWWA 2XYVA 1Q1BA 2PR7A 3RU7A 2DB3A 2XMBA 1XZGA 1L5ZA 1VI2A 3OY7A 4KMRA 1DX9A 4FDUA 4PYJA 1CHNA 5G1NA 1PO7A 3KXPA 3TMKA 4BBPA 2J0SA 1T26A 2YY6A 2JFHA 3COZA 4I1SA 1PQWA 4R41A 1SVIA 5EL0A 3KM0A 4EL5A 4HB2A 3JSAA 3I9MA 3Q98A 1U65A 3QVLA 1U11A 1G17A 4I8XA 4MR8B 4TTJA 5C31A 2XUJA 4MDFA 5JCJA 5ALVA 4FYMA 2DPHA 4EITA 1GL3A 1XCLA 4BX3A 2DM6A 4C7XA 5DB4A 4RZSA 2VTKA 4HTFA 4FFNA 2GPSA 5T3YA 3RPEA 3G0HA 3OMXA 1F8YA 1PG2A 4N5DA 2Q4RA 4JKIA 2HA2A 3G2LA 4A0RA 5JWOA 1AKUA 2HJHA 1CQZA 1FFCA 3CO0S 3G8BA 4FQ5A 1HTTA 5ALRA 1KI7A 3MMSA 4ZV7A 3NEYA 3HPQA 3HU3A 3L5OA 2W2KB 5T4FA 4C06A 3G0CA 1SVWA 5C35A 1YI0A 3VR5H 4EBFA 1BA2A 4ZOLA 3GK3A 3VU9B 2HMVA 4B4VA 4YY3B 4JNCA 3F47A 2KI5A 5TGZA 4QYTA 5DO9A 3UA3A 1X87A 5BSMA 5ADUS 1IK4A 3AL3A 1B7GO 2JAPA 2R6GA 3IHTA 4XVUA 3AHIA 4YBRA 5EIWA 4QWMA 2Y92A 3SYMA 4HNAB 3CV3A 3AEYA 3AJEA 4S1PA 2VT3A 4HN2A 3PHHA 3WVNA 4EO9A 4A36A 1EXNA 1DWPA 4X7PA 1ISMA 2GBPA 2NO5A 4OHPA 5EWLB 2C0PA 1UC5B 2EJUA 2J6CA 1YQ9A 4IICA 4XJSA 2X8JA 4LWOA 1A4IA 2LKCA 3X2SA 3K1AA 4I81A 4L95C 3SM3A 3L4BC 4WEOA 4D74A 3JATA 4GPAA 4X1IA 3OPMA 1UXGA 4D79A 1N25A 1E1QA 1UOEA 1KI9A 1CQPA 1PN3A 3DZCA 3H0KA 4G1FA 3SG0A 3TR0A 1RYMA 5J59A 1Y63A 4MUNA 3D2AA 4FONA 1YQGA 1OR8A 4RK5A 1GAXA 3C8HA 5LM3A 4J7CA 2DHDA 1H4TA 2LW7A 3R5SA 1KS2A 1P7WA 4F1JA 2EX0A 3OEHA 4NPCA 1ACMA 5IDYA 4IJQA 4ASUD 2IW3A 5BSGA 9ATCA 1W4LA 5EUMA 4F21A 1J90A 3HCCA 5CTJA 5KTKA 3LV8A 2AKAB 4GBGA 1CLEA 4TLDA 4KXYA 1PFVA 1HEYA 1KZ4A 1FY2A 1QWSA 2PBZA 4M1TA 4LVCA 5DHSA 3SOZA 4YNBA 3A10A 1JBEA 4IAOA 1COWA 3IT1A 4YRDA 3W9BA 3GV0A 3IUPA 3I05A 2ZBVA 4R0NA 4Q9JA 3QTBA 4E1AA 2PDAA 4ILKA 4XGIA 4C3OB 3LGXA 2HGZA 1WMAA 1YZNA 2PA3A 2BKUA 2Y1FA 3MOSA 5GONB 4PG5A 1K5PA 3FNBA 5AKKA 3SYNA 3UJAA 1UBKS 5HEKA 4BB5A 4L5YA 2JF0A 4P1ZA 2EP7A 2JARA 2V74B 2IXFA 3W5VA 4A6XA 5L7TA 1IRIA 2PUGA 1M1NA 2P3LA 4HHEA 2DPLA 5FUVA 3DFUA 4OGFA 3V8NA 1LRKA 1O4VA 5I7OA 1T5LA 3Q3CA 1DU4A 3B48A 1G98A 4QPNA 3RQIA 2V3CC 1JIUA 3L41A 1NQ5A 4B3HA 3NTRA 4KH0A 4CDGA 1IC6A 4DNOA 3KJGA 2AEEA 1HYBA 4NENB 3G2KA 3TECE 3R0ZA 3VUEA 1UBCA 3HE3A 4QJ3A 1AK2A 4QU0A 1FVOA 3OAAD 3AV3A 3QIAA 1F60A 5EQTA 3G7SA 1B6TA 2FH5B 2WQ7A 1Z5ZA 1ZBDA 4MH0R 1AKNA 5EA2A 4RFVA 1QFYA 2RG7A 2XJ4A 2R2AA 4J94A 3DE4X 5J4KA 2CXNA 3CA8A 2VH5R 3ETLA 3O8BA 3UYLA 5IJ9B 2YDYA 2ZWMA 2M6KA 4LK2A 5JNWA 4M0DA 2OHGA 4WCDA 3A2NA 1CY2A 1ZNQO 5E6RB 3ZQUA 1RE1A 2QVCA 5TPZA 1DJLA 4LS3A 5FA8A 2VAVA