1AUOA

Carboxylesterase from pseudomonas fluorescens
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
b'MTEPLILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQAPTRPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKRTGIDASRIFLAGFSQGGAVVFHTAFINWQGPLGGVIALSTYAPTFGDELELSASQQRIPALCLHGQYDDVVQNAMGRSAFEHLKSRGVTVTWQEYPMGHEVLPQEIHDIGAWLAARLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYLESTERASE
publication title Crystal structure of carboxylesterase from Pseudomonas fluorescens, an alpha/beta hydrolase with broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 73
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 1997-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auoA00
1XLUA 2C0PA 1QFMA 5A7FA 1E3QA 3WYDA 3DOHA 3C6YA 3KXPA 5JAHA 1DT5A 3FWHA 4W1QA 1W75A 3O9VA 4FKBA 3M3DA 3GELA 4G8BA 2HA2A 1CUHA 4XX1A 5ALJA 5KWIA 1JFRA 3WK6A 5ALFA 2C4HA 5FP0A 1OXMA 3IULA 2ZYIA 3VISA 2D0DA 4P9NA 2XUAA 4UPDA 1YB7A 2X8BA 3DKRA 1UKBA 1LPSA 2WJ4A 1XZBA 1UKAA 2V98A 1M33A 1C4XA 1H2YA 3FCYA 4BP8A 4OB6A 2P8SA 1FFBA 2WHPB 2OGTA 5AOCA 1YR2A 1R88A 3W2TA 3CXUA 5AK6A 3ED1A 1CUSA 2XUJA 2DQZA 5CT9A 4CFSA 3I1IA 5JARA 4YASA 4J0KA 2B61A 3I2GA 1TCAA 4HS9A 1ISPA 5C7YA 4AO8A 3WQHA 3DYIA 1EB8A 2VT7A 4Y2QA 5LP1A 5JANA 4NVRA 1XLWA 2BCEA 2Z8XA 4X3CA 4EUSA 1JKMA 1WB5A 3VJMA 4KYVA 2J3QA 4TGLA 4Y2VA 4Q1VA 4X6YA 1XZAA 5AHXA 2CKMA 2VJCA 1EH5A 5ALHA 4H77A 3OC0A 1X70A 4XWGA 1UK8A 4UHDA 1CLEA 4W9RA 4UBLA 4AQDA 3D59A 1MO2A 2RONA 5AM4A 2CZQA 5HFNA 5ALSA 2GYUA 3I2KA 4X85A 1LBTA 2XI4A 4B85A 1XZKA 2G5PA 3O4JA 4DSZA 5AK5A 3WWOA 5AI4A 3SK0A 1QIDA 3IUJA 2XB6A 5ESRA 5A7GA 4YPVA 4J0IA 1CUIA 1LLFA 3ZLTA 3C6XA 3VVLA 4X92A 2JGKA 1CUBA 4E14A 4HVTA 5AKYA 3UUFA 1SCIA 3BE8A 5CH5A 2FJPA 3KOOA 1SOMA 4FNGA 5ALKA 5LZ2A 5IVDA 5A6VA 2RGUA 4DMFA 4U2CA 3DEAA 3WA6A 4H0CA 4BAGA 1ZI6A 4BCDA 4F60A 3QMVA 5ALEA 1ZJ5A 2XQGA 4FTWA 4M0FA 4W1SA 1RWQA 1HQDA 3W04A 2ZJFA 3A2MA 3HYSA 3VDXA 3AZQA 4ETWA 1QLWA 3WA7A 2ZYHA 3STXA 1GT6A 4WDQA 1A8SA 4IO0A 1R3DA 1RYYA 5J3JA 4RGYA 4X94A 3QPCA 4XVCA 5DNWA 4MWSA 3BL8A 2VSQA 4BTLA 1FJ2A 2JGFA 2WILA 1I6WA 5HKAA 2W6CX 2QOEA 1K5PA 4AO6A 3A70A 2VAVA 4BCBA 3R3VA 1BCRA 3C6ZA 3ZI7A 4CCYA 4LXGA 4F0JA 2BKLA 3HC7A 4XJVA 6YASA 3G0IA 5AKZA 4X00A 3BIXA 3G02A 2CMFA 2OXEA 2OCLA 3WWDA 4JUIA 3R0VA 2QR5A 3D2AA 1CV2A 4X7BA 5LIPA 5LZ8A 2JGIA 3CCCA 4UBJA 3IUNA 2HL6A 5AIAA 1FFEA 1OILA 3K2IA 5A71A 3E4DA 1UWCA 2ONCA 1ZD5A 3IUMA 3M81A 4LYDA 4PW0A 3K9BA 4LYEA 2WG2A 4WDRA 5JADA 3PF9A 1ACLA 2QTBA 2Z8ZA 3AIOA 2GBIA 5LZ9A 7YASA 3IB3A 4AB1A 2B4KA 1CIJA 3F98A 3I6YA 5JYCA 4BRSA 2BAGA 4I4CA 1JJFA 3GUUA 2HA4A 4CG2A 3BF7A 3H2IA 4OU5A 2JEYA 3QZUA 3OM8A 3C70A 2ZJ7A 2HU5A 2XQJA 1BS9A 2WFMA 1AUOA 1CUUA 4Q3LA 1QIHA 4QDOA 3L1IA 4C6HA 4UBKA 3DKKA 4U2EA 4GBGA 3D4LA 5LZ4A 3PFCA 2QJRA 1BE0A 2XLBA 1QTIA 3WK8A 1YS2X 4W63A 4Q3OA 1XRQA 2GYVA 1UZAA 5C81A 3G9UA 3O95A 3EQ8A 1QIMA 5KREA 1GXSA 2DR0A 4QLAA 4E15A 3Q8WA 3W9UA 5AICA 1JT2A 1BN7A 3PICA 5AKHA 1MJ5A 5DYTA 1E66A 3WL8A 3DQZA 3M82A 3QM1A 5AOAA 4J0DA 2HRQA 1J06A 5EIAA 2WIKA 1ZI8A 5D3KA 2J3DA 3AIMA 3TEJA 1P0PA 5AI8A 3FSGD 4H7HA 3ESBA 5JAUA 2VA9A 1GQRA 5I8PA 2YH2A 4PSCA 4PNZA 1R9MA 3HXKA 1H23A 4CG1A 4OB8A 5DNUA 1E89A 2PSFA 4UBNA 4KAJA 2PU7A 2ZVDA 4EY7A 3SWWA 4MYDA 5EIEA 5LLSA 2CUTA 4K6KA 1N8SA 3WL6A 4BAZA 2WFZA 5EGNA 2O7RA 2Z3ZA 5BOVA 2RHTA 1VXRA 3QH4A 1CVLA 1W52X 2R8BA 5FDFA 4BVKA 1XQYA 1XKTA 4H7IA 3V1MA 3IDAA 2E3JA 4AXBA 1T2NA 1YB6A 2AJ8A 4EY5A 4L3WA 1CUFA 4LXIA 2ZYSA 4DNFA 1MAHA 2Y1KA 4G5XA 1QO7A 1LPNA 1K6EA 1SCKA 2K2QB 2HA5A 3ANSA 1UK9A 1SCQA 1XZEA 2XUHA 1MX1A 4B82A 2DQYA 2QMQA 4M0MA 3I2JA 4X93A 4IHAA 4A5SA 5BWBA 3PUHA 2GYWA 2QJWA 1THTA 1E8MA 1DQYA 4OYLA 5LKRA 3EQ7A 2O2GA 2OLEA 5AKKA 1XQWA 2DCMA 1BCSA 2XUGA 3V1KA 2QVBA 4H7DA 1HDEA 5DNVA 5HKBA 4FFVA 1XZFA 4ZXFA 1DWQA 1A88A 4CIAA 1EDDA 2GZSA 3G9ZA 2B20A 2WIFA 3O4HA 1MPXA 4WY8A 4HRYA 2ZJ6A 1NU6A 1B41A 1Q83A 3FVTA 2XQKA 5LYYA 4QDZA 2VAXA 1XKLA 3SX4A 1YASA 3ESCA 3STWA 3UMJA 4AN0A 3GA7A 4QDTA 5ALYA 4ZV9A 3WL5A 2WU3A 2XUKA 4Y2SA 2GBCA 4N8SA 4EY6A 1R1DA 3DOIA 2QUBA 4FHZA 1GPNA 4RNCA 1YAJA 3WMRA 4B6GA 4OSEA 2RAUA 3HJUA 3OG9A 1EI9A 3AILA 3WZMA 1FFCA 3PE6A 1U8EA 2PUHA 4N5HX 4EZIA 1DTEA 2O2IA 1ZOIA 4HAIA 5ALQA 3MUOA 4TVKA 1LPMA 3V9AA 1QZ3A 3WIOA 2Z5GA 1FFDA 3U1TA 4P93A 4B84A 3G9TA 2I03A 4QDUA 4JYPA 3AZPA 2XMDA 5AK4A 2XUPA 3STUA 1N5MA 2OAEA 2JGLA 3IUQA 4IH9A 3WKCA 4BZWA 1VE6A 3WKDA 2CEKA 3KWJA 3STYA 1TCBA 5EFZA 5CRIA 1EK2A 1YS1X 4P08A 3H04A 4MQLA 2QXTA 5C8XA 2H1IA 3RM3A 5JD6A 5JAPA 1N1MA 3V1NA 4H7JA 1K4YA 2PSJA 5AJHA 1CUAA 3NWOA 3W06A 3EF3A 4OU4A 2IIVA 5IH7A 2J4CA 4DGQA 1WOMA 1X2BA 3E0XA 4KEAA 3C87A 5H3HA 2VT6A 5AI9A 4BDSA 1G5FA 1UOQA 1DQZA 4NZZA 2JGMA 4BVJA 1C7IA 2VJDA 4O08A 2JGJA 4BRZA 4X97A 4U2BA 1CUGA 2PUJA 4CCWA 4I19A 3E3AA 3UUEA 1QTRA 2WM2A 5SYNA 5DTJA 5JD5A 2PM8A 3DL4A 4MEBA 4DMHA 3BF8A 3I2FA 2HIHA 3D0KA 2HA7A 1QIFA 1VA4A 3U0VA 1WHTA 3H2JA 1MX5A 2WUGA 1CUCA 4L9AA 2HM7A 5FV4A 2RHWA 1ACJA 4FLEA 5IVHA 1UK7A 2C58A 3O9MA 1AKNA 4Q05A 4X90A 4B0OA 2QS9A 2V9ZA 4OB7A 1PFQA 1MAAA 1MX9A 3AIKA 1YCDA 4QE3A 1EK1A 3D5EA 1WHSA 2C7BA 4FLMA 2PSEA 2XMQA 1PV1A 5AKJA 4KR0A 5T4EA 4UBMA 5K3DA 4Q34A 4WFKA 3G0CA 2WIGA 3O4GA 2CBGA 4G1FA 1USWA 4G9GA 3HLKA 1GPKA 1QIJA 4E11A 1A8QA 3H0CA 2VJBA 3FYUB 5HF5A 1UXOA 3C5VA 1R9NA 2Z3WA 4HXGA 4C88A 5EI5A 5K5EA 5AK3A 1CUXA 1FSSA 3A2LA 1LGYA 1W6RA 4ZI5A 1ORVA 4A16A 4Y2JA 2VF2A 2OQIA 5FRDA 2Y6UA 4GHWA 3H19A 1A8UA 3I2HA 1ZGCA 3OTQA 1G42A 3N2ZB 3F67A 1F6WA 3S2ZA 1NX9A 1Y7HA 2XLCA 4J03A 2DSNA 1QIGA 2BUBA 1CUWA 4B0PA 4DYHA 4RE6A 2XUDA 2ACEA 3EIOA 3L1HA 4KE7A 1EHYA 4U2FA 4M0EA 4LHEA 3DDUA 5AH0A 2WIJA 1H2ZA 1O6FA 2HU7A 3T52A 2DHDA 4YX9A 1UOOA 3X3HA 4BP9A 4J0JA 4HZGA 4D9JA 1JJBA 4BTVA 1ZIYA 3B5EA 3BXPA 5I7UA 2PKYX 3WK4A 4KJXA 1VA5A 1VJ5A 3F9CA 1JI3A 1BRTA 1XZLA 5D3ZA 1QIIA 3Q0TA 2WUEA 3QPDA 5E4TA 4Y2RA 3WK9A 2VQ6A 1OCEA 1VXOA 1F0PA 1IUNA 5AM1A 2OCIA 2JBWA 3B12A 3H1AA 4XIIA 5CMLA 3C5WP 5FPPA 2PVSA 4RE5A 3H18A 2CJPA 1ZJ4A 4WFIA 3I1YA 4C87A 4FBMA 2XMCA 1UOPA 4DM7A 2DHEA 3LP5A 3LCRA 5LZ5A 2ZYRA 3HEAA 3TJMA 5FKJA 4AZ0A 4GEGA 1FFAA 4ZWNA 1IUOA 2QKYA 1KEZA 2ZSIA 3QMMA 1QONA 4J3JA 2O7VA 1Q0ZA 4UFPA 3DD5A 4OPMA 3STVA 3I28A 5HK8A 4V2IA 2DHCA 5AKEA 2ECFA 2BGRA 4B7ZA 3ESAA 4PF1A 5CT4A 1U65A 4IH4A 3BDVA 4NS4A 5AM0A 4K6HA 1QGED 3LLCA 3QITA 1PJAA 1S8OA 1O6GA 1Y37A 1GGVA 4BYMA 1L7QA 2OGZA 5ALGA 5ALPA 4C89A 5ALVA 2WU4A 5JIBA 2HHAA 4KRYA 4UHCA 2WTNA 5AIBA 2WIDA 4X95A 3FBWA 4QLOA 1P0MA 1VLQA 2BFNA 2WLSA 3H1BA 3BIWA 3GZJA 5HCUA 3ZPXA 2AJCA 3BWXA 1AZWA 4Y2UA 2VATA 1XZIA 1LPPA 5YASA 1AMNA 2I3DA 3OURA 5K3BA 1J07A 3B3QA 5ALZA 4WJLA 4PV7A 5K3AA 4A23A 2BGNA 3C8HA 2B9VA 2PBLA 4BVLA 1R50A 3AJAA 1HL7A 1AURA 3MUNA 3G8YA 4GLBA 2HU8A 4Y2XA 1CUDA 2ES4A 3FNBA 4G4GA 3IA2A 4BC0A 4MEAA 1IZ8A 4BZZA 1QIEA 4OUKX 2HA6A 5AI0A 5DJ5A 1XQVA 1JU4A 1XRNA 3RK4A 2PPLA 2V96A 1TAHA 1P0QA 1F0NA 4QWWA 1MN6A 5ALLA 4BE4A 3VVMA 4FOLA 4H7FA 1BU8A 4HXFB 3IIIA 5E4JA 1LPOA 2XUOA 2ROQA 4FBLA 1Y7IA 3KD2A 5CURA 4KACA 4DNPA 2WQZA 5IVKA 2AJDA 1CUJA 2YYSA 3STTA 1HKHA 3V48A 3H17A 3PI6A 4Y9SA 4W1RA 4GW3A 3G9XA 1G4HA 3C43A 3ESDA 2GBFA 5IKXA 5FLKA 4INZA 5ALIA 1F8UA 1CRLA 4BDTA 2NW6A 2Q0XA 5AM3A 4LXHA 4G4JA 3BJMA 3AFIA 1CR6A 4BAUA 3TRDA 4P92A 4FFWA 5CT6A 3M83A 5JD4A 4KE6A 1VKHA 5ALDA 3AUKA 3WKBA 3G0GA 4QNNA 5EHQA 2C5FA 3ZLVA 2G4LA 1AX9A 5T4HA 1SFRA 1MNAA 5D7BA 4MJ3A 2X5XA 3OOSA 5F4ZA 2DFPA 1NU8A 2EEPA 3AINA 3G0DA 2Y6VA 1W1IA 2H7YA 1LNSA 2WTMA 5AOBA 3WIBA 4U2DA 4KE8A 2ORYA 4U2GA 4UHBA 1ZIXA 5AKLA 1XZCA 4Q3KA 3LIPA 1L7AA 3DYVA 1L7RA 3BJRA 3F97A 3FAKA 4UFNA 2I78A 4X6XA 4DIUA 2RIPA 1GKLA 3DLTA 4UHHA 3PDCA 5FUMA 2XMZA 5AKIA 1N5RA 4ROTA 3WYNA 1CQZA 5ALTA 3OPMA 2JGEA 1E8NA 1BEZA 1CEXA 4UHFA 4J0GA 5K3FB 4OD0A 3MGAA 3N0TA 2VTVA 5ALOA 1XRMA 5EHXA 4L72A 3F8SA 5ALXA 2H9YA 3EQ9A 1T4MA 2XUIA 2XMBA 4AO7A 1DWPA 1B6GA 3R3UA 4QZVA 3CN7A 1EVEA 3MVEA 4NMWA 3ANTA 1GPLA 5A62A 5JZ9A 4OCZA 1QFSA 2X76A 4ARBA 4BB0A 1XZDA 2ZSHA 3NOXA 1QO9A 3QPAA 3JYHA 1UKCA 5LKAA 1IUPA 3WKAA 4L0CA 2HFJA 3FLAA 3R3YA 4X6UA 4BC1A 2YASA 4RPCA 2GBGA 4J0CA 5C8ZA 4JYMA 1W76A 4K2AA 2OGSA 4CI9A 3WKEA 1Q84A 4G9EA 3I6MA 4F21A 3NUZA 2WFLB 1AGYA 4BE9A 2PU5A 3TGLA 3CN9A 3A6ZA 3R41A 1EVQA 1ODSA 3V1LA 3HZOA 4B81A 5CT5A 1GKKA 4C01A 5IVIA 4EA6A 3HABA 2XDWA 5KBYA 4Y2PA 3RARA 4FNMA 5AI5A 4GXNA 4JNCA 4GI1A 1THGA 1XFDA 5EHNA 3IURA 3KSRA 3GROA 4J7AA 3ZWQA 2XUFA 1ZI9A 1TK3A 2WUDA 4DLNA 2OCKA 3WK5A 4X91A 4ARAA 5BWCA 1ETHA 4HRXA 1EB9A 2H7XA 2HFKA 2XUQA 4GDMA 4H18A 2WG0A 1H22A 1X2EA 1ORWA 3FCXA 5CH8A 5SYMA 1QOZA 1ODCA 5HF8A 4KE9A 4QEKA 5FOQA 3FYUA 3ICWA 5FXMA 1VZ2A 5I9IA 1E5TA 3W9BA 5HF6A 2VEOA 4E46A 5E4YA 5DWDA 4B9AA 2BJHA 4PO3X 4K5QA 1TQHA 1VOTA 5CXXA 4OYYA 1Q0RA 2CB9A 2G5TA 4UBOA 5CXUA 1LPAB 2WJ3A 3GBSA 4GWLA 1WM1A 3F96A 4PSDA 3H2KA 1XLVA 2PSDA 2HADA 3PF8A 4TPKA 4N5IX 4Y2YA 4Z49A 1J2EA 4KAAA 2C0QA 3R40A 2Y2VA 1Z68A 1XRPA 3RKSA 3WWCA 3H2HA 3O0DA 1UT6A 3PFBA 3ZLUA 3EBLA 1YA4A 3ILSA 3AZOA 3WWPA 3ICVA 2O2HA 3I2IA 1CQWA 4AX4A 4C4XA 2V97A 1DT3A 2XT0A 5HFAA 4FLFA 1IVYA 1EA5A 2XQIA 3IVMA 1XRRA 1EDBA 3QBJA 2JEZA 3YASA 3S8YA 4AMZA 1TIBA 4ZRDA 4ZGBA 3LIIA 5K3CA 3H2GA 2IITA 2UZ0A 1QE3A 4QA9A 3WJ2A 3FVRA 5D6OA 1XZJA 4PSUA 1WPXA 3FSGA 4EY4A 5HZGA 1LBSA 4EY8A 4DMKA 5DLPA 5AKGA 5HQ3A 2FJ0A 5JALA 4DSAA 4N8EA 1KU0A 1EXWA 1H2XA 5E2IA 4JH0A 3WK7A 1XZMA 1XZHA 3G0BA 4FWBA 1H2WA 1IZ7A 2XMRA 2HRRA 3FLBA 3D2BA 1XRLA 1AQLA 4PQEA 1JJIA 3IBTA 1JU3A 4CIBA 1BROA 1CFJA 4IH1A 5T4BA 1RP1A 2C5GA 1MU0A 1XZGA 1LZLA 4F5ZA 5HF9A 4UHEA 4N8DA 5CH3A 5AP9A 1QIKA 2R11A 4KRXA 5DTIA 5HK9A 4ITVA 2XE4A 4FDMA 4CG3A 4EBBA 4MQMA 1U2EA 5HQ3B 3JWEA 1A7UA 4HTAA 4S0XA 3NGMA 5EHZA 4BCCA 4UFOA 2WG1A 4AN1A 3R3XA 1ZD4A 5C8VA 1CPYA 5CT8A 5JASA 4CCYB 5A7HA 3QVMA 5ALNA 3FYTA 4IQ4A 1GQSA 1TRHA 1DU4A 3CCBA 4UBIA 5CTAA 3DCNA 1MNQA 3SC2A 3HI4A 4C4YA 2OAGA 5BV7A 1JMKC 1C7JA 1LZKA 1WB6A 4Y7DA 4UUQA 3A2NA 3VJLA 3VJKA 2RI6A 4JEIA 1XQXA 3E1GA 5FPQA 3DNMA 1JMYA 5K3EA 2WJ6A 1BEEA 4G8CA 3FOBA 4QDXA 4B83A 3BDIA 2AJLI 2PSHA 1EX9A 2WSLA 2HA3A 3WJ1A 1ZGBA 1HLGA 4B80A 2HDWA 1J1IA 4WFJA 4Y2TA 3RLIA 2XMSA 1SC9A 4KAFA 3G7NA 3D2CA 1ZICA 1EINA 1YSCA 1YAHA 2OQVA 4MWTA 1DX6A 2GZRA 4DMCA 5ALWA 2FUKA 2QT9A 4MXDA 1R4ZA 2QZPA 1ODTC 4C4ZA 3FLEA 4GECA 3QYJA 2PX6A 2OPHA 4B9EA 1VZ3A 4DTCA 1W4LA 5JATA 2WKWA 1WCYA 3HACA 5DYYA 4ZV7A 1QJ4A 4BBZA 1UFOA 4W1PA 4I3FA 1CUEA 2AJBA 2VJAA 2QM0A 5CW2A 1WB4A 3WWEA 2QXUA 2G63A 1P0IA 4MYSA 2D5LA 3D3NA 3W05A 4H7EA 2ACKA 5A2GA 5ALUA 4YK7A 1HPLA 4Q82A 1U4NA 4K6GA 1ZD3A 3DJYA 2JIDA 2W22A 3HSSA 2I3ZA 4WCVA 3VXKA 3JW8A 1DX4A 3C8DA 3FYUC 4DNOA 2JF0A 4EB0A 4G8DA 3T4UA 1YA8A 2FX5A 5JZSA 5AKXA 4ZREA 1GZ7A 3WL7A 1IMJA 5AM5A 4AMYA 3KWFA 1CUYA 1DINA 2LIPA 1XROA 2OCGA 4BATA 4QWMA 5LZ7A 5K3FA 2BUCA 5ISMA 4H35A 1EDEA 2YXPX 5KWJA 2WHRA 2EDAA 3DS8A 1LPBB 3R3ZA 3KDAA 1CUVA 4EHBA 3R3WA 4WY5A 3VKFA 3K6KA 5JZBA 2XQFA 4AZ3A 5AO9A 5DYWA 3DL7A 3O4IA 1MTZA 1DWOA 5ALRA 5EIHA 3WZLA 2AXEA 2BUAA 2J4FA 2WUFA 1BN6A 3HRHA 3C45A 1TKRA 3L1JA 1KU6A 2QUAA 2QRUA 1HBJA 1D07A 4H7KA 4J0HA 5JAOA 1CUZA 4DNQA 1K8QA 3GFFA 1AC5A 5T4FA 5AM2A 2OG1A 5CBKA 3LS2A 4LKOA 1ZD2P 2EDCA 2H7CA 1UK6A 3ZV7A 1TCCA 1MT3A 2XMGA 2IX9A 3C6BA 1K63A 3WLAA 4LIPD 2PL5A 2WHQA 4HXEB 2Y2UA 5AI6A 2WFLA 1WPRA 5ALMA 3WI7A 3QMWA 2WHPA 2HA0A 3D7RA 3I6ZA 4FMPA 4G4IA 1VE7A 1G66A 3P2MA 1E8DA 4X71A 3PUIA
chains in the Genus database with same CATH superfamily
5CA0B 4Q0MA 3GJZA 3O47A 3T3PB 1V45E 1BCSB 2C0PA 2YWHA 4IGFA 4G0PA 3KK0A 3TKLA 2COEA 5A7FA 1YQQA 2RGCA 4Q9JA 4UEKA 4ZCIA 1ZJJA 5JBQA 4HGOA 3PQ6A 5F7OA 3CSSA 3ZHVA 3ABRB 3DOHA 4B7XA 2YIJA 3GW8A 2QUKA 4HI0E 1O4WA 3MTEA 4M1EA 4QBKA 2WWXA 4I5GA 3QE2A 3T4XA 5GMOA 5J5CA 3C15C 5D6NA 1DT5A 1SKUA 4BFTA 3K31A 1XHFA 3FWHA 4JKIA 4PIVA 1K97A 3ZUGA 4B3MB 4W1QA 1KAHA 2KS6A 3UUWA 4HGYA 1QG0A 1FJHA 3G6WA 4J2OA 5EXEA 5F51A 2WMOB 3MWEB 2PWYA 3N8HA 4CQMB 2HA2A 5K0FA 1KERA 4HNUA 4G25A 2FR8A 1E2UA 1SURA 2Q5OA 2VHZA 4MX8A 3VOTA 1GNSA 1E32A 2JRCA 2YYZA 3JQCA 1OYYA 4FFBA 4IM7A 1KOFA 1GQOA 3WK6A 2C82A 4DA6A 2JJ1A 5EZYA 4Q15A 2XE7A 3N87A 3A0UA 3QY9A 5ALFA 3JQAB 3TQTA 1HDYA 1S1CA 4MUNA 4BBPA 3MERA 1XUOA 4IRUB 4IRMA 5BV8A 2ZYIA 1C8LA 1M76A 2XOEA 3VISA 4BNNA 1C7ZA 1LSSA 2N46A 3L7CA 3TLMA 1ZD8A 1P77A 2XUAA 4UU0A 3OUTA 4UPDA 2X8BA 1II8A 5JY6A 2WJ4A 4BL5A 3N2KB 1DO8A 1O58A 1UKAA 3NBXX 2V98A 5TGZA 4CU2A 4UDXX 5DO9A 3CF4G 4NNJA 2A0KA 2IOHA 1DBIA 4GC9A 3FCYA 3CVWA 3R7LA 1LV8A 1QE0A 2E5LB 1F9AA 1DIAA 1FFBA 3F1LA 1EUZA 3WV4A 2ZB8A 1RCFA 3DR5A 3KKMA 4W8GA 5DMHA 1N32B 1FMJA 2YMMA 3THXB 1EFPB 1ULBA 3W2TA 4NDZA 3CXUA 1KDPA 3T3HA 2OLJA 4M1YA 1E9EA 3F5MA 4DLLA 2VOJA 3LG2A 4YACA 5EHGA 5K0JA 3PUJA 5B1SA 5T64A 3HB4X 3GLGB 4AL4A 3PVZA 1GRRA 3GAZA 2G0AA 3SX0A 2Y76A 1W4AA 2OBFA 5JARA 1WTCA 2P2NA 3E9YA 4DCUA 1XT6A 4AP9A 4YHBA 4MLCA 4MQ4A 1T91A 4ASUD 4LK3A 3CX7A 3LQ2A 5SV2A 3FPHA 4BWVA 2ZVQX 2AZXA 2IT1A 2X0DA 2YXNA 2VHYA 4B3XA 5KINB 3DYIA 2P5UA 4EA6A 1BDIA 1XXHE 2GEDA 2P68A 3V7UA 1K7XB 4LPSA 4UNSA 3KVOA 3D3WB 4D82A 2XVMA 4RMNA 1GZ5A 4IHQA 2BFFA 4CJXA 1GKUB 3VDQA 1WV1A 5HKLA 1T3SA 5EJ7A 1RDFA 2VYFA 3FHCB 3NASA 1FRFS 3KJEA 4LYGA 3HV0A 4ACBA 1RC8A 1H3EA 5JANA 4NWIA 4OGLA 3VVCA 1D6SA 4QECA 1U1EA 3ZDDA 4MPRA 5F3WB 2G28A 4C0BA 5JYEA 2Z8XA 1NYLA 1P9LA 1NXSA 2ECOA 3LHDA 5DXJA 4EUSA 5BYKA 1JKMA 3AM5A 1NKSA 2QNBA 2IELA 3DL2A 1AQ6A 1Y1TA 3ZK8A 2PL9A 4TGLA 1D4FA 1ZHHA 3E0QA 4X6YA 4Y2VA 4IIFA 2OV1A 1S4QA 1XZAA 3RANA 2R8YA 5AHXA 3LUJA 4DLRA 2REOA 1QO0D 2VJCA 2QRLA 5EXDA 1TM4E 2C03A 4X1IB 3KB1A 3GPDG 2HR1A 3ADDA 1K6IA 1EJ6A 2AN4A 2BHSA 5G1NA 3SJAA 4BJHB 2OORA 1NLUA 4RJKA 3FFXA 3I4LA 2ODBA 4Q4JB 4BRWA 3PR1A 4JVLA 1E4OA 3HUTA 1KXJA 4XWGA 2P6RA 3W1WA 4KPUA 2XGMA 1J21A 4NOLA 4WXEA 5U4XA 2Q3JA 1MO2A 1SHUX 3B3FA 4C1NA 1SELA 3WDLA 2IH5A 2CYAA 2QQFA 4P84A 1M73E 1KZ6A 4X85A 4JBYA 2Q4DA 1YFKA 5EE3A 5JVDB 1VL2A 4AAYA 1LEHA 1UEIA 1P5FA 4DABA 4EDFA 5DW0A 4B85A 4DA7A 1Q95A 3K8YA 2XZDA 1MRNA 2C1ZA 3II6X 3VZSA 4EMTA 3T9AA 2IW3A 4L6IA 2G5PA 3O4JA 1WEKA 2F8LA 2Q3LA 3WWOA 2IZ7A 1VJGA 5AWFC 2AC7A 1MAVA 3P9PA 3ANLA 2BI4A 1KJJA 1ECFA 4O1HA 4TSKA 2NWQA 4DC9A 1BYUA 3H97A 4D8VA 2PTGA 2OD2A 1T0JB 3DTVD 4JP2A 5ESRA 4BQQA 5A7GA 4US1R 3U44A 3M5DA 4QLBA 4YPVA 1O97C 4OI1A 1CUIA 4UTXA 3GQBA 4BNLA 3HXMA 3SQWA 1LLFA 2V7VA 4Z8XA 5ABPA 5K4GA 3ZLTA 3QKSA 5I7SA 1L5QA 4EL0A 3MJ4A 1CZRA 1CUBA 4Z7NB 2GVDC 3WADA 3LX6A 1RLJA 1GGMA 3MJHA 5CM2Z 5AHOA 7REQB 3UUFA 2GQ0A 1DIOB 2YBEA 1KWGA 2O2CA 1BVUA 4JOSA 4CQJA 5LA6A 1P75A 3IP3A 1OXKB 2GZMA 3SEFA 3IDZA 2QRGA 4DB4A 4UEWA 4LDPA 1SOMA 2VRCA 4DDVA 2W00A 3V8RA 3FKQA 2DHRA 2PVPA 4D9HA 5JHHB 4Z9AA 1RT9A 4ZT4A 2AOTB 2JVKA 5DASA 3ZKAA 3IYLW 3M6XA 4FXOA 1DI0A 3INYA 1TJPB 2FY8A 3F46A 5CB0A 3CRQA 5FFFA 3E5NA 4RCZA 5K20A 4YRGA 3QMVA 5EERA 2PKXA 5JDIA 4HDMA 2RGNA 1B0PA 2Y1GA 2O0HA 3KXIA 4WLFA 3AESB 4RGQA 4LMAA 4D45A 5KYWA 1BNCA 1JGTA 4FTWA 4DLAA 1T5LA 1K5GA 3OFJA 4WASA 3T9EA 3DMTC 3G1WA 3GJ5A 4PEVA 1SIBE 3TXYA 3A2MA 1C7EA 1ESNA 3Q3GE 3DBRA 4R9UC 4TKZA 1ZJ6A 2B6NA 2M6KA 1B23P 1G6OA 2I2XB 2ZRCA 2XH8A 3HYSA 1JNXX 1XR3A 3K96A 4WLVA 5FBWB 1JNYA 3VDXA 3RRMA 4UDOA 3SXUB 1IN6A 3Q0IA 4M54A 1GT6A 1P3DA 4N12A 2ZPAA 1KXZA 3NI2A 1YZUA 2GK7A 4H6PA 4IO0A 1R3DA 3GVHA 3PXUA 1E59A 1Z6ZA 2B3TA 1A5SB 3NOQA 1I0IA 3NT5A 1UXKA 2KPOA 2WLTA 3AP3A 3PT5A 2B1JA 4QOJA 4MWSA 1NP6A 2NSLA 2DE0X 2ZWPA 4DPMA 1EFLA 2VSQA 2C2ZA 1Y33E 3QXXA 3WOHA 4CKXA 4BTLA 1FJ2A 2WILA 2P0YA 1R6UA 3OCXA 5IJXA 4U9UA 1HM5A 3B8HA 1SU4A 3IHTA 1X3SA 4ZQBA 2H4HA 3LTEA 4D0SA 3T94A 1P7WA 1WHSB 4FGKA 5CFLA 3U7FB 3R9XB 2GPNA 3A70A 2XBLA 2BHLA 2VUUA 3SHFA 3ZWPA 1ZFNA 4P98A 1KDRA 4EI2A 5K45A 1XTQA 3COJA 1RS0A 3P20A 2FEAA 2C7RA 1KBQA 2VK2A 1HTBA 1M34A 3AQIA 3F8WA 4JELA 2HPHA 4LXGA 4F0JA 5MGBA 1GA1A 3HC7A 4NECA 1NQXA 2VTKA 5MFPA 4XJVA 1L5VA 1NAIA 4TROA 4CNQA 5C8YB 1PV2A 6YASA 3D4NA 4QAQA 1POWA 3G0IA 3BK1A 2ZR9A 3V8QA 1NBHA 3KKKA 4ENVA 1U0JA 1QHHB 4H4EA 2PUFA 4CMEA 3PL1A 5KNCA 3JQRA 4XB2A 5EJMA 3AJEA 1QB7A 2OXCA 2ZSUA 3SOPA 2EBUA 1WZCA 4C08A 1J0EA 3M1AA 5I9TA 1TUBA 5DFAA 4KQGA 4A2CA 3TLCA 1YBMA 3TGPA 1AGPA 4JUIA 2EFHB 4RXTA 4P82A 3PUWA 1TF7A 3RE1A 3EN0A 2ZW9A 4M0KA 4XASA 2BWJA 4EB3A 4ILKA 3KJXA 4F6LA 3FLMA 4LSMA 1C0LA 4MB6A 1WRBA 2EJCA 2PBFA 3OJEA 5IBQA 2ZIVB 1A9PA 2C2BA 3CJTA 3DV0A 1KJ9A 1PTJC 3FIJA 4ZO9A 3ZQJA 4UBJA 4MCHA 1EVIA 2HL6A 1Z75A 1UCFA 5AIAA 5EKSA 3R7BA 5BPFA 2GO7A 3K2IA 2IY9A 1TO2E 1WUTA 3OZFA 4EUEA 2R66A 4PANA 4OJQA 3RS8A 1JP7A 1KI7A 3E4DA 3IUMA 4LYDA 1TM3E 2CK3D 3WQQA 1NXTA 3MTIA 4PW0A 2JFPA 4A15A 3RYCB 3OZEA 4JQYA 4JSRA 1GPMA 3CH7A 5LU9A 1ISSA 3WNVA 1F0YA 1XXHB 1XPRA 2GXAA 2P62A 2DTEA 4WKPA 4C4PA 3MZ0A 4X6LA 1UAGA 4P4SA 4WDRA 4WL0A 2O3JA 3OE7D 1OX4A 3GUZA 1TYZA 1A5ZA 3AF0A 5BSUA 3RSQA 1FB5A 1R5BA 5KYGA 2QTBA 4Z3KA 3EC7A 4KITB 3VNSA 4AB1A 3BXZA 2B1RA 4CKEA 2JL1A 1EUCA 2FFJA 3IKJA 3FZEA 3UB2A 2A1TR 4KIJA 3SBDA 1BW9B 4Y1FA 3VKHA 4GRDA 2FN3A 2FLKA 1XALA 3KQNA 4QU9A 4I4CA 5FR1A 4H3HB 2IXFA 4L2IA 4CG2A 4HEA1 3BF7A 3FNHA 3L6EA 5MN5A 3H2IA 1RVDA 3UK7A 3OX3A 4KI7A 5HIIA 2BSAA 1BVYF 2NUPB 5FWYA 1NXPA 1ZNQO 1M54A 1P6UA 4J7UA 1CUUA 1C3OA 4Q3LA 2EW1A 3P9QA 3TCKA 1HNWB 1IQUA 2V0NA 4P5DA 5BMVF 1G5HA 3ER8A 1HEUA 4RTJA 1UUFA 4AWAA 3F6CA 5EJAA 4M3NA 3R9IA 2QVGA 3K92A 1LSOA 3QKWA 1MA3A 5EIBD 3P32A 2R96A 2V3CC 1IWBB 4RKWA 1E7SA 4HT3B 1RHQA 3FNEA 5BW5A 1YS4A 9LDTA 5LZ4A 3B20A 4Q3BA 5E7IA 2JFBA 4DJTA 4NCIA 3DCJA 2B7BA 3CRW1 1QYCA 2GDZA 1YS2X 2DPMA 2NO6A 2UKDA 4W63A 4JI7B 5SY4A 4YV2A 5B4VA 1WCIA 2BI7A 4YAUA 4CKCA 3EIHA 1KBOA 4N76A 4PPNA 3RSOA 5FI1B 1LBQA 5KREA 2GHIA 4QLAA 4DEXA 3HS3A 2C4NA 2XZTA 4JLBA 3Q8WA 3VNQA 3MCWA 3Q7PA 5IP5A 4GLFA 5HJEA 4LE0A 1A82A 3JCZA 1NONA 1Y3IA 2R00A 1W85A 3AEKB 3G3EA 2X9NA 3MM4A 2J9GA 1QBGA 5FA8A 3PICA 4S12A 2A3RA 2COUA 5EZ6B 1P1RA 1E66A 2BFCA 2XRYA 1IM2A 3AHCA 3HR7A 4Q7MB 4YGXB 3S8EA 2W2OA 3A1TA 4FVTA 1KY5A 3WIUA 3KETA 2HPAA 4OA5A 4NMHA 4C20A 4O4HF 4B3JA 5BVHA 1I3LA 3AHEA 1G41A 2W6NA 2XSZD 4J0DA 3AL3A 4QPCA 3A4TA 4QOFA 4KBFA 2ZBDA 3EK2A 3TIFA 2Q27A 1J22A 3WRWA 3ZE6A 3I37X 3F6SA 1OYWA 3F90A 3RVDA 5JAQA 1SUWA 4JVOA 1DMSA 2VHEA 5KTMA 3RRNA 3TNYA 5EIAA 2YW9A 1VJCA 2IOQA 4YV0A 2BM0A 1GDDA 4M46A 3HVIA 1NXOA 1YMUA 1LY1A 1E69A 1S6YA 4HK4A 3HCOA 5D3KA 4DIEA 4RD6A 3SVZA 3CT4A 4V0LA 1XQ1A 5KVAA 1NTOA 1P0PA 1VCMA 2C94A 1VPTA 1G8AA 3FSGD 3E22B 2QN8A 2WJPA 3ESBA 3I3SR 1WXWA 5JAUA 1X7YA 2VA9A 2PCLA 2WVHA 4HLQB 2JA1A 3IQZA 1MV8A 3NAQA 4IAOA 4UM5A 5I8PA 4OFWA 4QX6A 1P39A 5LOVA 5EVCA 4PNZA 1R9MA 1H65A 1UC8A 2OENG 3F3YA 3QEKA 3KZMA 1QH8A 4Q1CA 5KNDH 3AOGA 3UJPA 3DE1X 3W34A 2GHTA 2QMUA 5JISA 3WGIA 1EWYA 2FWNA 4KOAA 3QA3E 4PLZA 4CG1A 1RBMA 4JI2B 1FTYA 1PN3A 4U63A 5B1IA 2ARKA 4YJ3F 3ZHCA 4ZAYA 4DS3A 4LNHA 1LV7A 3BMQA 3IV9A 1W5FA 1B6SA 2PSFA 4UBNA 2PU7A 2QLTA 3KDPA 4K9PA 4EY7A 5DI3A 1OFIA 4MYDA 3CZQA 1E1YA 1Y63A 5DK4A 5DNCA 3S44A 3E53A 3RC3A 4C14A 3JZDA 1MVOA 3EIQA 4EHDA 6PFKA 1T4CA 2BW0A 5IU6A 1N8SA 3ZDRA 1HK7A 4E2YA 3HH8A 4MWEA 3IBCA 4B45A 4TTTS 2WNIA 1YRBA 3PLAE 3IT1A 2AG5A 5TPZD 1OTHA 3U4QB 4OFXA 1KBZA 2L42A 1E3LA 1SZDA 1OWNA 2Z3ZA 1E9DA 4I9HA 4RPGA 4ZEXA 5BOVA 10MHA 2W6OA 3B5JA 4URXR 5JCOC 1FS4A 3QH4A 4M76B 2VN8A 4EW2A 4PICA 2N42A 3A3PA 1JVSA 3ISVA 3L0OA 4MPPA 5FT9A 4EHNA 5C1DA 4CE6A 1GNVA 1XQYA 2X1LA 4RS4A 3RV3A 2MHCA 4H7IA 3V1MA 2X0RA 2YS6A 3DHNA 2XRFA 2HNAA 4DQLA 4H7PA 4K8OA 4PLPA 1OIWA 2VUSA 2YJGA 5LPNA 5FUYA 1YB5A 2O5RA 1T4DA 2EV9A 2R1TB 2PBRA 1Z29A 3BSFA 2EFJA 4OQZA 5NLLA 1NJ8A 5IN5A 3ZY6A 2IZOA 1KR5A 4RK0A 3PRKE 3ZDYB 3K0SA 2G08A 5ECGC 4NV1A 3VZDA 1F2VA 2GJAA 1CUFA 1FLVA 3D8NA 3FRJA 4MQBA 1CS0A 2DVMA 4R9NA 3JWPA 5AT1A 1DAGA 1YU6A 2LKDA 2OESA 4ZVNA 2ZJ8A 1FMFA 4UM9D 4C4RA 4DNFA 1G3QA 1TVKA 4UEOA 1A5TA 2UZ4A 4G5XA 1NW4A 2HHLA 1L4MA 4QDJA 3LHKA 2GF0A 3WWYA 1NJFA 3QX8A 1K6EA 1SCKA 5B3LA 5AMXA 1YZHA 3HFSA 4JY7A 1R18A 3LD9A 3UAYA 4JL8A 3QF4A 2BSXA 1ZEJA 1Q3HA 1SCQA 5F98A 4NAHA 1I94B 3WMEA 1H1TA 2V7PA 2C57A 4B82A 3BGIA 3K0CC 2HD4A 2NYVA 2P65A 4R7GA 4F9GA 5JAMA 3A32A 3GZ4A 4XSHA 2NO7A 4S2EA 2DWOA 1AKMA 3LHFA 2LCIA 2QLJA 2R3SA 3CC8A 4IHAA 4TLCA 2C2HA 1K8ZB 2Q5FA 2PIDA 3EXFB 4AF6A 2FJUA 1WG8A 1XD2A 2F43B 3HVHA 3PUHA 1IEXA 3MTBA 2GYWA 3EULA 3ZI0A 1J23A 4IUDS 4KCGA 1THTA 3OT1B 1E8MA 3DVAB 1ZESA 3BCHA 1DQYA 5B7GA 3H11A 2Z57A 4J9UE 3ER9A 1FIUA 1O9BA 1U8AA 2QR2A 3F4LA 4BFLA 2I9KA 4NK4A 1NFRA 3A6DA 1YI1A 1XIVA 3KT8A 1Z2CA 3PITA 3EQ7A 4X5OA 2P2ZA 2P7HA 3D6HA 1FP7A 1XQWA 1QAMA 1RWPA 2DCMA 4TLBA 1V5WA 4JN6B 5L9AA 5E3HA 4C0WA 4R0NA 4ZGGA 3V1KA 1GZ3A 3PWZA 2VXBA 1T8YA 2EIXA 2Y9PB 1GA6A 2I5PO 2PCJA 1QOQB 2GM3A 3MOSA 1SZJG 5DNVA 1KDTA 3W0LB 5D86A 1W7AA 1QBKC 2Z2YA 4R83A 2IWRA 1QU3A 4C6SA 4RTMA 3N8GA 1RZRA 2IHUA 2GPJA 4AT1A 3D6JA 2CNKA 3FSJX 1UBCA 3G9ZA 4WACA 4GM4A 3EC1A 4L3VA 421PA 2SKDA 4FX2A 5C4GB 1M75A 4LRYA 4WY8A 3ZG6A 3HK2A 4A3SA 3TZHA 3PC4A 4FFPA 4HRYA 2ZJ6A 2ZJAA 1NU6A 3MWJA 3HU1A 4DXHA 5CP8A 1AXRA 2ID9A 2QPTA 1IY8A 3BG5A 4IFEA 5CJJA 3TFOA 1DKLA 1BAPA 3T0IA 5D5HA 1OLSB 3SX4A 1ZWLA 1YASA 3KQOA 3CE6A 1GV1A 4HLDA 5F5NA 4Z0HO 2YMQA 5FBKA 1K9VF 3GA7A 2M9MA 4E21A 5EIFA 1HFWA 4BOYA 3HNOA 4YMHA 3R8FA 4GLOA 2G25A 3LWBA 1A98A 3P7MA 1CEEA 4XAQA 3QOFA 2QMHA 4E4YA 8ADHA 1QKJA 2CFOA 3REOA 1IRXA 1TYDE 4HH3C 5CCDA 1AM4D 1TPZA 2GBCA 3DD1A 4IIBA 3WG9A 3BMCA 1GUYA 1V37A 2W4QA 4PNHA 3RPEA 5JWRA 4B3DA 3LX8A 2D59A 4N7JA 1MJGA 3SXJA 1WWKA 3N53A 4M8IA 1PEYA 3ASZA 4JLOA 2X1VA 3T5GA 4R9VA 4ZARA 2IYZA 2FOXA 1X0XA 4KLNA 1JPJA 5U1PA 1F1JA 4UAVA 5GVSA 2J0VA 2ZQZA 3ZCSA 4HH0A 5IT5A 3T3NA 5CEJA 5JO0A 5K9ZA 1XJ0A 4PM4A 3SDSA 1KTIA 1JSCA 2CY0A 4DJJA 2WWYA 4MKIA 4JLPA 4J49A 4RU1A 3X1ZA 1JWAB 2I8LA 3M9XA 2IYQA 1FNDA 3DOUA 3N2LA 4HX9A 3UC9A 2VTBA 1XTIA 3PE6A 3GH3A 2J59A 3BCSA 4C0SA 1H85A 2R97A 4N5HX 4OBWA 3VHRA 3ABIA 1DTEA 4IQFA 2CYCA 3VNBA 2OHJA 3L9WA 3OMLA 1J25A 2C07A 3DDHA 1QQ6A 2XBUA 3T1VA 1JUDA 2XKAA 5B3KA 1H3NA 3DFZA 1WQ3A 4IEEA 3O6VA 3EPPA 2VO1A 3ROPA 2BPOA 3KFLA 2BMAA 1GYPA 2FPIA 3BHNA 4TVKA 2GKOA 5FR2A 2GWRA 5IARA 5CA1F 1EKXA 2HYDA 1DHRA 4TN5A 5AW5A 4B4OA 3NHAA 3BBLA 3ZGXA 1T3HA 4I5FA 3U1TA 4CGYA 4D4JA 2Q46A 3G9TA 2ISQA 1OXBB 1V4NA 4J0FA 2NU9A 2ZK7A 1ADFA 2BDUA 1WDMA 4QDUA 5JNUA 2G1PA 4F5DA 1CDOA 1Z5ZA 4RUKA 1FNSA 2XUPA 4JFRA 1M1UA 3IL2A 3ZW9A 2OAEA 2NXJA 4KFUA 2B83A 3FHJA 3OI7A 3RO7A 3DTTA 4EHJA 3NHWA 1JI0A 2W37A 4CMAA 4IH9A 1VJ0A 4PU0A 2DCUA 4AUKA 4ZODA 4TWZA 4WK0B 2A78A 2CEKA 4E1AA 3BM5A 1TCBA 2OK8A 4R2JA 3GK3A 1J8MF 5CFZA 3PPIA 2JVIA 2ONZA 2W2VA 1YS1X 2JKYA 3L0SA 4P08A 1UMBB 3FYCA 4YH1A 2Y4OA 4I1YA 3UJAA 1XP8A 3V4PB 2X7XA 4IWNA 5C8XA 2H1IA 4J3NA 4TV9F 4E6EA 2P3LA 2ANBA 1EBUA 2FQWA 3CB4A 4FGSA 4UNNA 2H92A 4WXRA 3VO8A 4GSLA 4C0XA 3V1NA 4CIYA 3ZV6A 1W73A 5J63A 4E22A 1SB9A 4RYLA 4H7JA 4H6XA 4PG4A 3BRQA 5FPYA 4F4UA 5I7EA 2GK6A 5FPTA 5TF0A 1T5DX 4D5EA 1Z6XA 4YJHA 3FY4A 3LRPA 5EWMA 3Q2IA 4N6OA 4A0HA 1E7YA 1IQ0A 3EGOA 2FEKA 4WKCA 3FOFC 5IUJC 1DUIA 1QGOA 2AXNA 2P5TB 4OU4A 1QU2A 4HBZA 2V4ZA 4HDKA 3ZK9A 4BV8A 3UMFA 1XVUA 2YRXA 1GGEA 1D2RA 1AKTA 5G4KB 5I45A 2XB2A 1Y5LA 4DBVO 1WOMA 4MK4A 3E5HA 2ON6A 2VPTA 4G1BA 2G17A 3VAZA 5ITSA 4BY9E 4N82A 4XB1A 3EXG2 3U39A 2OV6A 1XA3A 3C87A 4LQLA 1FOEB 1C8VB 2AYZA 1YB2A 1H8ED 3LWZA 2JI9A 3EUWA 4RIFA 4CHTA 4E13A 4E12A 2DBQA 1HYQA 1W5BA 4OOEA 5H3HA 1MIHA 1XTBA 1EYZA 1JJAA 3K4HA 4PIPA 4RSRA 2R6AA 1U3VA 3WICA 5K0ZA 2GTPA 3WGMA 1K98A 3DA8A 2VT2A 4WI1A 2XKBA 3O91A 2GFQA 4WOCA 2E4AA 5FNZA 6AT1A 4B44A 4NZZA 3ZWDA 3JV7A 3B1ZA 1SD5A 4EJSA 1IN8A 2QE7A 1D6NA 4BLTA 2PNFA 3UJ9A 1ND5A 4HC4A 4EVQA 3DEFA 5KCMA 1NR7A 3G8BA 3LVFO 4M4SA 3ZU2A 4LZNA 2PAAA 5F5XA 3SF8A 2ZPUA 2D7DA 2F1OA 1Q1BA 2G4VA 4U7FA 4DTIA 1XHLA 1Z2OX 4DG5A 5HM6A 2F64A 3QJGA 4XWYA 2O3UA 4F4FA 1D1QA 1W44A 3C8ZA 1KIFA 4FMBB 4NBRA 4YJ2A 4DV1B 2YJ5A 2FN7A 3RU7A 5GV7A 3RSHA 3BL5A 2WK1A 4K6CA 1UQRA 3CO5A 4I36A 1LSUA 1NBMA 2QMEA 4IMJB 1JSRA 2EKPA 1E2EA 1MGPA 1ZGGA 1GRCA 1JG1A 2WAMA 3NB0A 4IIJF 4KN9S 3PQ2A 2GF9A 4BS9A 3L0ZA 4DMHA 4GT1A 1GKIA 2UUOA 4JJZA 3LOUA 2UDPA 2ZSKA 3JWJA 3GJ6A 3EE6A 2HIHA 3VTAA 1MO5A 2I6FA 1XNGA 3D0KA 3C7AA 3M6VA 1U9CA 4CQMD 3ZCRA 5KNBH 1BOFA 1G38A 3Q85A 4B3BA 2O06A 1WHTA 2PLNA 2ZPTX 3N2GB 1WD7A 2FOIA 4FZJA 4L9AA 1I9GA 3JQAD 4NICA 3F5DA 4HQFA 3TRIA 5FV4A 1S2OA 1GM5A 4HUQA 2RHWA 4E7OA 1N6RA 1R74A 3HGQA 1ZDMA 1HOTA 4FLEA 2GAIA 2BDTA 4PX2A 2O07A 1V3QE 3DXYA 1UK7A 16PKA 1ZVMA 3B51X 4CTKA 4RTRA 1IN5A 2OWEA 3ROTA 2IUUA 2BHNA 2KI5A 5I7FA 1PJ3A 1LDNA 3O9MA 1AKNA 3TL6A 3TE7A 1M7HA 3K0BA 4IKOA 3RSZA 3OWXA 3ST7A 3DF7A 4OQXA 4D3XA 3UMBA 2QSUA 1PFQA 1MAAA 1RQLA 3FD8A 4OB7A 2REQA 3KAKA 3U9TA 2C98A 3Q3VA 4FOTA 3UZUA 4D4KA 4DLPA 1O57A 3AEZA 1BYIA 2GK4A 1UQTA 5EIXA 3BUSA 2A9OA 3A6LA 3RIEA 1WABA 2ZRIA 4B79A 5KDDA 2CCGA 1EK1A 2J7PD 1LK5A 1TC2A 2YINC 4QFDA 2XZOA 5HUQA 2ZRLA 3K6RA 4E3ZA 5ELMA 3JQFA 1PD0A 1P7ZA 4KUGA 3Q6IA 1KE1A 4AUMA 2P78A 4BUZA 1YQEA 2I3GA 1UC9A 3H5AA 4UASA 5E8JA 5JEEA 2BP7B 4C4SA 5L3RA 1N75A 4ARIA 1M8GA 5K3DA 2AA3A 3ZD9A 4MS4A 4WFKA 4K8RB 1P6QA 2CBGA 3JYNA 2ZT6A 2J32A 1FS6A 4OK6A 3PJGA 2IHTA 5BN4B 4I4TF 5LM3A 2OTCA 3VNUA 1HDIA 3DKVA 4F3KA 4NBNA 1H94A 4CIXA 1Q2XA 1SVOA 5EXTA 5TX7A 4PR0A 5JSZA 2VP4A 1A8QA 5D51S 4YCLA 5DX8A 3EA5A 4TMFA 5AD1A 2XVZA 2C5SA 1NVTA 5BQOA 1T5HX 2DM6A 3ELWA 4PSKA 2A9PA 1C80A 3LCJA 1DQNA 3PYXA 4AJKA 4F2DA 4F3TA 1FDTA 2X5JO 4YC7A 3OF2A 2Z3WA 2R8PA 4LQDA 5J4VA 4KO1S 3GJ7A 2HHJA 1ZOPA 1ZD1A 3SEZA 3NTQA 3GZTB 3SBXA 2YY7A 3K1AA 2C4TA 4JUCA 2IS1A 2GHQA 2W0MA 2LDXA 3VR2D 3ZHOA 4C88A 3REQB 1ZUD1 5EI5A 3VNAA 1YZFA 1V1MA 1MXHA 3FYHA 1LGYA 1W6RA 1L4NA 1WDLA 1JDUA 3CWZA 4ZI5A 1PZEA 3NBYC 4EKIA 5C32A 5IT9A 1OW3B 3R8XA 1J0BA 1FXSA 2G4CA 4BO8A 2OXIA 4DQKA 5LQMA 2OQIA 4RJTA 3E27A 4WKGA 1U7PA 4X60A 1RAHA 1NYQA 1VI5A 3O8OA 5IFLA 4I50A 3TZKA 2Z0MA 1P19A 1KY3A 1VGQA 2YN4A 1MC5A 2ZS8A 4U7HA 1W5TA 3AVTA 1P9OA 2AMVA 2ZJZA 4JVSB 5CVEA 5DI9A 3ZDEA 1AXEA 3WIVA 3QEJA 3FDJA 4QGFA 1P9RA 5E9WA 4IICA 1N0WA 1P9NA 3OOHA 4PLVA 2RHLA 3GLTA 2P2SA 3S2ZA 1Y7HA 2FPMA 2XLCA 4LE1A 3WHPA 2P77A 1OBHA 3ZX4A 4AS1A 4BX0A 4B48A 1M2OA 3GAAA 4P0PB 2CE2X 2JH3A 2QX4A 1D7OA 3SN6A 4PXYA 2A9QA 2W8BA 4DY6A 4Z0PA 4B0PA 4URWR 1ZL2A 3RAPR 2H1SA 3OX4A 2J0EA 5KMGB 4K0KB 4XJXA 2FSVC 4Q01A 4JBHA 3CIOA 4L0MA 4MV1A 4F2GA 1XTZA 1Y9JA 3KEQA 5DLEA 1VKZA 3ZVRA 3B78A 3ZR4B 3B52X 5G3YA 4IQ8A 2YNMC 4D6YA 1EHYA 2HBRA 2W2LA 4MS1A 4YJFB 4U2FA 1EVZA 2IV7A 1XVLA 2Q2QA 2ZRKA 4D3ZA 3A6HA 4E2XA 3GR6A 2PWAA 3IGFA 1XPOA 3ICCA 4N5NA 5BNTA 2JLAA 3MGBA 3B1YA 1RU3A 3SPXA 1GGJA 3TOXA 3OQJA 4BNMA 2WIJA 2BBOA 1WPQA 2UZ1B 3EGCA 3I9JA 1M0TA 3QXHA 3WLMA 5IC4A 2MSWA 3KZKA 4WNYA 3H1TA 3MELA 3WGKA 1DKRA 2ZG6A 3CNNA 3C1TA 4WY2A 1I4LD 1UBTS 3X3HA 2ZSAA 3RKRA 1LLDA 4J0JA 3HCEA 1MENA 4HZGA 1JJBA 4BTVA 2O8BB 4CZ2A 3B5EA 3KQMA 4JITA 4MQFB 3SHTA 2VS1A 2XVXA 1VLVA 2R4UA 1WXIA 3KYCA 4CTJA 5I7WA 5JJKA 4DKJA 4KJXA 4ZDKA 2RHHA 4R3UC 1HX7A 1J0CA 1RLOA 1KEUA 4O2BF 4K9SA 2YHBA 2ZRNA 3L0IB 1JI3A 4IIUA 1XEXB 1Z5NA 3IPYA 2FR1A 2VIIA 3EISA 3GI1A 2FRDC 3KPJA 3Q0TA 1RYFA 3A1SA 3OLVA 1YBAA 2WWTA 4JQCA 2AN3A 4L07A 3KM0A 5AJZA 2IU3A 3RVNA 1XB2A 2Q6OA 3EVEA 2XB4A 3UYLA 5IEJA 1YRQA 3A9RA 3OPYI 4Y2RA 4B7CA 4BVBA 4DVGA 5IAKA 4ECEA 1L1RA 5FL7D 3ZW7A 1SCNE 3ZVMA 4D9FA 2AC2A 1GYRA 2OCIA 2NU8B 2CJXA 1NSYA 2EZ9A 2GM9A 2CLHB 2R4TA 3H1AA 4XIIA 5EEGA 4IMRA 3X2EA 4BWFB 3SYNA 2FRVA 4EGQA 4HNAA 2DPYA 2PVSA 1S2LA 1BMQA 1CIVA 3TOSA 5JZOA 2LUOA 2WT9A 2CJPA 2ZITA 4JODA 1T1JA 2SECE 3AJ8A 4OUDB 2BFDA 2YRWA 3JPWA 4W8OA 5HVNA 4P4LA 1KC1A 4PGMA 4Q1DA 3C4QA 4DM7A 2CFCA 3V2UA 4YPOA 1K4MA 2QTCA 3QK7A 2E37A 4K3UA 4TTIA 4IJWA 5LZ5A 1BHQ1 2MINA 1DKUA 4JX9A 3RABA 4DLVA 2CLMB 4CDMA 3HEAA 2OCYC 3W5BA 2Z5FA 4LYJA 4KNWA 3BGWA 5DYNA 5FKJA 4IHKA 1F8GA 2XYQA 4LYHA 2JJQA 3BILA 1YC5A 2WD7B 1SOVA 4Q4CA 1IXSB 1NG1A 1ZAKA 1NR1A 1X80B 4ZWNA 4M53A 2VZ9A 2EBHX 2YWDA 3KTDA 4LECA 5A4JA 3KG2A 1SKAA 1KEZA 3F3SA 2JS7A 5BV2P 4K0RA 1I10A 4J3JA 5FAXA 1JG2A 3E9CA 1GWNA 5TY0A 4UFPA 4IDFA 1PEDA 2GOYA 4JBLA 1ZCFA 4OPMA 4QTXA 2OFFA 3RKUA 5C18A 5AKEA 1C41A 4KLRA 5JO9A 4LWOA 3U3RA 4C0JA 2C9DA 2ZCUA 4JVMA 1PFGA 3K70B 4ZDIA 3ESAA 3FNQA 5DHQA 1UXJA 4M60A 5BSVA 1E4VA 1PE0A 2Y92A 3P5SA 4GOND 2V6BA 1BQEA 1S7CA 4HPWA 3ORQA 5IXYA 3BDVA 1XNQB 1X42A 4JZYA 4NS4A 5AM0A 4K6HA 4UMEA 5TF4A 4A5OA 2CC2A 4YRCA 4BQRA 3LLCA 4MVJE 5IHPA 1PJAA 3CZPA 1Q17A 4JLUA 1VIAA 3HP1A 4B7AA 3ECAA 1Y7LA 1GGVA 1N25A 2A92A 3LP6A 3PDJA 3PDIB 5LDHA 1KY2A 1PGOA 2HQ1A 1M6YA 2E87A 1KI6B 1N9GA 1Z4QA 2PGOA 3AU9A 4Q1AA 2OYCA 1MC4A 1GN8A 2OCDA 2BM9A 2JLBA 1D2NA 2BLNA 3FTNA 3ZU4A 3I8SA 1J20A 1HNZB 1QRRA 1YCHA 1JBEA 1NTRA 1O8CA 5JIBA 2DHQA 2VXCA 4LWZA 3M1LA 4P8RA 3AG5A 3CVJA 1DARA 1C8BA 2D5CA 1E9VA 3FBWA 3OM1A 1QP7A 2IBMA 4IZOA 4M0LA 4MPDA 3UANA 4QLOA 5JH7F 3EFOA 4TVOA 6REQA 1QNLA 5LYJB 1TNDA 5C7LO 1ZUNB 2XKKA 3LY8A 1FFXA 4G0ZA 4HN9A 3N7AA 1D04A 4QQ8A 2BFNA 3LP8A 2HF8A 4KQKA 5ESXA 5HCUA 3ZPXA 3GGDA 3OE1A 4EF4A 5BMOA 1MPTA 3HR8A 3PPWA 4Y2UA 1XDSA 1XZIA 2QAGC 1EM8B 2QM8A 1H2HA 3WYBA 3AGPA 5K3BA 2WYUA 3QHAA 4PRZA 4M36A 1TT7A 4WZAB 1E7WA 4WJLA 1DV1A 2JHGA 1IM8A 3DLBA 1P7VA 3DBHB 5IJ9A 3KYBA 4MB0A 3FVQA 5DP2A 2R6GA 4TXLA 1TU4A 2YYAA 3MUNA 1M74A 2YDXA 3G8YA 4GLBA 2HU8A 4R5MA 4UNIA 2VLBA 5HIAA 2BE9A 5KPDA 4DCCA 2AR7A 1CUDA 2DC1A 3FNBA 1H6CA 2D2FA 4LHXA 1NBAA 4BZZA 4DAOA 2IYUA 4QT4A 2ZIFA 1K75A 3N0WA 3DVLA 1TOAA 4URZR 5A9RA 2QTWB 5G41A 1U98A 4CIVA 4D9IA 4LTNA 1YR3A 1F9EA 3DW3X 3EXEA 2CDRA 5HP4A 2WZDA 3DE2X 3FWZA 4IIHA 1UXGA 4C2TA 4IX9A 1XQVA 3N58A 3RK4A 1J9GA 3NQ41 1RI3A 1MT0A 1N5KA 2ACVA 2VJPA 5ITZB 1P0QA 4MKGA 3W5IA 5HOEA 3BQMB 1F0NA 1E3MA 4QWWA 1MN6A 2ZDQA 5FCDA 1OT5A 4H7FA 1BU8A 4JXXA 2J3MA 4RVFA 1YL5A 4A73A 4RLSA 4HXFB 4BVAA 3W8FA 3M2PA 2B82A 4ZAFA 2AKYA 3DMTA 3IMGA 1X1QA 3PVCA 4NU6A 1RRVA 2PYIA 4UUAA 1JEOA 2B4TO 4OYRA 4PS1A 3ZIAA 1GL6A 1M9NA 1TI7A 2C5LA 2WQZA 3IVAA 3BX1A 4TLAA 5K0BA 3N3AC 1CUJA 4LJ7A 1HKHA 4YREA 2AS0A 2PRKA 3M6FA 3EGXA 3FFBA 3RI3A 3UGQA 4M83A 1H0KA 3K2QA 3PI6A 3WY9A 5TS3A 3IP1A 3QG5A 4Z1OA 4JV5B 4JBIA 4UXHA 1VCHA 4W99A 4ER0A 1G4HA 1Z5VA 4ZRMA 3G79A 2OILA 3ESDA 5FLKA 2QQ5A 2Q2OA 3CIFA 1T36B 2O2JA 1FDRA 3GB9A 2EEZA 1DCKA 1FLNA 3KSZO 3SIPA 3ZIDA 4NR0A 4AKGA 3OOJA 3PLNA 4DLTA 2VDKB 3FSRA 5FULA 1P7YA 5ICMA 4NMLA 2IXEA 4WJZA 2XBMA 4G4JA 4HAZA 2Y77A 4QJ5A 4ZVRA 1E9CA 4BP3A 5CLJA 1CR6A 2MIIA 4DLSA 4UUBA 4I55A 4DDMA 3D5QA 3TRDA 4HQ0A 4RMGA 5BN3A 2Q9BA 3VPXA 2GXUA 3EPRA 1BRMA 3ME5A 2VDPB 4TL9A 2DQ4A 4KE6A 3CLSD 4WLOA 2F17A 3AFGA 1SPBS 1ZRSA 2VDVE 4JJ7A 5FJIA 4TMXA 3LBYA 2GEVA 1NUSA 4F3CA 1RNLA 1BJRE 1JPNA 1Y6QA 1WZNA 4CKWA 2NUAA 2YL2A 2BV3A 4QREA 3WLQA 1AX9A 1KO8A 3BMNA 3QU7A 4Y8VA 3U4GA 8ATCA 5B6PA 2EF1A 4MJ7A 1N5IA 2LDBA 1KP2A 2OCBA 1GFIA 4LHYA 1MNAA 5D7BA 5CFRA 4MJ3A 1A9RA 3AO0B 4HF7A 2OG2A 5F4ZA 2IP4A 1NU8A 2OKCA 2LVBA 1SC6A 4B71A 2GKGA 1LKZA 2EEPA 3UJNA 1ZGAA 2BR5A 4BEWA 3ILXA 4C3OB 3FUTA 2E55A 3E9QA 1G17A 1J0DA 1KYTA 1W1IA 2HGZA 1SY7A 1LNSA 2WTMA 5FOVA 1TYAE 4CLOA 4HY3A 3WIBA 4U2DA 2R5WA 3C3WA 3GGGA 4EB6B 2A4KA 3AY6A 1V8PA 4ZC8A 3FYDA 3NT4A 4CT5A 5IPFA 5LL6P 3OLWA 1U28C 2RK4A 3ZWKA 5C53B 2VZEA 1YIDA 1PTJA 2PH7A 5H5JA 4IX1A 1ZIXA 1UBHS 3T3GA 4COOA 2V59A 3BT7A 2DPGA 2CXPA 2CJFA 2NV0A 1XCJA 2YZ2A 1CJBA 1L5WA 4KXWA 4CETA 1P6XA 1H4QA 2VAMA 5HWSA 4MZDA 2DWQA 3FAKA 4URUR 3ZCTA 1WQ1R 2V0CA 2B3DA 1I4OA 3PFHA 2CZGA 2XNKA 2VSOA 2F4VB 3V2HA 4OXRA 1PJ8A 2E7ZA 2ZAYA 2QGZA 5CM9C 4UFNA 3W1EA 2EKZA 1DBWA 2OHOA 2WTAA 3QLJA 1KNXA 2CJYA 2I78A 2UXDB 3NYIA 4I1UA 2X86A 4K6FA 1YULA 2C8JA 3O03A 2I2DA 4K81B 1O08A 1UJ5A 4LI0A 2RIPA 3ZOZA 3PA8A 4RV9A 4DIUA 4N0MA 4QVKA 1AK9A 3ONVA 4YP1A 1SUBA 4AJHA 4OSOA 5FUMA 3WYAA 5TPWB 1HTTA 1L5OA 3G2KA 4KQXA 1N5RA 4QFMA 4ROTA 1XF9A 1IXKA 4E51A 1NM5C 2J5KA 2X2OA 2PKEA 4Y98A 1W4RA 2P9FA 1L5HB 3C3JA 1Y8QA 1IZYA 1MB0A 5ARDA 3CINA 4M6WB 5HBGA 1BEZA 1QOPB 5E4FA 2R85A 1CEXA 2X23A 3VSDA 3OCZA 4JB2A 5K3FB 3P9NA 3HWX1 4OD0A 4L85A 4RVSA 3VH3A 1WXHA 2VNSA 3W3AH 4S05A 5PGMA 1YQUA 3CKMA 3H65A 5CB6A 4EA7A 4MPTA 4YGYA 2V9PA 3D8HA 5EHXA 2B6HA 3O8BA 4RY0A 3HGTA 3FGPA 5ALXA 3NIFB 4ARBA 4JASB 1PUIA 2OSVA 3GO4A 3CLTD 3E7DA 2CSUA 3RVOA 5LC1A 4CGZA 2XUIA 2XMBA 3AHGA 1DWPA 2NVWA 4FYXA 3J7AC 3AMVA 3BXGA 1PGJA 3HKDB 3IVXA 3AF6A 3CN7A 1EFCA 4WZBA 4AZ3B 1XL1A 1EVEA 3T3MB 3ANTA 5D3MA 1FQJA 1JFFB 1GPLA 1NVVR 1Y98A 2C2XA 4YTEA 1U2TA 4IINA 2ZTVA 1ZN9A 2CWDA 4GE0A 4R3WA 1IN4A 5JVDF 1OZHA 3JQ7A 4OCZA 1OYOA 1QK4A 1QFSA 3PCXA 4TS4A 3CZ4A 3PEEA 3LO8A 4NDNE 3WXMA 2OP1A 5A3RA 3L06A 1YRAA 2B92A 2DECA 3GEBA 2PZGA 2E5FA 4AM8A 4P6VF 3GMDA 2AK2A 1V39A 1VLJA 1YUBA 1JILA 1ZM2A 3JYHA 3K5WA 4MRAA 4XOUA 5E3IA 4HNVA 2XZLA 3E3LA 4YMVA 3H8WA 5T8KC 2YC2C 3ZHRA 2HFJA 3FLAA 3UEOA 1XN1A 3ERCA 3O31A 3L3BA 4TTJA 1XKQA 2J41A 2WYIA 3ZN2A 2V7QD 1QDUA 1UP6A 4M1OA 2M98A 3HJHA 4XYGA 3RG8A 1NRWA 1FU4A 2ZE5A 3TZBA 3ZKWB 3WYEA 4S3MA 1YKFA 4MR8A 4BRUA 3ANYB 1E58A 3D7MA 4GR4A 4QXAA 4UW9A 1F3OA 1KAMA 2YQZA 5EWLB 4CI9A 3T3IA 1TM5E 4E03A 4P4UA 1Q84A 1YA6A 2WMNB 5HJ2A 3GLUA 2EG9A 1N6NA 1BXGB 1Q15A 3EW9A 3SEQA 4BE9A 1CY4A 1MKYA 2FG5A 2H1WA 1P33A 1PS9A 2W0SA 4Q3AA 2KHZA 3W7AA 2MYNA 1ETUA 1LS6A 4ND8A 5KYNA 4G09A 2OFXA 2H17A 1TLFA 4FD2A 3GGPA 4CM8B 3DMYA 4ZIRA 4B81A 1GKKA 1KA9H 1VHQA 2FN9A 2JBAA 3D3JA 3DO8A 2AD1A 3HABA 1PJSA 2XDWA 2ZANA 3R1IA 4JB3A 2NG1A 4LCBA 3MT0A 4AS3A 3QWHA 1FTGA 3ADOA 1ZJZA 5TLSA 4FWTA 2C88A 4GXNA 3VJRA 2A3NA 1Z0ZA 4F97A 1IHDA 1U7OA 3LLVA 3QVTA 3OETA 1V95A 4IGIA 4KR9A 2ZIEA 2WZQA 3R3JA 1I3OA 1Z4NA 2KBEA 5IKEA 3IURA 1NQAO 1N6LA 3KSRA 5K0LA 4FYPA 1B73A 3IJEB 2DF8A 3UT0A 2HMWA 1YQWA 1YNOA 2TMKA 3AF1A 3ZWQA 2AI1A 5BSGA 4YCNA 3ETEA 4TTRA 1P5JA 3ZXUB 4C29A 1AK2A 1XI2A 3OEEA 5GZ1A 5JXHA 1TK3A 3AUFA 4DLNA 1UM9A 3B1XA 1SCBA 1U7ZA 1T6ZA 4KR7A 1TA0A 4LDRA 4E7PA 1IC6A 4CQLB 3B7WA 4HGNA 1H5UA 1T0HB 2Q3HA 1FLAA 1JIUA 2AZTA 4G0QA 5L6MB 5IASA 1YR1A 4IJKA 1P3Y1 5DHFA 4GO1A 5EMLA 4LYYA 2XF2A 5I4KA 4RVUA 5JCOA 5C0OE 4MS3A 3KSAC 1XCLA 1Q44A 3H2BA 3PGMA 5IM5A 5D1HA 3OPNA 2D74A 4V0QA 5DH9A 3H9EO 1GJRA 1GAJA 1ORWA 3I9OA 4BB6A 4X41A 4AMBA 3CKYA 1G7TA 4GQBA 1G8GA 4J76A 4OG2A 1ZJYA 1E9AA 3LPLA 3NAMA 3L0BA 2NU6B 3M6IA 4QEKA 3OTOB 2CXUA 4L74A 3FYUA 2Q50A 1ECJA 3ICWA 2X13A 4L08A 5FXMA 2SHKA 3FJOA 1HXHA 1ZMRA 3GFBA 4B6PA 2DG2A 2NZYA 2KMLA 5GPBA 2ZUFA 3BHJA 4UKDA 1YD7A 1BKDR 1E5TA 3C7CB 5DULA 4KN6A 1SBTA 4E46A 5KQRA 1A7AA 5DWDA 5E4YA 1Z73A 5BORA 1MOPA 3E2MA 4K5QA 4LJ9A 2D7CA 2EX0A 3LOQA 1VOTA 3NJRA 3AUYA 4IVRA 5CXXA 2IIPA 4LY6A 2QLLA 4EGFA 3P1JA 4AVYA 1O1YA 2FX3A 4FZ3A 3VTKA 4UEJA 5ADHA 1VI2A 4GLJA 2Y1OA 4RTKA 2H11A 2LE0A 3EEFA 5HG0A 1DEHA 2WJ3A 3THYB 2Q7XA 2AR9A 4RABA 3GBSA 5CLHA 4BV3A 1WM1A 1VBKA 3NIBA 1JHQA 3F96A 2JD1A 3Q4GA 2QW1A 3U7QA 3WOVA 3O26A 4X7RA 5KNLA 1DBSA 3OEWA 3FPGA 3K0CA 1ORTA 1ZCZA 2FPSA 3LUHA 4YRJA 5H02A 2MSEB 2TMYA 1XLVA 3B8EA 3RC9A 3U19A 4TUYB 1DXHA 3PQ3A 2CSXA 2KQUA 2HADA 4K26A 1TU0A 4FR5A 4RCYA 3NG1A 1RIIA 4TPKA 5GONF 1RXYA 4N5IX 5TJHA 3K94A 3RRJA 1P1KA 2J8ZA 3A1DA 4DCPA 1L4GA 1UBOS 2V54A 1J2EA 3KAJA 4KXQA 4AMVA 1EFAA 3H87A 1HFKA 3LPNA 5HZKA 1RXEA 3HV2A 4RWEA 1D09A 5P21A 2CCJA 2NLOA 2ZR0A 1Z68A 3A36A 3N07A 4NP6A 4N0EA 3WGYA 1QYIA 3W90A 1ML3A 4EO4A 3D8SA 1T6BY 3PFBA 1UZMA 2DB3A 1N5OX 1WW3A 3A7DA 1YA4A 2AH5A 2PQ6A 1M2VB 4KRGA 2PYZA 3DL0A 1F4LA 1H42A 3EFBA 4WK4B 2WJIA 2O1XA 4R2XA 1OBCA 1F14A 3NKVA 1R0SA 1OKKD 2DR3A 3HDGA 4GMDA 3SM3A 3QWFA 2F3PA 4AXXA 1ZIPA 5P8WA 5JXIA 1KJIA 2DAPA 1U3UA 2RG7A 3VSAA 3KJZA 4GI2A 4YCMA 4C4XA 1R8YA 2FMFA 4D3DA 4MW9A 3RUHA 1P0CA 3ZHZA 4Q4AB 4WOBA 4Z6KA 5DNAA 3VPCA 4RHTA 1ZU4A 1JDJA 4NJEB 4J2TA 3SSOA 1UAAA 2R751 4HNSA 2QN2A 1A1VA 3MJTA 1WEHA 3C7DB 3HEBA 4YMTA 1C5KA 1EA5A 2XQIA 4W9MC 1OFTA 3M6WA 2PO5A 4Z4IA 3QBJA 2Q41A 4JLKA 4K9OA 5LQAA 1V11A 1GG5A 1Y8RA 2OECA 3JZMA 3C3CA 1JBKA 2JZCA 5GOZA 1ODIA 1EWKA 2Q0HA 4MDEA 2DKNA 4LA4A 2PUWA 1PBNA 3TVTA 5C5CA 1XJWA 1Q21A 3EXAA 3O94A 1QK5A 2Q4RA 3L6DA 4AJEA 5K3CA 2IITA 3ICPA 5GM2A 4Z7JA 3W6ZA 1QE3A 1U6JA 4U4AA 4MV9A 1Q1NA 1QG2A 4MROA 5FBQB 1NMYA 5I48A 1LRLA 1TQ4A 1I6MA 4B4WA 4JGIA 1DPGA 3I64A 3VMFA 3FVRA 1FMCA 2GPYA 3B3JA 3ONEA 5HZGA 1SXJE 1LBSA 3UQZA 5H70A 3IXQA 1GO2A 3CNOA 3L4KA 4P38A 1ZH4A 4AKSA 2VPYA 1PF7E 2DY0A 2RGYA 3IC5A 1RLIA 1LF0A 1NNEA 1X8LA 2YWFA 1RZUA 2I80A 2XA1A 1I2CA 3DBOB 1UL1X 1K3TA 4ZAGA 4WNCA 1L0BA 1PR9A 3GUVA 3IEPA 5CXSA 2JIQA 2I3BA 1ECBA 1PJLA 1RYHA 2HJRA 2JHAA 1R0YA 5E2IA 4AZWA 1ZOLA 1Z28A 2XGOA 1V9SA 1K0UA 1Z25A 5ELXA 4A6EA 5J2TF 5JLJA 1F2TB 4D7AA 4O63O 5DV9A 1EFRD 3U7RA 5KDOA 1P1BA 3TO5A 3L05A 2BLLA 1JDTA 2C9MA 5JY1A 2XMRA 1U9ZA 3TLGB 5LR6A 8OHMA 3SOZA 2HRRA 1TEZA 5DCLA 4HKTA 1B0AA 4F12A 4F4DA 1INLA 4P0TA 3VZRA 3D2BA 1Z2NX 2O8DA 1V8ZA 5CVDA 1NJSA 2WU0A 3LYLA 3H9CA 3MSXA 3SIWA 2NZ2A 2VK1A 5A9SB 1M2NA 1OGIA 2IHYA 3TD9A 2EARA 1KFKB 3GPIA 2PZJA 2OD9A 3TWOA 1W0KD 4R1NA 5F7XA 5IYZA 1GUBA 1TMKA 3KEGA 3INGA 3OLYA 5FOXA 3GIWA 1U2RA 3FTDA 4DJAA 4IH1A 1HT2E 4P7JA 4M0PA 5T4BA 2C5GA 2OV8A 3OPQA 1HGXA 1QQAA 1XZGA 1S01A 1LZLA 2W6JD 4UUPA 2HJWA 2GBLC 4OBXA 1E2HA 3NS7A 3VUFA 3C1AA 4UHEA 5CX1B 4N8DA 5JSKA 2VYQA 4EKNB 4EABA 4LSWA 1IL0A 5AP9A 3RW9A 4OM7A 1Z18A 1QH9A 1EAMA 3ITKA 3L0YA 1S2NA 2XAUA 4KRXA 3K5HA 4UNRA 3SVLA 3A2KA 4L50A 3G2IA 3JY6A 4DILA 5EE0A 2ZT8A 1MG0A 5HK9A 3ZBQA 5KZMB 3AWIA 4LAFA 4CG3A 3EVNA 3MIIA 1A4IA 1FC0A 3BGVA 1H6AA 3PB3A 3HZZA 4MQMA 4GNRA 1QGYA 4HWRA 4IG9A 2CNWD 4JNKA 4YT5A 5JD3A 1A7UA 1RQNA 2CHUA 3J7TA 2LTAA 3VO1A 3R0IA 1MMFB 3OAAA 4HL6A 1BGWA 1BMFA 4UC0A 4BGEA 3N0RA 5TRTA 1YF3A 1U5AA 4AFNA 2X8JB 4UFOA 2R1ZA 4X64B 2PV7A 3ZZNA 2WG1A 3GU3A 3R3XA 1GIAA 3R23A 4R1PA 4DA0A 3DMPA 1PWYE 5CT8A 3GXOA 2OAP1 2H85A 4XOIA 3EG5A 3P52A 4OQ4A 3R6WA 3ELYA 4XPIB 4CCYB 2K2WA 3M8KA 1VP9A 5CNMA 1YDMA 3DE0X 1CETA 2UV8A 4YI5A 5AXBA 1TM2A 4IQ4A 1CHDA 1D1TA 4KOEC 3Q3EA 2H1OA 5CPBA 1P61B 2R44A 2V7WA 5CAEB 5TQ0A 3W5SA 2O8EB 4UPVA 1KTVA 3JVVA 4UBIA 1IVNA 4ZYZA 3F8TA 4KHZA 1OB2A 3HI4A 4ZZ0A 3RVPA 4HJRA 2J9FB 3R5FA 1EK0A 4MGHA 4J8PA 1JMKC 5CR9A 3E3OA 1EP3B 4Z9XA 1RYEA 1D0VA 1LZKA 1VCNA 1WB6A 3KQPA 4ME6A 1EIZA 4WWHA 3QV1A 4UUQA 3A2NA 4LNUA 5CW1A 4BIIA 1R64A 4O2RA 3VJLA 4R84A 2QM7A 2FVYA 2D54A 3JAKB 3PQ8A 2OBNA 3VZCA 1PR3A 2A9FA 3ZBPA 1AN0A 2EQ5A 2Z5VA 3HI6A 1KDYA 1ZM3A 3MT7A 1XQXA 3REGA 3R44A 2XWSA 4PNPA 3AFMA 4TSFD 2O4UX 4UNPA 2CMGA 2BGTA 3AUSA 2P0EA 4HQNA 3JWGA 1MO3A 3N6VA 1ZVKA 4WD3A 3A06A 3NNNA 4ZV4A 1UPTA 2HHCA 1RFLA 3GJXC 1FVXA 2PFSA 3QGMA 4IVPA 4FI3C 3IMKA 3NP9A 4L9SA 1E3IA 2H9IA 3I6BA 4FM9A 2FK7A 4R2HA 5IM4F 4K87A 3V7YA 2EZ8A 1HQCA 2AJLI 4CUKA 1FP4A 1L8OA 2V7XA 1TIPA 2IDKA 2EWMA 5KIAA 1JVNA 1QHXA 3AR4A 5GTDA 1SCDA 1DAFA 1ECLA 3WX0A 1PUXA 1KDVA 2HA3A 4DSTA 4BTEA 1ZGBA 3CO0S 1HLGA 2Y0PA 3U6BA 2QUHA 4YJGA 4HAUA 4WN3A 2P3OA 1U1DA 3DOJA 5KC9A 5COAA 3RLIA 1ZN7A 5TQ2A 3G0HA 2AYXA 2IODA 3ZBTA 3LUBA 2J30A 4TYQA 1AUQA 3DJFA 2FPKA 4CLRA 3EVAA 2I1VB 2DUUA 2Y3IA 2Z83A 2R6JA 3PHHA 4IZ6A 2AG1A 4KGVA 4QIHA 4X61A 4ETNA 2XXAB 1W36B 2PMFA 3D2CA 4X3PA 5JSHA 2R7LA 2NQTA 3BTSA 3FKSA 4AJOA 4GMHA 1E1KA 5LP6F 4J9VA 1P74A 1FVOA 3BL6A 4IW3B 1HDOA 1WL8A 2E1RA 1T8SA 2CLLB 4RIIA 4ZU6X 3ZZ0A 3VR6D 3HRIA 3PC3A 3NCTA 1DX6A 4JC8A 4UREA 4DMCA 3KSBC 3LYUA 2GD6A 1L5SA 2HIGA 1YUMA 1TD1A 4IJVA 1R4ZA 4J94A 2HIAA 3BQNB 1ODTC 2XKJE 1EVLA 2ZWMA 3FLEA 3RIHA 3QYJA 4AC9A 1XVAA 3VYSB 5LWHA 4B9EA 1IDN1 1VZ3A 4HPJB 5LFAA 5JATA 1DOZA 4L0DA 3ACCA 3ROMA 3HACA 1JR3A 1KZHA 4A0FA 4ZYWA 4X20A 1GTVA 1P2TA 4Z2YA 2XHZA 3FJYA 1LCIA 2B8JA 2X3FA 2QBYA 5ILQA 1NE2A 2FYTA 3F1KA 1UFOA 1XMIA 2AMLA 4BBZA 1A9YA 4XPZA 4GICA 3R7AA 5H83A 3IHKA 4PLCA 1WV0A 1YJ8A 5DOZA 3SSNA 1CUEA 3I04A 4TM8A 5COQA 4Y7CA 1CX9B 1YI0A 2WU1A 2VJAA 4DV0B 3A9WA 3JARA 4RD2A 4K9MA 1Z4MA 2E6KA 2ZU6A 3O2SB 4BMVA 2Q6VA 1CY1A 3PFNA 5KOHB 3VU9B 1R6BX 2QXUA 3IAAA 4F9EA 4IQGA 1RJ9B 4MYSA 1XF1A 1YCFA 1ZYUA 2H5EA 1IK4A 3OP1A 3BWMA 3M70A 4L4YA 2ZRQA 4C2AA 1FYWA 3UHOA 5CNIA 2Y0CA 1KIMA 3RGWS 4H7EA 3LBNA 4EUFA 3A1EA 1W49A 3PFKA 2ZBEA 4ZO8A 3OJOA 1B6RA 3ZWOA 3SNKA 1G2PA 1P1IA 3RHZA 4HCJA 2IYXA 1SXJB 5A2GA 3PQ4A 4HHEA 1NV9A 1JHVA 4PHTA 2VKQA 1N2OA 3H6KA 3HCBA 4OLJA 3W6PA 4WAUA 1I0ZA 1SWWA 4UTZA 2O1SA 3NDBB 1U3DA 5L40A 1H8HD 1F60A 2FQXA 3QX9A 4NFHA 4XYMA 5DHUA 5F7JA 5H68A 3UWOA 3WDMA 3K70D 3BMXA 1OXVA 4CM7A 4WK6A 4J1TA 1SIOA 1UP4A 1ZD3A 1RYDA 1MUUA 2XZPA 3DJYA 3R3SA 4V0MA 4JXZA 4IR7A 1QKKA 1BQ3A 3OPYB 1CQJA 3VXKA 1DX4A 3IXMA 3QUTA 4PZAA 1T26A 2B99A 2BMWA 2IE8A 4ECAA 5IF3A 5IS2A 4EBFA 4DNOA 3T1TA 3ESQA 5EKXA 5LB2A 5M29A 1JN0A 2OFPA 5JJBA 1FBTA 1T8PA 2UVPA 3FR8A 3NKFA 4BJ5A 5ICEA 3TLXA 2VF7A 1IWPB 1EWQA 3UVEA 5DMXA 2Q9UA 1T0PA 1PS8A 3OZVA 3BZUA 3DULA 4P5EA 4V0KA 4HLUC 4OVKA 4DEVA 3LY5A 2A1UB 4MKZA 1SBHA 1Y6RA 5JMPA 4G8DA 5EJ4A 1ZEMA 4AKHA 2HEIA 4MUMA 5JZSA 3JWIA 1G8HA 4F96A 5BXYA 4ASUA 1PZHA 3QUCA 3UICA 2M32A 3U13A 4J91A 2FSVA 4ALNA 1FNMA 4YCBA 3COZA 3QBTA 4UD6A 2P9BA 4JC5A 4J0EA 1XSEA 4LC1A 3K71B 4W6QA 2YNMA 3AK4A 4L78A 1IU9A 1I1OA 1XXLA 2LIPA 1XROA 1D2GA 1TJNA 2DLDA 4O0LA 3SP1A 4EKGA 3R4CA 2OCGA 3CPEA 3OA0A 1M0WA 1ZKMA 4EF6A 4R1QA 3W77A 4GSYA 1QC5A 3ND5A 1A8PA 4O2AB 3IALA 2QX6A 4YFYA 2CLDX 1U3CA 1U90A 2WZBA 3WYGA 1OHHA 2ZWOA 5I9BA 2HSEA 1K88A 1R6AA 1T2EA 2NSYA 3IE2A 2FHPA 3QE3A 3ZHSA 4D0GA 4C7OB 3FTQA 4GE3A 3CZ9A 3GVXA 4DPKA 1DB3A 4GM1A 4Y0VA 3IAEA 1W9MA 4DWOA 2B0CA 2NTVA 3V8MA 5EJ6A 5ESWA 4OAQA 3R3ZA 3KDAA 3GP8A 3KOMA 4YWHA 1QO0A 1XZNA 3KEFA 1J42A 3VI3B 3VKFA 1JE0A 1V4VA 1E1RA 3TE6A 4BNYA 4FCVA 1VC2A 3UOWA 4H15A 5JZBA 2XQFA 2XR1A 1CY0A 2P9CA 4PLHA 1LJUA 3QX3A 1QX3A 1DXOA 1NDUA 2FRDA 3HVKA 1NLMA 3FDXA 3L93A 3O4IA