1AUOA

Carboxylesterase from pseudomonas fluorescens
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
MTEPLILQPAKPADACVIWLHGLGADRYDFMPVAEALQESLLTTRFVLPQAPTRPVTINGGYEMPSWYDIKAMSPARSISLEELEVSAKMVTDLIEAQKRTGIDASRIFLAGFSQGGAVVFHTAFINWQGPLGGVIALSTYAPTFGDELELSASQQRIPALCLHGQYDDVVQNAMGRSAFEHLKSRGVTVTWQEYPMGHEVLPQEIHDIGAWLAARLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of carboxylesterase from Pseudomonas fluorescens, an alpha/beta hydrolase with broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords CARBOXYLESTERASE
total genus 73
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 1997-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auoA00
1WB4A 5K3FA 5FDFA 3H17A 1LBSA 4UHCA 1ZD3A 4G9EA 3KD2A 3KXPA 4AMYA 1ZIYA 5ALNA 1JT2A 3BJMA 4B85A 4AQDA 4ZRDA 3MUOA 1MPXA 4PNZA 1LBTA 1LZLA 3W05A 4BVKA 3G0DA 1C7IA 5AKKA 2QT9A 1U65A 1ZJ4A 3K6KA 4P93A 1XZCA 1FFDA 2ZJ7A 3DOIA 4M0FA 4ZV9A 1QO7A 3KOOA 4PO3X 1QIEA 2Y2VA 1YS2X 3IUNA 3GA7A 4BYMA 1GPKA 5LZ5A 1E89A 1Q84A 1LPOA 1QGED 1AMNA 3ZV7A 1WPRA 3E1GA 2YXPX 5HFAA 3WYNA 2HHAA 3RARA 1A88A 4QDZA 1JJFA 2OCLA 1MN6A 4JH0A 3AIMA 3C43A 5HF8A 5FPQA 3WA7A 3U0VA 4PF1A 1JMYA 2XE4A 4BTLA 4Y2VA 4BDTA 5AI0A 3FSGD 5IVDA 1MJ5A 2IITA 1Q0RA 4BP8A 3QVMA 2WIJA 5AM4A 4Y2SA 1VJ5A 4EY5A 3C5VA 4KAJA 5ALOA 4FOLA 1TIBA 5I8PA 2Y1KA 1TCAA 5AKXA 4Q82A 3EBLA 1DWOA 5ALLA 5YASA 3STVA 2X5XA 1OXMA 4B82A 2HA2A 3VVLA 3FNBA 1EX9A 3PDCA 5JAPA 5CURA 4INZA 2IX9A 1ZICA 3HC7A 1MTZA 4Y2YA 3W06A 4UHEA 2OG1A 4UUQA 4QNNA 1XROA 2QTBA 1EH5A 2WKWA 4MEAA 3PFCA 3BXPA 2BGRA 2XQGA 1YA8A 4BE4A 3G9ZA 2Y6VA 4Y2XA 4GWLA 4B7ZA 3HRHA 3V1LA 4QEKA 2VAVA 4B9EA 4BBZA 3DL7A 1A7UA 1LZKA 3E0XA 2CB9A 1SOMA 4KACA 1AX9A 1DTEA 3O4HA 3G0BA 1MNQA 4Q1VA 4BCCA 1NU8A 1J07A 2WIKA 5CT4A 1IUOA 4H77A 3STUA 4ZV7A 1AKNA 4IHAA 1UK6A 5T4FA 1QE3A 5C8ZA 2CBGA 4QDXA 5LIPA 2XB6A 4X71A 1MO2A 5FUMA 2XQIA 2QOEA 4N8EA 1JI3A 5A71A 5LKAA 3C5WP 4Q34A 2AJCA 2CEKA 4K2AA 3IUJA 1DWPA 3AIOA 4X6YA 4C4ZA 4UFOA 2H7YA 4X90A 3C8HA 3R0VA 4L3WA 4ZI5A 5AKIA 3S8YA 1R50A 3V1MA 4EA6A 2XUAA 2HL6A 3WJ1A 3FBWA 3TEJA 4BDSA 3TRDA 4AO6A 3C87A 3PUIA 3H19A 4L9AA 4B0OA 1XZBA 2J4CA 2RHWA 4DNOA 2EEPA 3IVMA 4DMHA 2YYSA 4DNQA 4C89A 4B83A 1XKTA 5DLPA 2HADA 5E2IA 4IH4A 3A6ZA 5AJHA 1XRNA 1R9NA 1QFMA 3LIIA 2HA0A 4A23A 3B3QA 4K6KA 2WFZA 2WTNA 1XRPA 4V2IA 1QFSA 3QMWA 1S8OA 3PE6A 1Q83A 3HXKA 3S2ZA 2QKYA 1USWA 3ZWQA 4KE7A 5AO9A 3ZLVA 3DEAA 2H7CA 1CUVA 2ONCA 4OCZA 4ZXFA 5A7FA 3I2IA 4X00A 3W2TA 2XMSA 3N0TA 5ISMA 3FYUA 1EHYA 2I78A 5E4TA 5HFNA 3QZUA 2DCMA 3BJRA 3WWOA 3QBJA 2PPLA 4OB6A 2OXEA 1YR2A 3GFFA 4U2DA 3KWJA 4M0MA 3BL8A 5LZ8A 5CXUA 1CUGA 1LPMA 5D7BA 3QYJA 1FFBA 3O9VA 3CN9A 3D4LA 1QIIA 1MAHA 5LP1A 1GPLA 3ICWA 1ISPA 1VXRA 4TVKA 4AN0A 1J1IA 5HK8A 1I6WA 2WUFA 2ACEA 1E8DA 1XZKA 1ZD5A 2ZYHA 2C0PA 2C5GA 1XZMA 2GYWA 1Y7IA 4K5QA 5AH0A 3W04A 3TGLA 4CI9A 2RIPA 5C8XA 2JGJA 4FFWA 5BOVA 3JYHA 5A6VA 2JIDA 3IURA 3WZMA 4ZWNA 1H2YA 1UOQA 5CH8A 4GEGA 5A7GA 1E5TA 3R3WA 2VT6A 4MYDA 4B0PA 4ETWA 1P0QA 4WY5A 2WHRA 4LXGA 1L7AA 1U8EA 3VJKA 3WKDA 4BCBA 1GXSA 5EHXA 1A8UA 1JJIA 5CMLA 2RI6A 1ACLA 1VA4A 1YAHA 2XUIA 1EVEA 4J0IA 1FFEA 4WCVA 1TKRA 5AIBA 1FFAA 5BWCA 1K4YA 2J3QA 3W9UA 1WPXA 3FOBA 4Y2JA 2QJWA 4C01A 3O4GA 4S0XA 4O08A 4EY7A 3QPCA 1TK3A 3D5EA 4BVLA 2OAGA 2WUGA 1HPLA 2GBCA 5LZ2A 7YASA 5DWDA 5AK5A 4KYVA 5HF5A 4L72A 1N5MA 1RWQA 5CT8A 5AM1A 4BC0A 3ESBA 5FP0A 5ALGA 2C5FA 5AK4A 5IH7A 4AO8A 3QITA 4WFIA 1GKLA 5JAOA 2DHCA 4KJXA 1YB6A 1XZJA 3FLEA 3BF8A 4HTAA 3HEAA 2C58A 4FBLA 2QXTA 3K2IA 4JNCA 2YH2A 3WLAA 4B6GA 2Z8XA 2C7BA 3FCYA 4QE3A 5I7UA 4X85A 3DS8A 3I28A 3ANSA 4C6HA 2BKLA 1LLFA 5DYYA 4FTWA 2XUHA 1CV2A 4U2BA 1H2XA 3IA2A 4QLAA 5K3DA 3DQZA 2ZJ6A 2WJ3A 5BWBA 5LYYA 1AZWA 1HDEA 5AK3A 1CUCA 4FNGA 1A8SA 2JEYA 4XWGA 3WL7A 3H1AA 3M82A 1QIJA 3H18A 5HKBA 4J3JA 4A5SA 3I2FA 1Y37A 1QZ3A 2ZSIA 5CH5A 3PI6A 2W6CX 3L1JA 5DTIA 1HKHA 3STYA 1QIKA 5EI5A 4J0DA 2WU3A 1QTRA 1ZD2P 1JMKC 2QXUA 5JASA 3EQ9A 4I3FA 1IZ7A 2WJ4A 1W1IA 2ZJFA 5F4ZA 1C7JA 1WHSA 1CUFA 4CCYB 1DQYA 2VJDA 2AJ8A 4QWWA 1M33A 3QPDA 5JD5A 4NS4A 4HVTA 3FVRA 2XI4A 4D9JA 4KE6A 4WFJA 3WIOA 2ECFA 1JU3A 2RHTA 3LLCA 2I3DA 2V98A 1ZIXA 3B5EA 5AM3A 4OU4A 4BVJA 4YX9A 1EK1A 1BEZA 3VXKA 5D6OA 1GKKA 2DR0A 5DTJA 3C6YA 1ZD4A 3WQHA 1O6FA 4ROTA 1TAHA 1U2EA 1ZGCA 4JYMA 4C4XA 2VATA 5EFZA 1N5RA 3O9MA 5AKGA 1EINA 3DOHA 4EY6A 3WA6A 5JAHA 1AURA 4CG3A 1UOPA 3FLAA 4UHFA 5AKEA 1K8QA 4XJVA 3K9BA 2BUBA 1CUSA 2ROQA 4FLMA 4HXGA 1XZGA 2J4FA 1W76A 3LS2A 2O2IA 1E3QA 3D3NA 3AUKA 1CUJA 4G5XA 5ALRA 3G0GA 2HIHA 2WFMA 4X3CA 4AXBA 4KEAA 4U2EA 1CPYA 4X97A 2ZVDA 3G0CA 3I2HA 2VAXA 2ZYSA 3WK8A 2PL5A 5EGNA 2XUKA 3F67A 4PSDA 5KWJA 3F98A 1YAJA 5ALWA 3R3ZA 5FKJA 4UHBA 2WIDA 5CXXA 1E66A 1Z68A 1NU6A 1R1DA 1OILA 2GZRA 3OM8A 3L1HA 3IUMA 4H7HA 4Y2TA 1TCCA 4FNMA 1PV1A 1X70A 1BU8A 2XLBA 4UBLA 2OAEA 1ZOIA 4OUKX 4NMWA 5ALKA 5AOCA 3C6ZA 2B61A 1CUEA 1XZDA 3AJAA 1RP1A 2G4LA 3PF9A 2ZYIA 3HI4A 4X6UA 5DNVA 1VZ3A 4Y2UA 1KEZA 1CUUA 4OPMA 2V96A 2OCGA 3L1IA 1DWQA 3HLKA 3ANTA 5K3FB 4BZWA 4CIBA 1AGYA 5ALHA 3H2HA 5LLSA 3C6BA 5FLKA 4F0JA 4N5HX 1K5PA 5JD4A 1UOOA 2VJAA 2W22A 3OG9A 3ED1A 3BIWA 3DKRA 3QPAA 1N1MA 4G8CA 3H2KA 4I19A 3CCCA 5JIBA 4OB8A 1BRTA 1T2NA 1BN6A 5C8VA 3LP5A 2JBWA 1YB7A 5AI9A 1HQDA 5JYCA 1EXWA 2QZPA 4DLNA 2FJPA 3H2JA 2O2GA 5ALPA 4Z49A 5LZ7A 5JZ9A 5HF6A 3Q0TA 1GPNA 4AX4A 1VZ2A 2PVSA 1DU4A 2OLEA 4QDUA 4TPKA 1MX9A 3GZJA 4AB1A 2WHQA 3STXA 2Y6UA 4P92A 1WOMA 4G4GA 5CW2A 4IO0A 2Z5GA 3DCNA 5ALTA 1ZJ5A 2X8BA 3IBTA 5JADA 2GBGA 4H35A 2Z3WA 1LPSA 2OPHA 4FBMA 3BE8A 3I1YA 4OD0A 5CRIA 4QLOA 2BFNA 3ZPXA 1XZEA 1QIHA 4G8DA 3I2JA 4DNPA 2HA3A 1EDDA 1MU0A 3SX4A 1X2BA 4BAGA 4MQLA 4F21A 4Q3KA 1XLVA 2QJRA 4XIIA 1ZI9A 1UFOA 3R3VA 2B20A 4M0EA 4RPCA 3WL6A 1E8NA 3G7NA 1TCBA 3FWHA 1AQLA 3VJLA 4ARAA 3SWWA 4KE8A 1C4XA 3NGMA 5IVIA 5I9IA 2AJLI 1CUZA 2HA7A 4X91A 1Y7HA 3DDUA 4WY8A 3ZI7A 5BV7A 1BROA 5A62A 4LKOA 2VTVA 5CT9A 3DLTA 4EHBA 4OB7A 1R3DA 5AHXA 1XZFA 4UFNA 3QM1A 3MGAA 2X76A 2ES4A 2XMGA 4MXDA 5CT6A 3V9AA 5K3BA 4GW3A 1IZ8A 4UBMA 2PKYX 3NWOA 2PSFA 4LXHA 2V9ZA 4IQ4A 4RGYA 5A7HA 4BCDA 5HQ3B 4MWSA 1G5FA 1CUWA 4KAAA 4LXIA 3WK7A 2PSJA 2WLSA 4W1PA 3NOXA 4HRYA 4HZGA 3D0KA 3WK6A 6YASA 2G5PA 3EF3A 5IKXA 1IMJA 4H7FA 1E8MA 4H7KA 1MX5A 4Y2PA 4MJ3A 1CUXA 1EVQA 3F97A 3KDAA 4OYLA 1BS9A 4K6GA 3DJYA 1DX4A 4PSUA 1VOTA 4MWTA 1XKLA 4OU5A 3HJUA 1G66A 3BDIA 4BATA 2PM8A 1UKAA 2OGZA 3EQ7A 3PUHA 4ITVA 2WQZA 4X93A 2FUKA 5HF9A 2WG1A 4U2CA 5AI4A 5AM5A 2QUBA 1CQWA 2QMQA 3AIKA 3G9UA 1R4ZA 2WTMA 2QUAA 3G8YA 2GYUA 3SK0A 1BEEA 1YCDA 5ALYA 2AXEA 3HACA 4G4JA 4Y7DA 4W1QA 4BAZA 1A8QA 4AZ0A 2PBLA 4Q3LA 4Q3OA 1YSCA 5AOAA 2XQJA 1WCYA 5HZGA 1FJ2A 1GZ7A 1UWCA 2WHPB 1B41A 3O4IA 2IIVA 3KWFA 2BGNA 4RNCA 2YASA 4G8BA 4UHDA 2RONA 3AILA 3OC0A 1XRMA 4J0KA 4QDOA 3H1BA 3N2ZB 5AKLA 2G5TA 4EY4A 1H2WA 4ZGBA 2HFKA 5A2GA 1HBJA 3QMVA 1P0IA 3CXUA 5CT5A 3IUQA 3T52A 1EB8A 1JU4A 3R3UA 3R3YA 5JD6A 2PUJA 5T4HA 5DYWA 3V1NA 5HKAA 2XMBA 5ESRA 4UBIA 1CUYA 4UPDA 5CH3A 3C45A 5DJ5A 2JGEA 4B80A 5ALMA 1TRHA 3F96A 4L0CA 1YA4A 5ALDA 3VVMA 1CRLA 3FCXA 1SCKA 1LPAB 5AM2A 2RAUA 2XMZA 5LKRA 3X3HA 3BDVA 4AO7A 1ZI6A 4J03A 2GBFA 2WIFA 5ALUA 3BIXA 1QTIA 2XUJA 2XUFA 1XZIA 1CR6A 5FXMA 2CZQA 4FHZA 3IIIA 4FKBA 1EK2A 1UZAA 4Y9SA 1XRLA 3U1TA 3H0CA 1PJAA 2OQVA 3STWA 2PU5A 5EIHA 3WK5A 3OOSA 3ESDA 5AI6A 3HYSA 3FYUC 4I4CA 4B9AA 2JGIA 1YS1X 2PSDA 2Z8ZA 3H2IA 4FDMA 1FSSA 1IUPA 1JFRA 4KRXA 1G4HA 1ODSA 3P2MA 2BUAA 4OYYA 1AC5A 2HA4A 2DQYA 4PSCA 1X2EA 4EY8A 2HRQA 2WM2A 5ALVA 2XDWA 4GDMA 2DSNA 2XMQA 1LPPA 2NW6A 4LYDA 3WKEA 3AFIA 1CUAA 3AINA 4DSZA 3D59A 4UFPA 3EIOA 4WFKA 2XT0A 4LYEA 1XLWA 3DYIA 4CG1A 3WZLA 5EIAA 3DD5A 2JEZA 1GGVA 3I2KA 5ALIA 4XX1A 3D7RA 1F8UA 1SC9A 1DQZA 4KRYA 5EIEA 3OPMA 3GUUA 3WK9A 4UBKA 4JEIA 1EI9A 3YASA 3WWPA 1CVLA 2I03A 4EUSA 2HA5A 1XQYA 4B81A 1QIGA 4OSEA 3PICA 2BCEA 3I2GA 3FYUB 1ZGBA 3DL4A 2DQZA 4W63A 5JAUA 2ZSHA 5FPPA 4YK7A 5HCUA 3ZLTA 1CQZA 1G42A 1BCRA 2JGLA 5IVHA 2PSEA 4KE9A 3ICVA 4J0JA 3PF8A 3AZQA 3WKBA 2VEOA 1GT6A 1NX9A 2RGUA 1UKBA 3FSGA 5AKHA 2Y2UA 1UKCA 2OQIA 3R3XA 5AKJA 5LZ4A 2HFJA 3ZLUA 1THGA 5SYNA 1OCEA 4EZIA 5JARA 3D2CA 1R9MA 2WHPA 3CN7A 1YASA 1W4LA 1W75A 3B12A 2G63A 1ZI8A 1IVYA 5SYMA 3MUNA 4PQEA 1EB9A 2CJPA 4C4YA 4F5ZA 2OGSA 3Q8WA 5T4EA 3SC2A 5ALFA 4H7IA 1P0MA 3W9BA 1WB5A 1F0NA 5HK9A 4GHWA 3WMRA 1JJBA 4EB0A 3STTA 4GECA 1H23A 3LIPA 3DNMA 1J06A 4TGLA 4G9GA 4GXNA 5KBYA 1XZHA 1BCSA 3JW8A 5LZ9A 2K2QB 1QIDA 3FYTA 1CIJA 2CMFA 3WI7A 1L7RA 2WU4A 4DYHA 1LGYA 5FRDA 4DSAA 5H3HA 2GZSA 3G0IA 2CUTA 3A2MA 2XUGA 5K5EA 1UXOA 4IH1A 3QH4A 1XRQA 4H0CA 4JYPA 3TJMA 1DINA 1QONA 5E4YA 3JWEA 5E4JA 5ALJA 1H2ZA 1F0PA 1O6GA 3EQ8A 2WUDA 1VKHA 4BE9A 4EBBA 5T4BA 4W1RA 1HLGA 1ODCA 2ORYA 4BZZA 3VKFA 1EA5A 2OCKA 2B9VA 2D0DA 1QIFA 4X92A 4N8DA 2V97A 4CCYA 3D2BA 1LNSA 5ALSA 5ALZA 1ORWA 1WHTA 1QJ4A 4JUIA 3WL8A 1QOZA 3UMJA 1WM1A 4G4IA 1SCIA 4FWBA 4QDTA 5KREA 3F8SA 1PFQA 1UT6A 4UBOA 1XZLA 4Y2QA 4P9NA 2B4KA 2XMCA 1VLQA 1DT5A 4CG2A 1CUBA 1LPNA 3UUEA 4QZVA 2WFLB 1TQHA 3GROA 4HS9A 1VA5A 2HRRA 2EDCA 3DKKA 4X95A 3WL5A 4J0HA 1N8SA 2WUEA 5EHZA 5AP9A 3ILSA 4E15A 2DFPA 1ODTC 3WKAA 4GLBA 1QIMA 4IH9A 4AZ3A 4CCWA 1UK7A 4XVCA 4GBGA 5K3AA 4P08A 4H18A 1CUDA 1CLEA 4LIPD 5ALEA 2ZYRA 4DMKA 3GELA 3OTQA 4WDRA 3HABA 5EHNA 5AKYA 4RE6A 1F6WA 4BP9A 2VSQA 5AIAA 4B84A 3I6MA 4BRSA 2DHDA 2C4HA 1CUHA 3WYDA 1BE0A 1XLUA 3LCRA 1MT3A 1U4NA 4CFSA 4E11A 2HDWA 5JALA 3DYVA 1MX1A 2WIGA 1KU6A 1ACJA 4A16A 3WWDA 1Q0ZA 5FOQA 3I1IA 3A70A 2O2HA 4FFVA 3WJ2A 3WK4A 4DMCA 3O0DA 4UBJA 2XUPA 2EDAA 4LHEA 5CBKA 3IULA 2R11A 5JZBA 1QLWA 4FLEA 2XUDA 3WIBA 5JZSA 3IDAA 2JGMA 2XUQA 2DHEA 1B6GA 4Y2RA 2PUHA 3F9CA 5AKZA 3MVEA 1ETHA 1IUNA 5CTAA 3RK4A 4X6XA 2VT7A 4HXFB 3WWEA 2JGKA 2E3JA 3HSSA 2GYVA 4G1FA 4J0CA 5JATA 2ACKA 1LPBB 2HM7A 1VE7A 1XZAA 3G02A 4WDQA 1K6EA 3H2GA 4DGQA 5AI8A 2FJ0A 3QMMA 2UZ0A 3FVTA 3A2LA 5ALQA 2BJHA 4RE5A 4C87A 2H9YA 3E3AA 2VF2A 2WJ6A 4FMPA 4BC1A 1WB6A 5FV4A 4GI1A 3UUFA 2PX6A 3M81A 3A2NA 3VDXA 3PFBA 1D07A 4CIAA 2D5LA 3FAKA 1GQRA 2BUCA 4ARBA 5KWIA 2O7VA 3GBSA 1K63A 5EHQA 4DIUA 1H22A 2WG2A 1EDBA 5J3JA 2VA9A 4K6HA 1KU0A 5AI5A 2QS9A 3R41A 2QRUA 3V48A 3BF7A 1AUOA 1UK8A 3FLBA 5DYTA 4DMFA 3D2AA 3AZPA 2XUOA 2WG0A 4J0GA 5AM0A 1DT3A 5K3EA 4F60A 2R8BA 3WWCA 4H7EA 1DX6A 4YASA 4QWMA 2WILA 4BAUA 4FLFA 2QM0A 4Q05A 3AZOA 5DNUA 3ESAA 2LIPA 4H7JA 2HU8A 5AICA 2Q0XA 2JF0A 3NUZA 2WFLA 1UK9A 1P0PA 5JANA 4H7DA 3HZOA 2H7XA 4X7BA 2PU7A 4DTCA 4NVRA 2HA6A 5IVKA 3C70A 1RYYA 2J3DA 5K3CA 1CFJA 4AMZA 1J2EA 3G9XA 1SFRA 3RLIA 3IB3A 3C6XA 1FFCA 1XRRA 4J7AA 4MQMA 1W52X 3H04A 1BN7A 2BAGA 3VISA 4HRXA 4E46A 3KSRA 1T4MA 4U2GA 1MNAA 1HL7A 1L7QA 3M83A 4MYSA 3BWXA 1W6RA 5C81A 5ALXA 2OGTA 3I6YA 5C7YA 3G9TA 1ORVA 2Z3ZA 3R40A 5AOBA 2AJBA 1XQWA 4WJLA 5HQ3A 4U2FA 4N8SA 1XQXA 2QVBA 3M3DA 4BRZA 4MEBA 5D3ZA 1EDEA 2OCIA 4UBNA 4KR0A 3WKCA 2FX5A 1MAAA 2CKMA 4HAIA 4BTVA 2GBIA 2XQKA 3OURA 5DNWA 4PV7A 3T4UA 2PSHA 1CUIA 4HXEB 5AK6A 4BB0A 4W1SA 2WSLA 4DM7A 2VQ6A 1VXOA 2JGFA 3VJMA 4N5IX 1QO9A 3CCBA 3V1KA 1VE6A 2XQFA 4PW0A 2VJBA 4X94A 2H1IA 4W9RA 3O4JA 2HU7A 2XMDA 4KAFA 2C0QA 2XLCA 3O95A 2XMRA 2HU5A 1XQVA 4NZZA 3RM3A 3RKSA 3ESCA 4QA9A 4YPVA 1CEXA 3C8DA 2O7RA 4AN1A 5D3KA 4UHHA 2QR5A 2VJCA 1JKMA 4E14A 3I6ZA 1XFDA 1THTA 4C88A 1SCQA 4DNFA 2AJDA 2I3ZA 3E4DA 4ZREA 2P8SA 1GQSA 1R88A
chains in the Genus database with same CATH superfamily
3FH0A 4NFYA 2EG9A 2PKCA 3NT2A 4UEWA 4WKOA 5FDFA 3LK7A 3CLVA 4O6VA 4UHCA 4YUVA 2W11A 3BWBA 3EFOB 3KVVA 3S2GA 1IN7A 3D3JA 1QCZA 4PZ0A 3QI7A 3PJFA 2X2OA 4QO7A 4DSUA 1E1QA 1WHSB 5JYBA 3QYFA 1VHWA 3HDHA 1S6YA 1E5QA 2QMUA 1NF9A 2C9MA 3PUVA 2IV2X 4NQRA 2QW1A 1W29A 2KJQA 1JT2A 2P62A 3I9V1 4I6GA 5FR2A 4ZI3A 1G5TA 3C97A 2ENUA 3L8ZA 3BJMA 2Y0CA 1YU6A 2Y4NA 3IELA 3N8IA 1CJMA 5E0OA 2A33A 3RABA 3TW4A 1PNOA 4AQDA 2YY6A 4ZRDA 4V0KA 1KI1A 1M5TA 5G0UA 4IJKA 3HK2A 4E31A 1ONOA 3KELA 3WADA 2UXCB 1MGOA 1LBTA 2FB9A 2FUG6 3RU9A 1NZFA 3EK2A 3ZUGA 3PQ6A 3GX1A 4XASA 2IEIA 2MSCB 3ANNA 2XODA 1E7YA 1T8WA 1ZJ4A 3K6KA 1XZCA 1Q0HA 4P93A 1TGVA 3MLBA 1NVXQ 2BBOA 4MUJA 4WZAA 1E7SA 1RWPA 3EXEA 1C0IA 1U5BB 1EX6A 2QAGC 4HZIA 4KK3A 5GINE 2HB6A 2RHLA 3JD2A 3W5AA 3PXDA 1MD9A 1NXQA 1FP1D 5B1YA 1CCWA 1YDFA 1WNTA 4EIWA 5BNIA 6ABPA 1ZUIA 1U31A 1N6LA 4A6DA 4BFCA 2OZEA 2XWJI 4BUJA 5JY1A 3IUNA 1E1YA 1XNGA 2B5OA 3LBNA 1RKBA 3OUUA 4URZR 4V1CB 3C1AA 2YFHA 4IIEA 5FI5A 3N7AA 3NATA 2O8FA 3OJEA 5BW5A 4LUCA 4CM9D 1P2FA 2P75A 2VYCA 3FKSA 5HVNA 1AMNA 1GYRA 1M6NA 2P5TB 1CQIB 1PDWA 4ECEA 4D02A 1VJ0A 2JFQA 1K4MA 3F6SA 2HHAA 3I2YX 3I73A 3OU2A 4QTUB 1A88A 4QVKA 4YRRA 2EEZA 2H1RA 1CETA 3RARA 4DC1A 4DVGA 1G5PA 1EXDA 1G8JA 3UF0A 2OBMA 3H83A 4WZBA 1H9CA 3KZVA 5ECYA 4Q9IA 1Y4AE 2C9OA 4JH0A 3IQHX 2OV6A 1RPTA 3DKVA 2E5WA 1XOIA 1OWPA 1JLMA 3HYNA 2XNJA 3KBBA 1CQIA 4L50A 1ZGHA 2VZLA 1A5AB 1TW3A 3JPWA 5AI0A 4I4TB 2ZSJA 3SNKA 4EI8A 2G71A 3ZD9A 4EENA 3E5MA 1N5JA 1R8SA 1AUXA 4H1TA 1BVYF 1CJCA 2NPIA 4NV0A 2XIQA 5FA8A 4CMKA 4W5QA 1ENOA 1GPWB 1RKVA 2OD7A 3IH5A 1L7PA 2DPYA 3CWCA 5EKTA 1VG0B 5HJ5A 4O0LA 4BP8A 1YHNA 4AD8A 5FF9A 1PG5A 3L40A 3QVMA 4MGZR 1FS5A 1PCXA 3A8TA 5CEFA 3AVYA 4MVJA 1JAZA 1VJ5A 1NVEA 3MTEA 1SRRA 2EF0A 1IAQA 3V42A 4I9GA 1TIBA 2AQHA 5F5NA 3BA6A 2Y1KA 1TCAA 1X1DA 4Q82A 3NOQA 4PLTA 4MRNA 1W0CA 2G80A 4GP9A 4Q15A 3DWGA 4Q4HA 5JHHB 2JBAB 3MT0A 2OGWA 1Z0SA 4X1KB 4JB8A 1DPGA 2GSDA 4M21A 4CCSA 2C4WA 4ZVMA 2R62A 2V6JA 3STVA 2PZAA 4D74A 3PU6A 3NWBA 5DU2A 2DWUA 2IYPA 1R8XA 2J5RA 3GMIA 4RY8A 1RP7A 2GZHA 2Q7XA 1USIA 3FNBA 1JB9A 1HL3A 1NTRA 2JFWA 3TSZA 4NU0A 4B3HA 2KSQA 1SKAA 4CIVA 2LVBA 2HPAA 1CQXA 4CGYA 3GLFE 1L8QA 1FDRA 1Q20A 2Z8YM 4HAZA 1DUVG 2NQ2C 2P8JA 1R16A 1H93A 4M9UA 4Y30A 4LI0A 3L1KA 1EPUA 4FCTA 4Y2YA 2PANA 4RS4A 5DCLA 1XROA 4LGVA 2BF4A 2AYYA 1RTTA 4QGFA 3BZUA 3SQMA 2Y3IA 3GUVA 1NLUA 1YKFA 3QQPA 1F4PA 4MEAA 3LY7A 3K8ZA 3BXPA 3ND8A 3SD7A 1KYIA 1L7DA 3FPFA 3G9ZA 4WLOA 5IYZF 3S4YA 3PQ5A 1QS0B 1T2CA 2VRWA 3DV0B 4RZQA 2H59A 4KBFA 4U5XA 4ZYYA 5H81A 3NFRA 1JR2A 3AEKB 3ONVA 1KYVA 2HBQA 3WBBA 4IO1A 4XB6B 4BP3A 4IWXA 4LYGA 1E4YA 2WE8A 4PEVA 5BY2A 1JHVA 4BBZA 4X3OA 4DXDA 1MABA 3KTOA 5HZMA 1KQPA 1E9SA 5CVJA 4YRBA 5KTMA 5MN6A 3UAYA 3NVKI 1YRYE 1VMIA 4MVXA 3E0XA 2J85A 3FHCB 4WK0B 4P1ZA 2ODNA 4I5FA 3Q1LA 5HKOA 2BELA 3PWZA 1DTEA 3DMNA 4R2WA 1GPH1 4Q9JA 3E15A 1L5SA 5GTDA 4ZO4A 3V4SA 1E2LA 3A4TA 1MNQA 4GPZA 4XD7D 4BCCA 3OPYB 4CNQA 1J07A 3QEKA 3KAQA 4WLNA 5CT4A 3STUA 1I01A 1UPCA 3H5IA 4FIZA 4BKUA 4TTPA 2VI5A 4IHAA 2DGDA 4R0NA 3VR4D 3RHFA 3AF6A 1N2IA 4MUXA 1QE3A 4O4IB 4Q1BA 3ABQB 3CQ9A 2CBGA 3D64A 3NXSA 1KMHA 3VR0A 4P0PB 3DTVD 4X71A 3ZE9A 2HQRA 2P11A 4EUNA 3ABZA 5FUMA 1RQ2A 2QOEA 2AMVA 1WLSA 1Z25A 3P32A 4N8EA 2JJ8A 4EUHA 2X0FA 2HWUA 4IHJA 2VAWA 3NHJA 4JGBA 4MDYA 4CM4A 1T9HA 4C7JA 4ZAFA 1SVOA 1E4OA 4Q34A 2NOAA 3WTBA 2AJCA 4PZYA 2NUTB 1U8AA 2HMTA 3A9UA 3WGNA 3C14C 1BG6A 2MYPA 2ZBGA 2R79A 3G2LA 3GEEA 4PSVA 4URWR 1M83A 1MC8A 1B0ZA 2BHTA 1N5KA 2FKAA 3HDVA 3RYTC 4EQ6A 5BVHB 4NONA 1AM4D 1FLNA 2BEVA 3KS9A 3QGMA 3BCHA 3R0XA 4QRIA 3RVLA 4C4ZA 1DDIA 4L3WA 2B7LA 3EZ7A 2W6ZA 3WLNA 1EUYA 2JFNA 4ZI5A 5AKIA 5BR1A 1DNPA 3G23A 4ZOLA 3I76A 3S8YA 2Q3DA 3T9AA 4RIEA 3QP9A 4EA6A 2O2EA 3THYA 3VO1A 2YVQA 3KTDA 3FM9A 2B1IA 2OD2A 4AZ0B 1P77A 3D5TA 3ELDA 5AK3A 2PWZA 2HL6A 1QB8A 2XB8A 3LO8A 3FBWA 1JXMA 1TJPB 1NUTA 1ZQ1A 1RCTE 3NGLA 4PLHA 3KB2A 2IXDA 3EEQA 4NX2A 5DHFA 2HIAA 5ITZB 2EAUA 1JAYA 3G5UA 3EGWA 3NWEA 3FW1A 4KLNA 4NBWA 5MN5A 4AKEA 1UPXA 3EC7A 2J9ZB 1BGXT 4WAUA 3C87A 2I4MA 5KVSA 1UJ4A 3PUIA 4L9AA 4EMUA 1E7RA 5LB2A 4B3DA 2WIBA 3F3SA 3DVQX 4GOXA 4LHSA 3B1FA 4NBKA 3H5OA 5DK4A 5SZJA 4AZTA 1VDMA 4ARUA 4B0OA 1SXJE 3B60A 4G3XA 3WOVA 2FSHA 4V1CI 3AJRA 2R68A 4FZ5A 4ZEWA 2V1UA 3SLRA 4YC7A 2E48A 4ZARA 3VZBA 3WSWA 4Y3UA 2J48A 2XYHA 4QBTA 4RVSA 3PFWO 3T9EA 1NBMA 3JQ8A 4K05A 4Z7NB 1RC0A 5JXWA 4XRGA 1HGXA 2XVAA 1XKTA 5BMVF 4HX2A 2HADA 1TZJA 2VPQA 3GGJA 1CZNA 2DWQA 2X9QA 4UTNA 2MWMA 1XCBA 2XYPA 3L7MA 4M76B 2JFYA 1SC3A 1UDWA 2OT3B 5E2IA 2QYHA 3IJEB 3AUUA 4FT2A 1Y9JA 1K5GA 3I39X 4JDPA 5IT4A 3M6FA 2GN1A 3GRCA 5KDDA 3D8RA 4MVJD 3F71A 1E3TA 1QBGA 5F21A 3NV7A 1O1YA 5A0FA 4ENPA 2EGHA 2G76A 2NO6A 5F4BA 4K6KA 3VNBA 4QXMA 5EKDA 3NBYC 1H4SA 3URMA 2YNMD 4IEFB 2ECPA 2PMDA 1R74A 2HSZA 3I5YA 4NAVA 1QFSA 5KX5F 1E0KA 4ZVVA 3KYCB 1CX9B 1N9GA 1JIJA 3TTVA 1OAOC 1S8OA 2C94A 3LZDA 3MCUA 2WP8J 3QFRA 3EDYA 3WIEA 4X1YA 1YH3A 3RS9A 1V3UA 1Q83A 4WOPA 3H9QA 5ILGA 5IVPA 5KNBH 3INYA 4A9AA 4BNYA 5FV7A 1GL9B 2ZTVA 4OHWA 5FUWA 1E98A 4IMJB 1IDOA 2F67A 1NN5A 3O03A 5C80A 3GBVA 3ASVA 1YCHA 4OX9Y 4NY1A 1X42A 3DEAA 1XKXA 3BJEA 3T34A 3DT6A 1CUVA 1ZEJA 2ONCA 3JVVA 1ULZA 4GMKA 1QHFA 1Z4IA 5GM1A 3G2MA 3WRYA 1HF3A 3MCAA 1D4OA 4KI0A 1OPXA 1R15A 4IJQA 1KEKA 4BRUA 1MP0A 1RMYA 2AKYA 5BQ3A 3NDBB 3PC7A 3WMGA 2H17A 1MFPA 3OQHA 3UJBA 1U9IA 2ZRCA 1A2KC 1IXZA 2GZ1A 1HDOA 3N2LA 4JIGA 2P27A 3GP3A 2WVAA 3RF7A 3S99A 4Q7JB 1YVDA 1BYIA 2DRIA 1LY1A 3QBJA 3TFOA 3SZMA 2XRZA 2HQ1A 2BFDA 2P41A 2YHAA 2IYUA 3SICE 1J0BA 2HRDA 5LBTA 4OB6A 2ZUUA 5BR4A 2D2FA 1P4RA 4U2DA 3KWJA 3IQGX 4W9NC 2C2GA 4OLBA 4GP7A 5HMMA 3VPSA 5LZ8A 1S9HA 1LPMA 4D9GA 1EYZA 2GBLC 1HT1E 2W6PA 2EVWX 1OWLA 3PQCA 3QYJA 1PW7A 2WSIA 3PRKE 1CS4C 2FWAA 5ESWA 1Z34A 3RK1A 4B35A 1ECJA 1QIIA 2PGDA 4LRWA 4C29A 2JCXA 1G21A 2R97A 3RUFA 3AFNA 3ICWA 4M8NE 4TMKA 3RRZA 3GLGA 3OLZA 3IUSA 5B53A 5BO5A 1KK3A 3O2SB 5BUCA 1OAOA 2WUFA 1FLVA 3H05A 3ISVA 1F8XA 3L0IB 5CFOA 1AO3A 3SU8A 4ZYUA 1NBWB 2MYNA 1VMDA 3V8BA 3AFHA 3IKJA 1KMMA 2ZI7A 2ZYHA 5L3ZA 4N48A 1VPWA 1EIWA 4JJ4A 4P58A 1I3OA 4MS4B 1QU2A 1MJHA 1Y7IA 4K5QA 3SKVA 5TY0A 4J3NA 2IXTA 1QQAA 2I67A 4CMHA 1GQQA 3CGWA 1AKYA 4M87A 4MZXA 5EP2A 5FWXA 2J9GA 4CKCA 4Z99A 2EJCA 2RAVA 3DTYA 4D97A 5LP6B 1EBBA 5GJWC 2FFQA 5BWMA 5EE9A 3CW8X 4IVPA 5ULLA 1ZESA 2HHCA 4AS3A 3IQEA 3JYHA 2QLNA 5FBVB 4GRAA 2CYAA 3ZHYA 2FUCA 2DOKA 1RD4A 2CUZA 2V5VA 4FSXA 1LXCA 3F7TA 3FHJA 4GEGA 4MGIR 4YJFA 5A7GA 2B34A 4TTJA 4ALJA 3R3WA 1J49A 2VT6A 2VWHA 4R71A 3GCWA 3WMEA 3KLPX 2JVJA 4RHTA 4ETWA 1MOQA 3FOWA 3CLKA 1KYWA 2EL9A 4EPRA 1VL6A 4L5JA 4W9NA 3ZVKA 3KFVA 2OP0A 5F3DA 1RT9A 3DM9B 3OJXA 1KEEB 3BC1A 4RJ2A 3FF1A 3CEHA 3HLTA 3TVDA 4ER0A 2GN2A 3M4XA 2IY8A 5H70A 4BB6A 4BCBA 1RAIA 4E4TA 1A8UA 1YQQA 5JDCC 1GU7A 2RI6A 5DKFA 4C6TB 3PC8C 4CCAA 1O0SA 1EHCA 1EVEA 4LECA 4QTTB 3HO8A 3P9IA 4R9UC 4WCVA 4PS0A 3UEOA 4QUBA 2GM9A 4Z3KA 1K4YA 4ZAVA 2HF8A 4H17A 3FOBA 3OEWA 1T5DX 1E61A 4EI2A 4J0FA 3WAKA 4OLFA 1P18A 3IAS6 4Q4LA 4MKRA 1FU8A 4JXJA 4HX9A 2ZYTX 4TXMA 2C61A 3EYAA 2C2ZA 3E2MA 4GICA 3AI3A 4MHOA 3S2YA 2Y8EA 4UQPA 3RNOA 4BVLA 1OFUA 3OCVA 1NV8A 3ND5A 3VYUB 4BVFA 2OAGA 2WUGA 3ANYB 3F5FA 4HLDA 3NUQA 4FHGA 4DJEC 3TQOA 1UEIA 1KC1A 2OORA 3THWB 5LZ2A 3LX4A 3O47A 5LYJB 3TTTA 1VCOA 7YASA 2VDNB 2PZ8A 2JHAA 2IW3A 2ON6A 4GGPA 2BTEA 2Q8NA 3S6JA 1C8LA 2OK8A 5HF5A 3PFGA 1PFKA 4H4DA 4R84A 3I09A 1C1HA 1MJNA 3AUFA 4GC5A 2XDQB 1Z0JA 5DM2A 5CT8A 3ZWWA 4BC0A 1AQJA 2HKIA 3VNQA 1KA9H 3KETA 4AO8A 3GLFA 5G02A 4MKGA 3WQBA 2PUEA 3HR7A 1SQSA 2EC5A 4AJ4A 4II3A 4ARZA 4KJXA 1PX0A 2F1KA 1XZJA 3LYLA 3FLEA 2KWIA 4OUDA 1WO8A 3EIUA 3AVXA 1UC9A 5HDQA 3C5HA 2X58A 5HIJA 4BX2A 1GAEO 3K2IA 3TAUA 2PMWB 1VSUA 3DZBA 5DW3A 4QUJA 5JDCA 2Q1SA 2WD7A 1XMIA 2WNIA 3PHIA 2IZ5A 3UKOA 3K0CC 4B7XA 2ZR8A 2AF3C 4RVGA 3IOCA 2KW5A 5G4KA 1YV9A 3WGYA 2NSHA 1DRWA 4KGVA 4C6HA 4C5AA 4DLLA 5BW8A 3PENA 4ZCMA 2I3GA 3CO0S 1LLFA 1G4AE 4OXKA 1OH8A 1PVVA 1KF0A 4L0MA 1MW9X 4C30A 5KJ6A 4IYJA 3MWEA 5J2TB 4RXTA 5KOIA 4IINA 2XE7A 2FUG1 4OQFA 1LW6E 3HA2A 3A1DA 5A1TA 1T43A 1H0HA 2V0NA 2IXEA 3TAXA 4F3CA 4R0MA 4CEHA 2CVOA 2X0DA 1SY7A 5A3JA 5L4SA 2O5CA 4O4JF 2GCOB 3VH4A 1TF5A 3DQZA 3PD7A 2OM6A 4F1WA 2WJ3A 1QSGA 3RC1A 3ULKA 3UZUA 5BQ5A 5LYYA 2AMJA 2G4VA 1AZWA 1GA1A 1FJGB 2OMKA 2Y71A 3LSYA 1J5XA 2RHOA 2YS6A 1Q15A 1S01A 4XI9A 2Q45A 2OCXA 3P20A 3K8YA 5DSXA 3R7AA 1NN1A 3HV0A 1YVUA 3RT9A 3RVNA 3FNFA 4ENVA 4ZJPA 5ED4A 1QIJA 3DZHA 2QIPA 3WLSA 1KKUA 2QD2A 3EPPA 2FOIA 4KR6A 1OR8A 2VQDA 4INAA 4BZXA 3F7OA 3I2FA 3PXAA 2CMDA 2ZSIA 1YQXA 1K7EB 1A9PA 1EXMA 2VAMA 3ISTA 5KNLA 1JKXA 3I8XA 3L1JA 2QX4A 3EHEA 2Q2QA 3O21A 3FMIA 4XVUA 5TNXA 1I4EB 3DE1X 5TVGA 4TZ6A 3F46A 4J6EA 1L3BA 3DWFA 5KJCA 2BKXA 2NSYA 2OL4A 1BKSB 1I1HA 3O8BA 3P5SA 4R2HA 3SJZA 1KP3A 2JZNA 1CRZA 3CZMA 4QG3A 2GXQA 5JASA 4HZUB 1W85A 3PEUA 4WOCA 5C18A 4TX1A 1FW6A 1D1QA 3UKDA 3NANA 5LA6A 3TDNA 4FIDA 5JBQA 4WMLA 4RPGA 3V8NA 4LTNA 1TVKA 3H5NA 1ZJWA 3MWFA 1YGPA 2B1QA 5CLHA 5DE3A 2IKSA 3Q9NA 3UTCA 4A3SA 2DUJA 1CJUC 4JLMA 3VYVA 3SJ7A 3PD0A 1G8GA 2C4NA 2BEUA 3PIIA 1C7JA 1US8A 2PX4A 3B38A 3M6UA 3ZJ4A 4J07A 2Q4EA 2CB0A 3TLEA 4S35A 1KBOA 2FX2A 1O95C 4KNYA 3NPAA 1WXXA 4MICA 5KQGA 3IOEA 3X1YA 1QHEA 1NMQA 4QWWA 1M33A 3L41A 9GPBA 5JD5A 3KSAC 4Z51A 1YZVA 4HVTA 4PTYA 2C7QA 1CW2B 3BIFA 3P8ZA 4YUXA 3D1JA 3CCFA 3T9FA 2C7GA 4KE6A 4QBGB 5F23A 1U8YA 1QRAA 2VDLB 2OFOA 4AJ1A 4POAA 2ECFA 1B3RA 4OXIA 2ATVA 3H65A 2XUZA 1NF2A 3RHZA 4J1TC 3IR5A 2RHTA 3JYLA 3LLCA 2VDUE 3N74A 2VWGA 3LKVA 1DOZA 5T67A 1KJQA 2OXCA 4OU4A 1TF2A 3LNCA 4MP3A 1CEEA 3PDHA 4Q1FA 1LQ2A 2P4HX 2QX8A 1YRQA 3NC0C 3CVJA 3TTSA 4B71A 1M5UA 3OCYA 4R3WA 3NHYA 4I99A 2NXEA 4YDQA 2J0SA 1C14A 4K9LA 3A4IA 1ITZA 4KUGA 3JQBC 1JSXA 1W88B 4GKJB 3EAGA 5TGDA 4Y6PA 3ZZ0A 1C3LA 2BFCA 1XD9A 2J1LA 5JJIA 3SE7A 4C08A 2OXFA 1PD0A 3C6MA 3LOPA 4UD6A 3GGOA 1W96A 3SHTA 2MMCA 2W0SA 1W5AA 3NBFA 1O6FA 1UMDA 3LCUA 1OI7A 1SVKA 5A04A 1ZC4A 3T1TA 4HEA6 2HJWA 4L5AA 2VHUA 5K8LA 1HY3A 2WWGA 1NYTA 2VTKA 3INNA 2XCSB 1QC5B 1Z4NA 3MOGA 3MAJA 4L3VA 3O9MA 4PFSA 1C8KA 1EINA 1KHTA 4EMTA 5T5QA 2O05A 3ZWMA 3A9WA 1JH9A 2ECQA 3DOHA 5DXFA 2TRSB 2CVZA 5JAHA 1YRBA 1JAIA 4RV9A 3V8QA 1ADGA 3EN0A 5CUQA 2ZCVA 3GJ3A 1UOPA 2IXAA 3QUCA 4QYIA 5E0KB 4ZICA 3USZA 4DEYA 3BMXA 2SICE 4JMPA 3G13A 2OLKA 3GGPA 4V0SA 421PA 1H2FA 2IEBA 5TR9A 4C14A 4H6PA 1LRLA 3N2EA 2VQSA 2BUBA 3K9BA 4L9SA 5IARA 5K0BA 2G36A 1JQDA 2QR3A 5LOVF 4F2HA 2O7QA 1D4FA 1NONA 4EQZA 4C07A 2HRBA 1IVSA 4HXGA 3D9QX 3T7EA 3HCBA 1F9EA 2VYVD 2FLVA 4P31A 4BVBA 5HKKD 1FEZA 3A14A 4JQOA 2G1PA 3I4CA 4LE1A 3AUKA 1W581 1NOIA 4KHPB 5BMVA 1X7GA 2CLSA 5M34A 2WTBA 1H2EA 4YJ2A 3VFDA 2GB4A 4JJKA 3AONB 3HU1A 1TC2A 3K5IA 1KZ1A 3PFNA 4HATA 2ZYUX 4KR2A 2AI3A 2RGGA 4OVKA 2SBTA 5K3SA 1YL7A 1R18A 2HIHA 3JAMA 3GLHB 3HFSA 3WJ7A 2NZ8A 3IV6A 3R76A 3L82B 4B3FX 3RJ9A 3FY4A 4UW9A 3NIBA 5K0ZA 4IXTA 4XSGA 1U9IC 1Y9EA 1KI9A 5L9AA 2O0JA 4UVEA 3HA3A 4A8TA 4Z7OB 4CM7A 3DD1A 1F2UB 1I5OA 1Z16A 4X97A 1NW3A 3MEQA 2P30A 1LSUA 2ZXFA 1GQSA 4BJ6A 4MUGA 5A4KA 2P9EA 2I9PA 5FL7D 2XUKA 3F67A 1AF7A 5KKAA 3ZK7A 1T1IA 3CF6R 2TYSB 4M8IA 1L5HA 1IYZA 1YDHA 1QVWA 3DONA 2CXUA 5JYDA 5KWJA 2AL7A 1RLJA 4EB6B 1XYGA 3F2IA 4HVAA 2ZUTA 1CNFA 5CXXA 5B3KA 5CB8A 2WU1A 3W7VA 1R6XA 2Z09A 1TIKA 1S8AA 1RJEA 4DCSA 1OILA 2K7ZA 3LU1A 5AW5A 4E08A 5EUQB 1KQ3A 4ZIRB 1OB2A 2CZCA 2XYQA 1O08A 2ZS9A 4Z7JA 1TT5A 5JAIA 1YIAA 3ETLA 3F6YA 5G53C 3MWKA 1HE3A 1FQKA 3HNOA 3TZKA 1PV4A 3AVUA 1DMSA 3ENNA 3DMFA 3KK0A 1ZOIA 3L04A 3TM4A 3H3FA 5JRJA 1GQYA 2YZMA 4I55A 4J7CA 5CLQA 1NHGA 1XVAA 4LDAA 5BSGA 2CL5A 5LJLA 4NCAA 4EY3A 1DFGA 2DPHA 2W8BA 3LXXA 3AJAA 4FHCA 1WBDA 2E4UA 1JIVA 2ZBEA 1TM2A 1Y6GA 4KQEA 3E61A 1Q12A 2WAAA 4XYEA 4EDFA 1YVPA 1XWIA 4OG2A 5F3RA 2NO0A 1MA3A 2OY0A 3AHHA 1RE1A 2R8ZA 5DNVA 3THRA 4YCLA 2NTNA 2RC5A 1VZ3A 4S1VA 3KB8A 4CKEA 1JDVA 5JFOA 5B58T 2X4GA 3O8LA 5DWVA 3F6PA 1ONBA 4DBLE 1FRZA 2A1TS 4QT4A 1D9XA 5C0OE 4EO9A 1QRDA 3WP1B 3L8FA 3OQ1A 4DDTA 4OPMA 5CB0A 2V96A 1GCUA 2OCGA 2ZEJA 3KKPA 2AE1A 2C9DA 3L1IA 2O3RA 4RUKA 2VBFA 5D87A 4DR3B 5BYKA 3L92A 2XGJA 4M53A 2ZATA 3L0YA 1J8FA 2PR7A 4NABA 3BBPA 4RPLA 4DLXA 4BEVA 1V2GA 1WS6A 3PRYA 4YPFA 3T5AA 2QRQA 2KM1A 2XVXA 4GOKA 1U0BB 2HPHA 1EM6A 2I4RA 2JD0A 3MUEA 2J07A 4O29A 1IHXA 1COWA 4Z1MD 1TD9A 2R86A 2EHDA 3HY3A 5K01A 4F0JA 2I0FA 3WV4A 4YR9A 5IZCC 3HKEB 5GIPE 3WAJA 2OLJA 1LA2A 4C3OB 3D6NB 1U6KA 1LVHA 4EH1A 4URVR 5JC1A 1UBTS 2O4UX 2W22A 4LNAA 2FLWA 3B1VA 3GXBA 2A94A 2H54A 3ED1A 3R1IA 1UZMA 4QX6A 2IUUA 4RANA 4DV0B 3ZV6A 2WM3A 4BO3A 1GV1A 2I33A 1DBRA 1YE8A 1QO0A 2ZRMA 3DKRA 4LK2A 4IR7A 1WTAA 4YMIA 2RB5A 3E23A 4P7JA 1T0PA 1JSLA 3DEJA 1PR0A 2JI9A 1ADYA 1WSDA 3CCCA 4HGOA 4P82A 3W8DA 4AJ2A 2EHJA 3JCZA 4W4TA 5DYNA 5JSZA 1RQNA 3NH9A 1PX2A 2B6HA 5B4UA 3ES9A 2UZ3A 4OAOA 3E8MA 3U4CA 5KNBA 1NAIA 1Z4KA 2GAAA 1U1CA 1Y89A 3NWPA 4NBRA 5C8VA 4LPSA 3LP5A 4IIFA 2JBWA 1ADCA 1E58A 1ZC3A 2EKBA 4IIVA 1MGPA 2AF4C 1X7WB 3BMCB 1MW8X 4J7UA 2PWYA 4H1UA 3L77A 4DLNA 1T35A 3RRJA 1A4RA 1IXYA 4YMSA 4JL6A 3OKPA 1P0FA 4WXEA 1PWYE 3KPUA 3WRVA 1JDTA 1VFPA 5DOZA 2H63A 3PRHA 1C3OB 5C4GB 3TBHA 3LLUA 5ALPA 3S1AB 2FPGA 2IJGX 5TQ2A 1N4AA 1N2OA 4G26A 5L95A 3Q0TA 3FZEA 1K92A 1GPNA 5FR1A 5I7AA 3RYFB 4AX4A 4OJYA 2OGUA 2R00A 4UEJA 4DM4A 5AXBA 5JRDS 2OLEA 3OQOA 3M2TA 5GV7A 1MX9A 4OJNA 2PQ6A 4P80A 1W8IA 4L22A 1W4RA 1Z0UA 2JFHA 2Y6UA 4P92A 1BOFA 1WOMA 2NV2B 4G0QA 4ZP1A 2EKDA 3R4VA 4IO0A 4ZIRA 1VB3A 4P3NA 3K6SB 2RHRA 4HAUA 4DCMA 2VJLA 1FP4A 3WLHA 1FU7A 4PG6A 2QGZA 3RRMA 2EQAA 4L27A 1LPSA 5KO2A 1JKJA 4N49A 3AT1A 3M6XA 2P68A 1J97A 1PSWA 4QPDA 4TLBA 3DAYA 1M8JA 4WCFB 4D99A 1Y3HA 3DFUA 5CNMA 5FNZA 2MR5A 2WNHA 5DCUA 2Q5HA 5E7QA 2WV7A 1NLZA 3KQOA 2EL7A 2BHRA 1E9DA 4DKJA 1QIHA 1YS7A 4M38A 3HU5A 2UVPA 5B1EA 2R1ZA 4ROSA 2Q5CA 2WSYB 2JHFA 1P7ZA 2HA3A 2HCJB 4HLQB 1JAXA 4X66B 2GD2A 1ZIPA 1NFRA 3PUZA 3SX4A 1AG9A 1L4KA 1ZP6A 5I4BA 1EGAA 1A69A 4N01A 4IFTA 1CEYA 4MV6A 3L8EA 3AR3A 1FUIA 3PPVA 1DO2A 4BAGA 4BECA 5I3CA 3KG2A 4PZZA 3IPYA 1XMXA 3LLSA 3FNQA 4LY9A 4PLGA 3CZPA 3K4PA 1D2CA 1RWXA 2I2DA 1XLVA 1ZOPA 2ZVJA 5LQJA 1R00A 4LJSA 3DHYA 2P65A 3B1ZA 1E8NA 3TE7A 3HGMA 3KT6A 16PKA 3FWHA 3EUEA 1XGKA 1TYBE 3QJGA 4II2A 1KZHA 5A4DA 1SU8A 5MN4A 1R8YA 2XTJA 4CHTA 2GKOA 4KE8A 5K20A 2VPXA 4ZC1A 4NOMA 5TJHA 1UEJA 1FF9A 2NSJA 4DREA 1C50A 3IB6A 3LRPA 2DEUA 1FZTA 5I9IA 3IAXA 1YBAA 3QWIA 4IV5A 1V1MA 1GZ5A 2QQFA 3A3YA 3G8CA 2L17A 3O3OB 2HZ7A 3GZNA 4HNQA 2HA7A 5K0FA 3RADC 2NXWA 4U7JA 2X5JO 4L85A 3ZLBA 2JDID 5TSDA 3JX9A 5A4FS 3GFQA 5C5IA 4F4CA 3IUYA 1ZWKA 2E0IA 3D31A 2KMLA 4ZXPA 4BO0A 4ZYXA 2I4IA 3Q4GA 1HZJA 1QVVA 1DEAA 2FPUA 3OTIA 1BROA 2P2NA 3OCXA 4GVXA 1R0ZA 4YAIA 3EVZA 3CRW1 4OJKA 2VTVA 1ZRNA 3AFOA 3DMYA 5CT9A 1ZUD1 3FTDA 4XOUA 3BWVA 2QI9C 3LJKA 3WBKA 2FFBA 3ZXYA 5JC8A 1RJGA 3AKCA 4I2VA 4PPFA 3H8WA 4JT8A 3KSMA 1CU1A 1JP7A 4UFNA 1H4QA 3MGAA 2BKEA 2XMGA 2QTWB 4QFMA 5CT6A 3WNDA 3SC4A 2A1UB 4HD8A 2VK2A 2CLFB 5FQOA 2HXSA 2VNJA 3VU8A 5KVCA 3BFXA 3LPLA 4RF3A 4U7FA 1F2DA 4F7DA 5EJEA 3EXG2 2NLOA 5G4LA 4Q7QA 3NWOA 3LO5A 2AG0A 2PSFA 1NJ6A 3A6DA 3A1UA 2Z1MA 5I7RA 2V9ZA 3Q12A 3U4MA 3L5OA 3AP3A 5AJYA 5A7HA 2QD5A 1EWKA 5HQ3B 3EEYA 3DEYX 4HDQB 3CY6A 3IRUA 2WT9A 4Z9BA 3UY4A 4C5CA 1CUWA 4CQMA 2CSXA 4LXIA 1L4LA 3WK7A 1ZISA 3U3ZA 1ATIA 1I7PA 4HZGA 5FO1A 3WK6A 3QMPA 1M3SA 1W34A 2I62A 2W6QA 4G5RA 3K35A 2RGDA 4KSYA 1C7RA 5EP4A 5FL3A 1IMJA 2F3PA 3G8BA 3JQ8B 4H7KA 3U49A 3SC6A 5ANRB 3RC3A 4MJ3A 1R4MB 2EU8A 1SKQA 5JECA 4BWFB 1DUIA 1WCIA 3PGXA 1Q0SA 1NKVA 2GEDA 3VPHA 1RE0A 2QSZA 5BYAA 2WPDD 3E7FA 1DX4A 2WAXA 4PSUA 4I9NA 1JLSA 5FFNA 4OHVA 1PJ2A 1ZJZA 1G8AA 4RBNA 3BIJA 3ECAA 1VOTA 3EW7A 3MTJA 1VE3A 1AB5A 1C5KA 1DRVA 1RPAA 1UXHA 4PFKA 1UIMA 4YRCA 4C7XA 5F77A 3N0VA 3P9CA 7GPBA 4AZWA 4OU5A 5JUWA 2XADA 1GPYA 2WU8A 4XCVA 2MSEB 3AKDA 2WK1A 5KSOA 4D9CA 5JDIC 3F6CA 4N82A 4R7GA 5HDBB 3PQFA 4CMGA 1P73A 5AVSA 4AY6A 3TG2A 1FQOA 2OGZA 4KTVE 4KIGA 3VSBA 1VBKA 4I5IA 3MD0A 3QE4A 3URKA 5FOXA 1L5GB 3UOGA 4UTXA 2BPOA 4RF5A 5FWAA 1QPZA 5ITWA 5HRAA 2YHIB 4LNUB 1C9DB 1A71A 1E64A 1LK5A 4U2CA 2WB2A 1RM3A 4HVLA 2C2YA 3HDYA 4B6QA 1E5DA 2QUBA 3H2SA 1X1TA 2EWVA 1W85B 2ZPTX 1E4EA 1KIMA 1KORA 4MW6A 4XJSA 1T3ZA 5AUNB 1K1EA 3JRWA 1R4ZA 2C7PA 3G8YA 2VPTA 3LPCA 2XTNA 4AVYA 2NAFA 2PCLA 4Q12A 2BR3A 4HS4A 5U4QA 3FSJX 4ACAA 5AVRA 2JIRA 4DC9A 4G4JA 4MV5A 1L1QA 2HJHA 4UNNA 4ARIA 3VC7A 1XCPA 2IEAA 1U0RA 3TMKA 3WXMA 4BAZA 1JI0A 1X7XB 2DPMA 4R1QA 3DKIA 4V0RA 4L07A 5KKNB 5D1NA 1U8XX 2PBLA 3TTXA 2JI6A 2DFNA 3FCUB 5IJXA 1GZ6A 3CVUA 3IR7A 1NW4A 3BTVA 1RACA 2CDCA 3HPRA 3VZPA 2Q2VA 3T8YA 1LFAA 2HNBA 4WOBA 1V11A 1R27A 3IBSA 1YSCA 3EGDA 3MZ0A 1WCYA 3E81A 4URXR 1Y9AA 1X3SA 2VHQA 4KX3A 3GJQA 3L7YA 4MMXB 1SKYE 3A4NA 2A5YB 3CPEA 3FETA 4ID9A 3RV3A 1GZ7A 3VO8A 2RK6A 5E2BA 1QU3A 3L5KA 4OK3A 2YVUA 3KJHA 3OWHA 3HMKA 2QL5A 2ORIA 3PZBA 1MFZA 1XTJA 2OECA 1KY3A 1OYVA 5K7SA 3KWFA 4FYPA 3V97A 1U3VA 1HNNA 1H05A 3PGVA 3ZCRA 4QU8A 1T25A 4Y1EA 3C6KA 2ST1A 2JH8A 1MQAA 1NI4A 5H9WA 4E13A 1GCAA 3B7PA 5J4LA 4M1MA 5HR5A 4G65A 3OECA 4HSGA 4L4YA 3RANA 1TTPB 1J6UA 4YRFA 2Q4BA 3O74A 1AKWA 4QC2A 1RLMA 2I6XA 5F3WB 2QVZX 1EFCA 2BFEB 2N46A 3BRWD 2UYGA 4U8GA 5KU1A 3EC2A 3DE2X 3R7WB 3TQRA 1NYLA 3N2ZB 4QDOA 2BEJA 2G5TA 2XNKA 3I9JA 3MWGA 2O06A 3Q7EA 3U1VA 1P17A 1UJ2A 3HVIA 2HY7A 1GFWA 3ZV3A 4CLEA 3REGA 1B16A 3WNQA 4PPNA 3WV5A 3IUQA 4GX2A 4NYIQ 2RH8A 3JAKA 1FMFA 1AXRA 2JFZA 5A4IS 3GAFA 5BVHA 3R3YA 1F7VA 3MGGA 1YRHA 1R3UA 5IM5A 2UUCB 3AFMA 1WZCA 1GN9A 2F9FA 2E49A 1DMRA 4HLNA 1CHDA 2W6JA 5T4HA 1SC1A 1E9EA 2G1UA 4JNKA 1U0OC 2XZOA 1JEEA 1QG4A 4V3CA 1EK0A 2AFIB 2WAMA 3OPXA 4OQ4A 4XPZA 3CA8A 3B6IA 3AK4A 4NYMR 2A58A 3IPLA 5TGTA 3C45A 1KPHA 5ALMA 3SHFA 3K0BA 3A2KA 3EA5A 1SD1A 3EZYA 2NZ2A 3UBMA 2PT7A 4DG5A 3FPBA 1DJQA 3W5HA 1VIYA 1SCKA 3DWIA 1EFRA 5HE8A 1K75A 2JFXA 1JT9A 3D4NA 3I92A 4R31A 1KEUA 1CF2O 1T1EA 5FYDA 4D96A 3OBIA 5LKRA 2GWRA 2I6UA 4BE7B 3NMUF 5DBHX 2G0AA 3TVTA 4AO7A 2EFDB 3QWFA 2I76A 4B31A 1WOYA 2WIFA 2CE2X 2QRZA 4FB4A 5AW4A 5CIWA 3ZHOA 5CCBA 4FGLA 1K97A 4B1FA 1DAEA 2JFVA 2XZTA 5DGTA 3UPDA 4A0SA 2VSNA 1NE7A 3R2JA 3ZWOA 2CBZA 3H9EO 1TQ6A 4I1SA 4GIBA 4PLCA 3ROXA 1QANA 4L6IA 4S0ZA 5HPYB 3V7UA 1REQB 1PG0A 2ZPAA 3TSOA 3IPXA 4D3XA 5EN4A 3COSA 4I4TA 2YHUA 3L18A 4PLZA 4YREA 1R0LA 2PYZA 1RFLA 1ZRMA 2PQ0A 2RJOA 4OIFA 3W4KA 3WWZA 4DCJA 5HUQA 2Q3EA 2WNSA 5FBQB 1YL6A 4IZHA 1JV2B 3IUPA 3T7AA 5D00A 2GUGA 5E6SB 1VFNA 3DV2A 1T2EA 1BHJA 4XVHA 4F3NA 3M6VA 4HADA 4WZBB 4XWWA 4FDMA 2VNIA 2ZZKA 3SYMA 5C1BA 4LC0A 3PS9A 3VRHA 4EPVA 3KP1A 4LYJA 5FORA 1YQEA 4MW7A 3E70C 13PKA 2VTDA 4OYYA 2AQKA 5TPWB 1WEKA 2XD4A 2C2MA 3WSTA 2I9KA 2HA4A 4FI3C 2DQYA 3S0JA 2QP4A 1JHQA 3HR8A 2D5IA 1HFKA 2QD4A 1X2EA 4ND4A 1XEAA 5E1DA 3UFXB 3G1UA 3HCFA 1BVUA 2O8FB 5TMDA 1Z17A 4P4TA 5K99A 2V6MA 4N6NA 4IDEA 1RBQA 1GDHA 2PAFA 1U04A 1M2OA 2XMQA 3FGZA 3GL9A 1VGVA 2DWOA 2AW3A 3LVBA 1W46A 4TTVA 4CWAA 4EKGA 2C95A 2HJ9A 2WYVA 1G8SA 1L6RA 2BCJQ 1AKRA 1DIAA 2IYRA 2QJTA 2TMDA 1MX3A 4WUVA 3GLIA 3VAYA 2WI8A 3KC2A 1I0IA 3AFIA 1CUAA 1SKBA 1ID1A 2Z2KA 2ZWMA 3AINA 4AJKA 4ZHQB 1MVNA 4IVQA 5ENDA 1GCIA 4GZLA 1Z7WA 4JJ7A 4XB2A 1MORA 2XT0A 1ORIA 2LTAA 1VG1A 2LZ0A 1XLWA 2Q6TA 1SZJG 3DYIA 4LYEA 1O54A 3P96A 4YP6A 5KVQA 1XF1A 3PLAE 2A57A 3EDCA 3LQ4A 4HF7A 4O1IA 5EIAA 3RSOA 4IDCA 3U3JA 2YYZA 2JEZA 3IDQA 1V5WA 4EA7A 1ZJ6A 3TD9A 3U17A 1OX4B 4JQYA 3EMBA 3KKKA 4KGXA 5HIMA 2CHEA 3PFKA 1DJLA 1DPFA 3QNWA 4F8YA 5TPWA 3OESA 2J3IA 4D4JA 4E94A 2NP7A 1BC5A 1ZMBA 4FOPA 3C7KA 2X77A 2AI1A 1Q11A 3HBLA 2F3SA 1V5EA 1HDZA 1J0DA 3AO0B 4JEIA 4ZD6A 3VC1A 1H42A 1SELA 1QLHA 5FQNA 3YASA 2HAEA 1C2TA 5JCPA 3IQFA 3WWPA 3HJAA 2AYZA 1IBLB 2R0QC 1D5WA 1MDFA 1IJBA 1FX0B 5HQTA 2C77A 1TKCA 1YRLA 4MYUA 2P2YA 3PICA 3ZJVA 1LS6A 4KVZA 1ZGZA 4CM1A 4AZVA 1H8ED 1YJBA 2LE0A 5EQDA 4EEXA 4AECA 4I1UA 3TD2A 2IOHA 4F4JA 4XGNA 4FFSA 4LTMA 5JO0A 2ZT6A 2ZSHA 1INLA 1MJGA 4M7OA 2ZB3A 4HKTA 4S1OA 3NHRA 1UBEA 3L7BA 4DEVA 3QPWA 5KOJA 1DAHA 1DV1A 2WF6A 4FMBB 2IH4A 5BV8A 1FRNA 3ZE7A 1RXSA 3VPFA 4KZKA 4DILA 4CM8A 3G2HA 3ET4A 4HUQB 2Y0DA 4KE9A 1A3CA 3QV1A 3ZK8A 5LU8A 1EFVB 4HN2A 4WXYB 3RV4A 1I5EA 1TVMA 3WKBA 1G64A 4R1LA 1KY5A 5IAAA 3ZV4A 2VEOA 3LCMA 3ZCSA 1YR7A 3A04A 1ABFA 4DFDA 4EG1A 2ZPUA 3L4SO 2YXBA 4OGKA 1TO2E 1LSSA 4HN9A 5AKHA 3H5AA 3OOJA 5U1PA 3CONA 1CE8A 1AK2A 4CG0A 3A31A 2QTZA 2AHRA 4RAOA 5H3LA 3PKZA 4DIMA 4RDHA 1E1CA 1B6TA 3HCPA 5D3MA 4BU1A 2YWFA 1RHRA 4ER3A 2UKDA 3ZLUA 2EFCB 3LAWA 3MNFA 5HBRA 1LLUA 3V6LA 1THGA 1MH9A 1XZ8A 1M8KA 2UZIR 4Q3BA 5SZKB 4A91A 3RFVA 5LR6A 3O2QB 1P2DA 1ZMOA 1YNOA 3T7KA 1KMCA 4EWLA 1IG0A 1FFWA 3MS7A 2RHBA 2R6GA 3EE6A 4JJ8A 1R9MA 4R2LA 5B2FA 2W93A 3O1JC 1L3IA 5CVCA 3RR2A 3ZX4A 2BGKA 2H2WA 1U8TA 2AN1A 4K6CA 4XGIA 4EDHA 1E0SA 1N6PA 4RVCA 1T36B 1T0UA 4Y2GA 1FL9A 1OBVA 1XHEA 1SCNE 2ZRDA 5F2EA 2O8NA 3BRQA 3H2YA 4UVGA 1R0KA 4LCJA 1L5KA 1FVXA 2SHKA 2G9ZA 1P4HA 1QR6A 3PFHA 4DRXB 3MGBA 1G9XA 1GYQA 4N6OA 4JP2A 4YJ3B 4QBFA 3ZCUA 4AQ7A 1W4CA 4OFXA 5FPSA 5TMEA 2VRNA 3MUNA 1O94D 3M7IA 3HBMA 3FBTA 1WV0A 5FI3A 5JQWA 3AL0C 3L7DA 1DIHA 1W2HA 2GS9A 2VT2A 3E1SA 4KJZA 4XIYA 4WGGA 2J3LA 5F12A 3S1LA 2MCFA 4DN6A 2OGSA 4RTQA 3K4QA 3OCZA 3Q8WA 3UN1A 4QOFA 1S02A 1KGDA 5I9SA 5T4EA 2ACWA 3THYB 1P0MA 4ZVOA 3TL3A 1CJKC 4F11A 2QRLA 2IUEA 4QUIA 4EB0A 1DTWB 1PZEA 5C8YA 3RIEA 3STTA 4BMCA 3RVRA 4EG7A 2RGBA 2PXCA 4BEJA 2IOFK 1RKUA 4EG0A 3LIPA 1Z5VA 3TW8B 2RC6A 3CVWA 1FNMA 1G55A 3ILHA 4JP8A 1DKUA 2C4TA 4OXXA 2R8YA 2F48A 5CA0A 1PU2A 4DV3B 2GCEA 1ICIA 5AW6A 4S04A 1XZHA 2WOJA 4HGQA 3ZY6A 3S1SA 3OOYA 2CDRA 4HOYA 1GNRA 5ESDA 2DHQA 1BX0A 8ABPA 1W0JA 3INTA 3QLUC 4KQ2A 5EUCA 3R24A 3JQ9A 1L7RA 2WU4A 3DVLA 1G2OA 1QAQA 1R4NB 5GAJA 2GZSA 4RD2A 1SG0A 1NBHA 2M6LA 4ZOAA 5ERXA 2A0WA 2CUTA 3JVUA 4MI6A 1T13A 4C5BA 3A6PC 2ZIVB 1HQKA 4XX0B 4EABA 1F8GA 2OYRA 3UIEA 3R7SA 1EDOA 1ZM7A 3A2MA 4DIKA 1SU7A 1SCBA 3EY9A 2WKQA 1KZ4A 3Q3EA 3K70C 2SKDA 3PSAA 4JI2B 5JD3A 3BFPA 3GHHA 4QXPA 4EJ0A 1ZUNA 2Z9BA 2HXGA 3Q87B 1V4NA 1E4EB 3C24A 4IH1A 4KQWA 4JLJA 4QXRA 2C20A 3ZZTA 3NVDA 5H59A 1VL0A 1TYZA 5F7OA 4RTSA 4UUNA 1KI4A 3OA2A 2PL3A 3QUSA 3JARB 3EMKA 4MP8A 5K0NA 1C0KA 3FNEA 2CXOA 5E4JA 4D82A 4JI6B 3UENA 1Q7RA 4K9QA 4DUYB 2Y67A 4YNBA 1YS6A 4KREA 3K53A 4A73A 1BFKA 1FYVA 1ONPA 1VL2A 2QM8A 5GADl 3W9YA 1IBKB 1TADA 3A37A 4P3PA 5T4BA 2PUFA 1SCUA 1GZVA 5KOJB 4OHBA 2WHYA 4ERXA 5AR1A 2Q27A 4D4LA 5CDGA 5AVVA 3AX6A 3N2IA 2QUKA 1K5HA 1NMXA 4BZZA 3C8MA 4PZPA 3RTCA 1Z4OA 2YN0A 2WDPA 4ODIA 1EA5A 2ERYA 2O5RA 2X42A 4OQZA 3UFBA 3ZYCA 4OI1A 3DBHB 4A1OA 4HLCA 1RAFA 1OV6A 3V2GA 4TKVA 1HFEL 1QIFA 2Q2NA 4ZI7A 4DPMA 2DFVA 2ZJ4A 3UJPA 2JL1A 1C30B 1EVJA 4MQUA 1B7GO 4GX0A 5ILOA 1N8TA 5BNZA 3D2BA 1Z5WA 4MW4A 2Y1WA 1MF7A 2F9LA 1WHTA 1CK4A 4LV8B 3L0ZA 5DHUA 3LC7O 2W5UA 4G07A 2IGBA 3UMJA 3TEFA 2A5DA 4Q4JB 1WM1A 4B4KA 1CJBA 2JHPA 3OOWA 1SPXA 4I50A 1KO5A 4DADA 5JV5A 2AA3A 4Q3EA 5CGQB 4D9JA 4FWBA 5IHXA 3OJ0A 2VPWA 1K6XA 1C4KA 1P1IA 2NYRA 4YAKA 4QGSA 3L7JA 3ESRA 3ZJYA 5JNUA 1V7PC 3AY0A 4DLPA 1CDZA 1WZNA 1ZSNA 3OMLA 1DT5A 1SPBS 1YD7A 4YRIA 3FGPA 4X1KA 3EY4A 4ND3A 4LHYA 1LPNA 4M0LA 1RAHA 1P1FA 5FWYB 2ZANA 3UQYS 2WFLB 2ZRBA 3BGSA 1KH3A 2L19A 2LP4Y 3PQ7A 5DIZA 3WNVA 2NX2A 2PSSA 3GAZA 3GROA 1XVVA 4TXLA 4YMVA 5IANA 1PGJA 3ZY2A 1FSPA 3G5LA 1I30A 4MK4A 2HRRA 3DKKA 1ZW1A 4FEGA 4J0HA 1GUYA 4D43A 3VZQA 1LLQA 4CM8B 4GPAA 1N8SA 2P7HA 1TTHA 4QELA 5TPZD 3PNBA 1KDYA 4DW8A 5EHZA 4IJ6A 4Y9DA 1HSOA 5BQXA 1GILA 3OKCA 4AG5A 3I9OA 3K1TA 3V4FA 4TN1A 2DFPA 1IEXA 4KR7A 4DIOA 3DFZA 1OI3A 2B2XA 3IIJA 4WACA 3WKAA 3HJGA 4BLRA 3N0XA 2PWAA 4OI4A 3T0FA 2VJYA 3LI2A 2ZDHA 3JAWA 4YJKA 2COKA 3VYWA 1FB5A 3SFVA 3U19A 4MUFA 5C5DA 4RK4A 2IHZA 4XVCA 4GBGA 2IDZA 1VKZA 3LGAA 3N6RA 1JA9A 1OXVA 1ISJA 4OLHA 3FDXA 4U2KA 4MV1A 4J2OA 1RWNA 2C1XA 2WWTA 3AR7A 4QBHA 1A97A 1A7KA 2WUVA 1QE0A 4LIPD 2RI0A 4WBNF 2V59A 5CR9A 1RYHA 4EKYA 4LMAA 1OGIA 4BB5A 3IERA 4WZAE 3LK6A 2IH5A 4BMNA 4P38A 2AOWA 3RF6A 4UTRA 4N5MA 1O5IA 2XT6A 3LF1A 1G8MA 1WDMA 2MSNA 4RE6A 2OYCA 4RTOA 3H9BA 2VCHA 2VSQA 4G0PA 4ASUD 1NMZA 3M6LA 4HAOA 5IW8A 1LU9A 3BE4A 1PJ8A 4MKXA 1VM6A 1PBNA 4KYIB 2C4HA 1A1SA 1V6AA 2PPVA 3WLQA 1CUHA 2IHVA 4Z0PA 3WYDA 3GPCA 4NNJA 3AESA 4PCAA 5BSHA 4Q66C 4KO2S 3GPIA 4YCAA 1A7AA 4AP9A 3LCRA 4R8RA 1RYNA 4L6CA 4KPFC 3SLKA 3PHHA 3JYNA 1CS0A 1HTBA 4HFMA 4OMDA 3S44A 1SK8A 3VBCA 1OWNA 4K46A 1UWVA 4E11A 3LQFA 2GPAA 4DUZB 1V95A 2HDWA 3CJQA 2B5WA 3TX2A 2CDBA 3JZFA 3NBMA 3SIWA 4EFDA 1EWRA 4YT8A 3WP0A 1ISSA 4EW6A 1E3EA 1G1MA 3C4QA 3G89A 1OV4A 4C7KA 1LC0A 3K7EA 1Q0PA 4E5NA 3PGKA 3WYNA 4G41A 2WIGA 4WNYA 2GPWA 4WECA 3COYA 4HBZA 4V39A 1OYYA 1Q0ZA 5LQCA 1SBQA 1IE3A 3MM4A 1FRQA 3I1IA 1U7ZA 2X14A 3F9IA 2WYIA 4C4SA 4K3UA 3WJ2A 3QTLA 2J41A 2AFIA 3WK4A 2HZBA 1BHQ1 3O0DA 3JQAD 4IW3B 3KDSE 2CVQA 3V32A 4YUYA 5B4TA 3HA5A 5CBKA 2XCUA 5AW1A 3BREA 2R8RA 3IULA 2R11A 4ND8A 4EW3A 5IULC 3B9PA 2OO5C 1JLRA 1TUGA 2AIRA 1IK6A 1UBLS 3LT1A 4X7RA 3UMCA 4F5WA 4NCBA 5IN4A 3IDFA 5C1PA 2DKNA 2P9FA 2N1BA 1DQRA 5JZSA 5KWEA 3IDAA 1VSBA 1NVFA 3A9VA 4HQRA 5BQPA 2P7IA 121PA 3RYHB 5ADUS 2HSGA 2CW5A 1DJMA 3EW9A 3BEDA 4KDEA 3O73A 4MB0A 4HQFA 2GNOA 1UUFA 4UQOA 2WJJA 3BFVA 3RH0A 1I7LA 3KJNA 1LTKA 2X7HA 2PUHA 3F9CA 1GEGA 3ON5A 4LISA 4YQZA 4YV7A 5EXPA 2E4YA 3QJ5A 4MRPA 2AMFA 5AD1A 2J9YB 3TI7A 4KPGA 1XL0A 2AOUB 3B53X 3A27A 1QUFA 1ZM9A 4L57A 2VT7A 3RK4A 1VSQA 3T99A 4CQLB 2E4AA 3KVRA 4P4UA 4E51A 5JT1A 5JPIA 3I72A 1R37A 2JGKA 4YRMA 1T24A 5JNVA 4PZLA 3D3KA 3EDOA 3GLVA 3LOQA 4J90A 3WGOA 3OD1A 4DWOA 1VE7A 1FPQA 4MPDA 2D2XA 3BGIA 3G02A 2BONA 3AXTA 3KQQA 4DGQA 4WLVA 1QFZA 2IZ1A 3O4VA 3LC1O 3IP6A 3V55A 2QLJA 2J9FA 2P6UA 1OA1A 2PQMA 2R84A 3UHJA 5A3SA 3KHTA 3TBKA 3MJDA 4OLJA 5DBIA 2YFQA 1FFXB 2PT6A 3LPDA 2VF2A 1GVNB 2WJ6A 4XGRA 4XGQA 1V11B 3LFTA 4FMPA 4ACBA 5LWQA 4HNRA 4EKDA 1IN8A 4ZMRA 2GEBA 7MHTA 2ET6A 1A2BA 2J5XA 3GXOA 1X8KA 3ZWBA 4BO4A 4IDFA 1Z4LA 1ELOA 2FMUA 3AEZA 3ZOKA 1GTRA 3WRYC 1L7EA 3DT8A 3SC3A 4UMEA 1X7YB 1U1EA 1UM9B 1M2GA 1W2WB 2BMDA 2R65A 1E3MA 3HXMA 1D07A 3UK7A 2NO4A 2BM8A 4XM0A 2BT4A 3L05A 4YBZA 3TG8A 1Z06A 5EL0A 2I4LA 4PG7A 5KMGB 1ZDMA 1QGAA 3MYYA 3X1XA 1GQRA 3GPBA 4ARBA 2ZRFA 1S5PA 2AFHA 1TZ2A 3A4YA 1T15A 2K87A 4X1IB 4E70A 1MAVA 1OKKD 2RJ3A 3GBSA 3HGQA 1RHJA 1FK8A 1GRRA 2H1OA 4IXMA 1GLVA 2QTHA 2A0FA 1YJCA 4A36A 4K6OA 3R7WA 1SEVA 2KBEA 1TQ2A 2QRJA 1QXSA 2QL7A 4N7BA 1M0WA 1X7DA 4NBSA 1UIRA 2WKSA 2WG2A 4HWSA 1YB1A 2OHIA 3MUFA 4XUDA 5J3JA 2CLLB 3UXYA 3GD5A 4U7WA 3I32A 1XPOA 1OIVA 4MMZB 4HMQA 1NI4B 2O20A 2YINC 3OSUA 4NS1A 2Q3CA 4OHUA 2QS9A 3SAJA 2FFHA 2J6IA 4QGBA 4XR9A 3ZEIA 4D8WA 3PCTA 1QH9A 4JVSB 3WMXA 2G06A 1FTNA 5DBGA 2CK3D 1HC7A 3AP1A 3FLBA 2Z56A 1Z5ZA 4NE9A 2XCIA 5A5VA 3E8XA 2CV1A 3W8EA 1HKUA 3F4LA 4RLQA 4GBED 3VNAA 4CF7A 1AHHA 2P9HA 3MJEA 1DT3A 2O6LA 2Q2OA 3SFZA 1GHTA 1M2FA 2P0YA 3RC8A 1LWNA 3Q8KA 5KYWA 2A5LA 2YRWA 4F60A 5LNK1 2FN9A 3G1WA 3WWCA 3KD3A 4BLWA 1HM5A 4LWPA 3ZKAA 4F1JA 1HE5A 1DX6A 4H3HB 2CJFA 4HC4A 2VHVA 4KN6A 3HB9A 4WA7A 4YASA 4QWMA 3EPHA 1IQRA 1GU1A 4FLFA 3NQ41 4BAUA 1BJTA 2OV8A 4Q4AB 1Z45A 2PUWA 1E7QA 3BUSA 4GSLA 2O8CB 1F60A 1E18A 4NEHB 1UPBA 1Q22A 2HU8A 2IELA 4BVEA 1R6BX 3E5HA 2ZUDA 4M9CA 4JI5B 3CNOA 1Z2DA 4NMMA 3N9IA 2NGRA 1VSVA 1PZXA 3NUZA 1M2VB 3PNYA 2QN3A 2H9IA 3IO5A 5DEIA 4DIDA 2DH5A 1UK9A 5L4NA 1ZCJA 1P0PA 2YV4A 2ZIFA 4JGGA 3I05A 1LK7A 3Q98A 5G1OA 1K6MA 2H48A 5AW3A 1RZRD 2FEOA 1MAUA 2ADMA 2E5LB 4JQZA 2PTGA 4GZ6A 4IWYA 4YIKA 4L16A 1CNMA 1U8FO 3KT8A 3CX3A 3T7TA 4NVRA 1WMDA 4XZ3A 1EP3B 3E5NA 5E7IA 3MJFA 4QICA 4MV7A 1TIPA 3P26A 1IHYA 2PFKA 1WW2A 3T7JA 4B75A 4TUYA 3I04M 1Z4PX 5KYNA 3L0BA 3BSWA 3KJFA 4MW2A 4XLTA 3UCEA 1J2EA 1PNRA 3O31A 3OIUA 4HWTA 4ND7A 5KAPA 3EGXB 2GH1A 3CYFA 1FQJA 3G9XA 4TKLA 5J58A 2ZRJA 1SFRA 3NVAA 5E4FA 5BT8A 4NEGA 2QN8A 4EQ6B 4J43A 1QP7A 4JJZA 3M70A 4UM9D 1SHZA 4IJWA 1FMLA 5JNRA 1G5QA 4YN3A 1LV7A 3NYQA 4OHPA 1GPAA 3ZLJA 3UYKA 1L8XA 4LXTA 5HEKA 3H04A 5IG2A 5BUQA 1Y7TA 2BAGA 2PUVA 3SN6A 3A1FA 4IF6A 3SZLA 1EWVA 4E46A 3QEAZ 3O92A 2PE5A 2D2VA 2P2DA 1MNAA 5REQA 1KXZA 1WPQA 2C9BA 4K7JA 4JUAA 1FUYB 3EZNA 2Q62A 1O5OA 4MYSA 3BWXA 1O94A 2XSZA 4BNFA 4BMXA 4CMBA 3ZWNA 3TK1A 6AT1A 3GN2A 3EMDA 4AY2A 4JBXA 4KUEA 3OTOB 1U2GA 4EB6A 2OGTA 2FHPA 3P2EA 1B0AA 4Z4GA 4B6JA 1ORVA 2Z3ZA 1VYUA 3HM2A 3R40A 4R1TA 4CQMB 5AOBA 2AJBA 1XVIA 4BFTA 5C1DA 4LZNA 1WL8A 1JW9B 3TE6A 4RFLA 5HQ3A 1XTZA 2BFBB 1E1NA 1RQRA 3GP8A 1JR3D 2JVKA 1M6EX 3A6FA 3UB3A 1G20B 1KDTA 2A9JA 2I6TA 3PC8A 4J0QA 3H8VA 1XP5A 3GAMA 2PRIA 3H4IA 3KL2A 1FC0A 1N57A 4N3NA 4U2FA 5G1NA 4FN5A 3RTDA 3U3OA 3IAFA 4N8SA 3I58A 5TE9A 3AR6A 3UA4A 2A1UA 3EA4A 4HP8A 1YKSA 2XRYA 3M3DA 4N76A 4P6VF 5GGYA 5AVXA 3P45A 1XAIA 4MEBA 3A1TA 4FSDA 4OBEA 2WFAA 4Q9AA 5DTRA 4ESVA 1ZMXA 3IAUA 4U4AA 1PT6A 3GJXC 4I5EA 3T06B 3ID6C 2EWWA 2GLUA 5BNWA 1VYTA 3W3AA 5HOQA 1UODA 4GM0A 4OIMA 2Q6IA 1SA0A 3ONDA 4QULA 2YV5A 4Z1OA 3O8NA 1W9MA 3PJGA 4MKZA 2B0JA 2CMKA 1K2VN 4YRKA 4JDUA 1BMQA 5AXAA 3OJWA 5T3YA 1EVZA 1Z75A 2YKGA 3MERA 2V4UA 3OSZA 1YDGA 2ZJYA 3DR3A 4BTVA 2REOA 3T3OA 2IYSA 1NBEA 1VKOA 3O84A 4N65A 2FZEA 4ZT5A 5BN3B 5CBPB 1PKEA 2EWMA 1T6BY 1OX5A 3T4UA 2AN4A 1ULSA 3HEMA 3D7LA 3PPYA 2GXAA 2B37A 4WN9A 4BB0A 2Q6VA 1AZSC 4OO3A 3P2JA 1KETA 4UNQA 2WSLA 4L5BA 3TXXA 2BJWA 3IALA 4ITRC 3SVZA 1JX6A 1SVLA 4XB1A 4BTEA 4DM7A 3ORRA 4IJMA 1VXOA 3ZBQA 3BSYA 3R6LA 1PFUA 3EGOA 1K06A 3KKOA 4N5IX 3H5TA 4BRWA 1GAWA 4QUDA 1JDBB 1VE6A 3TLJA 4B4VA 4DCTA 2VJBA 2JC3A 3BMCA 1U6JA 3MRTA 1KE1A 1TVKB 1YK0A 2H1IA 2JJYA 4QARA 4I1IA 2OO7A 4CN9A 3IODA 5C1IA 4ZV4A 3ZDDA 4W7IA 1GCOA 3QVUA 3F49S 2XMDA 1L0BA 4BNWA 4NZMA 4O4HA 4X61A 2A1IA 4XM2A 4GOOD 4KAFA 3O95A 2VP5A 5JSZB 1T3LA 4F4DA 2XMRA 4YMTA 2W6IA 1UBUS 4UXJA 1X9HA 3HGTA 4YT5A 5FOVA 3K94A 1K88A 3SPXA 4YPVA 5K45A 3DZIA 5E6UA 1DAIA 4AN1A 5HIKA 5ARBA 2B8JA 3HB7A 4BN4A 3ECCA 3PDWA 5F1OA 4FYKA 1F1JA 2HUPA 2CWWA 4DPLA 2ZJ1A 3EX7C 2AOTB 3TSYA 2PH1A 4L2IA 1B2LA 5BN5B 1Z83A 1EUCA 2O5VA 6PFKA 2ISQA 1EFTA 1FP4B