1AUTL

Human activated protein c
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
97
Chain Sequence
QCLVLPLEHPCASLCCGHGTCIGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.8 A crystal structure of Gla-domainless activated protein C.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ACTIVATED PROTEIN C
total genus 15
structure length 97
sequence length 98
ec nomenclature ec 3.4.21.69: Protein C (activated).
pdb deposition date 1996-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00008 EGF EGF-like domain
L PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1autL02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1autL01
4JYUL 1IGZA 1KSNB 1CCVA 1WU1B 2W2PE 2XBWL 2NPRA 1IQKL 5CISA 1IQML 2J4IB 1EAIC 1HT8A 1KLJL 3GCXE 4YZUB 2MGRA 3HS5A 2KV4A 2W2OE 2J95B 1XDTR 2UWOB 2BOXA 1APQA 1CX2A 2TGFA 2XBXL 1U67A 3LN0A 1ATEA 3KQBL 1APOA 2KL7A 4MMYB 4CUEA 4Y6DB 2P95L 3F1SB 2FLGA 1HAFA 1IOEL 1PRHA 3N8WA 2J34B 3HO5A 4BTIA 2P94L 4BTTA 1U8CB 2BOUA 1CVWL 1X7AL 1XKAL 2WG3C 4Z0KB 4OTYA 3NT1A 3FCSB 3KQDL 4O1ZA 4PH9A 3ELAL 2J2UB 1NFYB 1IQLL 4MMXB 1UZQA 2FD6A 2BZ6L 4LMFA 1KLOA 3Q3KB 1G2LB 2CJIB 1G1RA 2WPHE 1DIYA 3QCWA 1FE2A 3OLTA 4JZDL 2P3UA 1MQ5L 1HJ7A 1I0UA 4XLWA 1CCFA 2VVCK 1COUA 1EZQB 1BF9A 2BQWA 3PGHA 3M37L 3SOVA 5COXA 1PTHA 1G1SA 5F19A 3CA7A 2Y7XB 1LPKA 1RFNB 5CKQA 4Z6AL 3LTGD 3V65B 4NG9L 2BO2A 1YUGA 4Y71B 5L2ZL 1FF7A 2M74A 3OLUA 2PR3B 5L30L 1HT5A 4RUTA 1FFMA 1O5DL 2PUQL 3Q7DA 4Y79B 1FSBA 1HX2A 1WHFA 4E1GA 1Z6EL 2EI6B 2VWMK 1K36A 4D90A 1NT0A 1NPEB 2G00L 2P16L 2W3IB 1LMJA 1WHEA 5JVZA 3KCGL 3H5CB 3CENL 5JBCE 3U73A 4LORA 1M1XB 4NGAL 2AYLA 3N8ZA 1KLIL 2UWPB 4C16A 3BT1A 5E8DA 4ISIL 1A3PA 4RRYA 3TBDA 3POYA 1IQNL 3QMOA 1P0SL 3U7UG 3N8YA 4RRXA 1UZPA 2FLRL 4MMZB 1IJQA 2XBVL 3R05A 4YT7L 1HZ8A 3CS7L 2RHPA 2VVVL 2RNLA 2RA0L 2WYJB 1EPHA 3SW2A 3HS7A 1F7MA 4G1MB 1FAXL 3RR3A 4X8SL 1IQGL 1PGEA 4JYVL 2VVUL 1EMOA 1JL9A 1ATBA 2WG4B 1HRFA 1ATAA 4M11A 1IQFL 4X8TL 2K2SB 1YUKB 4Y7AB 5JBAE 4ISHL 4BDXA 1F0RB 1DQBA 4RRZA 4D0FA 3M36L 2W86A 1UZKA 3LC5B 1YO8A 1OB1C 3ASIA 2YGOA 1DX5I 1IOXA 5IKTA 1URKA 1TLEA 1W7XL 2WPJE 2XC0L 3QH0A 5FDQA 2Y5FL 4Z0LA 1DDXA 4OTJA 2JKHL 1FAKL 2WYGB 3ZYIB 5JB9E 2XC5L 4JZFL 1W8BL 4XBMA 2WPIE 3NTBA 2Y82B 4X8UL 2B7DL 3KQEL 1NQLB 3HO4A 3ZYJB 1MOXC 5JVYA 1G2MB 5KIRA 3F6UL 4CSYA 1J9CL 1N7DA 3LTFB 4CUFA 2WPLE 4AQTA 1XKBA 3NTGA 3N8YB 2MHPA 2VWOL 2K2TA 4RRWA 1NFWB 4NA9L 4BXWA 1UZJA 1TOZA 2BQ6A 1EPGA 2F9BL 3TK5B 3KRKA 2Y80B 2W3KB 1LQDA 3LAQA 4ZH8B 1PFXL 4D0EA 4BDWA 1MQ6L 1JBUL 4JZEL 3K9XA 2WFTA 3HS6A 2WPKE 2OYEP 1GK5A 3HO3A 5JW1A 2FZZL 4FM5A 3HPTA 1XFEA 3SOBB 1G1QA 1ZAQA 1V3XB 4XL1A 2Y7ZB 2P93L 4COXA 1ADXA 2YGPA 4CUDA 4Y7BB 3KQCL 2VWLL 5IKRA 2Y5HL 4X8VL 2ADXA 1NFXB 1K37A 4TGFA 1EBVA 3TGFA 1F7EA 1DVAL 4O02B 2P3FN 1SZBA 3EGFA 1AUTL 1IQIL 1P9JA 5L2YL 3DEMA 1L3YA 1LPZA 1IQJL 2P3FL 1IP0A 1FJSL 1Q4GA 3SOQA 1F0SB 3MDLA 3P5BL 1CVUA 3GISX 2XC4L 2UWLB 2BQ7A 3V64C 2BMGA 3BPSE 2Q1JB 1QFKL 4YT6L 2PHBB 3C9AC 2MGPA 2Y38A 1YUFA 2J94B 2H9EL 3IITB 5F1AA 4ZXYL 2P28B 2FLBL 3FBYA 5JBBE 3MQEA 2I9AA 2EI7B 1JV2B 2VWNL 3CFWA 2Y5GL 1HCGB 4ZXXL 3KL6B 2BOHA 1CEJA 3KK6A 2XBYL 1B9WA 2EI8B 3ENSA 1L5GB 5I46L 1HAEA 1EQGA 1EMNA 3ZYGA 1KIGL 2OYUP 2VH6B 1EPJA 1IVOC 3LIWB 3N8XA 1YGCL 1NFUB 1N1IA 1EGFA 4RS0A 3NJPC 2Y81B 3LN1A 2GD4A 1EQHA 3TH3L 1ATDA 1IQHL 1G1TA 2D1JB 3IJEB 2VJ3A 2W2QE 1TPGA 3N8WB 3GCWE 1PXXA 1NZIA 5IKVA 1CQEA 5CKNA 4M10A 5CKMA 2W2ME 4A7IA 4BXSA 1HREA 2W2NE 3TZIA 5EGMB 4ZHAB 1EPIA 2BOKL 2VH0B 2WFXB 1C5MF 2J38B 1Z6CA 3BT2A 1IQEL 4Y76B 6COXA 2P26A 1LPGA 2DDUA 4ZAEB 5KN5C 3LC3B 2I9BA 5JB8E 2P3TA 2W26B 3N8VA 3TK6B 5IKQA 2KB9A 1IGXA 5K0HB 2WPME 4BTUA 3FFGL
chains in the Genus database with same CATH superfamily
4JYUL 1IGZA 1KSNB 1CCVA 1WU1B 2W2PE 2XBWL 2NPRA 1IQKL 5CISA 1IQML 2J4IB 1EAIC 1HT8A 1KLJL 3GCXE 4YZUB 2MGRA 3HS5A 2KV4A 2W2OE 2J95B 1XDTR 2UWOB 2BOXA 1APQA 1CX2A 2TGFA 2XBXL 1U67A 2KNIA 3LN0A 1ATEA 3KQBL 1APOA 2KL7A 4MMYB 4CUEA 4Y6DB 2P95L 3F1SB 2FLGA 1HAFA 1IOEL 1PRHA 3N8WA 2J34B 3HO5A 4BTIA 2P94L 4BTTA 1U8CB 2JJLA 2BOUA 1CVWL 1X7AL 1XKAL 2WG3C 4Z0KB 4OTYA 3NT1A 3FCSB 3KQDL 4O1ZA 4PH9A 3ELAL 2J2UB 2H9EC 1NFYB 1IQLL 4MMXB 1UZQA 2FD6A 2BZ6L 4LMFA 1KLOA 3Q3KB 1G2LB 2CJIB 1G1RA 2WPHE 1V1HA 1DIYA 2YGQA 3QCWA 1FE2A 3OLTA 4JZDL 2P3UA 1MQ5L 1HJ7A 1I0UA 4XLWA 1CCFA 2VVCK 1COUA 1EZQB 1BF9A 2BQWA 3PGHA 3M37L 3SOVA 5COXA 1PTHA 1G1SA 5F19A 3CA7A 2Y7XB 1LPKA 1RFNB 5CKQA 4Z6AL 3LTGD 3V65B 4NG9L 2BO2A 1YUGA 4Y71B 5L2ZL 1FF7A 2M74A 3OLUA 2PR3B 5L30L 1HT5A 4RUTA 1FFMA 1O5DL 2PUQL 3Q7DA 4Y79B 1FSBA 1HX2A 1WHFA 4E1GA 1Z6EL 2EI6B 2VWMK 1K36A 4D90A 1NT0A 1NPEB 2VRSA 2G00L 2P16L 2W3IB 1LMJA 1WHEA 5JVZA 3KCGL 3H5CB 3CENL 5JBCE 3U73A 4LORA 1M1XB 4NGAL 2AYLA 3N8ZA 1KLIL 2UWPB 4C16A 3BT1A 5E8DA 4ISIL 1A3PA 4RRYA 3TBDA 3POYA 1IQNL 3QMOA 2BT8A 1P0SL 2BSFA 3U7UG 3N8YA 4RRXA 1UZPA 2FLRL 4MMZB 1IJQA 2XBVL 3R05A 4YT7L 1HZ8A 3CS7L 1KKEA 2RHPA 2VVVL 2RNLA 2RA0L 2WYJB 1EPHA 3SW2A 3HS7A 2WZPP 1F7MA 4G1MB 1FAXL 3RR3A 4X8SL 1IQGL 1PGEA 4JYVL 2VVUL 1EMOA 1JL9A 1ATBA 2WG4B 1HRFA 1ATAA 4M11A 1IQFL 4X8TL 2K2SB 1YUKB 4Y7AB 5JBAE 4ISHL 4BDXA 1F0RB 1DQBA 4RRZA 4D0FA 3M36L 2W86A 1UZKA 3LC5B 1YO8A 1OB1C 3ASIA 2YGOA 1DX5I 1IOXA 5IKTA 1URKA 1TLEA 1W7XL 2WPJE 2XC0L 3QH0A 5FDQA 2Y5FL 4Z0LA 1DDXA 4OTJA 2JKHL 1FAKL 2WYGB 3ZYIB 5JB9E 2XC5L 4JZFL 1W8BL 4XBMA 1LMMA 2WPIE 3NTBA 2Y82B 4X8UL 2B7DL 3KQEL 1NQLB 3HO4A 3ZYJB 1MOXC 5JVYA 1G2MB 5KIRA 3F6UL 4CSYA 1J9CL 1N7DA 3LTFB 4CUFA 2WPLE 4AQTA 1XKBA 3NTGA 3N8YB 2MHPA 2VWOL 2K2TA 4RRWA 1NFWB 4NA9L 4BXWA 1UZJA 1TOZA 2BQ6A 1EPGA 2F9BL 3TK5B 3KRKA 2Y80B 2W3KB 1LQDA 3LAQA 4ZH8B 1PFXL 4D0EA 4BDWA 1MQ6L 1JBUL 4JZEL 3K9XA 2WFTA 3HS6A 2WPKE 2OYEP 1GK5A 3HO3A 5JW1A 2FZZL 4FM5A 3HPTA 1XFEA 3SOBB 1G1QA 1ZAQA 1V3XB 4XL1A 2Y7ZB 2P93L 4COXA 1ADXA 2YGPA 4CUDA 4Y7BB 3KQCL 2VWLL 5IKRA 2HORA 2Y5HL 4X8VL 2ADXA 1NFXB 1K37A 4TGFA 1EBVA 3TGFA 1F7EA 1DVAL 4O02B 2P3FN 1SZBA 3EGFA 1AUTL 1IQIL 1P9JA 5L2YL 3DEMA 1L3YA 4GU3A 1LPZA 2HOXA 1LK9A 1IQJL 2P3FL 1IP0A 1FJSL 1Q4GA 3SOQA 1F0SB 3MDLA 3P5BL 1CVUA 3GISX 2XC4L 2UWLB 2BQ7A 3V64C 2BMGA 3BPSE 2Q1JB 1QFKL 4YT6L 2PHBB 3C9AC 2MGPA 2Y38A 1YUFA 2J94B 2H9EL 3IITB 5F1AA 4ZXYL 2P28B 2FLBL 3FBYA 5JBBE 3MQEA 2I9AA 2EI7B 1JV2B 1V1IA 2VWNL 3CFWA 2Y5GL 1HCGB 4ZXXL 3KL6B 2BOHA 1CEJA 3KK6A 2XBYL 1QIUA 1B9WA 2EI8B 3ENSA 1L5GB 5I46L 1HAEA 1EQGA 1EMNA 3ZYGA 1KIGL 2OYUP 2VH6B 1EPJA 1IVOC 3LIWB 3N8XA 1YGCL 1NFUB 1N1IA 1EGFA 4RS0A 3NJPC 2Y81B 3LN1A 2GD4A 1EQHA 3TH3L 1ATDA 4A94C 1IQHL 1G1TA 2D1JB 3IJEB 2VJ3A 2W2QE 1TPGA 3N8WB 3GCWE 1PXXA 1NZIA 5IKVA 1CQEA 5CKNA 4M10A 5CKMA 2W2ME 4A7IA 4BXSA 1HREA 2W2NE 3TZIA 5EGMB 4ZHAB 1EPIA 2BOKL 2VH0B 2WFXB 1C5MF 2J38B 1Z6CA 3BT2A 1IQEL 4Y76B 3S6XA 6COXA 2P26A 1LPGA 2BT7A 2DDUA 4ZAEB 5KN5C 3LC3B 2I9BA 5JB8E 4GU4A 2P3TA 2W26B 3N8VA 3TK6B 5IKQA 2KB9A 1IGXA 5K0HB 2WPME 4BTUA 3FFGL
chains in the Genus database with same CATH topology
4JYUL 1IGZA 1KSNB 1CCVA 1WU1B 2W2PE 2XBWL 2NPRA 1IQKL 5CISA 1IQML 2J4IB 1EAIC 1HT8A 1KLJL 3GCXE 4YZUB 2MGRA 3HS5A 2KV4A 2W2OE 2J95B 1XDTR 2UWOB 2BOXA 1APQA 1CX2A 2TGFA 2XBXL 1U67A 2KNIA 3LN0A 1ATEA 3KQBL 1APOA 2KL7A 4MMYB 4CUEA 4Y6DB 2P95L 3F1SB 2FLGA 1HAFA 1IOEL 1PRHA 3N8WA 2J34B 3HO5A 4BTIA 2P94L 4BTTA 1U8CB 2BOUA 1CVWL 1X7AL 1XKAL 2WG3C 4Z0KB 4OTYA 3NT1A 3FCSB 3KQDL 4O1ZA 4PH9A 3ELAL 2J2UB 2H9EC 1NFYB 1IQLL 4MMXB 1UZQA 2FD6A 2BZ6L 4LMFA 1KLOA 3Q3KB 1G2LB 2CJIB 1G1RA 2WPHE 1DIYA 2YGQA 3QCWA 1FE2A 3OLTA 4JZDL 2P3UA 1MQ5L 1HJ7A 1I0UA 4XLWA 1CCFA 2VVCK 1COUA 1EZQB 1BF9A 2BQWA 3PGHA 3M37L 3SOVA 5COXA 1PTHA 1G1SA 5F19A 3CA7A 2Y7XB 1LPKA 1RFNB 5CKQA 4Z6AL 3LTGD 3V65B 4NG9L 2BO2A 1YUGA 4Y71B 5L2ZL 1FF7A 2M74A 3OLUA 2PR3B 5L30L 1HT5A 4RUTA 1FFMA 1O5DL 2PUQL 3Q7DA 4Y79B 1FSBA 1HX2A 1WHFA 4E1GA 1Z6EL 2EI6B 2VWMK 1K36A 4D90A 1NT0A 1NPEB 2G00L 2P16L 2W3IB 1LMJA 1WHEA 5JVZA 3KCGL 3H5CB 3CENL 5JBCE 3U73A 4LORA 1M1XB 4NGAL 2AYLA 3N8ZA 1KLIL 2UWPB 4C16A 3BT1A 5E8DA 4ISIL 1A3PA 4RRYA 3TBDA 3POYA 1IQNL 3QMOA 1P0SL 3U7UG 3N8YA 4RRXA 1UZPA 2FLRL 4MMZB 1IJQA 2XBVL 3R05A 4YT7L 1HZ8A 3CS7L 2RHPA 2VVVL 2RNLA 2RA0L 2WYJB 1EPHA 3SW2A 3HS7A 2WZPP 1F7MA 4G1MB 1FAXL 3RR3A 4X8SL 1IQGL 1PGEA 4JYVL 2VVUL 1EMOA 1JL9A 1ATBA 2WG4B 1HRFA 1ATAA 4M11A 1IQFL 4X8TL 2K2SB 1YUKB 4Y7AB 5JBAE 4ISHL 4BDXA 1F0RB 1DQBA 4RRZA 4D0FA 3M36L 2W86A 1UZKA 3LC5B 1YO8A 1OB1C 3ASIA 2YGOA 1DX5I 1IOXA 5IKTA 1URKA 1TLEA 1W7XL 2WPJE 2XC0L 3QH0A 5FDQA 2Y5FL 4Z0LA 1DDXA 4OTJA 2JKHL 1FAKL 2WYGB 3ZYIB 5JB9E 2XC5L 4JZFL 1W8BL 4XBMA 1LMMA 2WPIE 3NTBA 2Y82B 4X8UL 2B7DL 3KQEL 1NQLB 3HO4A 3ZYJB 1MOXC 5JVYA 1G2MB 5KIRA 3F6UL 4CSYA 1J9CL 1N7DA 3LTFB 4CUFA 2WPLE 4AQTA 1XKBA 3NTGA 3N8YB 2MHPA 2VWOL 2K2TA 4RRWA 1NFWB 4NA9L 4BXWA 1UZJA 1TOZA 2BQ6A 1EPGA 2F9BL 3TK5B 3KRKA 2Y80B 2W3KB 1LQDA 3LAQA 4ZH8B 1PFXL 4D0EA 4BDWA 1MQ6L 1JBUL 4JZEL 3K9XA 2WFTA 3HS6A 2WPKE 2OYEP 1GK5A 3HO3A 5JW1A 2FZZL 4FM5A 3HPTA 1XFEA 3SOBB 1G1QA 1ZAQA 1V3XB 4XL1A 2Y7ZB 2P93L 4COXA 1ADXA 2YGPA 4CUDA 4Y7BB 3KQCL 2VWLL 5IKRA 2Y5HL 4X8VL 2ADXA 1NFXB 1K37A 4TGFA 1EBVA 3TGFA 1F7EA 1DVAL 4O02B 2P3FN 1SZBA 3EGFA 1AUTL 1IQIL 1P9JA 5L2YL 3DEMA 1L3YA 1LPZA 1IQJL 2P3FL 1IP0A 1FJSL 1Q4GA 3SOQA 1F0SB 3MDLA 3P5BL 1CVUA 3GISX 2XC4L 2UWLB 2BQ7A 3V64C 2BMGA 3BPSE 2Q1JB 1QFKL 4YT6L 2PHBB 3C9AC 2MGPA 2Y38A 1YUFA 2J94B 2H9EL 3IITB 5F1AA 4ZXYL 2P28B 2FLBL 3FBYA 5JBBE 3MQEA 2I9AA 2EI7B 1JV2B 2VWNL 3CFWA 2Y5GL 1HCGB 4ZXXL 3KL6B 2BOHA 1CEJA 3KK6A 2XBYL 1B9WA 2EI8B 3ENSA 1L5GB 5I46L 1HAEA 1EQGA 1EMNA 3ZYGA 1KIGL 2OYUP 2VH6B 1EPJA 1IVOC 3LIWB 3N8XA 1YGCL 1NFUB 1N1IA 1EGFA 4RS0A 3NJPC 2Y81B 3LN1A 2GD4A 1EQHA 3TH3L 1ATDA 4A94C 1IQHL 1G1TA 2D1JB 3IJEB 2VJ3A 2W2QE 1TPGA 3N8WB 3GCWE 1PXXA 1NZIA 5IKVA 1CQEA 5CKNA 4M10A 5CKMA 2W2ME 4A7IA 4BXSA 1HREA 2W2NE 3TZIA 5EGMB 4ZHAB 1EPIA 2BOKL 2VH0B 2WFXB 1C5MF 2J38B 1Z6CA 3BT2A 1IQEL 4Y76B 3S6XA 6COXA 2P26A 1LPGA 2DDUA 4ZAEB 5KN5C 3LC3B 2I9BA 5JB8E 2P3TA 2W26B 3N8VA 3TK6B 5IKQA 2KB9A 1IGXA 5K0HB 2WPME 4BTUA 3FFGL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYU L;  1IGZ A;  1KSN B;  1CCV A;  1WU1 B;  2W2P E;  2XBW L;  2NPR A;  1IQK L;  5CIS A;  1IQM L;  2J4I B;  1EAI C;  1HT8 A;  1KLJ L;  3GCX E;  4YZU B;  2MGR A;  3HS5 A;  2KV4 A;  2W2O E;  2J95 B;  1XDT R;  2UWO B;  2BOX A;  1APQ A;  1CX2 A;  2TGF A;  2XBX L;  1U67 A;  3LN0 A;  1ATE A;  3KQB L;  1APO A;  2KL7 A;  4MMY B;  4CUE A;  4Y6D B;  2P95 L;  3F1S B;  2FLG A;  1HAF A;  1IOE L;  1PRH A;  3N8W A;  2J34 B;  3HO5 A;  4BTI A;  2P94 L;  4BTT A;  1U8C B;  2BOU A;  1CVW L;  1X7A L;  1XKA L;  2WG3 C;  4Z0K B;  4OTY A;  3NT1 A;  3FCS B;  3KQD L;  4O1Z A;  4PH9 A;  3ELA L;  2J2U B;  1NFY B;  1IQL L;  4MMX B;  1UZQ A;  2FD6 A;  2BZ6 L;  4LMF A;  1KLO A;  3Q3K B;  1G2L B;  2CJI B;  1G1R A;  2WPH E;  1DIY A;  3QCW A;  1FE2 A;  3OLT A;  4JZD L;  2P3U A;  1MQ5 L;  1HJ7 A;  1I0U A;  4XLW A;  1CCF A;  2VVC K;  1COU A;  1EZQ B;  1BF9 A;  2BQW A;  3PGH A;  3M37 L;  3SOV A;  5COX A;  1PTH A;  1G1S A;  5F19 A;  3CA7 A;  2Y7X B;  1LPK A;  1RFN B;  5CKQ A;  4Z6A L;  3LTG D;  3V65 B;  4NG9 L;  2BO2 A;  1YUG A;  4Y71 B;  5L2Z L;  1FF7 A;  2M74 A;  3OLU A;  2PR3 B;  5L30 L;  1HT5 A;  4RUT A;  1FFM A;  1O5D L;  2PUQ L;  3Q7D A;  4Y79 B;  1FSB A;  1HX2 A;  1WHF A;  4E1G A;  1Z6E L;  2EI6 B;  2VWM K;  1K36 A;  4D90 A;  1NT0 A;  1NPE B;  2G00 L;  2P16 L;  2W3I B;  1LMJ A;  1WHE A;  5JVZ A;  3KCG L;  3H5C B;  3CEN L;  5JBC E;  3U73 A;  4LOR A;  1M1X B;  4NGA L;  2AYL A;  3N8Z A;  1KLI L;  2UWP B;  4C16 A;  3BT1 A;  5E8D A;  4ISI L;  1A3P A;  4RRY A;  3TBD A;  3POY A;  1IQN L;  3QMO A;  1P0S L;  3U7U G;  3N8Y A;  4RRX A;  1UZP A;  2FLR L;  4MMZ B;  1IJQ A;  2XBV L;  3R05 A;  4YT7 L;  1HZ8 A;  3CS7 L;  2RHP A;  2VVV L;  2RNL A;  2RA0 L;  2WYJ B;  1EPH A;  3SW2 A;  3HS7 A;  1F7M A;  4G1M B;  1FAX L;  3RR3 A;  4X8S L;  1IQG L;  1PGE A;  4JYV L;  2VVU L;  1EMO A;  1JL9 A;  1ATB A;  2WG4 B;  1HRF A;  1ATA A;  4M11 A;  1IQF L;  4X8T L;  2K2S B;  1YUK B;  4Y7A B;  5JBA E;  4ISH L;  4BDX A;  1F0R B;  1DQB A;  4RRZ A;  4D0F A;  3M36 L;  2W86 A;  1UZK A;  3LC5 B;  1YO8 A;  1OB1 C;  3ASI A;  2YGO A;  1DX5 I;  1IOX A;  5IKT A;  1URK A;  1TLE A;  1W7X L;  2WPJ E;  2XC0 L;  3QH0 A;  5FDQ A;  2Y5F L;  4Z0L A;  1DDX A;  4OTJ A;  2JKH L;  1FAK L;  2WYG B;  3ZYI B;  5JB9 E;  2XC5 L;  4JZF L;  1W8B L;  4XBM A;  2WPI E;  3NTB A;  2Y82 B;  4X8U L;  2B7D L;  3KQE L;  1NQL B;  3HO4 A;  3ZYJ B;  1MOX C;  5JVY A;  1G2M B;  5KIR A;  3F6U L;  4CSY A;  1J9C L;  1N7D A;  3LTF B;  4CUF A;  2WPL E;  4AQT A;  1XKB A;  3NTG A;  3N8Y B;  2MHP A;  2VWO L;  2K2T A;  4RRW A;  1NFW B;  4NA9 L;  4BXW A;  1UZJ A;  1TOZ A;  2BQ6 A;  1EPG A;  2F9B L;  3TK5 B;  3KRK A;  2Y80 B;  2W3K B;  1LQD A;  3LAQ A;  4ZH8 B;  1PFX L;  4D0E A;  4BDW A;  1MQ6 L;  1JBU L;  4JZE L;  3K9X A;  2WFT A;  3HS6 A;  2WPK E;  2OYE P;  1GK5 A;  3HO3 A;  5JW1 A;  2FZZ L;  4FM5 A;  3HPT A;  1XFE A;  3SOB B;  1G1Q A;  1ZAQ A;  1V3X B;  4XL1 A;  2Y7Z B;  2P93 L;  4COX A;  1ADX A;  2YGP A;  4CUD A;  4Y7B B;  3KQC L;  2VWL L;  5IKR A;  2Y5H L;  4X8V L;  2ADX A;  1NFX B;  1K37 A;  4TGF A;  1EBV A;  3TGF A;  1F7E A;  1DVA L;  4O02 B;  2P3F N;  1SZB A;  3EGF A;  1AUT L;  1IQI L;  1P9J A;  5L2Y L;  3DEM A;  1L3Y A;  1LPZ A;  1IQJ L;  2P3F L;  1IP0 A;  1FJS L;  1Q4G A;  3SOQ A;  1F0S B;  3MDL A;  3P5B L;  1CVU A;  3GIS X;  2XC4 L;  2UWL B;  2BQ7 A;  3V64 C;  2BMG A;  3BPS E;  2Q1J B;  1QFK L;  4YT6 L;  2PHB B;  3C9A C;  2MGP A;  2Y38 A;  1YUF A;  2J94 B;  2H9E L;  3IIT B;  5F1A A;  4ZXY L;  2P28 B;  2FLB L;  3FBY A;  5JBB E;  3MQE A;  2I9A A;  2EI7 B;  1JV2 B;  2VWN L;  3CFW A;  2Y5G L;  1HCG B;  4ZXX L;  3KL6 B;  2BOH A;  1CEJ A;  3KK6 A;  2XBY L;  1B9W A;  2EI8 B;  3ENS A;  1L5G B;  5I46 L;  1HAE A;  1EQG A;  1EMN A;  3ZYG A;  1KIG L;  2OYU P;  2VH6 B;  1EPJ A;  1IVO C;  3LIW B;  3N8X A;  1YGC L;  1NFU B;  1N1I A;  1EGF A;  4RS0 A;  3NJP C;  2Y81 B;  3LN1 A;  2GD4 A;  1EQH A;  3TH3 L;  1ATD A;  1IQH L;  1G1T A;  2D1J B;  3IJE B;  2VJ3 A;  2W2Q E;  1TPG A;  3N8W B;  3GCW E;  1PXX A;  1NZI A;  5IKV A;  1CQE A;  5CKN A;  4M10 A;  5CKM A;  2W2M E;  4A7I A;  4BXS A;  1HRE A;  2W2N E;  3TZI A;  5EGM B;  4ZHA B;  1EPI A;  2BOK L;  2VH0 B;  2WFX B;  1C5M F;  2J38 B;  1Z6C A;  3BT2 A;  1IQE L;  4Y76 B;  6COX A;  2P26 A;  1LPG A;  2DDU A;  4ZAE B;  5KN5 C;  3LC3 B;  2I9B A;  5JB8 E;  2P3T A;  2W26 B;  3N8V A;  3TK6 B;  5IKQ A;  2KB9 A;  1IGX A;  5K0H B;  2WPM E;  4BTU A;  3FFG L; 
#chains in the Genus database with same CATH topology
 4JYU L;  1IGZ A;  1KSN B;  1CCV A;  1WU1 B;  2W2P E;  2XBW L;  2NPR A;  1IQK L;  5CIS A;  1IQM L;  2J4I B;  1EAI C;  1HT8 A;  1KLJ L;  3GCX E;  4YZU B;  2MGR A;  3HS5 A;  2KV4 A;  2W2O E;  2J95 B;  1XDT R;  2UWO B;  2BOX A;  1APQ A;  1CX2 A;  2TGF A;  2XBX L;  1U67 A;  2KNI A;  3LN0 A;  1ATE A;  3KQB L;  1APO A;  2KL7 A;  4MMY B;  4CUE A;  4Y6D B;  2P95 L;  3F1S B;  2FLG A;  1HAF A;  1IOE L;  1PRH A;  3N8W A;  2J34 B;  3HO5 A;  4BTI A;  2P94 L;  4BTT A;  1U8C B;  2JJL A;  2BOU A;  1CVW L;  1X7A L;  1XKA L;  2WG3 C;  4Z0K B;  4OTY A;  3NT1 A;  3FCS B;  3KQD L;  4O1Z A;  4PH9 A;  3ELA L;  2J2U B;  2H9E C;  1NFY B;  1IQL L;  4MMX B;  1UZQ A;  2FD6 A;  2BZ6 L;  4LMF A;  1KLO A;  3Q3K B;  1G2L B;  2CJI B;  1G1R A;  2WPH E;  1V1H A;  1DIY A;  2YGQ A;  3QCW A;  1FE2 A;  3OLT A;  4JZD L;  2P3U A;  1MQ5 L;  1HJ7 A;  1I0U A;  4XLW A;  1CCF A;  2VVC K;  1COU A;  1EZQ B;  1BF9 A;  2BQW A;  3PGH A;  3M37 L;  3SOV A;  5COX A;  1PTH A;  1G1S A;  5F19 A;  3CA7 A;  2Y7X B;  1LPK A;  1RFN B;  5CKQ A;  4Z6A L;  3LTG D;  3V65 B;  4NG9 L;  2BO2 A;  1YUG A;  4Y71 B;  5L2Z L;  1FF7 A;  2M74 A;  3OLU A;  2PR3 B;  5L30 L;  1HT5 A;  4RUT A;  1FFM A;  1O5D L;  2PUQ L;  3Q7D A;  4Y79 B;  1FSB A;  1HX2 A;  1WHF A;  4E1G A;  1Z6E L;  2EI6 B;  2VWM K;  1K36 A;  4D90 A;  1NT0 A;  1NPE B;  2VRS A;  2G00 L;  2P16 L;  2W3I B;  1LMJ A;  1WHE A;  5JVZ A;  3KCG L;  3H5C B;  3CEN L;  5JBC E;  3U73 A;  4LOR A;  1M1X B;  4NGA L;  2AYL A;  3N8Z A;  1KLI L;  2UWP B;  4C16 A;  3BT1 A;  5E8D A;  4ISI L;  1A3P A;  4RRY A;  3TBD A;  3POY A;  1IQN L;  3QMO A;  2BT8 A;  1P0S L;  2BSF A;  3U7U G;  3N8Y A;  4RRX A;  1UZP A;  2FLR L;  4MMZ B;  1IJQ A;  2XBV L;  3R05 A;  4YT7 L;  1HZ8 A;  3CS7 L;  1KKE A;  2RHP A;  2VVV L;  2RNL A;  2RA0 L;  2WYJ B;  1EPH A;  3SW2 A;  3HS7 A;  2WZP P;  1F7M A;  4G1M B;  1FAX L;  3RR3 A;  4X8S L;  1IQG L;  1PGE A;  4JYV L;  2VVU L;  1EMO A;  1JL9 A;  1ATB A;  2WG4 B;  1HRF A;  1ATA A;  4M11 A;  1IQF L;  4X8T L;  2K2S B;  1YUK B;  4Y7A B;  5JBA E;  4ISH L;  4BDX A;  1F0R B;  1DQB A;  4RRZ A;  4D0F A;  3M36 L;  2W86 A;  1UZK A;  3LC5 B;  1YO8 A;  1OB1 C;  3ASI A;  2YGO A;  1DX5 I;  1IOX A;  5IKT A;  1URK A;  1TLE A;  1W7X L;  2WPJ E;  2XC0 L;  3QH0 A;  5FDQ A;  2Y5F L;  4Z0L A;  1DDX A;  4OTJ A;  2JKH L;  1FAK L;  2WYG B;  3ZYI B;  5JB9 E;  2XC5 L;  4JZF L;  1W8B L;  4XBM A;  1LMM A;  2WPI E;  3NTB A;  2Y82 B;  4X8U L;  2B7D L;  3KQE L;  1NQL B;  3HO4 A;  3ZYJ B;  1MOX C;  5JVY A;  1G2M B;  5KIR A;  3F6U L;  4CSY A;  1J9C L;  1N7D A;  3LTF B;  4CUF A;  2WPL E;  4AQT A;  1XKB A;  3NTG A;  3N8Y B;  2MHP A;  2VWO L;  2K2T A;  4RRW A;  1NFW B;  4NA9 L;  4BXW A;  1UZJ A;  1TOZ A;  2BQ6 A;  1EPG A;  2F9B L;  3TK5 B;  3KRK A;  2Y80 B;  2W3K B;  1LQD A;  3LAQ A;  4ZH8 B;  1PFX L;  4D0E A;  4BDW A;  1MQ6 L;  1JBU L;  4JZE L;  3K9X A;  2WFT A;  3HS6 A;  2WPK E;  2OYE P;  1GK5 A;  3HO3 A;  5JW1 A;  2FZZ L;  4FM5 A;  3HPT A;  1XFE A;  3SOB B;  1G1Q A;  1ZAQ A;  1V3X B;  4XL1 A;  2Y7Z B;  2P93 L;  4COX A;  1ADX A;  2YGP A;  4CUD A;  4Y7B B;  3KQC L;  2VWL L;  5IKR A;  2HOR A;  2Y5H L;  4X8V L;  2ADX A;  1NFX B;  1K37 A;  4TGF A;  1EBV A;  3TGF A;  1F7E A;  1DVA L;  4O02 B;  2P3F N;  1SZB A;  3EGF A;  1AUT L;  1IQI L;  1P9J A;  5L2Y L;  3DEM A;  1L3Y A;  4GU3 A;  1LPZ A;  2HOX A;  1LK9 A;  1IQJ L;  2P3F L;  1IP0 A;  1FJS L;  1Q4G A;  3SOQ A;  1F0S B;  3MDL A;  3P5B L;  1CVU A;  3GIS X;  2XC4 L;  2UWL B;  2BQ7 A;  3V64 C;  2BMG A;  3BPS E;  2Q1J B;  1QFK L;  4YT6 L;  2PHB B;  3C9A C;  2MGP A;  2Y38 A;  1YUF A;  2J94 B;  2H9E L;  3IIT B;  5F1A A;  4ZXY L;  2P28 B;  2FLB L;  3FBY A;  5JBB E;  3MQE A;  2I9A A;  2EI7 B;  1JV2 B;  1V1I A;  2VWN L;  3CFW A;  2Y5G L;  1HCG B;  4ZXX L;  3KL6 B;  2BOH A;  1CEJ A;  3KK6 A;  2XBY L;  1QIU A;  1B9W A;  2EI8 B;  3ENS A;  1L5G B;  5I46 L;  1HAE A;  1EQG A;  1EMN A;  3ZYG A;  1KIG L;  2OYU P;  2VH6 B;  1EPJ A;  1IVO C;  3LIW B;  3N8X A;  1YGC L;  1NFU B;  1N1I A;  1EGF A;  4RS0 A;  3NJP C;  2Y81 B;  3LN1 A;  2GD4 A;  1EQH A;  3TH3 L;  1ATD A;  4A94 C;  1IQH L;  1G1T A;  2D1J B;  3IJE B;  2VJ3 A;  2W2Q E;  1TPG A;  3N8W B;  3GCW E;  1PXX A;  1NZI A;  5IKV A;  1CQE A;  5CKN A;  4M10 A;  5CKM A;  2W2M E;  4A7I A;  4BXS A;  1HRE A;  2W2N E;  3TZI A;  5EGM B;  4ZHA B;  1EPI A;  2BOK L;  2VH0 B;  2WFX B;  1C5M F;  2J38 B;  1Z6C A;  3BT2 A;  1IQE L;  4Y76 B;  3S6X A;  6COX A;  2P26 A;  1LPG A;  2BT7 A;  2DDU A;  4ZAE B;  5KN5 C;  3LC3 B;  2I9B A;  5JB8 E;  4GU4 A;  2P3T A;  2W26 B;  3N8V A;  3TK6 B;  5IKQ A;  2KB9 A;  1IGX A;  5K0H B;  2WPM E;  4BTU A;  3FFG L; 
#chains in the Genus database with same CATH homology
 4JYU L;  1IGZ A;  1KSN B;  1CCV A;  1WU1 B;  2W2P E;  2XBW L;  2NPR A;  1IQK L;  5CIS A;  1IQM L;  2J4I B;  1EAI C;  1HT8 A;  1KLJ L;  3GCX E;  4YZU B;  2MGR A;  3HS5 A;  2KV4 A;  2W2O E;  2J95 B;  1XDT R;  2UWO B;  2BOX A;  1APQ A;  1CX2 A;  2TGF A;  2XBX L;  1U67 A;  2KNI A;  3LN0 A;  1ATE A;  3KQB L;  1APO A;  2KL7 A;  4MMY B;  4CUE A;  4Y6D B;  2P95 L;  3F1S B;  2FLG A;  1HAF A;  1IOE L;  1PRH A;  3N8W A;  2J34 B;  3HO5 A;  4BTI A;  2P94 L;  4BTT A;  1U8C B;  2BOU A;  1CVW L;  1X7A L;  1XKA L;  2WG3 C;  4Z0K B;  4OTY A;  3NT1 A;  3FCS B;  3KQD L;  4O1Z A;  4PH9 A;  3ELA L;  2J2U B;  2H9E C;  1NFY B;  1IQL L;  4MMX B;  1UZQ A;  2FD6 A;  2BZ6 L;  4LMF A;  1KLO A;  3Q3K B;  1G2L B;  2CJI B;  1G1R A;  2WPH E;  1DIY A;  2YGQ A;  3QCW A;  1FE2 A;  3OLT A;  4JZD L;  2P3U A;  1MQ5 L;  1HJ7 A;  1I0U A;  4XLW A;  1CCF A;  2VVC K;  1COU A;  1EZQ B;  1BF9 A;  2BQW A;  3PGH A;  3M37 L;  3SOV A;  5COX A;  1PTH A;  1G1S A;  5F19 A;  3CA7 A;  2Y7X B;  1LPK A;  1RFN B;  5CKQ A;  4Z6A L;  3LTG D;  3V65 B;  4NG9 L;  2BO2 A;  1YUG A;  4Y71 B;  5L2Z L;  1FF7 A;  2M74 A;  3OLU A;  2PR3 B;  5L30 L;  1HT5 A;  4RUT A;  1FFM A;  1O5D L;  2PUQ L;  3Q7D A;  4Y79 B;  1FSB A;  1HX2 A;  1WHF A;  4E1G A;  1Z6E L;  2EI6 B;  2VWM K;  1K36 A;  4D90 A;  1NT0 A;  1NPE B;  2G00 L;  2P16 L;  2W3I B;  1LMJ A;  1WHE A;  5JVZ A;  3KCG L;  3H5C B;  3CEN L;  5JBC E;  3U73 A;  4LOR A;  1M1X B;  4NGA L;  2AYL A;  3N8Z A;  1KLI L;  2UWP B;  4C16 A;  3BT1 A;  5E8D A;  4ISI L;  1A3P A;  4RRY A;  3TBD A;  3POY A;  1IQN L;  3QMO A;  1P0S L;  3U7U G;  3N8Y A;  4RRX A;  1UZP A;  2FLR L;  4MMZ B;  1IJQ A;  2XBV L;  3R05 A;  4YT7 L;  1HZ8 A;  3CS7 L;  2RHP A;  2VVV L;  2RNL A;  2RA0 L;  2WYJ B;  1EPH A;  3SW2 A;  3HS7 A;  2WZP P;  1F7M A;  4G1M B;  1FAX L;  3RR3 A;  4X8S L;  1IQG L;  1PGE A;  4JYV L;  2VVU L;  1EMO A;  1JL9 A;  1ATB A;  2WG4 B;  1HRF A;  1ATA A;  4M11 A;  1IQF L;  4X8T L;  2K2S B;  1YUK B;  4Y7A B;  5JBA E;  4ISH L;  4BDX A;  1F0R B;  1DQB A;  4RRZ A;  4D0F A;  3M36 L;  2W86 A;  1UZK A;  3LC5 B;  1YO8 A;  1OB1 C;  3ASI A;  2YGO A;  1DX5 I;  1IOX A;  5IKT A;  1URK A;  1TLE A;  1W7X L;  2WPJ E;  2XC0 L;  3QH0 A;  5FDQ A;  2Y5F L;  4Z0L A;  1DDX A;  4OTJ A;  2JKH L;  1FAK L;  2WYG B;  3ZYI B;  5JB9 E;  2XC5 L;  4JZF L;  1W8B L;  4XBM A;  1LMM A;  2WPI E;  3NTB A;  2Y82 B;  4X8U L;  2B7D L;  3KQE L;  1NQL B;  3HO4 A;  3ZYJ B;  1MOX C;  5JVY A;  1G2M B;  5KIR A;  3F6U L;  4CSY A;  1J9C L;  1N7D A;  3LTF B;  4CUF A;  2WPL E;  4AQT A;  1XKB A;  3NTG A;  3N8Y B;  2MHP A;  2VWO L;  2K2T A;  4RRW A;  1NFW B;  4NA9 L;  4BXW A;  1UZJ A;  1TOZ A;  2BQ6 A;  1EPG A;  2F9B L;  3TK5 B;  3KRK A;  2Y80 B;  2W3K B;  1LQD A;  3LAQ A;  4ZH8 B;  1PFX L;  4D0E A;  4BDW A;  1MQ6 L;  1JBU L;  4JZE L;  3K9X A;  2WFT A;  3HS6 A;  2WPK E;  2OYE P;  1GK5 A;  3HO3 A;  5JW1 A;  2FZZ L;  4FM5 A;  3HPT A;  1XFE A;  3SOB B;  1G1Q A;  1ZAQ A;  1V3X B;  4XL1 A;  2Y7Z B;  2P93 L;  4COX A;  1ADX A;  2YGP A;  4CUD A;  4Y7B B;  3KQC L;  2VWL L;  5IKR A;  2Y5H L;  4X8V L;  2ADX A;  1NFX B;  1K37 A;  4TGF A;  1EBV A;  3TGF A;  1F7E A;  1DVA L;  4O02 B;  2P3F N;  1SZB A;  3EGF A;  1AUT L;  1IQI L;  1P9J A;  5L2Y L;  3DEM A;  1L3Y A;  1LPZ A;  1IQJ L;  2P3F L;  1IP0 A;  1FJS L;  1Q4G A;  3SOQ A;  1F0S B;  3MDL A;  3P5B L;  1CVU A;  3GIS X;  2XC4 L;  2UWL B;  2BQ7 A;  3V64 C;  2BMG A;  3BPS E;  2Q1J B;  1QFK L;  4YT6 L;  2PHB B;  3C9A C;  2MGP A;  2Y38 A;  1YUF A;  2J94 B;  2H9E L;  3IIT B;  5F1A A;  4ZXY L;  2P28 B;  2FLB L;  3FBY A;  5JBB E;  3MQE A;  2I9A A;  2EI7 B;  1JV2 B;  2VWN L;  3CFW A;  2Y5G L;  1HCG B;  4ZXX L;  3KL6 B;  2BOH A;  1CEJ A;  3KK6 A;  2XBY L;  1B9W A;  2EI8 B;  3ENS A;  1L5G B;  5I46 L;  1HAE A;  1EQG A;  1EMN A;  3ZYG A;  1KIG L;  2OYU P;  2VH6 B;  1EPJ A;  1IVO C;  3LIW B;  3N8X A;  1YGC L;  1NFU B;  1N1I A;  1EGF A;  4RS0 A;  3NJP C;  2Y81 B;  3LN1 A;  2GD4 A;  1EQH A;  3TH3 L;  1ATD A;  4A94 C;  1IQH L;  1G1T A;  2D1J B;  3IJE B;  2VJ3 A;  2W2Q E;  1TPG A;  3N8W B;  3GCW E;  1PXX A;  1NZI A;  5IKV A;  1CQE A;  5CKN A;  4M10 A;  5CKM A;  2W2M E;  4A7I A;  4BXS A;  1HRE A;  2W2N E;  3TZI A;  5EGM B;  4ZHA B;  1EPI A;  2BOK L;  2VH0 B;  2WFX B;  1C5M F;  2J38 B;  1Z6C A;  3BT2 A;  1IQE L;  4Y76 B;  3S6X A;  6COX A;  2P26 A;  1LPG A;  2DDU A;  4ZAE B;  5KN5 C;  3LC3 B;  2I9B A;  5JB8 E;  2P3T A;  2W26 B;  3N8V A;  3TK6 B;  5IKQ A;  2KB9 A;  1IGX A;  5K0H B;  2WPM E;  4BTU A;  3FFG L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...