1AUVA

Structure of the c domain of synapsin ia from bovine brain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
306
structure length
292
Chain Sequence
b'AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLINQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAKYDVRIQKIGQNYKAYMRTLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPSIN IA
publication title Synapsin I is structurally similar to ATP-utilizing enzymes.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 80
structure length 292
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1auvA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1auvA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auvA02
4O81A 3JRWA 4ME6A 4FFRA 2VPQA 3V4SA 4O83A 2DWCA 3ETJA 4O4HF 4QSHA 3I12A 2GLTA 3DF7A 4EGQA 1GLVA 1JDEA 3AX6A 4XYMB 4NYEA 4GGMX 3GLKA 5KKNB 2IP4A 4YAJB 4FFNA 4MV6A 4RZQA 3VPBA 5DMXA 5GONF 3N6RA 4O7YA 3TINA 3E5NA 3TIIA 1DIKA 4IZOA 4O7LA 4ZOLF 1A9XA 4EABA 2CNVA 3OUUA 4YJ3F 3OUZA 5BMVF 2I80A 1JDBB 5C1OA 1KEEA 1ULZA 3BSYA 4M9UA 1SCUB 4E4TA 1C30A 4DLKA 5C8YF 3TW6A 2YZMA 4J6EA 1IOWA 1EUDB 2I87A 5IYZF 3Q2OA 3ORRA 4EG0A 2W6MA 3MWEA 3VA7A 4O7ZA 4HNUA 3VPDA 4Y8VB 1AUVA 3NUAA 3VMMA 5LA6F 2NU7B 3UFXB 1KJJA 2P0AA 4HQ6A 4FU0A 3BG5A 1UC9A 2YZNA 4IIJF 2R7KA 1WR2A 1GGOA 1PK8A 2J9GA 4XYLB 4O2BF 1GSHA 3HBLA 4O7VA 1KJ9A 1B6SA 2NU9B 1CE8A 4MV9A 1KJQA 2R82A 2PN1A 1OBDA 3HB9A 1C3OA 2V59A 3KREA 3G8CA 1BNCA 3KAJA 4MV1A 2YL2A 2R7LA 1EHIA 2CNQA 2QF7A 1PX2A 2DLNA 4C5AA 4FFLA 2X0SA 2GPWA 1E4EA 4IHJF 2W6OA 5LYJF 5D8DA 3GIDA 2W6ZA 3Q1KA 3VOTA 4C5BA 4TV9F 3RV4A 2YRXA 3BSSA 2XCLA 2SCUB 4O4JF 2HJWA 2FP4B 2R7NA 5HBRB 3WO1A 1T36A 2Z02A 2PBZA 3R5XA 4YBZB 4MV3A 5LP6F 4O7NA 2NPOA 5LXTF 5H80A 3VPCA 4O7SA 1VBHA 3AW8A 4HR7A 2NU8B 4C5CA 2YS7A 1KUTA 5J2TF 2DIKA 4MAMA 1KJ8A 3R5HA 5HV6A 3TQTA 5I47A 4IWXA 4O84A 4WBNF 3ETHA 3KALA 5FNVF 4FFPA 4WD3A 2YW2A 3R9RA 4TV8F 3U55A 1M0TA 4O82A 5JVLA 3K5HA 4O7RA 1JKJB 2ZDQA 3HO8A 3G8DA 3K3PA 2YRWA 1Z2NX 2YWVA 3MWDA 5EZYF 2W71A 3LP8A 2YYAA 1E4EB 2GPSA 1I7LA 5JH7F 4EA8A 1CQIB 4I55F 2OLSA 2CQYA 3LWBA 2R85A 5JVDF 2V58A 3BFPA 2W6PA 1IOVA 2V5AA 3U9TA 2CNUA 1CS0A 4O7WA 3KAKA 2FB9A 2R7MA 4DIMA 2PVPA 2CZGA 4FGRA 4HNTA 5CA1F 1A48A 4MV7A 1JLLB 4YJ2F 4O86A 2NUAB 3R5FA 4O4IF 3JZIA 4O7TA 1VKZA 4TUYF 3U9SA 1KBLA 4ZHQF 4MA0A 1EZ1A 2C00A 4FFOA 5JQWA 4L1KA 2FPIB 1CQJB 5CB4F 1W93A 4EGJA 5KX5F 4MV8A 2R87A 2FPPB 2VHEA 4O4LF 4MA5A 4ZQIA 1W96A 2QK4A 4M9CA 2FPGB 2HGSA 1EUCB 2R6FA 2XD4A 4XZ3B 4I50F 5BPFA 2W70A 3U54A 2WYOA 3RV3A 4HNVA 2VQDA 4FFMA 5J2UF 3RFCA 3JZFA 2W6NA 4I4TF 1UC8A 4EAAA 3TIGA 3N8DA 5C1PA 1BXRA 5CA0F 1KC7A 3BSWA 4MV4A 2YS6A 2YZLA 1EYZA 4EA9A 4M99A 2DZDA 2W6QA 2Z04A 1AUXA 5BPHA 5LOVF 1B6RA 1Z2PX 4YAKB 4IWYA 5K2MA 3SE7A 4EA7A 4FE2A 3JRXA 2GQRA 1DV2A 4O2AF 2GQSA 2ZDHA 2I8CA 4ZI7F 1GSAA 2NU6B 1I7NA 3R23A 3V4ZA 1GSOA 2R84A 2ZDGA 3RUPA 3ORQA 3WO0A 2R86A 5JQGF 4YB8B 2VR1A 1M0WA 1DV1A 1M6VA 1KJIA 3WNZA 3MJFA 1OBGA 3K5IA 1Z2OX 5CAEB 1VBGA 4M98A 2YZGA 3QFFA 4XX0B
chains in the Genus database with same CATH superfamily
4LDPA 1QXSA 3K09A 4MX8A 4HDMB 4Q3BA 4UCRA 1W8IA 1ZETA 1VB3A 1ZK4A 3MWGA 3OMWA 1T2VA 5K3FA 1YDWA 3L04A 2HIAA 2E18A 2R6DA 4ZXPA 3G0HA 3M6IA 3BABA 4ZAZA 1AKQA 2XOEA 3WP0A 2HDNB 3TLJA 5F9MA 3FYUB 3Q7EA 1TF2A 4BLTA 4N4AA 2OSVA 3S40A 4FGLA 4KLCA 3KJNA 5JFOA 3THXB 4J9UE 5FLEX 4M9UA 1FVXA 1T43A 4LJRA 3USES 1N8TA 3ORRA 3KVNA 1TCCA 4Z4QA 2AQKA 3OOJA 4INAA 1FVHA 4AURA 1Z15A 2O52A 2B8TA 4AO6A 1EHCA 3L7LA 4R5HA 3VMMA 4A2WA 3JARB 4OLAA 3UA3A 3OM1A 4BN4A 4WOBA 1MW8X 1QRTA 1HFJA 4HB3A 3RG8A 5LXTB 4YAIA 1WIWA 1QG6A 5ARCA 821PA 2W2VA 2VZEA 4INZA 1R37A 3DBLA 3RFXA 4OGWA 4EFBA 3ENQA 3R9XB 1HZJA 2ZJ0A 5LU9A 1YS6A 3GLHB 1V7CA 3WMFA 2B34A 1XV5A 1Y1LA 1CB7A 2IYTA 1HT1E 4FQ8A 5I6DA 5DI9A 3EJ6A 5CNIA 1GAXA 2XVZA 3DFIA 4BQIA 2R2AA 3BIXA 3STWA 2ZRBA 4TLCA 5LYJF 4YP5A 4CGYA 3GLVA 4NCKA 2JH8A 4ENSA 1F9EA 2B20A 3QUCA 3QQ5A 1FJXA 3ADBA 5DRTA 2J9XB 4TMWA 3ZNOA 2PRIA 3ENZA 3DOHA 2JAXA 1KFKB 3U62A 1X14A 5CCXA 1PLLA 5LYYA 3QK7A 2H0AA 4MHSA 2UDPA 1ORHA 3BXOA 3G0DA 3E3OA 3FG9A 1MAAA 3VUFA 3AF1A 3NTRA 3RFFA 1Z6XA 4U5XA 3TQTA 1JX6A 2FYTA 4R7TA 3WIOA 5JR3A 2RHRA 3WAGA 4KYUA 1QHYA 4ZO9A 1CZHA 3LDAA 4L8WB 2YW2A 1NYTA 4NCJA 3VU0A 1RXVA 2CLIB 2JA6A 3AM1A 2I4TA 4G4IA 1NQVA 2ACWA 1QKIA 4B4DA 2IHTA 3HADA 1NM5A 1NG1A 2J5QA 3DCNA 4AYBA 3TNJA 3LKVA 4LHXA 3NAGA 3PUWA 1EA7A 2NZJA 4IXTA 1MG0A 1SBQA 4BNIA 3PFFA 1VKRA 3TVDA 4PZ8A 4QG7A 1CEXA 2PGNA 3UBMA 5JAOA 2QSYA 2Y0PA 1Z39A 5P21A 2X8WA 3EXG2 5KX5A 3R7WA 1DKPA 2EFDB 2QZPA 4UCUA 5E9JA 3TW8A 4DDVA 1L5ZA 1LU9A 1KI7A 3NO4A 1GDTA 4JY7A 3BDAA 1RABA 2O07A 2QORA 3F7TA 4ZT2A 5L1JA 5DH9A 4M1YA 2UVPA 3E1GA 2GF0A 4H7HA 4CBVA 4BPBA 4QQRA 3JYNA 4WESA 3JV7A 2F1OA 3I61A 1ZGCA 2GX6A 1NI5A 2DR0A 1BXRA 2SKEA 5FBKA 2Y9PB 4EBCA 2WI8A 3FFBA 3CZ4A 2IEGA 3PA6A 3I9KA 4ND4A 5LQSA 1UJBA 3SJZA 4GR5A 4GPBA 1YQQA 3LT0A 4TVIA 2F2TA 1K1EA 5DQIA 4EUSA 5CFLA 2OHGA 3CCFA 3KVYA 3ER9A 1XL0A 1JDPA 5DYTA 1L1EA 3D02A 4NATA 4XPIA 3K05A 1SQ6A 1ESDA 3EAQA 4P3OA 1U1GA 3ZOKA 2O05A 4LTDA 1Z6QA 1XHEA 1NUQA 1YRHA 3ONNA 5FADA 3QKRB 1Z0AA 4FILA 1OV6A 2D59A 1XZJA 4R8KA 4OYLA 1V41E 1KAOA 3KJIA 1T8UA 2QTFA 4YRAA 3MJHA 1J2RA 1H2FA 3R8CA 3BQMB 1WVGA 1UMKA 1EJ0A 1XQ9A 5HIKA 2FJUA 4W63A 3W9UA 4X8LA 1IJBA 2H1IA 2W4MA 5CFNA 3HWX1 2XA1A 4BO5A 4OJYA 5DNWA 4CEHB 4PQRA 3PUHA 3AKCA 1BDHA 3F47A 2YX1A 4EJ0A 4XE5A 2M98A 3K9BA 1OOEA 3DMTC 4QTZA 3LX5A 1X13A 2AS0A 1BHO1 4AP9A 3OH8A 5BNZA 4G2NA 2GA9A 4HQ0A 1OVGA 1P77A 1RJWA 4DUGD 3SR3A 2YMPA 3ICVA 5DI3A 2E5LH 4WEOA 2IZ0A 3ZY3A 3CVZA 2I4OA 2A0YA 3FFTA 2ZB3A 3AP1A 4G5QA 1U5CA 3K0HA 4RZRA 2DFVA 3SQOA 3ST7A 1C5KA 4YMUA 2ZYTX 5CNKA 3IP5A 3LPAA 3TS1A 4L78A 8LDHA 4S1VA 2WKQA 2B3DA 4J43A 1U2TA 3EPKA 4S2UA 4LRQA 5TT0A 3UFBA 4N7MA 1ST3A 3GGDA 3B7GA 3PHHA 1P45A 5H4GA 3FVVA 4GDFA 2OBLA 2FN7A 1Y8ZA 2QM0A 5AQ1A 2RHDA 4FKZA 4MV9A 4EO7A 1QFMA 3X1MA 1ULBA 3QXHA 4Q66C 1C9YA 3LDUA 1ONPA 5IUNC 2ZRLA 2YCHA 2BFCA 1PX2A 1GNLA 4HDQB 4QYMA 1WP9A 3PU6A 2VTDA 2DAAA 1ULHA 5EJFA 4CT0A 2PD3A 3TK1A 1AKWA 1V4BA 2ZIFA 2H57A 1LJ8A 1ZH2A 2LP4Y 5E4TA 1US8A 1YK0A 3LHKA 4US2R 5IMBA 4E4RA 4LDQA 4J0EA 3AYZB 5AUQA 1Y98A 4MKGA 3MJVA 1Z22A 1PYOA 5LZ7A 1SC1A 3ZVLA 2IOFA 5LNK6 4UHHA 4HDOB 3E61A 1SCDA 1VFNA 2ZCVA 4WZAB 4YR3A 1ZM2A 1D4OA 2HNBA 1GGFA 1NPTO 3L4EA 1I7QB 4RVCA 4PDBA 1UJMA 3KEFA 1PJCA 3NI2A 3HU5A 3RYFB 1Z2NX 2GM3A 1QP7A 3V2GA 1N3BA 3BHNA 1TCBA 3DT8A 4E21A 3AF2A 4KAJA 5HQTA 1R5BA 5ICFA 3HZZA 4NAHA 4EITA 3SY8A 4PZ7A 3FX2A 3Q10A 5D86A 2I71A 3EPRA 2VS1A 4TMVA 1FMLA 2CNUA 1A9SA 3OURA 5FRDA 4P7JA 1JKFA 1KFBB 4GMDA 1D6NA 3EFOA 5BW5A 2IXAA 2HNKA 1UPFA 2OFOA 5FLXW 5IZCA 1EH5A 3L2OB 1J9EA 4M0UA 1XDSA 1LBEA 3WLTA 4F8YA 3ZXUB 1O97D 5M04A 3DTYA 4DUGA 4MUJA 5AOVA 3DBOB 2FPIB 3LX4A 1GZ7A 5IN4A 2E4XA 2ZJYA 5WRFA 3D8TA 1CX9B 1JFVA 3TZHA 5FUMA 1MC4A 1ATZA 2R6FA 5HOQA 5LPNA 4PX3A 2A0XA 3F4BA 3FWPA 2FQYA 3FYUC 3WGLA 3RJ5A 5J2UF 1U9YA 1ZMRA 4OP2A 1UDCA 4RE6A 3JYHA 4IQGA 2BJVA 3T15A 4NEHB 1QFJA 4BAUA 3OHMA 1BROA 4EKIA 1IM2A 3PD0A 2JHCA 4YAJA 5AI9A 1QDEA 4JBLA 5E1OA 2YJ5A 5TMBA 1S4MA 3P2OA 2Q2OA 2HIMA 3FRJA 3EWNA 2Q5FA 2FSUA 4BKMA 3M4NA 2GPJA 1OH5A 4ZT4A 2R86A 1E6CA 4DV6H 1NOIA 1E89A 2OGWA 4LF8H 1Q77A 4DWVA 2G7ZA 2HEIA 3RQSA 5IVPA 3D3JA 1O5IA 2VQ6A 1HT0A 4NYIR 4DUPA 1Y9JA 1OYVA 5EEGA 3K20A 2JH9A 3EARA 5JSZA 1KZ4A 3JQGB 1Z17A 4XYMB 2EYQA 3A6FA 2EWWA 3DT9A 2MSWA 3PVXA 1YZNA 3RUAA 2WSSD 4P3XA 3E82A 4WEQA 2R6HA 2PKQO 3M8KA 3QV1A 2AMVA 3EGIA 1V35A 5FTJA 1A8IA 2QQ5A 3VU8A 3U80A 3ER8A 4FYXA 4N1AA 1ADYA 1IATA 4IIDA 4FCWA 4ARZB 4CYMA 3SEFA 4PGFA 5HYVA 1JDBB 3VGPA 1MEEA 3QUTA 3UHAA 3KCQA 3HXPA 1N34B 1J07A 5C8YF 3SBXA 4ZVTA 3LUAA 4EF5A 3KM0A 4WZBA 4K6HA 2BAGA 3GDEA 2FNAA 4EG0A 4IUBS 2CW8A 3CWQA 4EZIA 3GXOA 3C1AA 1PTJC 1I14A 3LUKA 4KV7A 4UNRA 3GQBA 3W90A 3CG4A 4MVJP 3HBJA 521PA 3RIYA 3WWHA 3FF1A 3CUSA 5FI3A 1SCJA 1F8XA 4D9GA 3WYCA 1JDNA 3Q7TA 1GPBA 3U1VA 2AUTA 4D5GA 2JCBA 1DG3A 4K0KB 4O0LA 4PYIA 2BFBB 5C2JB 4MQ4A 4FI3C 4GSYA 2PZKA 4CUJA 1YVRA 5F1OA 4FN4A 4TV9A 1NBAA 4UEJA 2AYYA 1D2HA 2ZYGA 4IH9A 2XADA 5C7YA 4FFBB 1QH1B 5CT4A 3CVUA 1SGWA 5BORA 1S0NA 1BGXT 3C0KA 4KIFA 2IA5A 3HSSA 4F3KA 3JD1A 5H16A 3WLAA 3AVOA 4HNQA 5G3ZA 3MBIA 4J0GA 5TIIA 4QJIA 1KI9A 4DLVA 1TYAE 3TIVA 1YKSA 3FKJA 2PLNA 2PYIA 4DMFA 2KQUA 3U7QB 2X3UA 1EEXB 1X2BA 3H1FA 5J4YA 1J9ZA 3OUTA 2P4HX 3JD2A 4L4YA 1S3FA 1R6DA 1IUPA 1JHXA 4TKUA 4R1QA 4WWHA 3GHYA 2JJ8A 2AK3A 4JJ7A 3FDJA 2C9DA 2CJPA 4JI3H 2WWYA 2Z09A 4FJ1A 4Q1CA 1T9GR 3OQ1A 2NVOA 4I55F 3QLEA 3MTIA 4F6RB 4KQWA 4ZOQI 2WSSA 2GBGA 3HZHA 4ZO8A 5JFTA 1NN1A 2FZ5A 4GI7A 3WGHA 4PBCA 4EHNA 5KFUA 1H9BA 1PR1A 2VKTA 1G16A 5EWFA 3WFIA 1FCJA 4JGBA 3L6OO 1YIAA 2DUMA 4G1BA 3AGPA 4H3KB 1OTHA 5CA1F 1Y37A 5ECGC 4G37A 1P2TA 2XYVA 1N3YA 3R5FA 4QHSA 5SICE 1VP9A 1NLZA 2C1XA 2FWPA 3OE1A 3OQJA 2P3LA 5CFRA 1I3LA 2AWNA 4X66B 2FK2A 2DULA 2BGGA 1JDZA 4IYJA 3PFBA 3JWEA 1LQTA 3QVLA 3H83A 1FFAA 4XVQA 1KKLA 3KPWA 1NR5A 3GBSA 4M6WB 4GBMA 5JWOA 5IPFA 4BX8A 2RMKA 1TEVA 5AM3A 2H06A 1TT5B 4URFA 3SYTA 1JHPA 4B3HA 3VUEA 3I3SR 4J2OA 1CF4A 3L1UA 5F7OA 5EWGA 1BIFA 2OCYC 1IQPA 4B46A 3OX1A 1K83A 1UK6A 2XOKA 4LZAA 1SVNA 4UUOA 1T2FA 1B4DA 3NBUA 2HF9A 2HGZA 1ECPA 3PE3A 3FGNA 2XRZA 1MX1A 5ELMA 2FR0A 2HWWA 2ZRIA 3EZ7A 3GJ7A 1YKGA 1ZL0A 4DV1B 1FY2A 2WYHA 5D5PA 4LWQA 4ID9A 5ALYA 2E37A 2IF0A 5KFMA 5JQGF 2X19A 5K9ZA 1TAGA 2CXSA 2E4VA 4AS3A 2C7QA 3I62A 1J21A 2B5WA 3T0GA 4I36A 4GDMA 5JAMA 1D6MA 4QQKA 3QU5A 4QUGA 4Y7DA 5LQNA 1DX6A 1KDPA 3DF7A 2P9JA 1D4FA 1IHXA 1KVSA 3QEJA 4OLHA 5LP6A 2GJKA 2H1OA 4Q16A 3GLSA 3KQYA 1IG0A 2C1EA 4BO1A 3K6RA 3RYCB 3EOAI 1NIJA 1AUOA 4P3PA 3EF0A 5BWNA 2J30A 3BMCB 1R0SA 2PLWA 4ENWA 5KPJA 1E3LA 4LJ6A 3DFMA 3BE6A 5H7XA 4II2A 1M9NA 4HQNA 3PDIA 1AN0A 5ITVA 4HV4A 1XXHB 3QX7A 1H1DA 3L7KA 1CUCA 4C0AC 5T3UA 3HEMA 3PXBA 1QJCA 1YS9A 4FBUA 1GGNA 1MN6A 4Q4JA 4KC0A 1HLFA 1RBMA 4QD3A 4RUCA 1O0SA 3WMGA 1JLMA 3LM8A 1L5GB 5HKBA 4CF3A 2EJBA 2FMIA 1Q1AA 5E1BA 4BO2A 1CE8A 3BN3A 1I6MA 1XAHA 2I54A 5IBPA 2G9QA 5BN5B 2VJDA 1SULA 2WP8J 4B9AA 1QMGA 1A0GA 5C4XG 4J16A 4CXMA 5DG9A 4CE6A 5EVJA 2OO7A 4LV8B 4GX0A 4DCCA 3D2BA 4C1NA 4JLVA 2GLXA 2RGGA 4XCXA 5KG4A 3KWLA 1FF9A 1VI6A 2HTFA 4ZJPA 2Y3IA 4RV5A 2G1UA 1IOLA 4KZKA 3DB2A 2JHPA 1Z88A 2JFWA 3GLUA 1G60A 4E11A 1ZGJA 1ECCA 2YS7A 1VOTA 4HYYA 3X2FA 3IBGA 3PTAA 1T5OA 3BWCA 4L8LA 3DHNA 1G2IA 4HVTA 4DUZH 1IZZA 3BUSA 4ER0A 5KVQA 3RF6A 1U7ZA 1U98A 1T5TA 2WTBA 1XOIA 1MO4A 2YDYA 3RRBA 2AX3A 2BHRA 2WP0A 2GOYA 4RTMA 1MP0A 3PRKE 4ED2A 1DE0A 3EQZA 3QLVC 5FYDA 3N6XA 4C3UA 3OCUA 4ZGBA 3RSGA 1GPLA 4LFAB 4AFNA 1O96B 2WJIA 1R0BA 4RZXA 1O1YA 5CIQA 4YT4A 5HJ7A 1UBHS 2B99A 5CLJA 3W9BA 1KAGA 1FJ2A 5I9IA 1O4WA 3EVNA 4CM1A 1IONA 3K5PA 5JOQA 1VHDA 5MN4A 4AICA 3FI9A 3S6JA 4BFSA 1S9DA 3MR3A 2VQFH 1C8KA 2VDQB 3FN4A 1ZMXA 3CYFA 5IVKA 4AYBE 3RVRA 3UM9A 4Z9BA 3ELWA 2C4MA 4QSMA 3CZPA 1ZWKA 3ZGVA 1IZ8A 4B2PA 4DPKA 4XGKA 3PW0A 4MUNA 4FSHA 4NU5A 5TSDA 4XLTA 5C3UA 3OQNA 4G97A 4O5OA 1JDBC 4HLCA 1DL5A 3TRDA 1FYDA 1V9CA 2EWVA 1B0AA 4UPVA 4NSNA 5EA2A 4OAPA 4HTFB 4OQNA 5T6MA 4M8SA 1LFDB 4ECYA 4C2MA 1E0DA 4GH5A 2GETA 2H4WA 4ETWA 3I9FA 5CFMA 1SVUA 3URKA 3VR1A 5DQGA 1UBSB 1EVJA 2IH5A 4OAOA 4LSXA 1VG1A 5I9TA 1KK3A 1J2JA 3MJFA 5D85A 3R3UA 1P2VA 4Y6LA 1BE1A 3W1BA 2QBYA 1W76A 1FDUA 3JRWA 1U2RA 4RKQA 4BCCA 4Q9KA 3AERB 3GRZA 4AJ2A 3KDAA 3T1NA 4TKVA 1YRLA 3OZIA 4S1PA 3V8BA 2IW1A 5IVDA 2YXPX 3L8YA 4NCIA 3CLKA 4QGFA 3COZA 2ZSEA 4HY3A 2IYNA 1TVKA 4WLNA 4Y2RA 3AY7A 5G0SA 2LPMA 1PQ4A 4HDRA 3D2LA 3DOEA 1CWUA 4ZU3A 2C2RA 3PFGA 1FLAA 3WL5A 3IP9A 4DJJA 3COPA 2OBMA 3IEIA 5IEBA 1QQAA 1QR6A 5C1OA 5JRJA 2Q2UA 3IIIA 4I7EA 1U3WA 2JFGA 3KXIA 3BIFA 1J1UA 4LVOA 2VJMB 1L5SA 3OKCA 4FX2A 3K31A 3D7RA 3DP9A 2I1WA 5KVVA 3DYIA 1EE2A 1UQRA 3FF4A 4B74A 1QS0A 3U31A 5K3DA 1GRQA 1NYRA 3WDMA 1CY4A 1E3QA 2CW7A 1P62B 4OAQA 2EKZA 3SXJA 1VKNA 2ODPA 1IHYA 3KJXA 3FZGA 3A4VA 4CHIA 1SHKA 4Q7QA 3JQ8A 1G2WA 2OLKA 5I5EA 1Z16A 4LRWA 1N9GB 3H1BA 4WECA 3OCWA 4D9HA 3RU7A 3TOVA 5CIYA 3CLTC 3ZV3A 1XZMA 1T25A 3MUNA 4UARA 4W9NC 5JLJA 3B7PA 1MJNA 2VNKA 2WPDD 1IDN1 3VU3A 2LD4A 4CMDA 5C5CA 1S7GA 3T5JA 3ENVA 1EFAA 3H6GA 3D2CA 2HJWA 2R7NA 5JSYA 5HBRB 2DH6A 1T36A 1ZIXA 2W8BB 1UDWA 4FEYA 4QHYA 2PRJA 2BD0A 3BXGA 4OFXA 3VBEA 4DV0H 3PE4A 3WNBA 2PKQP 2G4VA 1XI2A 4M7WA 1OGJA 1KUTA 1G2OA 1CUZA 3S2YA 1EWVA 1QIHA 3KALA 4Q4AA 4CIYA 3LXUX 3L4BA 4WK6A 1FP6A 2VNJA 3K5HA 1Z6TA 2O0MA 3OTQA 3HDGA 1E3TA 4IXWA 4JQCA 3DAHA 2W71A 4LE2A 3ZWNA 4CM4A 4YCJA 4MQMA 4EQ6A 3GQCA 1FE8A 4BZXA 2O3QA 1V16A 1HYBA 1M8JA 1ZM9A 3U4GA 3USZA 4WXRA 5BRJA 1E9CA 1NW7A 1PZMA 4PSDA 4BX3A 2LBPA 1U7HA 1SVMA 3M83A 2XMSA 3WFZA 3ILHA 5HX7A 2QSJA 2VP2A 1YH3A 2VJAA 3NJRA 3L0OA 2EL9A 4LE0A 4MR9A 3DYVA 2COIA 3GTOA 3CRVA 2V9ZA 4PTLA 2IX3A 2VXCA 4N3AA 3IQZA 3OBIA 2O50A 4BQEA 4CIBA 4C07A 2QW8A 4QOSA 5BWWA 3HOYG 3BGOS 2IWHA 2G83A 3U4QA 5D1OA 5TQ0B 2JGFA 1TOAA 5CE8A 1EK1A 1E2FA 1PGJA 4EUFA 2PK3A 1QE5A 1UC4B 3UAYA 4NDZA 1JKXA 2BBSA 3N39C 1DX9A 2GEFA 1Y3IA 4ZC8A 3UK7A 4QT4A 5C18A 3HTXA 2GN8A 1OE0A 2X5XA 1AZWA 1VMAA 3CSWA 1MFPA 2F62A 4CR7A 3VYSB 1YQ9A 3DCJA 3VC1A 3D43A 4MV4A 1G63A 4RE5A 3GLFB 1XG5A 3CT6A 3EG9B 3RU3A 3QMPA 3MC1A 2VHWA 2XGMA 3I6YA 2DETA 2ZUWA 1GY8A 3IG0A 2G5GX 1XGKA 2FPOA 4NCHA 2P90A 4UHBA 3DFZA 4KO3S 4PO9A 4E13A 2O19A 2H2IA 2OFFA 2WE6A 1Y8QA 3TNFA 4IHAA 2B4KA 1OLOA 1J2YA 3DPSA 1JPUA 4C6TB 3NWPA 5B7QA 4NCNA 3WO0A 2W22A 2Z9DA 1KK0A 3CWCA 4BMVA 1QO9A 4AUMA 3GCXA 2YV2A 4M98A 3ROPA 4DREA 3T5HA 1VPWA 3A3OA 2AJCA 4U0KA 5IJZA 4CE5A 2Q0XA 3L5KA 2GEBA 4GWLA 4YMSA 1XVIA 5B4VA 1FRFS 4EMSA 3G2HA 1IVSA 4F2WA 1XKQA 3MSCA 4D0SA 1P31A 2GNPA 1PSZA 2RGNC 3U26A 2IHVA 5PNTA 4BC0A 3PKIA 1NT4A 1A3CA 4NZ9A 3STUA 1A9XA 1HR0B 4CMJA 4OHPA 4OQXA 3I4LA 1M2KA 3HNRA 5BMVF 4RSMA 3BF8A 4ESHA 1ZH0A 3B85A 1V5EA 4JLJA 4KQ2A 2JLXA 2B8NA 1VL1A 3UIEA 4PLGA 1IH8A 2PX3A 3RSLA 4QC2A 5FEMA 2Z08A 1EQAA 2BGIA 3H87A 1NUSA 2D5BA 1RYNA 2OBBA 3AMVA 2PSDA 4CMIB 4QIHA 4O1MA 5E25A 3L0BA 1T8WA 1RJRA 2PL5A 4EATA 1ZD3A 3IBTA 3ZE8A 1F2VA 3ZU2A 2OFPA 1EXMA 3L6UA 2UXDB 3H3FA 4EIWA 3AVQA 3UATA 5DHPA 1NFFA 4HNRA 4IGIA 3PC2A 4EKEA 2AMLA 3IQHX 3PQFA 4MCIA 4D26A 1PYDA 1S2LA 1M1YB 1RLTA 3VH2A 2CXOA 1K92A 4QPDA 1N2JA 4EK9A 1DIBA 1W36B 1GP2A 2IYYA 2X58A 3FTDA 3AR2A 4KHZA 4JENA 3NS7A 1QHGA 4NS4A 4M0CA 1GOTA 1K6EA 1R9JA 1C8VB 1NRJB 4YVFA 4F85A 2WHQA 1JEYA 3JSXA 1XZIA 3MCTA 1BMTA 2JPDA 3C3MA 4YI3A 4XRGA 1YONA 4Y18A 3VR4D 3FXAA 3A32A 5HS6A 4LY0A 1XA4A 1V47A 4B6OA 3U4CA 2OV2A 3TEMA 2QP9X 1ABEA 4Q1VA 3QE0A 3O47A 1N78A 4DT1B 1K7SN 2XDYA 2QN9A 2R85A 5KZMB 1R4ZA 1FP4B 2VZ9A 3DE3X 3ZE1B 2G04A 1G64A 4G0MA 3R0QA 2Y1WA 3ES9A 4MW1A 3ACDA 4OLJA 4RF2A 5F9FA 5BWCA 4S24A 2JLAA 2GN0A 4G41A 5G4KB 3ZLUA 2JFUA 2Q3JA 3RC7A 1DIHA 2BGLA 1P9RA 4MQ5A 1MQAA 1QUEA 1RHRA 1CUFA 3HWWA 2XUJA 2RIPA 1KS9A 2NP6A 5BSVA 4GX1A 3ZHTA 3GLTA 1SEPA 1HYGA 4E51A 1YB4A 3E7DA 4O4LF 3C98A 1OXTA 1LBIA 3RUEA 1M6NA 1ICEA 1BN7A 1E99A 3A9TA 3H99A 2AXNA 5PGMA 2PUTA 3QVUA 4JNCA 4XR9A 2W4IA 3EEYA 3DZGA 3ZIAD 4RKEA 4IO0A 1FRVA 5ESRA 4P93A 4R84A 2YIVX 1BHJA 3JS5A 2GAOA 3VO8A 4ZT5A 2HJSA 4Y98A 4O3FA 4EZEA 3CUUA 1GVHA 2EBHX 2REBA 3ACCA 5JS6A 1WEKA 1JG6A 2C2BA 1VPVA 1SU6A 3GA0A 4A3JG 1BW9B 1J8VA 3W6OA 3W6ZA 1X1BA 3B3AA 5FR1A 2Q5OA 1GL9B 4L4ZA 4NTZA 3COJA 4B4WA 1FTNA 2Q45A 5L3QA 1E2QA 1TM1E 3BMOA 2BP7A 3NYWA 4CKEA 3IP3A 1UJNA 4L08A 1KC1A 1QCCA 3GY0A 3R0ZA 4MS3B 1DV1A 1LWOA 4D8VA 1XKXA 1DCFA 3GPCA 4UE2A 3IOEA 2QN7A 4Q3EA 3VR4A 4PBTA 1G5PA 4AMVA 1CYDA 1OKKD 1GVNB 3KYHC 2H00A 3DW1X 4WK2B 5DWVA 1G8HA 1WD7A 1L9KA 2JI4A 3D7SA 5AJXA 3DR5A 3N2EA 1JDEA 4G0NA 1X7ZA 3PSHA 5K03A 3FOAA 4RLHA 1G6HA 4YHHH 2A57A 2CDRA 5AH0A 4RFSA 2RGUA 4CMHA 4L5JA 3O4VA 1YRYE 1P39A 4AY5A 4R81A 4D74A 4WNCA 5JE8A 4X8HA 4OI0A 2EX0A 4C0QC 3PEWA 2Q4RA 3RR2A 2YHUA 2V7QD 3HYTA 3V8RA 1FBTA 4A8JA 2FPMA 2PUVA 5K2OA 3KHRA 4QXOA 3R74A 3EGVA 4E4TA 4PBSA 3GQVA 2OCDA 4P3NA 3PX7A 2EGGA 1O6FA 4OHVA 4JC4A 1AKEA 3U09A 3R8XA 4NCBA 3CRMA 5EGNA 1RJ9A 3LA6A 4LXYA 4WCVA 1RWBA 2M6KA 3CR7A 3G17A 2GFIA 5KT7A 4P8RA 2AOUB 4EYIB 1DQPA 1IY2A 3IA2A 1DJOA 3PWSA 2R96A 4BQRA 3KD3A 2ZUVA 1I1MA 4J9NA 4MRMB 2YXNA 4CQJA 3I1YA 3KHSA 5F64A 2AV6A 4TUYA 1L0BA 4GAEA 3ZIAA 2Q41A 1DNPA 2A67A 3BTSA 1JVBA 2WLTA 3UH1A 3IUNA 3QMVA 4AJ4A 3QXJA 1ZIYA 4KFSA 2G6BA 1TFUA 5C7OO 4C21A 4YXWD 1W4BA 4QDZA 4G8DA 2CFTA 4WX2B 4G0WA 2GD6A 3PWZA 4EB6B 4PQEA 1A8UA 3C6YA 1Z5ZA 1RHJA 3TEKA 5IMSA 5JPDA 4Q1FA 4P92A 1HNXH 4TQAA 1VG9B 3NBZB 1GNSA 1V8PA 2YH2A 4TVSA 5B7PA 2QL9A 3ZH2A 4JBIA 4AY4A 4QU0A 2AJBA 1EB9A 3ANYB 1FS4A 1O54A 4B6SA 3QXXA 4G63A 2Y6UA 2H2DA 1HFKA 1ECGA 1Q44A 4IIGA 4UQLA 1T26A 1OKKA 2A3NA 2X76A 5JEEA 3DBVO 3PHLA 1TMYA 1Y8CA 4BMXA 5DT2A 4X3CA 1X1CA 5HJEA 3WDKA 1ZQ9A 1FTYA 2DAPA 4WE3A 4M8LA 2OYRA 1HNWH 1Z4PX 2ZSJA 3FMFA 5HIAA 3S81A 4EHKA 4YJGB 3OA0A 3DUFB 2CYAA 1GILA 3V00A 1MIHA 2V7QA 1WS6A 1E4GT 8MHTA 4Q3KA 3BH7A 2ZYIA 3P9PA 2CFCA 2L0XA 4FOLA 3CVOA 4FFOA 5LQAA 3N43B 3K53A 2Q49A 3GLRA 1PG0A 1HF3A 3CRNA 4MLZA 2ZI5A 4MA5A 1QHXA 1TQDA 2A9JA 1R6AA 2WAYA 4ZK6A 4D45A 5C46F 5THKA 1DU4A 4K8RB 4W9RA 3FJ1A 3CURA 4HAWA 5BSFA 3IHLA 2ZLBA 1CUEA 5JS7A 1W4LA 4ZCRA 2G5CA 1JNXX 2EDAA 2QWXA 3WWIA 2Q5QA 4RU1A 4BB5A 4YXWA 4EX7A 4C2TA 3LXMA 4NE9A 2GYWA 5DGDA 4HLUC 1DV2A 1SZCA 1BMDA 4BWFB 1UK9A 3T9CA 1MH9A 3TFOA 1X8LA 3T9EA 3T94A 3WRVA 3GVIA 5F2EA 4ALIA 1A1VA 1BU8A 4F5DA 5EJ6A 1JVSA 4DF3A 1WBBA 3HJNA 4IKEA 4EBBA 5K3AA 3D4OA 5IYZB 1HY3A 1C9KA 5JXWA 3L93A 5KVAA 5A2QW 1Z0IA 1I2ZA 2JIPA 3IHKA 5FBQB 5BSGA 2WM9B 1A4XA 2FEPA 4O2AB 1Q1EA 2A5DA 4BDTA 3ADPA 5DGTA 3CZCA 5EJEA 3HCFA 1GYPA 4GR9A 1T34A 2IYSA 3HRIA 1W36C 2CGEA 4JWKA 1ISJA 2TMKA 2ZG6A 4S1NA 3TIIA 3UPDA 5KT5A 1R3UA 4LMRA 3S2UA 3O4HA 4HGYA 2VBFA 4RULA 4R0VA 2ZE6A 3MPOA 4QJFA 4Q8EA 3UJ7A 4HWGA 3HM2A 1G8AA 2VA9A 1RK6A 3AIMA 2X2PA 3PC7A 4PGMA 5MDHA 4XAQA 5JC1A 1NBME 3TOXA 1A9RA 3QX8A 1F3OA 5L95A 2QV7A 1VJDA 3M0EA 1FP1D 2ZVPX 2XUPA 3J80A 3PQ4A 2X7HA 3WNDA 4RQAA 2I33A 1LC0A 1ZAUA 2I3AA 2YCLA 3V4RA 2HMTA 1G8KA 1QNLA 3PKJA 3V1MA 4J6FA 1B6SA 1EESA 2H7XA 3S2ZA 2BF7A 3WYFA 4IR7A 3ZY4A 3KAJA 1P9OA 2PS3A 3MCVA 1IRXA 1Y81A 3L1KA 4OJNA 3WTBA 4TGLA 4IHJF 1R0ZA 2JLYA 1YR3A 4I66A 4MJXA 4KFTA 2HGXA 2A84A 1XE3A 2BEVB 4CLOB 3VVCA 5DMHA 3ILSA 3BSSA 3RODA 5DNYB 4DLYA 5TV2A 2ZIZA 4D3SA 4P4GA 1SFRA 1Z12A 3DLHA 1MJGA 3V8EA 4ZALA 2ZAMA 1P2DA 3WB1A 4RTOA 1KJ8A 1NI4A 2VO1A 4W6QA 2IPMA 1XZHA 2EU8A 1AN7A 5HF9A 5DTRA 1G1MA 3K7EA 4W8OA 4LXUA 1LX6A 3GJTA 3LP8A 4O2LA 3H1AA 3SYLA 5B6JA 1XU7A 3GGCA 1GN9A 4AF7A 2FE1A 1KI6A 1E3SA 4LRTB 4G3IA 3TTVA 2QRVA 8ATCA 4YUAA 1CUVA 5CA0B 1X6VA 3KJQA 4NMWA 3U60B 1RJDA 2OZLB 2VJCA 3KB1A 3AF0A 2M1XA 2ZBVA 2Q1UA 3GFTA 5TGDA 5CVUA 4LFBH 3CXUA 2I55A 1DQYA 1WRVA 2EFYA 2REQA 4J9MA 1PU2A 1KE2A 4NPAA 4GU5A 1XDDA 2EWMA 1W5TA 1L8QA 4KWTA 5JQWA 5KHAA 3SVLA 2ZAIA 3PGA1 5JDIC 5AVZA 3BWXA 4X1YA 2IBMA 3O9ZA 3ZHZA 1OZFA 2KSQA 3DDWA 2OZKA 2XR1A 2W37A 4COOA 3L1IA 4EFKA 4R3WA 5B36A 4BNXA 3V8PA 2H2FA 4ZZ1A 4YX9A 4PHCA 5TMDA 4RJLA 2L18A 4RKRA 1BKDR 1KC7A 2XBLA 2ESRA 4RGVA 3D8RA 4JKYA 2XIGA 3C3BA 3EPLA 3HOXG 2XI4A 4ZEOA 1NRIA 3B6IA 2ASLA 3I2JA 2F3QA 3CUYA 4XVRA 2R6GA 1Q50A 4I5DA 1XLWA 3ZXYA 1Z6PA 1TPYA 4BB6A 4PBRA 3A1VA 3TQ1A 3HFGA 1XA3A 3KT8A 4C29A 3F5QA 4B0OA 2M6RA 2PNFA 2CE2X 4UU0A 2VWHA 3JRNA 5L3SB 2P3OA 1YZKA 4M76B 5C4IA 4UXJA 4BIMA 4JLMA 1VBGA 1R4MA 4I4CA 5FR2A 2OL4A 1YDHA 1FNCA 1JT9A 4J1QA 3RRZA 4U3JA 4QLOA 5K6AA 1ABBA 3TLCA 3LRTA 1ZKMA 4ZQFA 1BJTA 2JIRA 4H0CA 5M3BA 4DR6H 3EG5A 5IG2A 2NO7A 3PJRA 2H4FA 2QVXX 2O8NA 1WJGA 2OBYA 2Q5CA 3VR2D 3P9NA 1B74A 3PP8A 2MSKA 1Z8NA 1VHTA 4PHFA 1J8FA 4EY7A 3G0GA 2YHAA 2OKCA 1UMBB 2FDXA 1Z83A 4L5AA 3G0IA 1LI7A 1LV8A 4DNQA 3NBZC 4Y9RA 4EDFA 1CIVA 4Q45A 2A0KA 3I8OA 4AU1A 1X7XB 1N2OA 4K9SA 4Z0PA 4MUEA 3DOCA 3IXQA 3RSQA 1AS0A 2WDPA 4JLOA 4BYGA 1RRGA 1ZGAA 4P35A 4EQZA 4PZ6A 3GLGA 4A3GG 6PFKA 1OT3A 3OT5A 2BTQB 3N7AA 4GXRA 4A1FA 4R6WA 1THGA 1X1QA 3G2NA 5BVGB 4FDUA 1OI7A 1N33B 3RRFA 3FR7A 4AK9A 1CR0A 1V96A 2PZEA 4W7IA 3TFWA 2HRBA 1WSAA 4Z4IA 5KDLA 3ZXXA 2C03A 2GBLA 1FJGB 3MWFA 1QVZA 1Z6YA 4ZGWA 2A9PA 1O8BA 1Q14A 2GZAA 4PXAA 1SXJB 3F7OA 3R5JA 5JH7B 2B7CA 2ADMA 1AKNA 5CBPB 4LMYA 3LECA 1RJEA 2CMHA 4KTVE 3ZDYB 2Z8YA 3QENA 2YIDA 2XOXA 4IG9A 1V95A 2Q1TA 1C3EA 3V4VB 3VOBA 2JASA 2UVDA 3B1JA 2NV2B 2AFHB 2K7ZA 4A3LG 4IX9A 1J8DA 3WE7A 2H2GA 4B3CA 3NJ4A 3ECSA 3ESXA 3SSMA 4RH3A 1OSNA 1NVXQ 2YC2C 4P5PA 2O20A 3W3AD 2WU3A 3UZUA 4FWIB 3TRJA 4XWOA 1C4KA 2D00A 1CUXA 2N46A 1S1MA 3HL0A 1YZLA 3C8ZA 2OZPA 3R0XA 2IHYA 2PMKA 3OP4A 2A1IA 1DADA 4DYVA 1C7JA 1K27A 1XD2A 4BFXA 1VSBA 3GJZA 4DLLA 1X7WB 3VAAA 4EVIA 2QG4A 1QQTA 5ALUA 3T7KA 2CKZB 3VR2A 3O21A 3ANSA 4BO6A 1THTA 4P5EA 4H08A 4U9IS 4KP7A 3BEOA 2R7MA 1EKXA 4DQDA 1NRXA 4ZODA 2A58A 3MAAC 4OHZA 1XZAA 2P5UA 4MV7A 1A72A 4JR1A 1ODIA 3AR4A 1QCZA 3O90A 3H2HA 3L4SO 3OKAA 1U0JA 3HUUA 2P9BA 2AT1A 2J4FA 5IJAA 2UYQA 4REMA 3YASA 5FBWB 2P27A 5E38A 2ZYUX 5F2KA 3TE6A 2VPSA 3QEMA 1O58A 3ZWAA 3KJZA 4Q4CA 5D5QA 3EOZA 2O8DB 4FFMA 1UUFA 5HKLA 2WHPA 4RLSA 1M5RA 3TIGA 2HDOA 1UP4A 5LR6A 4NICA 3DO6A 1D1TA 2D5AA 3IBFA 4EQ5A 2BZ1A 1RE0A 5DHFA 3GYBA 1DAOA 2C58A 4WJKB 2D06A 4WA8A 2W7PA 2YR0A 3KTAB 3P9ZA 4MYDA 3WI7A 4CMEA 2ID4A 4UVGA 4ODIA 4U4AA 5HIMA 3OM0A 3JASB 3HJFA 1RI1A 4UTVA 3PQCA 1ODJA 3GEBA 4D3XA 3WNCA 4MRAA 2B25A 3H8JA 1KAEA 2I2DA 1L5RA 4F3RA 4D4HA 5FLMG 4KVGA 5K05A 4IGAA 2ONKA 1AGYA 2VC2B 2W2TA 4CLRA 3W3AA 2FH5B 4B84A 2UVRA 3BK2A 2VPQA 2F00A 1B8OA 2V9CA 2GVZC 2PZJA 1U9JA 5AKEA 4EW6A 5MHTA 1E2NA 2XOKD 3TEFA 4EARA 5KKCA 2OYCA 3I4FA 2DY1A 2Q0HA 2AUNA 2J4DA 3E5NA 4OSPA 2QY9A 3HA2A 4RJIA 4L50A 3DLIA 1SKAA 4O2BB 3QP9A 1WL8A 4YP3A 2WRZA 4PLVA 4QUBA 4LZJA 4R2IA 5REQA 1RXYA 1L2TA 4I1YA 1UKCA 1SC9A 2BI4A 3KWMA 1LPAB 1JHAA 2ZJ3A 2C9OA 2HXGA 4O2RA 1ADCA 1FDIA 2N75A 1OC2A 1ZLYA 4O33A 5K3FB 1CJBA 1L4NA 2AC7A 3FMIA 5FBLB 3L7IA 4BJ1A 3IAHA 2JGLA 1VL5A 2AN3A 4IAJA 1Z4NA 3OZAA 4EG1A 3SWWA 4V2UA 1K7CA 2Q7OE 1RXSA 4JI8B 3EAGA 1ZCAA 3WBJA 4JVLA 4V0RA 5GZ1A 5TQ2B 2I2XB 3M9LA 4WVFA 1E3DA 3T54A 3QZUA 4UCOA 4DC0A 3EBOA 1JP7A 2QA5A 2QVZX 4S12A 2NYUA 3OLXA 5C1BA 1U3GA 2FRDA 1U9IA 3OVMA 4ZOCA 4G0ZA 4PSAA 4GZMA 1L5HA 1JIVA 4FC6A 3P45A 4DWJA 4XPZA 1P0QA 1GLGA 2YWGA 3RDPA 1ZMBA 4J0IA 4YCMA 4N0QA 3DBLB 2MDTA 5GM2A 1PWZA 2GEJA 2Y0EA 1J8MF 3GVCA 4JT4A 3HGTA 1QM5A 1V3UA 4NV3A 1CRWG 4DJTA 1Q6ZA 2VXYA 1XWIA 3AZQA 4RQBA 3WL3A 3ZX4A 2B1QA 1U3UA 2FFRA 3EFBA 5HEKA 5TPWA 4XOUA 1U1FA 1XA0A 3KUUA 5F7XA 3CR8A 2FDCA 4N82A 2PG3A 2CMKA 5K4HA 3LQFA 4X64B 3KSMA 1XCJA 2BUAA 1E1LA 1NWHA 2Z9BA 4IOKA 2F3RA 4TWZA 4PGHA 5LQCA 4R83A 1H85A 2ZQYA 3WHLA 4MPJA 1R00A 3Q3CA 3HH8A 3FYDA 3JWHA 3Q11A 2RAFA 3O1JC 3ZW9A 4O86A 5IT0A 2NUAB 2G5PA 2OM6A 4KQEA 1QGED 3WX0A 1JGTA 1G38A 5KSOA 4GQBA 1WLYA 2MYPA 1FLDA 3I2KA 2HBRA 3B8HA 3E48A 1N5MA 5A06A 4HLNA 3I5MA 2W2OA 3SQXA 1N2HA 4JZYA 2EJ3A 1AO3A 3L5OA 2HY7A 2FPGB 3VZQA 2O7VA 1C3JA 3HKZE 2WD9A 3IN5A 3FKIA 4IFTA 2O03A 4J0DA 4MSUA 4ZCIA 1A9ZA 3SM3A 4GZ5A 3OTGA 4EUKA 1HMPA 3HA5A 1UWVA 3ZOZA 4ZDJA 1DAEA 2CF5A 4BNUA 2GJSA 3R7WB 3LQ4A 4RY9A 3D6JA 4FFWA 3OBBA 3IUBA 3W2GA 2QP3A 5IC6A 1LTQA 2FWJA 1UC5B 2JEYA 3BE8A 3DZIA 4B3XA 2OG1A 3QE3A 3GUVA 2X5JO 4AJOA 4PX2A 1U8YA 2P11A 1JR6A 1ADGA 2V7TA 2AHRA 2WZQA 2ZXUA 4WESB 1T4CA 3DZHA 3HCRA 1IULA 4UOEA 5ANRB 5DFAA 1AGRA 3ZXIA 3GV5B 2CFOA 1TD1A 4O3NA 1Z4MA 1BXRB 1SCUA 4BU1A 1Z4OA 2AFRA 5HE8A 2COUA 2D2VA 3QPCA 4F4DA 2ZI3A 1N0UA 4O4HF 4UMEA 1II9A 1SXJC 4F92B 1ORIA 3LDFA 1QNFA 3S7TA 1B00A 1F48A 2HF2A 4LSZA 3F90A 4ZPJA 4XPIB 3K70D 1XJQA 4HRYA 2XQGA 3CJTA 2IS1A 2CKMA 1L7RA 1IQ0A 2CVFA 4Y2QA 3HDVA 1BE8A 3F6YA 4FYVA 1BDIA 3SKYA 4GC5A 4B79A 1PDVA 3AUTA 1ODFA 2NSLA 1L4HA 5KTRA 3P7MA 4C06A 3OZXA 1SWVA 3TRKA 3EQ9A 1IHDA 4X95A 4DLKA 1Q3TA 3E53A 2O4UX 3SR4A 4ZCSA 4J0HA 4WASA 5JC8A 1NBMD 3E03A 1NE2A 4KYTA 5KYWB 3ZH9B 3EXHB 3TG2A 3TQSA 4AZWA 1Z18A 3GG2A 3C5CA 1YZQA 1KIFA 2RCYA 4ARBA 1N34H 2NO5A 5DK6A 4OF4A 5K01A 3EDYA 4L0MA 1WXDA 2YWDA 3AOEC 4EI7A 3O1HB 1BRTA 3W4IA 2I29A 3CH6A 1SKMA 2JLRA 4QAQA 5SYNA 4KQ6A 4MV0A 2X8AA 1XEFA 3BE4A 3L7OA 1P5FA 1KDTA 2WKWA 5CH3A 1U11A 3QKIA 2P9ZA 1U0TA 2V8BA 4JUCA 1RIIA 4JI4H 1YSCA 1RBZA 3HR7A 1NZFA 3OQBA 3M4YA 1NVAA 5ESXA 1PJ3A 4N3CA 5TS2A 3ABIA 3Q72A 4K0KH 1C0IA 1MT3A 2QTZA 1TZ2A 2A0UA 5CD1A 1YHZA 1R15A 3WGQA 5ALZA 3HKDB 1TIPA 4AIRA 3I83A 3CB4A 3DO5A 4CNQA 4N0DA 1NASA 5BQ3A 3BHIA 2AKAB 3EDQA 1NT2A 5HKKD 4DDHA 2G70A 2RONA 3SD7A 1BWQA 5K1ZA 2XKAA 3AGQA 3RVDA 2LW7A 5F73A 5LLDA 3AUXA 2YMQA 2XX3A 3RB6A 2VA3A 2CZQA 3N2YA 1HI9A 4MPPA 4F2GA 2PUGA 3CGWA 2GPSA 5JJCA 4MP6A 2NXJA 1JLHA 2IZZA 3GAZA 1FDVA 4H7DA 4JIMA 2W6PA 4BNKA 1AU9A 4KBFA 4D0GA 2IVZA 3WSVA 1HO3A 1QQ5A 5KSYA 4Q8FA 1LEHA 1P5RA 5DTEA 4YT2A 2HO4A 1FFXB 1ZD8A 1DBVO 5K6RA 4PS0A 3H5IA 1A48A 5K8TA 3DDOA 4YMLA 3BBLA 2JEGA 3CT4A 2PBLA 2JGIA 2VNIA 3ASVA 4YS6A 3GN2A 4OI4A 1WKVA 1W93A 2RK6A 1NBMA 4KDRA 1KGDA 3N2ZB 1BH2A 1FXUA 3HC7A 5DCUA 1V1JA 5CDYA 3HVJA 4U2EA 3QPDA 3AI2A 1N0IA 2RGDA 4IF6A 3AFNA 2EF1A 2X4IA 1GA6A 4Z51A 5IDVA 3TW4A 2C5EA 3M1LA 2VBGA 4X66H 3AEZA 4PRZA 3IKJA 3OPQA 3N8DA 2V98A 2C61A 3T9AA 2XUFA 4CZ2A 3RVPA 2JA2A 3Q1LA 4J9SA 4ZA2A 3L82B 3MSXA 2HCTA 1VCNA 4PZ9A 1VGVA 3K09C 1ZD4A 3NM6B 1U3VA 3G9TA 2JFNA 2L19A 3LLSA 2VP0A 1Y1PA 5A1JA 4PG8A 4ZVKA 1YVUA 5IKMA 2YN2A 2C8KA 1LQ2A 1J0DA 4NEGA 2OD9A 3CBQA 4A16A 3B1WA 4EJFA 2BQRA 4IWNA 3QU4A 2FEMA 4IIFA 3MD0A 3NM4A 2Y8EA 2A59A 4XWWA 4L95C 1NU6A 1ZFNA 3MJRA 4E1VA 4N49A 3F2VA 4KXMA 2QKYA 5HKKA 1I1OA 3NUQA 4DV1H 1BS2A 1P8JA 4EYGA 5KS8A 2X9GA 3BRWD 4LAFA 2ZTHA 3C43A 3CEHA 5KG2A 4YAJB 3KSDO 3ZBPA 4PIPA 3EQ8A 4BFWA 1A2QA 4I5GA 1PT5A 4MVCA 4QUKA 2BR3A 3U1BA 4WAUA 3R6TA 2R11A 2ZWVA 4OOFA 4BLVA 3MEQA 2XTJA 1W48A 4M7PA 1Y6RA 2RKWA 4ED9A 3AJ9A 1SKUA 4H7KA 5JSQA 4DBZA 2CCKA 5AXBA 2JRCA 1ZHFA 4CL8A 1G4AE 5CB0A 5C0OE 2DHQA 4I2VA 2ZM5A 1GGHA 2GN6A 5JSZB 2V7VA 4NY1A 3UQ8A 3NUAA 2HG8A 2W6JD 1Q6YA 1XYGA 1F3LA 4RIIA 1GFWA 3ONDA 3CMCO 3DDHA 3JSLA 8OHMA 1AGXA 5KQMA 3EOBI 1GZ4A 1LUAA 4TZ0A 1E8DA 3WB2A 1HZZC 3HXOA 2GRJA 5LNK1 3WLPA 2QYTA 5JXHA 1HRKA 2IU6A 4Y2VA 1PVDA 3NNNA 1U6IA 2EJWA 4BQFA 2QLNA 3EMDA 5DVZA 1KJZA 4YA6A 5C37A 3USCS 3B2NA 3D4LA 2I6TA 2L69A 3GPIA 4WZBB 1NR1A 3LIIA 2YY6A 3KYDA 4KJXA 4FMDF 4HAIA 1U0FA 3CX7A 4CDMA 5JCJD 3GLGE 5FUVA 2VAWA 5C32A 2ZE7A 3PA8A 1LC3A 2RFLA 1VZ2A 2WG2A 1T5HX 4GPD1 2SCUB 3UYLA 1S2MA 5EXXA 5LJLA 3U0GA 1KO1A 3OZVA 4FMCB 5HRAA 4OLFA 1OBFO 5ICGA 5K5EA 3HY6A 2BGNA 4TXLA 3MYRA 5LZ9A 1KZ9A 5BWXA 2EZTA 2OCGA 2OBNA 5E8JA 1QQ6A 1LTHR 3PZRA 5AJTA 4QATA 3IGFA 3ZD9A 3F3MA 2OK7A 5J47A 5CB4B 2Y05A 4TV9B 4JWTA 1XN4A 4PAWA 2EFEB 1R5JA 3OZCA 4WFIA 2PX0A 3BRWA 3CU5A 5DGBA 2ZK7A 2O8EB 1FZTA 1H0SA 3PJDA 5BUSA 3M4XA 1CG6A 5KT2A 5D3MB 1C0KA 3CTPA 4YJ2A 1L5VA 3PN1A 3MTEA 4YBRA 2G9VA 3EBLA 1TRHA 1N6NA 3FZYA 2O54A 3DS8A 4GP6A 3ZQ6A 1XQVA 5DX8A 4JB8A 3ZWBA 2G9UA 2ZAGA 1XC7A 4B33A 2V1XA 2DMRA 3ABOB 4N9QA 2X5RA 4MUFA 1RIFA 1JZTA 3IYLW 3UH0A 4AKIA 3TTXA 5IARA 3H5RA 3BQ1A 1U7TA 4MUGA 2ZIGA 1G6OA 2EEZA 3EXEB 4ETIA 4LFAH 2OV8A 5KAPA 2ZUDA 4BEJA 3LK7A 4H16A 1AK9A 2CYBA 6CHYA 2W6JA 3QU9A 1JA9A 3A6ZA 4E5MA 1GGEA 3F8NA 3TAHA 4RETA 3W1WA 3R41A 1RQPA 1USUA 3QVGA 2YASA 5CK4A 3V7FA 2W8ZA 2W5UA 4LYJA 1P4GA 4R9UC 5ARBA 5DTJA 4K2AA 3TN7A 3C3CA 3GT7A 1Y9EA 4LX8A 3LT5A 1N5OX 3VO1A 5CFPA 5EQTA 4QTXA 5FULA 3A58B 2GESA 4Y3UA 1H23A 4FK8A 1T6BY 4QM7A 1XP5A 4M0KA 3W9YA 3P9QA 3Q7IA 5AOCA 5HNKA 4KGDA 4NXNB 1TWGA 2CHUA 5GPBA 1QANA 5JXIA 5LUAA 3KEGA 1GR1A 3SC2B 5JCJA 1R0YA 4N39A 1SUDA 3RJ9A 4RJJA 1ZC3A 2I8CA 3OPVA 1CBUA 2XB4A 3EXHC 3GWGA 4DW8A 5FPHA 1QFSA 3Q2KA 4E70A 3BD9A 4EBEA 1ZCJA 1RYHA 2J48A 4YJ3B 4YJKA 1AF4A 2ZS9A 1AQJA 3D6NB 4ED0A 1XR3A 4MO2A 3TI7A 3NOQA 4ER7A 1YA8A 1B04A 1TKRA 5ERYA 4ZOAA 1T8YA 1NQXA 3EVTA 2TYSB 2A30A 4A92A 2C9CA 3SHWA 2W11A 4Q3NA 1RLOA 2J1LA 4V0NA 4MARA 2EGHA 1E3WA 2V1UA 1M2FA 4PSCA 1OIVA 2BHNA 2J0UA 1DELA 1U0BB 4FFNA 1F2UB 3OE7A 1ZO8A 3VPXA 3DZCA 3KR1A 1T2CA 1XRJA 3VNQA 4YMTA 3ZX5A 3E9CA 1F1JA 2XA2A 1CKEA 3E27A 1ZK3A 4PTYA 3TJRA 4JR2A 3WP1B 5KSPA 5T8KA 4HDKA 1U2PA 2GVNA 5EWLA 3QKUA 1U2ZA 1GCGA 1S0OA 3EA5A 1CZLA 3D1VA 2GZ3A 5CT9A 4O7ZA 5AXAA 3FKIG 4A0GA 1JR3E 5LP6B 4R40A 2ZB4A 1W0CA 4DMHA 2ISQA 4ROTA 2AN9A 1ONBA 2C31A 3STHA 2XJ9A 1TTTA 1G7SA 1KSHA 2PMWB 3HCBA 2X0IA 3IT3A 3DBRA 4XCVA 3JQ6A 4K03A 4X92A 1J0XO 4F4XA 3AEXA 3DMFA 3HRHA 4UJ3A 4X65B 2QRJA 3GWZA 2GD2A 4DQLA 2RSLA 3PDIB 4CIDA 2GHIA 3RIHA 1JEQA 1UDRA 2NSHA 3MMSA 1KAQA 4RA6A 5KOJA 1XZLA 3HEAA 3CXRA 1KYQA 4BQNA 3IT1A 1ZSYA 3WIBA 3WGUA 1WHTA 4NFYA 4RY8A 2XPCA 3BRSA 5KFRA 3QVOA 3R5XA 1KOFA 4ZRNA 4DA8A 4TSFD 2TECE 2GD1O 2GBPA 4HXFB 1YFZA 3PYMA 2QENA 3KRTA 2OHOA 2IXEA 3R5HA 1NONA 2H65A 3EGOA 2IV3A 3NHBA 2LDBA 4GC6A 5CT8A 2H7YA 1M10A 1Z13A 2IOYA 4C89A 2BW0A 3R9RA 2OORA 4TV8F 3BH6A 1GITA 2MOKA 4Q02A 5IYBG 2W9CB 2REOA 3E9RA 5AHWA 2AK2A 4EYHB 4HNGA 2IYXA 4L0CA 3WA7A 3ONWA 3VOSA 4F1JA 4DIMA 4GZ6A 4CUKA 5C1IA 3IV9A 4YNBA 3AL0C 1CKNA 3U9SA 4LGVA 1CR4A 1KZ6A 2BR4A 4ITUA 2QTWB 4K6NA 1K3UB 5M34A 5DLEA 3CB2A 5TJHA 1H1LA 4UOZA 1Z35A 2PIAA 5AM0A 4BECA 4UQOA 2HGSA 2XGPA 2FZGA 5KQPA 1SUWA 3HKEA 2XCQA 3RWOA 4EHLA 4U2GA 4B87A 4D4LA 1LLCA 4JNKA 3PWTA 4JSTA 1UFOA 3M9NB 3T34A 1RK5A 3GCZA 1SZDA 1SOMA 1U63A 1JAYA 1JX4A 4KXYA 5K99A 3ISTA 3MWKA 2HQBA 1BGWA 1KMHA 1T9CA 2YIJA 4DL6A 1HH4A 3QOXA 4UXIA 6YASA 1MZVA 2IUYA 4DDTA 4XZ3A 2JEIA 4DLBA 5DGCA 4HYKA 4ZOLB 1UFQA 2OZVA 2A2ZA 3MB8A 4A0RA 2H31A 1NXXA 3ELUA 3IJPA 2VAPA 1FTGA 4CRWB 4BRZA 4TSFA 2CL7X 1L7EA 4UTXA 3UMVA 2VJLA 4NNJA 3RBVA 4IFBA 5EZ6B 4DDMA 4PQGA 4JC0A 4MIYA 1M1ZA 3ZJUA 1V39A 3NUGA 1QPGA 4EB0A 1DC7A 2BRUA 2J3QA 4ESEA 1XEWX 4FFVA 2IPAB 3SK0A 3K3VA 1CUAA 1V4VA 2KB0A 4N8SA 1DZIA 2IP2A 2FDRA 1O97C 2YHIB 2QN3A 3ER6A 3PC3A 1ZJWA 1QAMA 5B1DA 3T3HA 2Q4DA 1LBQA 5HCNA 5ELXA 3I9NA 1OZAA 3Q8MA 2G25A 3CIOA 3IC5A 2HMYB 5EE1A 3UK1A 2H8KA 5LD2B 2DY0A 4LYAA 1CJUC 1F7VA 1EVIA 4DLWA 3ZU6A 4MPTA 2QBYB 1W2WB 5H82A 5CM2Z 1R9NA 1WPXA 3EVGA 2WF9A 3CR3C 3FNRA 2VAVA 3NYQA 2DHRA 4GSKA 4TKVB 4BC1A 4RMIA 1R6XA 1R0RE 1JWAB 3HXKA 1HR0H 4K40A 1KPIA 2WC1A 4BLPA 3R8FA 5J3JA 1TVKB 3I04M 5KNBD 3UENA 4LHZA 1SJ9A 3MMPA 1BFDA 4UHFA 4MVJH 3HKZA 2P40A 1PK7A 3GGPA 1NVEA 3PL5A 2HRDA 5EP2A 2C2KA 2PLFA 3U7EB 4PG6A 5I48A 3UVEA 4M22A 5JD3A 4R2MA 3TQFA 1CUJA 1WMDA 1UBRS 1NA5A 3ANLA 1X80A 2XCOA 3GEGA 4Y1EA 3GIDA 3BX1A 1QS0B 4LOLA 4FYPA 4Z8XA 1LDNA 3VOTA 3FZEA 3MB5A 5F21A 2EW8A 4A2BA 3BICA 1GQOA 1XZBA 2DFKB 2UXDH 6GPBA 5J2TA 1ZOSA 1TRKA 1MHPA 1OBCA 1P3Y1 4C08A 4AY6A 3OU6A 4QVKA 3KE8A 3KWJA 5K0FA 4QXPA 1SXIA 3JQ8B 5EZYA 5JECA 1JEJA 3ENWA 1ZA1A 3ETHA 1Y6JA 4CDRA 2GXAA 4Z8YA 4PO3X 3E6AA 4N0EA 2N42A 4V1CA 3OPMA 5F3DA 3WLHA 2WNHA 4TTSA 5FAXA 4M9RA 1H0KA 1TA0A 4MWDA 1ML4A 4YMWA 2FP4A 4DIOA 3TLKA 2WKRA 3JQ9A 5I4CA 2PX6A 5GJBA 3EULA 2R8JA 2V8OA 4TS9A 2VRNA 3ZJ5A 3CZAA 1JRLA 1U0HC 2Q21A 3JQ7A 5HUJA 3OX4A 4FXPA 2J5BA 4KPFC 5AYVA 1CF9A 2N47A 4PPFA 1JAHA 4DLTA 4K28A 1R3DA 7REQA 1DCTA 1UXKA 4Q4AB 3BCRA 1RRVA 5IM5A 1A82A 3C24A 4BO8A 1B8PA 5H1YA 2VPWA 3I9OA 4QYIA 1DXHA 1VBFA 4EQ6B 3IXLA 4MROA 2O0JA 4ES6A 4CUZA 1H2BA 5HG0A 4CL3A 1H3FA 5KNBA 5AKYA 1GNTA 2ZYWX 3FGPA 3QHAA 4LJSA 5JBQA 1OA0A 3W1GA 4RK1A 4BO4A 4EI2A 1EK6A 2QLFA 4YR7A 3IEKA 4NMMA 4PEVA 4KKXB 3BJMA 1WMFA 1CJVC 1NNI1 2WA1A 4MR9B 3N58A 4RB2C 2DLCX 4H6WA 1Y48E 1C7IA 1ORTA 3OF3A 4YHBA 3U37A 3T3DA 3OOWA 1O89A 3N2LA 1TW3A 1D7OA 4O1HA 4FM9A 4O59O 4L4UA 4EWLA 1ADBA 2KPOA 4R8MA 5EWMB 3U4QB 2PGIA 5IC4A 2JS7A 5IT5A 3H4VA 1G7RA 2XYPA 4HB4A 5IDXA 3JPYA 5LP6C 4M89A 2V7EA 1N5JA 2VJNA 3NEYA 1C9NA 4XWTA 4TMYA 4KVAA 3SBOA 3UWMA 7MDHA 4Q4DA 3UHOA 1QIDA 3BYZA 3SZUA 1YBMA 2AG5A 3RU9A 1UAYA 5CAEB 2X0NA 4K9KA 4QE3A 1GZ3A 2Q9CA 1KEVA 5E3IA 1UFVA 4ZI2A 4DB2A 4EEQA 5ENDA 1W5FA 2PRKA 4BP9A 4D4GA 3V8NA 4IEIA 2IZOA 4MR8A 1JB1A 1A1SA 2D0PB 1KGSA 4LVCA 3L0ZA 2ILVA 3L7NA 3F98A 1W49A 4QPJC 1DBRA 3L06A 2ZRNA 2X5KO 3AETB 3U19A 1YS4A 4FKMA 5BR8B 2D5CA 4R2LA 3FDXA 3PQ3A 2C7RA 3R5SA 4OA8A 1NVWQ 5E6SA 5ITZA 1RWQA 4WV3A 4G23A 4CTNA 1ZUNA 1KQOA 2I67A 2I80A 3RC3A 1E2PA 3FMVA 2XRYA 1XRPA 5JS2A 3RYHA 2PSJA 4Y2XA 4YRMA 4QZVA 2ZR9A 2VDKB 1J8QA 1XLUA 1S96A 2D1FA 4I4IA 1JKIA 1ZK1A 3C6ZA 1THMA 1KH1A 2B2NA 4J16C 1N1EA 3BRCA 5LQDA 3JQEA 5JWHA 4N5IX 1XRQA 3FBTA 3KHTA 2P69A 3SQLA 3G13A 1JMVA 1U9CA 5CX1A 2IU3A 1IG3A 5I4KA 1A9XB 2CHQA 3K9FC 5AP9A 1CDZA 2B1GA 3G7NA 1DFIA 1QB8A 2O4CA 3JD4A 3HJHA 3L1JA 1SVIA 3O7WA 4E7OA 3COVA 5FV7A 4L02A 1LLQA 4ETMA 1XROA 3AEUA 4K9PA 4YAFA 1QX4A 1NX9A 1P1IA 1XIVA 1E1RD 4RUAA 4RPJA 1GNPA 5IK2D 4LJ8A 4TWBA 4PSVA 1UBKS 1GUDA 3E0XA 3I1FA 5B4TA 4BN5A 2ZFUA 3RV4A 1HFEL 3CJQA 2I6QA 3HVHA 1AGPA 1T3ZA 5ICEA 4LA4A 4KO8A 4OKNA 1ORRA 4V0MA 4K8OA 2NPOA 1EM8A 3K15A 1T5DX 4ER5A 2IITA 5HQ3A 3R0VA 5AK4A 1Q0HA 5ER6A 5FD6A 3O2NA 1UBOS 4KK3A 3SFVA 4PG4A 3U4HA 3GZNA 1X7DA 2CXQA 3ZDQA 3T38A 4FIDA 5KYTA 4DLNA 4QOGA 1KYVA 4YR0A 1TAEA 4OXQA 4D81A 2HHHB 1TLTA 3OMXA 3IUJA 1QPZA 3EZ2A 4KXFB 5CVEA 1L1QA 2FZEA 4K26A 1CS0A 4F4ZA 3EDOA 2ZPAA 2HCBA 3FBGA 2HVSA 3C7DB 4Z0TA 1MU0A 3QFSA 4QFDA 3Q8LA 4CEJB 1GAJA 2JK1A 3DHYA 1E6LA 5C44G 2UYOA 3W7BA 3PZBA 4ZICA 2NTEA 3A1CA 3JAWA 2FZ4A 4BB9A 1HDZA 2HVQA 3WC4A 1WU7A 1EE1A 2ECFA 3JATB 1WCIA 4M37A 4B31A 4MV8A 4RHCA 3ZHYA 3NHMA 2R87A 2WTFA 1CEYA 4GM1A 2LDXA 1YXMA 4I4TA 4JLAA 4YCBA 2ZYHA 3PD1A 4HVAA 3DVAA 1V43A 5DNDA 2XD4A 4ZI3A 2FU5C 1HV8A 2IS6A 1GTL1 1EGAA 5CDHA 4PQYA 3Q15C 1XALA 4EL0A 4RDXA 3H9EO 5C5IA 2QUAA 3W8DA 1DEOA 2YY5A 4CM7A 3N2KA 5LD2C 4DGSA 4IZIA 1ZPDA 1ZRNA 2RARA 3C4VA 3OJ0A 2NUTB 4QLBA 4UU8A 3FDZB 3EC7A 2C7OA 1CULC 1DTSA 2GTIA 4DNPA 1E1RA 3OZWA 1HTTA 2ZWMA 5IK2A 3A0UA 5DQHA 2NTJA 1I10A 1H3EA 2GQRA 5AW7A 1T9AA 2HV9A 2CF6A 4U8HA 2H29A 1QTRA 4PANA 1KMQA 5FPKA 2FUKA 2CUZA 2WU1A 3LG2A 5TB5A 2XVXA 2EL7A 2NVXA 1H2YA 3NIFB 1XQWA 3GT4A 5KB3A 3DCYA 3HCNA 3V4SA 2AQHA 3HNPA 1Y4DE 1USWA 1KR5A 3LZ6A 4A3FG 5DNCA 4ER3A 3N40P 1NBEA 4Z1OA 3BJYA 2OTCA 3JVEA 1QGYA 4RZQA 4MWSA 2QRNA 1OAKA 5E8RA 3VNRA 3L1HA 1V3TA 1FFDA 4D02A 3A3PA 2Z2KA 1AD2A 3P0RA 2BJHA 3CKLA 2RK4A 1HE1C 5SY4A 4EUEA 3R6LA 4E08A 4JCCA 1X15A 1JDTA 3GFPA 4HYTA 5A3RA 3EA4A 1KU0A 3VJRA 3SS8A 1V11A 1P91A 2XDAA 3PIDA 5K09A 2IELA 1YB6A 1BYUA 3TDMA 2CD9A 2I9PA 4QOEA 4IIJA 3OETA 5F2OA 4MDEA 2ATIA 4C88A 1JHZA 2H85A 1ZJ6A 4MB6A 3X2EA 3I37X 1E1MA 1JR3D 5HFNA 3QHQA 2ODTX 3QYFA 1FPMA 2I8LA 2QMYA 1E8NA 1GDHA 1H1TA 3BIJA 4CG1A 2Y1GA 4KITB 4QYTA 3E81A 1GTJ1 2J3MA 4HFJA 1ZHOA 1IBMB 1QIFA 3GIIA 2Y1OA 5C5EA 4BXOA 2P9YA 4KWHA 4MQFA 5A4FS 3CLRD 1ESEA 1WSCA 2B0JA 4GPEA 3LFHA 5JS1A 2HFJA 4QW9A 3UXYA 4D3DA 1XT6A 421PA 5COBA 3QXSA 3J81W 5IW8A 2UUAB 3II6X 4LG1A 3SEZA 1LQUA 5FD8A 4IDAA 4O4JF 1ZW6A 3WB0A 3S24A 1PS8A 4LZNA 5GTDA 4DL5A 1T15A 1HDIA 3OLYA 2ORVA 5KYXB 4TUYB 1Q0RA 2R92G 1YZUA 4XB2A 5FTNA 3T9DA 4XQGA 1U2QA 4PFKA 1XZ8A 5JVLA 3VTFA 4QUAA 1MB2A 2Y1EA 1P18A 2W2PA 4C0SA 1RM5A 3P1JA 4QXAA 3MWYW 4ZIRA 3ANNA 4NG4A 2Q0QA 4BTVA 3UUWA 3MLBA 3WZ2A 4EG6A 1EUCA 1FDWA 3PLNA 3RI3A 1JB9A 4EPYA 1ETUA 3LHDA 4PG7A 1TE2A 2Y6VA 2IY7A 1KY5A 1VLLA 4HX5A 1HDGO 1JKJA 1ZJ5A 5IZ4A 3MW8A 3UUEA 4D96A 5AHXA 4XKJA 2FPPB 1N5DA 1RI5A 1SHTX 3ZLJA 4LJ4A 2FWBA 4O3RA 2WDZA 1JR3A 3C3WA 3QJ5A 4LCBA 1CRPA 4UUPA 1SIBE 3G79A 3C16C 3KXDA 3N2GA 1T91A 4H6PA 4JVMA 4FQ5A 1UF9A 1RADA 4BBSG 3ZCTA 2ZUCA 2R9VA 3TLAA 3LWDA 5CVJA 4DABA 4FR5A 2O2HA 4US1R 2B82A 5DIZA 3DFKA 1I6KA 1BWPA 4B17A 3GNTA 1D8TA 1ZUIA 3D0KA 4M1QA 2A7QA 3IRUA 4ALLA 3TBHA 5DOVA 1POXA 1ADJA 2ZRDA 3SC4A 3WLNA 3ZU4A 1L4EA 3CNNA 3PUVA 2VOEA 4DXDA 3SCZA 4WGFA 1MO2A 3JZ6A 1P1JA 3LVRE 5EKTA 2AZDA 1BD4A 1RLMA 2E4UA 3ZZUA 4BQQA 4C2UA 1D6JA 4EDHA 1V5IA 1NVBA 4P83A 1IBKB 1NXTA 4XTCS 1MO3A 2QW0X 1COWD 3N6VA 1Y7HA 1SUSA 2E4AA 2VEDA 4BTLA 3ZZNA 3WB9A 4DJFC 3K6SA 4NVRA 3RT9A 5ALEA 4N76A 2QM3A 3LYHA 1JKMA 1O6ZA 4J0MA 3KQWA 4YRGA 5HS4A 4XCQA 2NZ2A 4OB8A 2PUDA 1Y1TA 5FNVA 2BZSA 3WWPA 4KDEA 5ARDA 3PXXA 1ZI6A 3DLTA 3VHRA 3DD1A 4BJ3A 4KWIA 1I1QB 4NESA 5LA6A 3WLJA 4LV6A 4WOJA 4X71A 3W5CA 1KJYA 3ZW7A 3SJ7A 1R0CA 1PT8A 4DBVO 1E6MA 1P0PA 3P9CA 3N28A 1JJFA 3UJNA 5IBQA 4BAGA 2QMQA 4LZWA 1R7RA 3N2NA 2FHSA 3GTPA 3A1TA 3RAFC 3SU8A 2W42A 1SHLA 3C6QA 2OC4A 4Q93A 4GLLA 2WV7A 4RTPA 3QYJA 1H94A 3N5KA 5LKAA 1IJKA 1XTIA 4GHWA 1XJWA 3PHIA 2C5GA 4RZUA 1INLA 1M5TA 1UM8A 1IJFA 4Y0AA 1CD5A 2YL2A 5DNVA 1PJSA 4ILKA 4MYHA 3QPVA 1N33H 2C2GA 3IIKA 3OIUA 1SO8A 3UMYA 2PO5A 1FYXA 3ND6A 2WWVD 3AFHA 1MQSA 4IUYA 4DNFA 4BRSA 3G2JA 2VDLB 1FJGH 2D62A 3LBHA 2K4MA 5EJMA 3ZBTA 2PQ0A 1X86B 1E7QA 1SC3A 3O8QA 2WWHA 5AVUA 1UOOA 3ANXA 1TCVA 3A2MA 4FS2A 1Y3CE 3OQVA 1YU9A 1KE1A 1NNLA 4YRZA 2X9QA 3GYGA 5C7IO 1V8FA 1YMVA 3LY5A 4HNHA 1Y0BA 5KX5B 1NMYA 3OE4A 2ZJBA 3U4IA 3MWDA 1U94A 3COSA 3TW8B 2C4UA 1KC3A 3CX6A 1COWA 5KG6A 1LY1A 1VE9A 4W1RA 4HPWA 3BGVA 4ZVOA 3AW9A 2POCA 4YMIA 2EP5A 2C4NA 2UVPB 2X40A 5H5JA 2ZVJA 2XLBA 3P2IA 5CR9A 4JC5A 5EYPA 4O3QA 4D6YA 2R8RA 1S2GA 3L0IB 1C4WA 3KXKA 3IAUA 1NI4B 3IVMA 2HF8A 5HMLA 1GT91 1X92A 3JZMA 3OICA 4NENA 1WXXA 2QT1A 2JZOA 3LC2O 3HP1A 3LI2A 1WWKA 2QMUA 5E0KB 3WISA 5F9LA 2X23A 3E4DA 4QOJA 1KI6B 2AKYA 4BUJA 5EN4A 2JIBA 2QRVB 2C99A 4Y30A 1OX4A 3U7IA 1GN8A 1K98A 4KAAA 2Y1FA 4V0QA 4QQNA 4B76A 3UB3A 4EY6A 5IT4A 5A5VA 3S1AA 4EHIA 2LVBA 2ZZNA 3OY2A 3UICA 3AL2A 1WSWA 4K88A 4DWOA 5AESA 3O3MB 1A5TA 1OCEA 4X7RA 1DXOA 4Y2UA 3CBGA 4D9NA 3ZWVA 5E9AA 3QW2A 4PC6A 1C1YA 3ET5A 4QREA 5K8CA 5C8XA 2C35B 4XOIA 4OBBA 4TWIA 2D4AA 4Q21A 4V0OA 3AEQA 1I1NA 3VAZA 4XWGA 2P75A 4EMTA 1QIGA 1AQUA 1AHHA 2EV9A 5KWIA 4A8PA 3T5CA 2PRYA 1J2UA 5F7ZA 2RC6A 4XXHA 4W5HA 1S89A 2QNBA 4KEAA 1NWCA 2OAEA 1EDOA 1BVUA 1NF9A 3RGZA 2FZKA 1RJGA 3K6KA 2JW5A 2V03A 2CLHB 2DPHA 3MILA 2WKSA 4YAGA 1ORDA 4JP1A 3GB9A 2AJTA 4FCTA 3MIIA 2FSGA 4F7WA 3ONFA 2K2WA 1U2GA 2Q1WA 1V1MA 3W34A 1W44A 2D0DA 3ETJA 2CLOB 3E2MA 4HPJB 2G1PA 5DI3B 1M1NA 2IC5A 2GM9A 3H5TA 1K5HA 2RH8A 3JX9A 2FLVA 4JBGA 4D97A 1DOAA 2VXOA 3FOCA 2RGYA 2PMCA 4K9LA 4PNZA 3UO8B 4B4VA 4IJMA 4FOSA 1ORVA 4RADA 4YWHA 2ZUBA 4Q44A 5G0WA 3DGEC 4EF4A 3MERA 5CITA 3U48A 2BH9A 2DT8A 5AW8A 4LZPA 1E1KA 2VDPB 2G3YA 2O1WA 3KZKA 4M0PA 4GLXA 5EIWA 1JVNA 1UEXC 1P7CA 2XIQA 1DGQA 1I0IA 4RXMA 2HWYA 2YFQA 2Y66A 2HQOA 5AW6A 1GLNA 2BFCB 1NQUA 3VA7A 4F3CA 4PTZA 2BMFA 4ZTUB 3MTJA 3TTTA 4P82A 3OCYA 4NOMA 4UDOA 4BBPA 4N8DA 1WXQA 1R27A 1US8B 2HM7A 3T3NA 3QXCA 1R66A 2DBZA 4XIFA 3TZ6A 1JTFA 1SXPA 3ZNNA 2BFAA 4KVZA 1OBDA 4Z3DA 2V54A 3T3EA 1QQBA 1BXGA 3H0CA 5DP1A 1C3LA 3ZQUA 4MGKR 3T7AA 1M6HA 4AQYB 1PW7A 3PIIA 1T9KA 3V6HA 3GEHA 3NBKA 3IBSA 4JI8H 3DONA 4LKOA 1AA9A 2YHBA 4WERA 1HE3A 1LLUA 2F90A 2P79A 3PCXA 1CLEA 4W8HA 1B0PA 1DT3A 2B4TO 5DBFA 1SXGA 3A9SA 1T6XA 2HSGA 3RT1A 5BQXA 2D3WA 4J0FA 4NZYA 3WHKA 4BBAA 3ZIUA 3RS9A 1S4QA 4REQA 2GZDA 3KKKA 1LBSA 1RP7A 1C0PA 2WT9A 2OLEA 3EFOB 2COGA 4H7FA 5LSAA 3QY9A 1KNXA 3FUCA 2J6IA 2I3DA 4A0SA 1OILA 2AZ4A 3ORYA 3V46A 1IUOA 2EX1A 4BQPA 2WNSA 2OQRA 3UCFA 1DC6A 2DF8A 3CPJB 2QYHA 4MWOA 4YAEA 3VYUB 3D6FA 4PR0A 5CFOA 2ACKA 1U8UA 2NAPA 2ZEJA 4V0ME 2VJKA 4YQWA 3NWBA 3CW8X 3P0IA 1YBAA 5AVWA 1QDUA 5CXQA 5JY1A 4AN1A 5I7UA 1BCRA 3SZOA 1ZINA 2BZ0A 2PR7A 2X3YA 4RXTA 1O3YA 3WRXA 1JXMA 4JVOA 1IXZA 2CEAA 4X64H 5IUJC 4MYUA 3M6LA 4ZVSA 3S0JA 1TU3A 3HJRA 4L74A 4OJMX 4EM6A 4JODA 3IE1A 5BUZA 4FEGA 2DBRA 1ZR4A 4BVKA 2DWQA 1IWOA 1QMPA 3EAFA 1LPMA 4AWAA 2CSUA 4ERNA 3EA0A 1GT6A 3I42A 3B6MA 4DA9A 4QU9A 1N1DA 3T5AA 2I2CA 2VHCA 3NH6A 5JAZA 4GC7A 1QU3A 1JHOA 4ZXFA 4FLEA 5AICA 3UHJA 5HZKA 1K8XB 3LBNA 4OXIA 2OUIA 4WUVA 2AWOA 2IIVA 3O3NB 2XZOA 4H4EA 3KR9A 2FCRA 3BXFA 2V0CA 5CB6A 2FVYA 1XMVA 1XNHA 2FWIA 2RGAA 2QUHA 3BILA 4B7AA 1CDOA 1WCXA 3GUZA 3DMYA 4CF5A 2I1VB 4YPVA 2I2AA 3R3XA 1GKLA 4KGZA 3HJTA 3NYIA 2VZ0A 2BFFA 1F51E 4I9FA 3PGJA 2V6GA 1QG0A 3P5SA 4EPXA 1VJTA 4JELA 4I3GA 1IEWA 4HQFA 2WLSA 2JARA 3ELDA 1YZHA 3AHEA 1AQIA 6REQA 3MHTA 1MC1A 2R68A 3GI1A 3NP7A 2LV8A 4MP8A 4KFUA 2WJVA 2IEIA 3ZK9A 3UHPA 1EFRD 2O8VA 5BRAA 4PHHA 1J0CA 4X54A 4ZAGA 1LS6A 1OYOA 1NM5C 3GQBB 4CODB 2WE8A 2EF0A 4FYKA 3ZS9A 3VDMA 1NDUA 3BIWA 4GPAA 1LZLA 1PNVA 1E2KA 3ZEAA 3FKSD 4D9EA 3H04A 3TQIA 4RD4A 4W1PA 1CSEE 3SEAA 1JXLA 1BXZA 4J6EA 2BTEA 2VUMG 1NBHA 1WQ4A 2O7QA 4WXMA 1CDDA 1R6BX 1ABFA 4DDUA 2EG9A 3TNYA 1FPQA 2CNOA 3NIWA 1YFJA 2H5EA 4DTIA 3C4JA 3OE7D 4FU0A 3HDJA 4GC9A 4EG8A 4F4JA 5LWHA 2QXYA 1MHTA 5CIWA 1HOXA 3STYA 3RB4A 1BJRE 1QYXA 4UFOA 2BBTA 2RKOA 1KPGA 4F21A 2FUG6 4BLOA 2XMQA 4DR4B 4PAMA 4Y9SA 4JAVC 1FXSA 5FBRB 2XGOA 4J75A 4P0QB 1C3OA 5REQB 1M7HA 2AVDA 1MUUA 4M2LA 4AW9A 4NHEA 1ACLA 3FUXA 1RHKA 1QGDA 1UBJS 4DILA 1FKAH 5BSTA 3HVRA 2XVYA 4MGHA 3TVTA 2FUCA 2WOJA 1R8YA 4TKUB 4ACBA 2H5IA 1DCMA 3K4HA 3EVZA 3RAJA 2BGTA 4ZCTA 1RACA 3OZGA 3TLGA 4WXHA 3SDSA 4II7A 3IP8A 3NHFA 2JJ1D 3THOA 4J0QA 1VSTA 2MJLA 2YWCA 4D8TA 4E5SA 3WGVA 1YA6A 3NDBB 1RM3A 2DSNA 5BQOA 4D82A 1H4VB 5KFAA 5KMGA 5JVDA 1LW7A 2OHFA 2G71A 4PINA 4NC9A 3AHFA 4PIVA 4MHOA 3NASA 3FNGA 3EODA 4KSBA 4PHTA 1JWBB 1VB5A 4UFZA 1ZIPA 2Q6VA 3TECE 3NANA 3ZD6A 3OQIA 4OMCA 5JU6A 1EFRA 1L5HB 1MAUA 3U39A 3PT5A 1MC8A 4KUGA 3QVVA 4YV7A 2RAPA 4IJVA 1T6NA 4CQNA 5EE5B 4EFNA 2GKOA 4UW9A 4JVNA 3TL2A 2GCGA 4BASA 4LSGA 4OI1A 2WTEA 5CYGA 2ZB7A 3FKSA 2IIBA 5BQPA 2FKLA 2Z30A 2PJZA 4MRPA 4Q0MA 4QXMA 2FX5A 2C7BA 1E4OA 3DMNA 3FPCA 1RFGE 2O3JA 1RRCA 3SEQA 2PKRA 2WUWE 3IHWA 5TPWB 5EIFA 2JDIA 2VHEA 1TW2A 3TKYA 4J7AA 2OD7A 1AQNA 4B44A 3RKSA 5TXGA 1F60A 3EY4A 3FGZA 2HC9A 3NXKA 4M53A