1AUVA

Structure of the c domain of synapsin ia from bovine brain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
306
structure length
292
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLINQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAKYDVRIQKIGQNYKAYMRTLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPSIN IA
publication title Synapsin I is structurally similar to ATP-utilizing enzymes.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 80
structure length 292
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1auvA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1auvA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auvA02
2NU8B 4MV4A 1GSHA 1KJ8A 4IIJF 3TQTA 2VPQA 1C3OA 3MJFA 1E4EA 5KKNB 2DZDA 4FFNA 3HB9A 5GONF 3VOTA 3R9RA 3JRXA 1UC9A 5C1OA 3ORQA 2YS6A 4O7SA 5JH7F 4GGMX 1GSAA 2R6FA 4MA5A 4J6EA 4O86A 4XYLB 2FB9A 1CQIB 4MAMA 2HGSA 2V58A 4M9CA 2Z04A 4HNTA 2GQRA 4ZHQF 1VBHA 4ME6A 2FPIB 4EA9A 1B6SA 3I12A 4O7LA 1A9XA 5LOVF 1JDBB 4Y8VB 3N6RA 4E4TA 2W6ZA 4O2BF 3OUUA 1CQJB 3RV3A 3U54A 2YYAA 3JZIA 5DMXA 4YAKB 4M9UA 5HBRB 2X0SA 4FFMA 4EA7A 2W6OA 5C8YF 2YW2A 4FFPA 3ETJA 3K3PA 1DIKA 3K5IA 1WR2A 1SCUB 2YZLA 2PN1A 4FFRA 3AW8A 4O83A 3Q2OA 2QK4A 4O7TA 2R7KA 1KJIA 3Q1KA 3V4ZA 1JDEA 4EABA 4O7ZA 3VPBA 4TUYF 5LYJF 1AUXA 2J9GA 3TIIA 4EA8A 4O4HF 3LWBA 5FNVF 5C1PA 3SE7A 1Z2OX 2YZNA 4O7VA 1BXRA 2XCLA 4MV8A 4ZQIA 3OUZA 1ULZA 2ZDQA 4HQ6A 3AX6A 5JVLA 2C00A 2GPWA 4C5AA 4FU0A 4WD3A 3R5HA 5CA1F 1KUTA 2VHEA 4XX0B 3TW6A 2NU6B 4C5BA 4HR7A 2YS7A 3BG5A 1CE8A 3U9TA 1EYZA 2VR1A 2R85A 3BSSA 2P0AA 1Z2PX 5HV6A 5JVDF 3KAJA 2CZGA 3VPCA 3R23A 3HO8A 5JQGF 4MV9A 1VBGA 3NUAA 3RFCA 3WO1A 2GQSA 4O4LF 2V59A 4EG0A 1GLVA 1KC7A 1M6VA 3WO0A 3MWDA 2R84A 5IYZF 4C5CA 4IWXA 2WYOA 2W6PA 2CNQA 2I87A 1EHIA 5CA0F 4O7RA 3G8CA 1W96A 1IOVA 4MV1A 2QF7A 1KJJA 4O4JF 4FFLA 1GGOA 1JKJB 1E4EB 5LA6F 2R87A 4DLKA 4I50F 3R5XA 4HNUA 2YL2A 4XYMB 1M0WA 4EGQA 2R7LA 4MA0A 3LP8A 4YAJB 2W6QA 2GLTA 5K2MA 2NU7B 3U55A 1OBDA 3BFPA 2YZGA 3MWEA 1AUVA 4EGJA 3V4SA 1T36A 1GSOA 3KALA 3JRWA 4M98A 2NU9B 4TV8F 1C30A 2FPGB 3JZFA 4FE2A 4NYEA 1OBGA 2ZDGA 5BMVF 5BPFA 2IP4A 2W71A 3N8DA 4WBNF 1EUCB 4O7WA 5LXTF 3KREA 3VPDA 1W93A 4O7NA 2W70A 3HBLA 4O4IF 4I55F 1Z2NX 2I80A 3KAKA 2YRXA 2DIKA 4MV7A 1I7LA 5J2TF 4O2AF 1M0TA 3G8DA 1VKZA 2PBZA 2YZMA 4L1KA 2SCUB 2NPOA 3BSWA 3DF7A 5D8DA 4MV6A 3WNZA 2I8CA 5EZYF 2HJWA 2R82A 3TINA 4O82A 2CNUA 4YB8B 5H80A 1DV2A 2FPPB 3K5HA 4EAAA 4IWYA 2R7NA 1JLLB 3ETHA 1I7NA 2XD4A 4IZOA 2W6MA 2V5AA 4ZI7F 3R5FA 2ZDHA 1UC8A 4ZOLF 1BNCA 4I4TF 2CQYA 4YJ3F 3RUPA 1DV1A 4O84A 2YRWA 1CS0A 2Z02A 5BPHA 2CNVA 5CB4F 4FGRA 4YJ2F 3VMMA 1KJQA 1PK8A 3TIGA 5J2UF 3RV4A 3ORRA 1A48A 3U9SA 1KJ9A 1PX2A 3GLKA 2VQDA 4O81A 4M99A 4IHJF 1B6RA 2R7MA 4QSHA 2DLNA 4YBZB 2FP4B 2OLSA 4MV3A 4O7YA 1EZ1A 2YWVA 2GPSA 1EUDB 2R86A 5KX5F 4RZQA 1IOWA 2NUAB 3E5NA 3QFFA 2W6NA 5LP6F 5CAEB 3UFXB 2PVPA 5JQWA 3VA7A 1KEEA 4XZ3B 1KBLA 4DIMA 3GIDA 4FFOA 2DWCA 4TV9F 4HNVA 3BSYA 5I47A
chains in the Genus database with same CATH superfamily
2ATVA 2OCDA 5CYPA 2BQ3A 3NWEA 4U2FA 2IYRA 1YMVA 2FMAA 1B6GA 1S0NA 5D1PA 1MQAA 3VR1A 3ENVA 1E69A 1CNFA 1A4RA 1Z17A 1U0EA 3JX9A 3LYUA 3E9EA 4X1IA 2CW7A 3UK6A 1E61A 2EARA 1DTWB 1PGOA 4HF7A 4HHEA 4GL4A 3ORHA 3RLIA 5HFAA 2XY4A 3PUYA 3GNTA 2F3SA 4JL5A 3JYNA 2JCSA 1A9XA 3GRRA 4C22A 5LOVF 3G49A 2W7PA 3G59A 3FFWA 3F3KA 3G0DA 3UH0A 4LA4A 3VDRA 4NYJR 2FSGA 4M0JA 1GZHB 2QB5A 1ZIYA 1FRZA 3K5IA 4GG1A 2O4UX 3FWNA 3JR7A 4AYBE 4LPKA 3HEBA 1V5GA 1UP4A 4ZAWA 1SQGA 2Q1WA 4WNAB 1F8XA 2VF8A 2VA9A 2ZWIA 3WVNA 4XDYA 3AOGA 1D6NA 1T5OA 4L28A 4OYYA 4NPCA 3QY9A 1C1DA 1G291 5LXTA 1UZUA 2AEFA 3TWOA 3TRDA 1DC6A 3HM2A 3G0HA 2WW8A 1FDVA 3KJZA 4LSGA 4HYEA 2GWRA 1Z0KA 1UJ5A 2ORYA 2CLLB 2YNMD 2M05A 1MRSA 1SHTX 3GLSA 1UL1X 5TGZA 1NMZA 1NF3A 2ZUSA 2Q6VA 2H2IA 3KR2A 3JPYA 4GF5A 4INOA 4EVQA 4H1WA 4EARA 5AK6A 5C5JA 2V03A 4MV9A 3U2QA 5E0OA 5AQ1A 4LE0A 3R8FA 1VPWA 4RTMA 1M1YE 4QBKA 3IDOA 3K5PA 3HWWA 3GZTB 1XDGA 1NLYA 4X8OA 4KQHA 2PS3A 3GFSA 1APBA 621PA 3J7AC 3L05A 3DBHB 3NUGA 2XDQA 4RADA 4ODIA 2CJWA 3WQQA 1A95A 1GGVA 4Q1FA 3M6FA 2B1IA 3QJYA 1NBIA 2PJZA 1K8XB 4KITB 4UBLA 4PN3A 2DC1A 1XJ0A 4EY8A 2HIXA 4RV5A 2Q5CA 3PNOA 5TNXA 1O6FA 2HMVA 2QUHA 3ZDCA 3D54D 2GPAA 1FEZA 3PQ4A 1K7XB 3M9XA 4J3NA 4OP1A 1SXJE 4U3JA 2QN6A 1ZU4A 2HHHB 4NYIR 1S03G 1NT4A 3HEAA 4L74A 2YRXA 4CDNA 1DC7A 3HFJA 3WJ7A 1HA3A 2CNKA 4KXLA 3G2PA 2PGLA 4GOJA 5CM0A 3TM5A 1YR1A 3ZX5A 3GUCA 2CW8A 4N7RA 4Z51A 5PGMA 3R0QA 1AKMA 3QLEA 1QBKC 3ASZA 1X8XA 2H7XA 2O7VA 1WB6A 2IXDA 4CE6A 4F2DA 3PFFA 4N48A 2VUMA 2E49A 1DRJA 4LZZA 3R7AA 4FFVA 3FOAA 4RQUA 1JNYA 1XNGA 2H59A 1YC5A 2RHTA 1GGEA 2HF7A 3IS3A 2YVLA 1JZQA 3H42B 5EQFA 4IDFA 2FEOA 4BFUA 1RZRD 3DBRA 1NYLA 2G9ZA 4GI2A 3T7EA 4OAOA 2SECE 5HRUA 1B6RA 3HN2A 4CLHA 5JMOA 3M4NA 4AP5A 2HSWA 3VKWA 4ISBA 2IKQA 2VG8A 2E55A 3GIIA 2O8BB 2YYSA 4F5WA 3KVOA 1J70A 1X8LA 2XW6A 1BEZA 2A0WA 1HKUA 5ADHA 3GIDA 1XK7A 3T6KA 5GOTA 1E1RA 3C5WP 4W7HA 4MGZR 1DHTA 1PUIA 4F4HA 4EDHA 4TM8A 2MSLA 4BLOA 3WB1A 2GM4A 1DQZA 2OORA 2VQ6A 5HGXA 1N3YA 2VUGA 1UC9A 2YOFA 2CYBA 2DPGA 5DYYA 1Q1NA 1YFKA 3AJDA 4PZZA 1YB4A 4AUNA 1IC6A 3QWFA 2Q8PA 3GAFA 4XLTA 1T9HA 2ZBGA 1HLFA 3IDAA 2QJRA 4FDVA 1U4NA 2AF4C 1G63A 1C4OA 1GNVA 3A37A 3JXEA 3MN1A 5DISC 1IBMB 1US8B 4A3EG 2PUTA 3K70C 3KPVA 5JXWA 3X3HA 3RVRA 3MIZA 4Q93A 2WWFA 3IALA 2HCTA 4NFHA 3ANLA 1U7ZA 2FWJA 5E4JA 2O14A 5IAGA 3UUGA 3UNXA 1IZZA 5IW8A 1NM5C 4EYSA 4R0MA 1RKVA 2O2JA 5FFMA 1K2VN 1Y4AE 2IH5A 2HT1A 4P9NA 5KWVA 1Z06A 4PG5A 6REQB 3R77A 3KQTA 3N41B 1MPTA 1Z63A 3L43A 1CUJA 3BXXA 2F67A 1DTWA 3FYDA 4UTPA 2NV0A 1B0ZA 5HK8A 4JVOA 4KBYA 3F1LA 1Z2OX 1P19A 1R66A 3TZQA 1ZX1A 1KI3A 1ZQ1A 3VVCA 5FWAA 4K5QA 4DDWA 5J2UB 2C1XA 1TU0A 4K9OA 3KOMA 5ENDA 1KSJA 3NUZA 3LO5A 1AO3A 1O57A 2Q5FA 3PQ3A 4PLPA 4JU9A 1C2YA 5EJ2A 5DRTA 3WLTA 2PGOA 4NZNA 2IIVA 4GM1A 4F2PA 4WNAA 1NVTA 1WBBA 1CP3A 1IBSA 2BI4A 2FRXA 5HA5A 1NSYA 4DCPA 1ZITA 1DT3A 2VJMB 4CU2A 3EPHA 3MD0A 4YUWA 3KSAC 4DMFA 2Z1MA 5KYUB 2MOKA 2WQ6A 2BVNA 5BUCA 5AK0A 2CB0A 2C3UA 3MRXA 2XOXA 3VO1A 2CLCX 3VH3A 2YZ7A 1XRSB 3KUKA 1Q0HA 3GVXA 2IGTA 5CDUA 1W581 1V43A 1KOFA 4Y98A 4Q82A 3WLIA 1SN7A 1M33A 4C43A 4WBNF 4GECA 1GCGA 3IV6A 3RAPR 4QRDA 3WGIA 3TDNA 3L0IB 5K3CA 2WMYA 1SUEA 2I80A 5J2TF 3ORFA 1NQAO 1Z4NA 3VVLA 3MJCA 2DWQA 5JI2E 2BWJA 3VH2A 3DBHA 3LPMA 3H0CA 5BR7A 1ZUNB 1QFMA 3C6QA 4U7GA 2GO7A 1U8XX 3NIFB 1L5YA 2YWDA 5BO5A 2QGNA 1NQWA 2W93A 4H08A 2YOHA 2VHUA 2BEUB 3T3PB 1A71A 5C3UA 2J6HA 1Y3FE 1EP2B 1PJRA 4Y0AA 2O2CA 2Z95A 4BQQA 2ZDHA 2VZ9A 1VSUA 3PCRB 1U3TA 4B81A 5KSWB 3RUPA 3HS3A 4CTOA 1E60A 2ARKA 2VHTA 3EDQA 2CD9A 2GEKA 4MGHA 2ZJBA 3ENKA 1LVHA 1U99A 2X8WA 2DXIA 1U5BB 4JMPA 4EYQA 5G3YA 1XZLA 4RK6A 4NCNA 4IIHA 4N12A 2QVXX 4NICA 3K0CC 4YQFA 4MJXA 1J5PA 4LMPA 1H4VB 4OIFA 2BFPA 2D6FA 3WIUA 1XZEA 3Q9LA 3DLTA 2EQBA 1UPUA 3ZNQA 5EXEA 1JDVA 3RB6A 1DCMA 3FKJA 1R8QA 3RS4A 1Q84A 1RLOA 4RXUA 3PQDA 2GEFA 4UBIA 2GKSA 3H6HA 1UT6A 3MWYW 1UJ6A 5E4TA 3IKMB 2F9MA 1AKTA 1PFQA 1DEXA 3SR0A 1V8PA 2CVFA 4R31A 3DMTA 4IFEA 2ETXA 3IXQA 3JARB 4XQ0A 3SF8B 5LQJA 4F4XA 1Z8FA 4YPVA 2ZZNA 4MUKA 1P7WA 1XKTA 4LJ4A 3RPEA 1NVGA 4JI4B 5D84A 4WACA 1G42A 3I9KA 3IQGX 4KR7A 2WMNB 3K31A 2GHTA 3TAXA 4CIBA 4N3BA 1G38A 4R81A 1G7CA 1TOAA 4XUEA 2O8BA 1LPMA 3CA8A 5C0OE 3BA8A 3E5RA 2M1ZA 4LC0A 3UH1A 3FIUA 2QLTA 3CF4A 5DWVA 2GAFA 4HAYA 4QWCA 1P2DA 4G5SA 2CJYA 2ZJ8A 1WHSB 2COJA 1YFJA 1TQDA 5DM0A 3RVQA 4K1XA 4A2QA 1EFKA 5DHQA 2HXGA 5LJLA 1Y80A 2ZSHA 2C29D 2WSBA 2QT1A 1JJVA 2R79A 5KFGA 3LUKA 1P6UA 2QK4A 3N8GA 1ACLA 2Q9UA 3SXUB 2P75A 4YCBA 2IYUA 2BBWA 4JNKA 2J7PD 5HZKA 5FR9A 4A0SA 1GRRA 2NUTB 4EUSA 1FFYA 1YBVA 2ZYGA 3IN5A 3OUZA 1CETA 1US8A 4I5DA 1C8VB 1M2JA 2Q4BA 421PA 1M2EA 4KXNA 1PD0A 3K1YA 4KPEC 2GYUA 2C4NA 2W42A 4FPXA 5LZ4A 4LF5H 4DR4H 2ONZA 4YCAA 3RU9A 3I5MA 1ELOA 1KR5A 3RAXA 3LC1O 4C3UA 1JJIA 1PNVA 3G8BA 3RRMA 4TL7A 4BNDB 5LJIA 1BOFA 1CUFA 4XRGA 3KR0A 1XWWA 4KE6A 6REQA 4DREA 1G9TA 3HBFA 1T0IA 1CJBA 3BRWD 5FBWB 1UFKA 4EGSA 2OAP1 3DR3A 3RAGA 2J3DA 1PDWA 3MWFA 1VXRA 5AYVA 2Y1EA 3ZVKA 1C50A 4KJZA 1V9SA 1RZ3A 1E79D 2COIA 1BX1A 4YLEA 5ECYA 3LW7A 2UVQA 2YZGA 4E14A 3SIRA 1J39A 4L7VA 5THKA 4Q44A 5AHRA 3FB1A 3T5KA 1QK4A 5J2UA 1CUXA 4Q1CA 1NVWQ 4W1PA 3UENA 2VBFA 5F7JA 5DLEA 4QGFA 2GK6A 3JYQA 1FJGB 3CT6A 5FV7A 3HVIA 4UKDA 5JNTA 2H51A 3NPMA 2GNOA 3TNYA 1L3CA 4QQNA 3W5VA 1OAKA 4M8LA 1Z3IX 3L82B 2VJMA 1SR8A 3G0IA 5K9ZA 3SMVA 2XTZA 3QOYA 1JVNA 4WV3A 1K68A 2FW0A 5KYUA 3K5WA 4JBYA 1H0HA 4IS3A 2BHNA 1RVDA 1ENYA 2Q8QA 3PGKA 2I7CA 1VHWA 3KK0A 3CZ4A 4MVJH 5TEVA 1FW8A 1TJNA 3GLHB 1T29A 3T94A 4BECA 1VPTA 4WNCA 2EW2A 4R9SA 4LBYA 2JLQA 3THOA 4R1PA 2C5LA 1G4UR 2XBUA 5CVUA 1SKQA 4WXYB 2R4QA 1UPAA 5BNTA 2QDXA 2WTNA 4EFLA 1LBSA 4FGRA 3ZG6A 2WJYA 4BDTA 5BSEA 3TIGA 1WSAA 2ZQ5A 4LXUA 3WIVA 3U9SA 1PX2A 4M99A 1EVIA 4CGZA 4HSEA 4RL4A 5FUQA 1ZUNA 1OT5A 5FI5A 3R40A 5C8DA 3EWIA 1Y81A 1IJKA 2D1FA 5G1NA 3QI7A 1DQNA 1PK7A 3QFFA 3EUWA 3VZDA 3VHQA 1CUAA 2HA7A 1IY1A 3ZZ1A 1M6EX 2BEUA 5FH9A 1UBOS 4KR0A 4MYRA 3PSAA 1HK7A 1ZGHA 2I3AA 5J4KA 2GXSA 4HFNA 3RARA 1VLJA 4KQGA 2R65A 1E4EA 3B48A 4NZPA 2FXIA 2IUFA 3QE4A 1S3FA 1GUBA 2P90A 4KP7A 1FVIA 5H9WA 1QU2A 2EBHX 4RVDA 2EDCA 1U5BA 1MFZA 1JECA 4OHBA 3GJSA 3GFOA 4UQOA 4KFSA 4V0MA 1E1KA 1XOIA 1S0UA 2XCPA 2FLLA 4G8CA 1PL6A 1X3LA 1EX7A 3A3PA 2VHJA 3KUXA 4HDCA 2GOYA 1NURA 1F1JA 1FSZA 1J8QA 1AK1A 2ZR8A 4FQ5A 5KYVA 2L18A 4FKMA 2FZCA 3H65A 3IUSA 3GNSA 3U19A 2Z6QA 3VO8A 4L3WA 4YAKB 1HYGA 3OHPA 3DDHA 4RDCA 2RK4A 3RVLA 1WDKA 3AIKA 3B20A 4Q3NA 1TIPA 3JARA 3SF8A 3E8XA 4PC2A 1O6GA 1D6SA 2YRFA 1CIJA 3SZLA 3MB8A 4Q05A 2B82A 1IN6A 4JBGA 4KXYA 4BDSA 4URZR 5EQDA 3O2QB 1FW6A 2QRQA 1X38A 3SYKA 4X3PA 5BQXA 4TUYF 5GJCA 2J9GA 2X2PA 1TEZA 1T5SA 3ESYA 1RPNA 3SR4A 2B2CA 3RFUA 4BJ3A 2TECE 4ETWA 4GLOA 4CIDA 4PW0A 4RBNA 4YJ2B 3IERA 3AEXA 3RM3A 4AWAA 2VXOA 5M3BA 3PUIA 4U7PB 3HA3A 5B7NA 4K9NA 4HI0E 1WHSA 4GZ5A 4OB8A 4UE3S 4WQMA 4CI0B 1OI4A 2GD6A 2Q0SA 1IOZA 1LTQA 3AGPA 4P7FA 3AL3A 3QZ7A 5CH5A 3AQ4A 3DSRA 1FJXA 5ELMA 2R84A 1BVYF 4MUXA 4PO1A 1V8ZA 3DVSX 1SULA 3SXUA 1CULC 3TSOA 2QLBA 3LBHA 5FPHA 2EG5A 4GMFA 4L8GA 4CN9A 4Z4EA 5DCLA 3LDGA 1VDMA 3OE1A 2NUTA 1EDZA 3ICQB 3BM5A 3TNLA 4XWWA 1MZVA 4INZA 4X66B 4BKOA 3Q9NA 4L4UA 4UEJA 3RGWS 4WCFB 5FQOA 2UZIR 5KNBH 2UVWA 1KRWA 4UUOA 5BPFA 3CINA 4IH9A 2GXAA 4ZEVA 4BNDA 4CG3A 1POXA 5TPWB 1E8DA 3FTPA 1D2MA 1ZD2P 4O2BB 5ESDA 3I4FA 1VGRA 2FMTA 1EJ6A 3KYCB 4GLXA 4KI7A 2HMWA 2XE6A 1VOTA 2GD2A 2W2VA 3A32A 2B63G 3NT4A 3QQMA 1P4HA 3PDUA 1U28C 1N2BA 3QBVA 1P1KA 2I66A 1XTVA 2OGSA 2GA9A 4BE7B 2WDZA 3H8WA 3WL7A 2JFFA 5LUBA 2JEFA 1M2HA 4IWYA 1XZHA 1Y0BA 1ZBDA 1I50A 3GL9A 4IV5A 4E2WA 2WU0A 5HRCA 1WSWA 4WBXC 3S27A 4Y9SA 2FAXA 1RZUA 4OXQA 4QJFA 3ZHRA 3RC8A 4MW6A 4FYVA 3CONA 1PFYA 1DT5A 4QJ5A 1QGED 3I8XA 3RIGA 2D1QA 3M0EA 2NVUB 2FDCA 1NNLA 3LPAA 2INGX 4CN8A 4UNRA 2A9JA 2DHCA 2C4MA 1EWRA 4RMHA 1ZNWA 1W2HA 3AKZA 1ABBA 2J31A 2R5NA 3S5JA 3GLHA 1UF9A 1SCQA 3PIDA 1WXGA 4P5PA 1XD2B 3CZ9A 3FHTA 1GTG1 4DM3A 2JF0A 4BB6A 3BSYA 2AQ4A 1U98A 4YP3A 2E7ZA 3EG5A 1LLDA 3BE5A 4PG4A 2F62A 1WVMA 5CCEA 1RYSA 1ORVA 3RS3A 3AL0C 3TDKA 4NMWA 1ZL2A 1F2TB 3FPBA 1S0MA 1P9LA 3NHBA 3O7WA 4OI0A 5TS2A 4IYJA 5CVCA 5KNCA 3E2IA 5B3KA 2ZWPA 2D5CA 4XM1A 2IA5A 4DL9A 1F60A 4E4TA 2HO4A 3ZZNA 2XEDA 4Q66C 4AG6A 1PIWA 2AFHE 4FHZA 2F1JA 3PB3A 4OB7A 1IH8A 2Y0EA 2IEDA 2YFQA 4S0ZA 3A1CA 4RD4A 2X3UA 4ZT4A 5DN6D 2ECOA 4UOQA 1P5ZB 3KJGA 1KYZA 5SV2A 4BJHB 4YUXA 4UCRA 3JD3A 1NXQA 4J0KA 4G4GA 1EQUA 4RX1A 3RUAA 2WY2D 1ZD1A 4KK3A 4KLNA 2V6FA 1KYVA 4QG3A 2CLEB 2J6CA 4IGEA 3VX4A 1P7CA 5EIEA 3U7IA 1NW7A 4EYHB 2XCLA 4NDAA 3M1LA 5CTAA 4ABYA 4UMVA 3ZHOA 4DG5A 3N2GB 4LJ9A 4UFPA 3NTXA 4YAKA 3UTCA 1TA8A 4LTNA 4GOND 1Z2CA 4ALNA 3IV9A 1X86B 1MPXA 3K0HA 4CTMA 4QBHA 3CSSA 5JZOA 1MZPA 1XQWA 4I9UA 3EGVA 2GPBA 5KFBA 4L27A 1Y1TA 1GVNB 2OA0A 1F6WA 1S2GA 1MGOA 3I28A 2O5VA 2P11A 5HZMA 2ZJ0A 1KWGA 1CUGA 4M0EA 4YALA 4FMDB 3J80W 2VTDA 2XB9A 4GRIA 3MMNA 2W9BB 5KTYA 4MA0A 3MIIA 3RIEA 4N9QA 5E7QA 5BSTA 4G8JA 3FROA 1PSDA 4YJ2A 3KU4A 3Q3GE 2PQ0A 5BWRA 4OI2A 2YVUA 2C5BA 4BJ5A 2IDMA 1V7PC 4ZHQB 4MTEA 1JEAA 2RGBA 2XADA 4YRJA 2AHRA 3M9NB 2GK4A 1SVUA 3DDOA 1OYWA 3BQMB 2OGZA 3ZEIA 1BS2A 4RNOA 1V0JA 1SWWA 4LZPA 3DF9A 3U7RA 3UJDA 3V48A 2HQ1A 3S1SA 1GPJA 4C0QC 4QZVA 4TWRA 1B8UA 4FBLA 4IDAA 4LMYA 4Q3KA 4A8HA 3SEFA 4LFBH 3N0RA 2HIHA 2IQIA 3N74A 4ETMA 3H99A 4AY5A 1TYAE 2E0IA 1PTKA 1IBCA 3JS5A 5DXJA 3A9WA 2F43B 5BV0A 4DUGD 1Q95A 4WCFA 1NVBA 3KPWA 4IGAA 3AF6A 3GB8B 3O8OB 4TQSA 1GADO 3SDZA 2FUG1 2X9VA 1CDEA 4A36A 4GL2A 2EHDA 3O8NA 5TPWA 1GYFA 3LX8A 5ADVA 1T13A 1Z25A 3NM5A 4A1OA 4O2BA 3RHFA 2POQX 1YZLA 3KYCA 1HETA 2BFMA 1A48A 3F8TA 2G8LA 1QRUA 3F8NA 1MAAA 5KFPA 4CCYB 2XYRA 2IIPA 3RAQA 5CFOA 5LZ8A 4LDAA 2YIVX 3T95A 4Y18A 4WA7A 5FUWA 4D2IA 1KY2A 4ZGGA 4Q3CA 3DMDA 3U3OA 4OLBA 1FQOA 1N0WA 3MMZA 4N5LA 2KYRA 4JI8H 5CIYA 3D6MA 4PZYA 3FSGD 4FS8A 5HF8A 1S6YA 4QO8A 1V39A 1EHCA 1RWWA 2WUWE 2DR2A 3LXUX 3WSTA 2W7TA 2RH8A 2XQIA 2FZEA 4MQUA 1GCAA 2BR5A 3D4IA 3SSNA 4ED6A 1L1QA 5LDHA 2NVUA 1XXHB 1RHUA 2A9FA 4BFYA 5ETJA 3P2JA 5BSRA 3I9V6 1T15A 3AL2A 4F6LA 3MT7A 1RJ9B 2VZEA 1K5DA 1O1YA 2XUDA 1MO5A 1E3MA 3WGMA 1Y3HA 1EE2A 1XVAA 4EHNA 1U2EA 4CW7A 5CEEA 2QM7A 1GEEA 3I6ZA 4R1NA 1ITZA 2V6BA 5I5UA 1RIFA 4K28A 1XD2A 3OQ6A 3O31A 3ZK8A 2EW8A 2X0RA 3JQRA 3ZHSA 3DXXA 1HPLA 5BSUA 3N59A 5C3MA 3PQFA 4ETNA 1HM5A 121PA 2YZLA 2FSVC 4NYMR 4RHYA 2H0RA 3PGJA 1UKYA 2JAOA 1SIUA 2TMYA 1F2TA 3RR5A 5HS6A 3N0WA 1A3GA 2VK8A 4EA8A 3LWBA 3F78A 4D26A 3LCCA 5A4AA 4TMXA 3L7NA 1P9WA 2VJNA 1W30A 3KR9A 4ARZB 1KERA 1R27A 2FZ4A 2WSMA 3WBFA 4M1YA 3AETB 1N3IA 1MB4A 2IXBA 2Y9PB 1GQFA 4P3XA 2V5UA 5IDQA 4OBEA 3G0OA 1LJLA 1T9ZA 4Y2RA 3HO8A 4PC6A 4ENTA 3UV7A 1TZMA 2V4UA 4YRFA 5K3BA 4GMKA 3WYBA 5AM1A 4OQNA 3RKUA 2A5YB 1E9SA 4N3AA 5DTQA 4AUKA 5HVNA 4Q21A 2X6RA 1W96A 1NR7A 4QAQA 2Y0SA 4QU5A 1JMYA 4MIKA 2DETA 5JROA 1LC0A 4BV2A 3HGMA 3N2GA 4WKCA 1MB3A 1GGMA 2MR5A 4JBLA 2WTUA 4XQCA 2OORC 4PAGA 2PEYA 4BNJA 4D9GA 4AJPA 1ZCBA 4IIGA 4MHSA 1KDVA 2C4WA 1JDSA 1PFGA 2OO5A 4BMSA 4WKGA 2FEMA 2VP2A 4XX1A 4M0KA 4J0GA 1WH2A 2JGMA 1OTHA 2X0DA 2C9ZA 3FN4A 1KYWA 5I9LA 1KJWA 2ZWAA 2FWMX 2Y77A 1D2GA 2PA3A 3QLJA 1I7LA 3ZDEA 3BE6A 4UTZA 1ZCZA 4BO0A 4MDEA 2OH2A 2H3HA 3MYRA 3ZLBA 1EUQA 3PGLA 4LXTA 3OHBA 1U0RA 1U9JA 4MMZB 4QUJA 3TOVA 3PEYA 1ZJ4A 2C5AA 4KQMA 2W9BA 3JQCA 1R3UA 3BTVA 3GT3A 1YQQA 1VGVA 2IHNA 5HUJA 1I32A 5BYJA 2X15A 4GKJB 1YRHA 5BSWA 1TUIA 2GO1A 4H0NA 3GF4A 4B4DA 3ELUA 3E15A 4ZHQA 2Q1TA 2VA3A 4RTQA 2PLAA 3T3DA 4TKUA 4XW2A 2UUBB 4BN5A 2XIGA 2P2ZA 3W05A 4HAZA 2HYDA 3OCWA 2PUWA 2QUZA 4RKRA 5IKXA 4DB4A 5JT1A 4XVUA 2O3TA 3E7PA 5JVDB 2B4AA 1XMSA 1P8JA 3UANA 4JUIA 1PNRA 6AT1A 5JS7A 3RDPA 1NW3A 4PVDA 3C3DA 3CEBA 1RQNA 3D3WB 2F43A 3SZ3A 1UBKS 4U2GA 4FFOA 2H7CA 5IBRA 4RVGA 4O4JB 2PUEA 5C7LO 1Z0ZA 2YV2A 3GG9A 2P1RA 4DW8A 3L4KA 4GPIB 2QR5A 1W5SA 3MUFA 2HM7A 4NKRA 3GHHA 3K16A 3EDRA 4E88A 1E4YA 1JWAB 1GFZA 1JR6A 3KNZA 3W8RA 2RMKA 4YPFA 4D98A 3KQLA 3DQPA 1J5XA 3FFXA 3OI7A 1J90A 4RH3A 3OMXA 1ABFA 1LNZA 3CCFA 4IRDA 3L6UA 3LLSA 5AT1A 3JAMW 3RQIA 2YFYA 1GU1A 2WAMA 10MHA 3HYCA 1AVTA 2ZZKA 4WZBB 4M9UA 2VNJA 1IB6A 3H7IA 3GVPA 4TPKA 1IY9A 1U2PA 3QOWA 5ENVA 3LF1A 2J5BA 4BVEA 4RVNA 1E58A 1CU1A 1NQUA 2O48X 3UTDA 3M1YA 2YOGA 5G4KB 3AP2A 4W8GA 3N87A 1XFDA 4ID9A 5KVQA 1XXHA 3M81A 4X64B 1MO2A 3ZJ5A 4LDPA 2V3CC 3R6WA 2VT3A 2XB8A 1RJ9A 5EXDA 4M7WA 3ZGVA 4FW8A 5JAHA 2WJWA 1O2DA 2NSYA 4E5PA 4J1TC 3H1AA 2CXXA 2RI0A 3ISTA 4R2WA 2R68A 2OFPA 4A3JG 4BZZA 2R8JA 4URYR 1MU0A 3L41A 5GQSA 5BV8A 3P4XA 4EQZA 1KOJA 1NHWA 3B3AA 3HXOA 2FEPA 2BSQA 4MEJA 2VN8A 2PPVA 3U4QB 4MGIR 1E94E 3PHLA 1KTAA 2I1LA 5C32A 3EPLA 1L3IA 3WY9A 4D8UA 1V8OA 3GJ6A 1IN5A 5I8ZA 4PCUA 1ZG3A 2YY5A 2CXPA 5FUVA 1Z7BA 5AM5A 4IDQA 3H4TA 4X61A 2IOFA 4ZV7A 3PLAE 1F6BA 1UK8A 2RHMA 2AE2A 3ZLVA 3HGTA 1E32A 2EX4A 2CE2X 4YJDA 2PFGA 3DZJA 3QU9A 1CHDA 3HKZE 4ARZA 4CBVA 3C43A 3L7LA 5L7TA 3P32A 3JYHA 4TMYA 3DMTC 4OIMA 2WWIA 3TVYA 3OESA 5FIUA 3AETA 1U2GC 3E0QA 2YJTD 3ZJTA 5FD6A 4EZBA 3EULA 1ONBA 2CHQA 2FX2A 3PKZA 3NIDB 1WG8A 1DOHA 2VDVE 3SI8A 3DAGA 4FE2A 3EA4A 1RS0A 1OH8A 2YVKA 3RFVA 1IY2A 1I01A 4EL5A 1YCFA 5DHAA 3N44B 1A9PA 1N36H 3HYTA 1M7GA 1NATA 3DEKA 2D62A 2BKVA 1S3SA 3IXMA 1C7JA 2ZTMA 2XZLA 2FTKE 1UH5A 3SN6A 2PD3A 2AYZA 2G1PA 3W34A 4JR1A 2D7DA 2P9ZA 3QPCA 3EX7C 1U1IA 2R6HA 3FX2A 1XLWA 3T3HA 1YMQA 3V1UA 3A9VA 2J0EA 4TVSA 2XSZD 5C5IA 3P9ZA 4FT2A 4M55A 2HB6A 3HRHA 3GR6A 4J0CA 2B6HA 5L1JA 3ACDA 3I6MA 1V7CA 2I1QA 1QYIA 5HS4A 1V5IA 1KO4A 3WBKA 2R00A 4UM9B 1HNXB 3ZI0A 2F3QA 2QQ5A 1FFWA 1OCEA 1OI7A 5EWLB 3Q8RB 5BQFA 2LVBA 3A27A 3H8VA 1E4OA 2OV4A 2JVKA 4KO8A 3IVGA 4HUJA 1WZCA 1G6OA 5CG2A 4HC4A 2O8FB 2OECA 4CQMB 4M8KA 4JXXA 4LYAA 3GVHA 2O7RA 2FN7A 4YBZB 1NULA 1VKHA 1QE0A 2NO1A 3Q15C 4D82A 2YC4C 4ECWA 2RFLA 1A4IA 2IX3A 2O03A 1RC0A 5TQ2B 4J91A 4DJFC 4BUZA 3UC5A 3QVKA 2HBZA 5IAKA 1W4AA 5I5XA 2C3PA 2VTBB 3L7KA 2EBUA 3MOIA 3DOEA 3TE6A 1NMEA 2DTDA 1QX4A 5K3WA 3VOTA 3ZXSA 3URKA 1XZFA 1O6ZA 3P8ZA 2XUIA 1GL9B 3OJXA 4ZMBA 4YCMA 3LUHA 5GV7A 4IPTA 3EF0A 4OFBA 2VDQB 3PC8A 4HH1A 2XVYA 3SLGA 1TCUA 4AZWA 3ILVA 5JVDA 5KT5A 1GGHA 5ITSA 4WEOA 4Y6OA 4N8DA 5B1IA 1I3LA 4DMHA 2I3BA 1HQYE 4N8SA 4YLGA 2CL6X 4FDTA 3D3WA 1ZD9A 3T5CA 4NH0A 2ECKA 4O4JA 1SU4A 1KIFA 2V96A 3U3ZA 2P62A 4FYPA 1P3JA 3B70A 1OA1A 1GAQA 4DSUA 1TW2A 4J07A 5HXAA 4PQRA 4M89A 1TYEB 3KSRA 4O8CA 3AIMA 2XWPA 1SBCA 4NHEA 3DDWA 4RSRA 5A6VA 4G4SO 1N32H 4FNGA 2IIBA 3LKVA 5K2OA 2ALZA 3AZQA 2W5UA 2ZTLA 3VU0A 3M3HA 4ZQFA 4KSBA 1S9DA 1SO8A 3BJZA 5CDTA 3D8BA 5EJAA 5CX4A 1QZZA 3T5MA 2BMFA 3OH8A 4G0ZA 4C78A 4WZBA 4KDCA 2CK3A 3TXXA 1FLNA 3GGPA 2ECFA 3RVBA 3AOEA 1T2NA 2BV3A 4DWWA 4R69A 3HB1A 1B23P 3PV0A 2HJRA 3M5WA 1QIJA 1M72A 1QS0B 4NBKA 5G4KA 4WMLA 2A9RA 3PEFA 4FNOA 2GQSA 4L4RA 4QFDA 3J80A 3IMEA 1Z62A 3HJCA 5CNMA 5LNK1 4D6PA 2MT9A 2I87A 1OXKB 1Y1WG 2A1UB 2MINB 5ECDA 3KHUA 4JROA 4NLLA 2BM9A 3K32A 3A0RB 1E9VA 4DLKA 2BW0A 2VP9A 3DW1X 1H94A 2DU8A 3BXOA 4OMUA 1UBTS 1EMDA 2GLTA 3H4MA 1DOZA 3GUYA 2VK1A 4H60A 2XMCA 3C7AA 2VJPA 4K6GA 1J5EH 2BGRA 1W88B 4JCCA 5IJAA 1N4DA 3VR3D 3ROFA 3L0BA 3U4QA 1RMQA 1PS8A 3I2GA 1IN7A 3CLTD 1TECE 3U3KA 1F8GA 4X94A 1JZTA 4GP9A 2SKEA 1SOMA 2R7AA 1NAHA 5ALYA 3L77A 3T9AA 2AN1A 2QWXA 5KFMA 3EF1A 3O93A 4OQXA 1AJEA 4X6LA 3HUFA 1UEXC 3SCZA 5LU8A 4RCYA 2EC5A 4OXRA 3IUJA 5CGZA 2PZKA 2HLHA 4YB8B 5DNAA 4XB2A 4IJKA 1VZ2A 1NU8A 1WMEA 2H4XA 5FR2A 1ZN8A 3TMKA 3DV2A 4PAWA 3I9LA 2B25A 4XUGB 5IG2A 3ETLA 3CRNA 3NCHA 3PNLA 3PFIA 4DR5H 3GJXB 4QLAA 3K1ZA 5JD5A 3ZGYA 3MCZA 5EHZA 3BQ1A 3TLGA 4LWOA 2BGMA 5B3LA 3VHXB 2XKJE 3G1TA 4BWYA 3FKIA 3P71T 4M54A 2IZ1A 1MTZA 1YI8A 4G67A 5JQGB 3VKVA 1XDBA 2E9SA 4J9QA 4Y6QA 1KAMA 1L5OA 3I4CA 2I6UA 5HSGA 2RI1A 5FULA 1QR6A 1ZUWA 2ODQA 3ZU4A 4C6SA 3IEKA 2ZUVA 5EHGA 1HBJA 2N42A 3VV3A 2O2GA 1SD1A 4AO8A 5I48A 3ZKWB 3AY3A 2PWPA 2V55B 4JI2H 4IZIA 4J29A 4AY3A 2VL7A 2VPQA 4P3NA 3I4MG 1J8VA 2H7YA 4XASA 2YNMA 1NN1A 1II9A 5SYAA 2O2EA 5JAUA 2O8EB 5EWLA 3KXLA 4IO0A 1MX9A 3Q0TA 4RMJA 1S01A 1TU3A 2P9QA 2Q6OA 4E94A 2O8FA 4CQMA 3OMWA 2L69A 4AG3A 1P1RA 2ZM6H 2Q9AA 4YBZA 2YJ5A 4A3SA 3ZVLA 2IHKA 1VBHA 1ANKA 4R7GA 1A9ZA 4M3NA 1O0CA 5LMNB 1Y37A 1XZPA 2WICA 1PWZA 5TQ2A 3U54A 1QV6A 2PKXA 3F7NA 4NOLA 1ZM4A 1G6KA 2QG6A 4KXVA 4OLFA 2XT6A 4KIFA 4IGFA 4DV4B 1O8CA 2I62A 5TIIA 1CE8B 1XROA 1EFUA 3O92A 4PVCA 2VTBA 2Q29A 3MWJA 3HYSA 2AWNA 5D2CA 1EINA 2JHCA 1RIIA 4XGQA 1UFQA 5KYGA 3S28A 1SYXB 4AKIA 1CIVA 4YWJA 2CFRA 1A7AA 2RF4A 2QLMA 1KS9A 1DHRA 4H6PA 3ADOA 3QF7A 3P7MA 3E05A 4PLHA 3QY0A 4L8YA 4OI1A 2AZDA 3K9BA 4HSGA 4BV9A 3ZQKA 4O8ZA 1ISSA 1J56A 4QM7A 4ZTBA 4OA8A 4D3DA 2CE7A 1TYDE 1HOTA 5FBKA 1LI5A 5G0TA 1M6WA 2VR1A 5HJ7A 3UV3A 4ZOEA 2Q28A 4M7EA 4NATA 5LCXA 3KV1A 2XB4A 1EK1A 2JGFA 4GDFA 3ZZ0A 4CUKA 1OAOA 3RFCA 1P9RA 1KZ9A 4HUTA 3PNMA 1XE3A 1SZCA 2EZ9A 3BL8A 4L75A 1LZLA 5A3SA 2ZI9A 4ZT7A 1Q1QA 1BW9A 4IOJA 1B43A 2L82A 1E4EB 1K6MA 3N0VA 3OPYB 2KLBA 5AH0A 3WLJA 3DV9A 1IEXA 2K2QB 2JI4A 3EIOA 1M73E 1E7QA 3I6QA 2YXNA 5DBFA 1OBFO 2GYYA 1GAWA 5EA2A 1B15A 1UPBA 1QS0A 1LPAB 1GDDA 4NESA 4E11A 5FX2A 2QX8A 5FPPA 4DLUA 3SJCA 1RRVA 3RT1A 3Q8QB 2A1UA 2MINA 1KDTA 4G81A 1UT5A 2DJ5A 4MOWA 2NZVG 1DIAA 3RNOA 3K0BA 2GH1A 3FLEA 3WQRA 1W88A 4GNRA 1KEEB 1I7NA 4L5BA 2NYAA 2EG9A 5GVRA 4MYSA 2AOTA 4TKVB 1TWCA 2PTGA 2OGWA 3R5FA 3OZWA 3GCXA 3FUVA 1KK1A 2FGJA 3KETA 4YDRA 3DXYA 1D3AA 1EB8A 4GI1A 1GA4A 4WZZA 4JLJA 3FPKA 2BM0A 3MK31 4K88A 4C07A 3U4DA 1BS9A 4E5MA 3NM6B 3F0TA 2WYWA 4IHJF 3K8YA 1ZSYA 1KYXA 3TDMA 3E8MA 1E2NA 3OEWA 1ZUIA 3W9UA 1KBQA 2FNAA 1MOQA 5H4HA 2JLWA 3PDWA 3MS4A 1R16A 1O9GA 2NQ8A 2D74A 1IAVA 3M70A 4YB8A 3E5NA 2OQIA 4GZ6A 3FYCA 4AB1A 4DIUA 3K20A 3PZBA 1YHZA 2TSYB 2PYZA 1KIMA 3NFYA 1M34E 2DFTA 4H7PA 2IBMA 5HUHA 4RAQA 1KAHA 1QPBA 4AU1A 2Z43A 1L7XA 5C8VA 4JYAH 2CF5A 3H8SA 1C9NA 5FOQA 1TMKA 3QWAA 3V4VB 2F4VH 3IHKA 3NOXA 1DB3A 4BKQA 3KJHA 2Q2TA 1DLJA 1I1MA 3PENA 1DO2A 3KTFA 5CDFA 3VHXA 3FWZA 1L7EA 2IOYA 3ZQJA 3SVTA 1YKSA 3K53A 1U7PA 5B3JA 4EB0A 3FNFA 5JQGA 4P7GA 4WUVA 1PJ4A 5F3DA 5AESA 4X1YB 4RTKA 3W5OA 3HN7A 4IJMA 2VOBA 3T5JA 2EL7A 3DOJA 1AQUA 5K6TA 3ZKWA 5ICCA 1U7DA 4CR7A 1FPMA 1UKZA 1XALA 2X7XA 1P62B 4HH0A 1FTNA 5KREA 5FI0B 3ZLTA 4A3DG 2H1VA 2O8EA 2XA9A 4M0UA 3WGOA 2FJZA 2JIZA 1OFHA 2PFSA 2ZUBA 1XVTA 1E3SA 2VNSA 3FWYA 4A27A 3FF1A 1W5BA 3VTKA 1C3XA 4YA6A 3V9PA 1E5LA 1A8QA 4WK6A 4CMBA 3D5TA 4O1IA 2VSQA 4WCFC 1O97D 4DXHA 1ZWKA 1RRFA 4BV8A 5AJHA 3ZHVA 3C8DA 1TKRA 2Y05A 1Z29A 3UMBA 2XF2A 3HVRA 4EPWA 3NBQA 4B2PA 1JMVA 2OHJA 5FUYA 1GZVA 1R8YA 1CE8A 5G4LA 4R4JA 3KHLA 1Z2PX 4M87A 2PS0A 5KX5B 1VCMA 1FFXB 4EPXA 1QZTA 3R6LA 4X60A 3B5IA 3MFQA 3ND9A 2YW9A 2H5JA 4UMDA 4F06A 4LF8H 2AKEA 1AUOA 1JDJA 5B58T 4L4ZA 1KI1A 4NP6A 5TR9A 5FTJA 2B1JA 1QO9A 4EQ6B 1UMDB 1RXUA 4UVHA 5KZMB 4UCXA 4N01A 1QHEA 3LP8A 3P2IA 4V0KA 2EKQA 1XHLA 3K09C 1Q7CA 3GBPA 1C2TA 4IOMA 4ZRDA 4IUCS 3EAGA 5JHHB 2MSWA 3PQCA 2G9RA 3UA3A 4B3TB 1RWBA 4BP1A 3CLSC 1PNOA 3PX2A 1A5ZA 3V4PB 2GPJA 3GI1A 5K1ZA 2VBCA 1G3RA 2YY6A 5H3HA 4GUDA 2IU3A 2CDBA 4DC9A 2RK6A 1E0JA 3Q87B 1BMDA 4I8IA 2ZT7A 2P8SA 3E4CA 5JYEA 1YQDA 1X7XB 5JOQA 1F0YA 3HKDB 1I0LA 4QUIA 3OPYA 5FBRB 2HJWA 3ZVMA 1VBKA 1KVRA 3GPCA 2PVSA 4OMDA 3PXUA 3M6VA 4B3MH 2V54A 2PJUA 3P9NA 1XZ8A 2FZWA 3OJFA 5HMMA 3SQNA 1NXXA 5A9SB 5LKRA 1QFSA 4D9FA 4NCKA 2WZQA 1CD5A 4XTCS 5FPSA 3WK9A 2M6RA 2WU4A 1E5DA 1JIVA 2H1IA 2RK3A 2HDKA 1KOLA 1DV1A 3AR4A 5L3RA 1M2VB 1Q6ZA 2GTPA 3HJAA 5BPHA 3A4LA 1EDOA 3WRXA 2QU8A 4PAOA 3I0ZA 4AXXA 4AROA 2B6NA 3FD8A 1D0VA 1L5MA 5K8IA 1NFRA 4F11A 5A1TA 2JA6G 4YR7A 2LRHA 3KBOA 2J7PA 3O4RA 2QHXA 3QEMB 1XAGA 1ECFA 4QDTA 4UZSA 4KYTA 3CX7A 1GEGA 1KEEA 1E3JA 4PFKA 5A7FA 4QD3A 3VNSA 1RI5A 4TKVA 3HU2A 1XNHA 5BN3B 3GELA 2ERCA 5CU7A 4ZKEA 5BWNA 4B3HA 4J4BA 4RV4A 4KACA 2BBTA 1YJXA 1ZUD1 5LZ9A 1A2QA 3IEMA 5DG8A 4U02A 2WEKA 3W1WA 4JZKA 1HZJA 1X39A 5AK4A 4PX9A 3BMNB 2BEKA 1QO0D 2VLIA 1XXLA 1T6YA 4FIZA 5AQEA 2I4LA 3V8VA 1WULS 2WAQA 2CYAA 3RJZA 3BRWA 3IR5A 4EWLA 4PO9A 4Z4IA 4DR3B 4B32A 2FPIB 4NBRA 2ZIWB 2HUPA 3CLRC 2ISSD 1GGJA 1EE9A 3OM9A 5FTNA 4M53A 1HSOA 3FMGA 4DQ0A 1JEQB 5K6RA 3HN6A 5LN1A 1E5XA 2EHJA 2VCYA 5FUXA 5ICGA 3PD1A 1N2CB 3AZOA 4YYEA 4WXPA 3CPHA 4B6FA 1LV7A 1B0UA 3LV8A 2R8PA 4KIWA 3AILA 4E7OA 2XQGA 1PR0A 3QVLA 3AWDA 1EK2A 1WP4A 1Y6ZA 4C4RA 2XCQA 5BSFA 1T2EA 5JEDA 5KDDA 4UJ5A 3QG1A 4C7MA 4ZZIA 5ARBA 3AW8A 4I1PA 1ETHA 1NXVA 1FA9A 2HCJB 1P1JA 1F38A 1JBEA 3MJ4A 4F5DA 3K15A 2O0KA 1NJ2A 3RIMA 2D2FA 4YCJA 4LQLA 1KJIA 3QP9A 1BMQA 1ZIOA 4DMKA 4HLUA 4MUIA 4MH0R 5GIPE 3DLCA 3FTNA 3R3HA 1HL3A 5IM5A 3RLFA 1KZ4A 4JAVC 3RU7A 1A98A 4IQ4A 2IYTA 4Z1MD 4CIWA 1FFGA 4X1YA 5ALPA 3F7MA 4J2OA 2C04A 5FPKA 4D3YA 4RH1A 2NOAA 2YYZA 2HG8A 3CE6A 1YR8A 3MWLA 3RO7A 3UJ8A 2V3VA 4N82A 2H4ZA 5T8KC 3IXLA 1Z6QA 2D4AA 1BFKA 4KGVA 3L7JA 4Q1AA 4PGAA 2OV1A 3U4AA 2NWQA 4Z86A 4ZZ1A 3B1WA 3CY6A 2X9GA 1F14A 3DWIA 2AYYA 3GPDG 5LQMA 3VOAA 1VL8A 7MHTA 5TB5A 1SVWA 3EZLA 2LCIA 4LVUA 3E9MA 2D1YA 5CFLA 4AFNA 3L5OA 4B09A 2V97A 1U4SA 3NWOA 5DQHA 2C2RA 1LBHA 1J8YF 4HNUA 2X0JA 5FWYB 1LDBA 2IPNA 1H3FA 2ZANA 1IBRA 3VU8A 3L7YA 4X62B 1K98A 1SB8A 2KLHA 1I9GA 5CT5A 2OY0A 3HB4X 3QZ8A 5JY1A 1VCOA 2PRKA 5KX5A 4TKMA 3E22B 1FFXA 3LHDA 1W0KD 3DMPA 1MZBA 4HPJB 4ILEA 3DCJA 4DA4A 1P45A 3DC2A 5MN6A 3DH0A 4BX3A 2ZSAA 3PITA 3VR5D 2JA7A 2HJHA 3LLCA 3TG8A 2XC9A 4IRKA 4Y2QA 4KE7A 4JYMA 4EQ6A 3RUCA 1UMDA 3EZGA 4HRYA 1LDYA 1CF9A 2BCJQ 3HRKA 1DAEA 1VXOA 4MP8A 5KVCA 2D5AA 1ZL0A 4BNMA 2EWWA 5BNIA 3MGBA 4EUFA 4GEGA 3ROTA 3QKUA 2PUDA 3K3VA 1ZXBA 1ISPA 2Y99A 1RKUA 1FP4B 1WSDA 4IIUA 3LO8A 3LYAA 4FK8A 1QCYA 4IMIB 1YBMA 1XRNA 1U2SA 1HE3A 1C1YA 3OZAA 2OT3B 4B3CA 2IYNA 2XZOA 1KOGA 5G0VA 2PO5A 1Q0QA 4ARIA 1X7XA 3PFKA 3HKDA 2QMYA 2N3ZA 3RSFA 4IRCA 1KFEB 4P34A 3W5AA 3B3QA 2HK9A 4YMTA 1NQOA 5LP6F 1ZI8A 2EV9A 1TAQA 1MQ9A 5A9SA 5BWMA 5EMKA 3M6MD 4GQIA 1UJBA 1D2CA 4C7JA 1ZK2A 4NWIA 2H00A 2G09A 3R74A 1CZKA 3WNCA 4X65B 1M2VA 1VS0A 3VKHA 2H11A 1FLVA 4JJAA 1Q83A 1VYVA 3RKSA 4YWHA 1RAEA 1RP1A 2O5EA 1KI7A 3DLPX 4ZPJA 5K8VA 3OF5A 3PDCA 2CFTA 2VRBA 4IEIA 2R62A 3LBFA 4P86A 1MG0A 1CFZA 3GJ0A 1KAQA 3ZGLA 1PE0A 2CSUA 2YJNA 2PH1A 3A4TA 3QEMA 2YWFA 3AF5A 3BTOA 4JLOA 2CUZA 3NBAA 2PRIA 2NQ2C 2DFDA 1YDHA 3EIQA 3OJEA 4D9CA 3WZ2A 2X0SA 2JLBA 1D1SA 2WTAA 1QDUA 5BN3A 3JRNA 1L5RA 2P2NA 2YZ2A 3HJHA 3L0DA 3I8SA 4UZFA 2Q8NA 2OK8A 1JXAA 3WKAA 2O0HA 5LMUB 2PL3A 3EH2A 3OPMA 1JFRA 2BYTA 2ZYTX 4I5EA 1PJQA 3BMNA 3BA9A 3NHYA 4R9NA 4JI6B 2FFAA 3AKEA 3TCNA 3PHCA 2JEJA 3R2JA 5EINA 4Z6KA 2FPIA 4TKUB 2ASLA 2IZOA 4Q9KA 4RVHA 1GFWA 3MQ4A 4TL8A 1JEQA 1C9KA 3O38A 1NLUA 3WWYA 1QRSA 1N2CA 2C9MA 1I33A 3NHLA 4QELA 3RGXA 3KLNA 3O9VA 5I9IA 2QTBA 1DIHA 2VNHA 2Y0PA 1HURA 3DVLA 2O2HA 3ZS8A 5CLHA 1QYVA 1DINA 3ONEA 4B8ZA 1ZRNA 1EHIA 4KWIA 3OEHD 4BWFB 2QZSA 2BC9A 1E92A 3N9IA 2Q2VA 2VRCD 3TBKA 4MEBA 1VM6A 5L1IA 4Q4CA 1SOVA 4P2GA 1B14A 4ECRA 1VB5A 1JXQA 2P3OA 3AUFA 4LQDA 3K2BA 4A3LG 3FOBA 1G1MA 1DUSA 2BMWA 3DOOA 1T10A 1KSHA 1BE1A 3ABOB 4HZUB 5LD2B 1KK3A 2EJ2A 1EFHA 4DKXA 4WLVA 4H18A 4KODA 3PC8C 4WOKA 4MIYA 3RVKA 4EX7A 3ROZA 4RACA 3HABA 4YS6A 2CEKA 2QJFA 1BKDR 4I08A 2F3RA 2XMZA 2G80A 1K8YB 3C8ZA 1I1OA 3B85A 1K66A 1PKEA 3EEOA 4Z0HO 4KR6A 1GDTA 1B1AA 4I3GA 3OT5A 1NE7A 3FH0A 3AHJA 5KQMA 5EEHA 4H16A 4PLTA 4CV2A 1HWYA 1UR5A 4ZP1A 5THXA 4P54A 5FWYA 5L4LA 3NBKA 3DS8A 3SYMA 3PGMA 3ZV7A 2QP4A 3L1IA 3JWGA 1BWSA 4U2EA 4FUTA 2QVYX 2V6GA 3DMNA 2FHSA 3TX2A 1NVVQ 1BGVA 2PUCA 2WOJA 3FHJA 3BRQA 2WWTA 3PXEA 3E22A 3ET4A 2VBIA 2EEZA 6YASA 2PXXA 4GW3A 2ZPTX 1FE8A 3KLPX 2XTJA 1W4BA 5DN6A 1OFTA 3RV4A 2IL1A 5CW1A 1CK4A 3WYGA 1Z7YA 5CVDA 3HDVA 3DFZA 1PT6A 4YRTA 4XIYA 3AOEC 3SE0A 3I2HA 4RGQA 3U26A 1NE2A 3CRVA 1CUSA 4RLQA 4LC9A 2PMWB 2HLPA 4XUDA 3C24A 2GN9A 3M9OB 3T5DA 5IYCG 2YV5A 4YRBA 4FXPA 2O1XA 4DCMA 2AOUB 1FP4A 5LA6B 3C3WA 2RBKA 2PYDA 5E38A 1TTPB 3LBYA 3HDGA 4NBSA 1ENPA 1GPMA 1QP7A 2ECPA 2FPRA 1F7VA 3RF2A 3O4HA 1W4RA 1XZGA 5EJIA 1H2BA 3W04A 2B4YA 1E6CA 2H2FA 4PCVA 1QPZA 3B52X 1IK6A 5TMBA 2CL5A 4PG6A 3MYYA 4I99A 1R3DA 4E51A 1YQXA 4RPIA 4JI3H 4U7WA 1MUUA 4J9MA 3H83A 4JBXA 3UY4A 3V1TC 4WLNA 3KV3O 4ZAYA 2OO7A 3IV7A 4R9RA 3FYHA 4QYXA 2CDAA 1K3UB 4I9FA 2C57A 2PX3A 4L8FA 1EGVB 2H2GA 3IAEA 2FWIA 1TJPB 2J3LA 2QI9F 3D6TB 4A2AA 3AUSA 3B2EA 5TGDA 3I0MA 3UWOA 2ODTX 1MA0A 2BRUA 2VYND 1BGWA 1HTWA 3IX7A 3CKYA 3OFKA 2FEWB 5AJTA 1XCMA 4ZOLB 3OJWA 3WNBA 2P4QA 4JHXA 5IKMA 1YTUA 1CW2B 2ZAYA 4YMGA 3O94A 1DZ3A 2FW6A 3T0IA 4CQNA 3W5UA 4DDKA 1NV8A 1KUTA 1D4ZA 1CUWA 5CT4A 5FAXA 2GM9A 4PBTA 1Y1VG 1RSZA 4Z7JA 3H1GA 2PNFA 5HZHA 1HLPA 2QD3A 1PV2A 5FOXA 2QTZA 2JEZA 2M6SA 2CZQA 1YMUA 3O1JC 4JI7H 2H4YA 2JEYA 2H18A 2HBYA 4AS3A 4NYJQ 3KTOA 2QQEA 3SQMA 1D04A 2CNQA 1EX6A 1NOJA 3M2TA 3LT2A 3F5QA 4YV2A 3PG5A 1SD2A 4UU1A 1MJGA 1FXWF 2ZRQA 3W1VA 3PDHA 1MH1A 1LDGA 3UGQA 3ETDA 3U55A 3CQZA 4E5NA 1GSOA 5DN9A 4XTRA 4YV1A 4N3NA 4J0IA 2DQSA 3B36A 2O4CA 1HYHA 3VU3A 2P3LA 1RAHA 4ECYA 4FN4A 3FSGA 1SC9A 2ZJZA 1K1SA 4O7NA 3GRUA 4CCSA 1X42A 2YASA 4BO6A 5FP0A 3IT1A 3H3FA 4IXNA 3DT9A 5KIAA 3HKCB 3EOZA 3MWKA 2QKYA 1W85B 2BTOA 2IEYA 3O4VA 2PBZA 5CBPB 4R6WA 2UYGA 5L8VA 3VNNA 4FD2A 1M7BA 2AUTA 3DMYA 1VG0B 1ZXXA 4F4IA 1OJLA 2HFJA 2W00A 4IMRA 3ZWNA 2HJSA 4QGSA 3I34X 4YRIA 2QYZA 4MVJF 3Q3EA 1J8DA 4HZUA 1CVRA 1U1FA 5KSYA 5DASA 1K4YA 5DLFA 2UXBH 3PUHA 3GOHA 4JP5A 4OXXA 6NULA 1C3OB 2AG1A 4H7KA 2IY9A 2WVJA 4Q4JB 1Q1ZA 3LUAA 4L16A 4XJTA 2FA9A 3WJ1A 1D2AA 1PO7A 4HVCA 5EJ4A 3KAQA 4HP8A 1XTJA 1E6WA 1F12A 2YJ3A 3RC9A 4BO1A 4QUDA 3NC0B 4NYIQ 4LTDA 4Z8YA 1ZNZA 3OQBA 3I2YX 2BUCA 1AX9A 4YT8A 2NUAB 4OD0A 2F3TA 2RJOA 7GPBA 4DQKA 3DLHA 3HXKA 4FM9A 3K9CA 5EMJA 1OAOC 1T43A 3NDIA 1X2EA 2F55A 4GMHA 3N7UA 4TYYA 4YV0A 4AUEA 1U80A 3R3JA 1VMKA 4IIJF 4CZ2A 4PSCA 4OJKA 3JWIA 5DOVA 1U9ZA 2DZDA 3SOZA 4HWGA 1PT7A 4ZU6X 4BNYA 4ETSA 1B04A 3ZTWA 2YS6A 5TLSA 4GVPA 3ZU6A 2V7PA 4DV3B 3EHEA 3D3QA 5A4IS 3GARA 2UZ3A 3DQZA 3SQXA 2QDKA 3RVPA 2PLWA 3AFNA 1BMFD 3EVDA 4PEVA 1XTTA 2ZRCA 4RXMA 3PUJA 5AVSA 3ML1A 1M7HA 3ULKA 4ARBA 1P2BA 1E4FT 2WJHA 5IP7G 4AY2A 4AKGA 2WKSA 1P4RA 4ZAGA 5JZMA 4P80A 2WLTA 3GTPA 2NZWA 1XEFA 1H23A 4JLKA 5JSYA 2BR0A 4DL5A 2V8BA 4FFMA 1WF3A 4V0QA 4HT3B 2GCPA 2AOUA 1D5WA 2YYYA 4HEA1 5LA6A 5C1BA 3TLEA 4S04A 4EFNA 3RB3A 1SCKA 3SHFA 2A9QA 2Y9MB 5M34A 1OGJA 3DT6A 3ZI7A 4DL3A 3ZWYA 3IP5A 4AULA 4G5XA 4QU8A 2WHPB 1ZK1A 4X8LA 2PUAA 2JJ2D 4DRYA 4QHTA 2O2YA 4EABA 3LRPA 5KNDD 4MAFA 4PWZA 1MAWA 3NDPA 4GIBA 3GTGA 1CLUA 1XN4A 1ICEA 4JJKA 3U49A 1NASA 4BE4A 2EKZA 2OHOA 4TTAA 4WASA 4NMLA 3UB2A 1NQXA 2FYTA 2ISQA 3UFBA 2VHEA 4GGOA 4G0QA 1D9ZA 3TLGB 3EIEA 5BNFA 1XD8A 2V7TA 1U3UA 2Z0MA 2I54A 3CUYA 3THYB 1XWFA 2PM8A 3OZXA 5TT1A 2HGWA 1PU2A 1I80A 1UQUA 1LPSA 3VC3A 5BR1A 4IRUB 3V4OA 1SUSA 3ITDA 1E9RA 3QBEA 5CDYA 1K3TA 5H16A 5L9AA 3ABZA 1PJTA 4JWTA 3ZU2A 1G66A 3NBUA 5CA0F 4F4CA 1R6VA 2BEWB 4QWMA 1X7ZB 3JQEA 4ZOLA 2VJDA 4LX0A 4IIBA 3F6PA 4F7DA 1TFUA 5F3RA 2YZKA 5B4TA 2CFIA 1E77A 1LWOA 2VHYA 1PJ3A 2PMDA 1X9HA 3A3OA 2OWOA 3CBGA 3GJXC 1UAYA 1EVZA 1WVGA 1XA4A 3KQOA 3TW7A 3L1UA 3OT1B 1JVBA 4R3WA 3TQQA 4IO1A 4RV9A 2GZ1A 2ZTHA 3HCFA 3TEMA 3GJ5A 1ZJJA 3T41A 5LSAA 4KPFC 1U6JA 2PGJA 4JFRA 4TN1A 2I55A 1ZBQA 1Z28A 1VSQA 2X0EA 2G1UA 3GQCA 2GAJA 5FV4A 3PZPA 2TYSB 3G0BA 2W98A 2WIKA 1YK0A 2PYIA 1JHPA 2DWOA 2CNLA 4S2UA 5AJYA 3E7WA 1MN6A 1RRPA 4JYBA 5I9SA 1ESCA 3AF2A 1NN3A 5GJBA 2JJYA 1UMKA 4A0HA 3VC2A 2R93A 5FNVB 1RM0A 1L5FA 3W3AD 4TLCA 2ID4A 2YN0A 2ZQYA 5CTJA 3UXHA 1PCXA 2YWXA 3WX0A 1Y4DE 4CDRA 5KWJA 1Z5ZA 2IE8A 2V7XA 1QNFA 1IJBA 1RI3A 3AJAA 3QUAA 3HKCA 1JG1A 2ASJA 1N4AA 2F48A 1W85A 5CBPA 4D8VA 4CM9A 1TKBA 4FZ5A 1HNWH 3BCUA 3LFTA 5K5EA 3RFXA 1NBMA 1ZMRA 3UGKA 2PBFA 2LE0A 5KFSA 4ZVOA 2AG8A 1WNTA 1HLDA 1KVTA 1BW9B 1XWIA 4QGBA 2RAVA 1IEQA 3OCZA 4M0DA 4D8TA 2VYFA 3QIVA 1FIUA 4X90A 3UQZA 2NAPA 2J7KA 4JJGA 1C3OA 2O2IA 4Q4JA 5DYWA 1TZBA 2UAGA 2GCIA 2YMQA 3RIXA 5KQSA 1UKAA 2J08A 3WWPA 1RFGE 4JJFA 4D57A 1K97A 2F8TA 2HSEA 2VBGA 4INJA 2HPHA 4KXUA 3TKAA 1VBMA 3T1VA 5EP1A 1R64A 2NUAA 1OC2A 1QWOA 4PLFA 3ODGA 3VSAA 2PH5A 2XAAA 3QLUA 4L9AA 4G41A 1VECA 5K0BA 1TQ8A 5JNUA 1VRWA 3A11A 3DMFA 2PKQP 2CHVA 4GWLA 1OWOA 3KWMA 1P9NA 1P3DA 4LK2A 5AVOA 1KR2A 4OGKA 3F7TA 4BBSG 1QIKA 4LOLA 4B31A 5D1OB 1OQAA 1KC3A 1P0MA 4YQWA 1Y1KE 2FOIA 1P17A 2AOTB 1XHEA 3ZD6A 4MYDA 1CEYA 2VF7A 2C3MA 4GC5A 5LWQA 1QG0A 1IYZA 4KHPH 2C5GA 1K89A 4AJ9A 2X58A 4CM6A 2WP8J 1ULZA 2J5QA 3DYBA 4KFUA 3NHSA 1EX9A 4RKWA 2XRYA 5GZ1A 3EZ7A 3NVDA 4MQ5A 4M36A 4C4XA 2XSZA 4AXBA 3WRXC 5GMOA 4OBWA 2WF5A 2AJLI 1N1MA 1BWPA 3IAS1 4OQMA 3O82A 1TM3E 4F9EA 1UZNA 3O8DA 1VE3A 3I23A 4DADA 4W7IA 3R7LA 4JKOA 4JV2A 4IJQA 1Y63A 2WHPA 4AECA 3SX2A 1WETA 1G8KA 5C5EA 4F6CA 3HO6A 2QW8A 4JC4A 1ZAYA 4LNUB 1BIFA 1S1CA 5IAEA 3QEJA 4PV7A 5GZ3A 4GOKA 2P91A 3VSBA 4N5MA 3H2HA 4XRRA 2OBYA 3RRZA 2VIIA 1S2MA 5CD1A 3OIGA 3G2JA 3THYA 5KI6A 1D09A 2UUPA 2ZVJA 3D3NA 1OBGA 1PJZA 3GA7A 5U9CA 3D7LA 1YIDA 3BN3A 2QGZA 2BFBB 2OV3A 1JE0A 4Z4HA 2A14A 3JYOA 5JFTA 4XGNA 1XTZA 3DAHA 1O87A 3IDZA 3GTOA 4AQYB 2VP0A 2RGWA 3UUFA 4QDXA 2BEWA 4PZCA 3ITEA 1X7ZA 3HCCA 4FE7A 1FSFA 2NPOA 2HQSA 3LULA 2NV2B 2R92G 1JHMA 3TR5A 5ALKA 3RGZA 1G8JA 4AKHA 1OBHA 1XAHA 2VZ0A 4R1TA 2WPNA 1N9KA 2BLLA 4OCZA 2Q5EA 2HA6A 5HKKD 4A3CG 1NSFA 4IP0A 4KV7A 1XDDA 3TBHA 1V8DA 3AM3A 3IBTA 1IBLB 5IT0A 4UTVA 4F56A 1JTEA 3OT1A 1HEYA 2BDTA 2W8ZA 4OHPA 2ZYHA 4TTJA 3ZIUA 1K1EA 5KFUA 1WPRA 2HI0A 1WKCA 4HLUC 4V1CA 2BFEB 5B1DA 4Z3OA 3H1PA 5AI4A 4DQDA 3ELYA 1KPIA 4PO8A 4YI5A 1STOA 1ZD5A 2JD1A 3COWA 3SS9X 1KEKA 5JD6A 3T9DA 3E8SA 3HOVG 1JBKA 2VCEA 3L9WA 3R3ZA 2JFVA 3KQPA 3MAGA 2J9YB 3OSUA 3GRCA 4FX5A 2Z4SA 4PSUA 3ZH2A 5J4HA 1I3MA 4YMIA 4Y0VA 1G4HA 3BJYA 1R6DA 2WUGA 4D4GA 3U7GA 3WHKA 2VRWA 5FNVA 3NWJA 2QENA 2BIFA 1C7EA 2IKSA 3UAYA 3KJIA 4K6NA 3AHGA 2G67A 3OIDA 1ST2A 5TEWA 5A06A 3ORQA 4M21A 2QXYA 1W76A 2Z2ZA 4DIEA 2XGOA 3V7NA 3TXYA 1BXKA 3DDSA 1U90A 4NVRA 2QX7A 2GHIA 1GV0A 4ME6A 4G0VA 2XWBF 4DCCA 3IUQA 3DZBA 1O58A 5J40A 1WCMA 4U6PA 1KKMA 1RZRA 2WJIA 3KYBA 1TJ4A 4DQUA 2V7EA 4DILA 2HHFB 4HQKA 1YACA 3QE0A 2OPBA 3NHWA 2B99A 4PRYA 4PFSA 1UAAA 2OBBA 2ZE8A 5CCXA 5K3DA 4JUFA 4HLDA 2G04A 4ESOA 1JHUA 1ZC4A 1H85A 3TLAA 1G59A 2VPSA 2WF7A 2ONKA 4YAOA 3LZDA 2IPXA 3QUTA 3ASVA 3CKMA 4RABA 4BEVA 1UBUS 4CR6A 4W1SA 3KT0A 2HIMA 3KXKA 1C14A 1TCCA 4B4VA 4YFVA 3GIKA 1MEOA 4QBIA 4OEHA 3EZFA 4UE2A 2CCJA 1N78A 3LUJA 1ZETA 2I2XB 1QG4A 1RZVA 1TVEA 1QONA 1XXHE 4XARA 4JQZA 4AN0A 4C89A 2ENWA 1QVRA 4Q45A 5IJZA 1PQPA 4L8LA 3PA8A 2I0FA 4ONEA 1NIPA 4IDBA 2PZMA 2NTYC 3C6BA 5D1OA 4QBFA 2BKLA 3I1IA 1KC7A 2VDOB 1IYDA 2IYPA 2WKQA 1TT7A 2PZEA 4EITA 4OYRA 3GAAA 3KTDA 1Z13A 4WKOA 3Q8KA 3T61A 4L5JA 1JKJB 1MVNA 5DGCA 2OD2A 1S9FA 2DBYA 2UYHA 4KXWA 1CJMA 4Q3LA 2E18A 1V9LA 5KOIA 1N92A 4X44A 1W34A 4RZ3A 4MUMA 1U65A 1UP7A 5A03A 4LVOA 2HUNA 3KRTA 5LM3A 3W79A 3WSVA 5AFSA 4PF1A 2DM6A 3CVVA 1TWGA 2HQOA 4DR1H 2HADA 2WU1A 5G2OA 3V6KA 3HDTA 2X8BA 4GQBA 2AN9A 4I55F 2D06A 3EGDB 1Z2NX 2V0NA 1CUUA 2AZ4A 1I4LD 5K0NA 2YXBA 5F77A 5JTUA 3CZMA 3A6LA 3TZ6A 4LNUA 2QRLA 4KQ9A 1CVIA 3SX0A 1PS9A 1P8LA 1DPGA 1G6HA 4FCTA 2C1ZA 1DWOA 1GPH1 1XTQA 3T3OA 4NBVA 4GXQA 2AFIB 3PX7A 2G3YA 2H7VA 1YQEA 5FLKA 1F9EA 5E2IA 1ZCFA 4FDUA 2A6PA 4AMVA 3KEFA 2XUOA 5MN5A 3CW2A 3JAMA 1NQ5A 1AHHA 3IIJA 1G64A 2JLZA 1EK0A 5CNKA 1O5TA 4Q01A 1K2WA 1FU4A 4DMGA 3EZ2A 2BELA 5JXHA 2FHPA 2XXJA 3OPYI 2QLJA 4KYVA 2EKBA 5TJ9A 4BFTA 3I6BA 2BFBA 1SQ6A 1PJ2A 1I6WA 5FADA 2CNVA 2FG7C 2Z6VA 1KQOA 3GNQA 3LQ1A 3BEDA 1PBTA 5L3ZA 5CH3A 1NI5A 1BMTA 3B1JA 2OXCA 1H9CA 2FE1A 1JHOA 4ZRMA 4RB0A 4A1FA 1VIDA 1W4CA 3Q3VA 4MS3B 1ZFNA 2MSKA 3UPTA 5EIBC 2O8CB 2ZIFA 4O4LB 4MX8A 4KVZA 4RTRA 2W6NA 1Y6QA 1RPAA 4XZ3B 1L8LA 3MILA 1DX6A 4DR6H 5ED4A 1EFLA 4TZTA 3L0CA 2Q3EA 4MRNA 2VK4A 3M89A 3P9RA 4IIYA 5ILQA 2BFEA 4JJIA 4FSDA 1KBOA 2GJ8A 2ZB8A 3ES9A 4DLWA 4BP9A 2WSYB 4Q9AA 2EJ0A 3MFYA 4NK5A 4J1QA 4IXTA 3H2GA 2IF0A 1D0IA 1JYEA 4URWR 5EJEA 3F5MA 5E9JA 4QNNA 5GJWC 1EGAA 1LCIA 3MJHA 4HNTA 2G5PA 4K8OA 1WDMA 1OAAA 3HSSA 3O75A 2RHCA 4EY7A 2FPLA 3I12A 3QFHA 1KZGB 3CUSA 1PK9A 2CJXA 2JCGA 2O1EA 2QUJA 5DGDA 4IJ5A 2VJBA 3PX3A 1ES9A 2UXDH 1J2UA 1PV4A 4WXRA 5A1JA 4HXFB 4XVRA 2IZZA 4O3NA 4HGQA 4FFRA 4LOIA 4CV3A 3EISA 1CZUA 2GD0A 1PGJA 2OZEA 4Z9AA 1LD3A 3HOWG 2QZPA 3VAAA 4YP6A 1FYEA 3LXMA 1XF1A 2WWVD 3FDSA 1H2XA 2PUFA 4A23A 3KHRA 4JLMA 4X00A 3BABA 3FCEA 1OB5A 2OG2A 2ASEA 2P9YA 1KJNA 2G63A 1M54A 3I2KA 2E6UX 3ZWAA 3BT7A 3ACBA 2I6FA 4MQBA 2GPWA 4RL6A 3TW0A 1QGYA 1R15A 2HHFA 4DDVA 1B4DA 4G1EB 2CN1A 3UZOA 4CC5A 2XMBA 3VZCA 1GO2A 3LCVB 2OOKA 5K8JB 4D4IA 2J67A 4J76A 3MMSA 3KJNA 3KPYA 3RROA 1VLVA 4LXYA 1EBUA 2J48A 5JPIA 3OA0A 2VWPA 3M6WA 2Q1SA 5AW6A 1RQ2A 1KXZA 4MQEA 4URXR 4OJQA 4WZBE 1SEPA 2QF7A 2RHDA 3OQ1A 2HA3A 3WB2A 3GMIA 1OIWA 2DHRA 4DR2B 2NXNA 2BHTA 4LZWA 4MLPA 1P39A 2H54A 1DRUA 1UDXA 1NXSA 4B9EA 5BQ5A 2X6QA 1IM5A 2DUJA 1SKYB 5EC8A 4REQB 1AGNA 1TTTA 2QVGA 4GBED 3CVZA 3WMFA 1KJZA 5AI5A 3ZCUA 4F86A 4EG1A 3UWPA 1QDLB 1YH3A 4KL8S 2FPWA 3GRPA 1N3BA 2RDIA 5EVJA 4DMRA 2BM8A 4TWIA 4GKBA 5HR5A 4J9OA 3GTQA 2QNBA 2CYCA 4E1AA 3OQHA 3TZCA 4GX0A 5F21A 4PRKA 2FETA 4RE6A 3NFRA 1V7ZA 1JIKA 1DIGA 1IY0A 3T5LA 3G8DA 1GGFA 2Q6IA 3KQYA 4QTZA 2IS6A 3HZRA 3ZCXA 5YASA 3LPDA 3AKDA 1VJ5A 1P16A 1JKJA 1UINA 1VKRA 3NEAA 5JZVA 3IUPA 4J3JA 1CUCA 1I24A 3M49A 3MXOA 2C5SA 3OM1A 5AHOA 3KT8A 2VT7A 5H80A 1L5ZA 4NE7A 4UHBA 4D1YA 3J7AK 4XI9A 3PYMA 2OO5C 2ZB7A 2R5WA 2BRUC 2AOXA 2PX5A 3GG2A 1Z4JA 3CN7A 2BSXA 2BBOA 2XDYA 4TQRA 5F64A 1E79A 1N25A 1T4CB 4OQQA 3D64A 2B5OA 7YASA 3EGDA 4C06A 5L4SA 4P5DA 2G9UA 3B5EA 4EP1A 4C7VA 2AVDA 3A2NA 4I19A 4UUGA 1ATZA 2ZAMA 2P7IA 3GFBA 3QTBA 2AFIA 1JJBA 4J0MA 3RSCA 2HCBA 3EZYA 4JODA 2IZ5A 4TS3A 3S29A 2FGKA 2P35A 2FLNA 1M8FA 2NTNA 4K6MA 5CYOA 5EGNA 5F98A 5DB4A 1JPVA 2VNAA 1JQKA 2F17A 4XIFA 4D79A 3Q1LA 5SYNA 5IXSA 1GZSA 2FQYA 4UQPA 4RUKA 2PZBA 5FOWA 4LOAA 3KQMA 3LPLA 3CX8A 3PO3G 4NZ9A 1YHNA 5DAAA 5MFZA 1B41A 1QO7A 3EODA 4PY2A 1KP2A 4ZQCB 3E2MA 3F3YA 1JU9A 4TMKA 2QE6A 1MC5A 4F21A 3HA5A 2BAGA 3I3SR 5K3SA 1G21B 4MS3A 2O8CA 3T9EA 4O4LA 2YH2A 2BJWA 3K7EA 4JJ7A 2XCRB 4M8NE 1WMBA 4EGCB 4XZ3A 3EVAA 2ASDA 3EIWA 1IUKA 4UC0A 2R6GA 1IQRA 4EG7A 4WK2B 1T8UA 4MRAA 3GEBA 2O0MA 3UCEA 3OE7D 4CTKA 4TSFD 1C5KA 1QANA 4RPLA 1OUMA 1YNSA 1UAGA 3RFFA 1WZUA 5P21A 5KWSA 3TIIA 3M6UA 1KDYA 1CJTC 2GBLA 1FZTA 1WQ1R 2CXOA 2RGXA 5LD2C 1SELA 3OX4A 4B4WA 4CGYA 3AUJB 4EW1A 3AF3A 3DKKA 2V0CA 3AR9A 1QKKA 2E4UA 2VSYA 1A1SA 1R7RA 1RK5A 2SBTA 4DY6A 1YF3A 5DKFA 2QRGA 4TTIA 1QF6A 1DBWA 1RBMA 4L9SA 2A5JA 2MSCB 3RODA 4JOCA 5NULA 5I5SA 4MPTA 3ZZTA 3PC2A 4EG0A 2OWEA 2Y68A 2PKEA 1BZYA 1E1QD 1V48A 2QPAA 1YA8A 5EWFA 3R3VA 1XU7A 4B33A 4MYTA 1PT9A 2Y6VA 1N5KA 2LR0A 3LTEA 1UM8A 4NYMQ 4DQLA 4CLOB 2IEIA 2OE2A 2E37A 2QTGA 3P2OA 4C4PA 3KWLA 4BQIA 5IULC 1TAEA 4DVJA 5IDVA 4D41A 3IOMA 2NU7B 1WCWA 2JHAA 3CPSA 5E9QA 3BF7A 3E81A 1RK6A 2AJ8A 4PGFA 3G8AA 1NUQA 1CF4A 4ZOBA 1D4OA 1YKFA 1L7DA 3SICE 5ECGC 2XTNA 4OLAA 4KRGA 2Q5JA 3UK2A 3GEPA 3GDHA 5AM3A 1E0KA 3VZSA 1HE5A 4GZMA 4GC6A 1AK2A 3RG2A 2CMFA 2H57A 2ZRMA 4K6OA 5C8XA 1XA3A 4B6SA 2OL4A 4PHTA 3KAKA 2ZT5A 2GI4A 4XOIA 1WB5A 3DMGA 4LFCH 1ABEA 1Z56C 3T0FA 3IODA 2ZYDA 5AUQA 1L7MA 1TNDA 3UJBA 4REQA 1ORRA 1TA0A 2OCAA 4PWYA 3D8HA 1L1EA 2OFFA 2NO0A 2PMFA 5A5EA 1H22A 2P9EA 4FB5A 4PICA 2V4MA 1I2BA 3PHHA 2R1VB 5AI8A 3NVAA 4L4SA 4KH0A 4KMMA 1VE1A 3DL0A 4NE9A 2C94A 1N1EA 2WJJA 3WK6A 3U4GA 4F2WA 3OZFA 1UM9B 5CM2Z 4CUJA 1N1GA 1K8QA 3K30A 1IUOA 1FSGA 5A71A 4GSLA 3W4KA 4ZFNA 1EJBA 4C08A 2YR0A 1SH7A 2WF9A 1QRTA 3RCBA 4XWOA 4Z1MA 5INTA 1XTKA 3PQ8A 3LT0A 2AK3A 5DHUA 3RE1A 4B5LA 4GFDA 2QLLA 4JENA 1GKLA 1NJFA 4JLVA 5DNDA 2R00C 1T4CA 4DAOA 5KG0A 1IATA 1TZKA 1NJ8A 2DPIA 1R2QA 1UBMS 4NS4A 1WD7A 3COYA 1IXZA 5KKAA 1GPLA 3BMCB 4TRNA 3IELA 1QLJA 3GROA 4N0PA 3M1IA 3AP3A 2FW9A 4ZXFA 2Z30A 3BWXA 1A96A 4WCVA 4US1R 1C7IA 1P9OA 3CWQA 2FEKA 4DBZA 3ZV6A 3L46A 1SBZA 1GTSA 3RUFA 3PXBA 2G8NA 4ATNA 2ZSFA 4UXJA 1S2IA 1Y7LA 4NDNE 5KFCA 3PUKA 4BVBA 5IVKA 5CDFE 1F4VA 1E63A 3E7FA 1RAIA 4QWAA 4QDZA 4CWAA 1PWEA 2A5FA 1MQ8B 3IEIA 5EUQB 1USVA 4U8GA 4J03A 2XXAB 3TZLA 4DZTA 2YWBA 2RBEA 1OI3A 4XKJA 1PQ4A 4C4TA 4U2DA 3Q41A 3S8EA 3TNDA 1G21A 3NTLA 2QTFA 3O91A 2YCBA 5DCWA 4MO9A 3U37A 1AF4A 1POWA 4J9VA 3GIMA 5CA1F 2YY7A 1J9EA 4LGMA 3W8DA 4F45A 4GKAA 2D2VA 4XB6B 2ZJ2A 2DQZA 4DCOA 1Z0FA 2JAHA 3ZNPA 3S99A 5HIIA 3DP9A 4J6FA 1YRLA 2GXQA 2ODBA 3L8GA 2VQEB 4NULA 4MUGA 4PGMA 4QXQA 4AJKA 1X1QA 3QUQA 1EWKA 2CMKA 3FPJA 2ZBUA 3PW7A 3PICA 5ALQA 4JBHA 2BBSA 2CGEA 3O3NB 1GCIA 1OZAA 1JQAA 1GNQA 2UXCB 5ARDA 4BAZA 1RLIA 5A62A 4ZZ2A 4JUZA 3UPDA 3SYTA 1RQGA 3MUOA 4ZAZA 1C8LA 2BGNA 3RKRA 3FBWA 3PE6A 1RHMA 1UPTA 4BGVA 1CJVC 2JA8G 2JG3A 2XVAA 3AFMA 4F93B 2IY8A 2PWYA 4WOCA 3LLMA 3FMFA 4X0EA 1M83A 2XGSA 4MWDA 2ZDGA 4KNVA 1A8IA 2CNNA 2WT4A 3F4LA 3KCNA 4IY1A 2GN1A 1DC4A 2OKGA 1DCFA 3OM8A 4HDKB 2JIOA 1EJ2A 3B3FA 4XR9A 1P1BA 4ITUA 4GI5A 3ABSB 4CXMA 3MTJA 4EKNB 3QLUC 1IYEA 3V6JA 4FS3A 4PLZA 1V96A 4CLOA 4Y67A 1QIEA 5G02A 1ICIA 3KM0A 3INTA 1X3SA 4JSTA 1HGXA 3DHWC 4UVGA 2TMGA 2J09A 2NU7A 1IONA 3D6FA 3V8PA 1WUIS 3G5UA 4X3OA 1O5IA 4HVTA 2O1WA 2WWYA 1SUCA 1N77A 1F4LA 1F51E 1W4LA 1BAPA 1KXJA 3DE2X 4ZV9A 2YVAA 4JOSA 3PFBA 4N7BA 3C48A 3UMYA 1MRNA 4ZEXA 1IVSA 1NRJB 5T3YA 4F2GA 3PLRA 2H4FA 3KZMA 2QL9A 1F48A 4J7XA 2IV7A 1VSTA 4HDQB 1U0TA 3SZMA 1GP2A 4C88A 3A9CA 3PNYA 1WZ2A 2J9ZB 4MR9B 5EJ9A 1Y1RA 4V0ME 3ZYZA 2OZVA 5DBIA 4J0FA 1Z36A 2RGYA 3VZBA 2HLNA 4UFZA 1D1QA 4MP6A 2F9FA 4XEHA 4BU1A 1MAVA 3HP1A 3F71A 2NVXA 3L01A 1V6SA 4Q03A 2W43A 4XIIA 1SXHA 4FDLA 5TVKA 3T1TA 3NBZB 2Q99A 4HNSA 4MQ4A 1YQ9A 4IDPA 3W78A 1QK3A 5F51A 2F9LA 3PR1A 4XD7D 2WTMA 2R1VA 4HUQB 3IUBA 4YACA 2Q46A 1S3GA 3CH4B 2OQVA 5CB0A 5HF9A 3WMWA 3N7TA 3MRSA 4JLDA 2J3EA 1MB0A 4P84A 1UM9A 1SC3A 1GPYA 2ZRPA 3ADKA 3QW4B 1LUAA 4DUGA 4MAMA 1P2VA 1X7GA 4QTXA 2XB6A 2OXTA 5DM2A 2YUTA 3TQ1A 4LJ7A 4KMSA 3GQVA 4NTZA 1CF2O 4OPMA 2VRCA 2QN2A 1SUBA 4ZQGA 1GL7A 2ZJ5A 4LRTB 4ZCRA 3ZBUA 3IKJA 1VL0A 1YVPA 1RWMA 3WGJA 5I7UA 5FO0A 1OA0A 1M8JA 1FXUA 2NSHA 1Y6JA 3OG9A 3V42A 2YIJA 3R20A 2HGZA 2WAQE 3LJKA 2W4QA 2VA2A 1A9TA 4Z4GA 4IR9A 2YNMC 4I14A 4YEDA 3CU5A 3MWDB 3CZ5A 3N2IA 1GRVA 1KPHA 3Q1KA 4IIXA 1HRKA 3EPIA 2RHJA 2FRVA 3QYFA 1EGHA 2DFVA 2HU7A 4PG8A 2FPOA 5DIZA