1AUVA

Structure of the c domain of synapsin ia from bovine brain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
306
structure length
292
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLINQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAKYDVRIQKIGQNYKAYMRTLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synapsin I is structurally similar to ATP-utilizing enzymes.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords SYNAPSIN IA
total genus 80
structure length 292
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1auvA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1auvA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auvA02
5H80A 3RUPA 2GPSA 2PBZA 1OBDA 3VOTA 4O2AF 1IOVA 3RFCA 4O7TA 5FNVF 4O4IF 5BPHA 1CS0A 3KREA 1KJ8A 5C8YF 2YW2A 2YZGA 2FP4B 1B6RA 1SCUB 2YZMA 4DLKA 1M0WA 4O84A 5EZYF 4EAAA 2GQSA 2YZLA 4C5AA 4FFPA 3K5HA 4C5BA 4O4JF 4EA8A 3AW8A 3G8CA 2DWCA 4I55F 1GGOA 4IWXA 1GSAA 3LP8A 4O4LF 5JVLA 1I7LA 2V58A 3ETHA 3N6RA 5DMXA 2P0AA 4O7RA 2R7KA 3VPBA 2W71A 4YBZB 2W6NA 1A48A 3MWEA 2CNUA 5LOVF 4MV1A 4M98A 5JVDF 1VKZA 4O7NA 4YAJB 2FPPB 2NU8B 3SE7A 2VPQA 1E4EA 2YL2A 4HR7A 4HNUA 4O7LA 3VMMA 1IOWA 1KJJA 5LYJF 1KBLA 4FFLA 2I8CA 1JDBB 5LXTF 1KEEA 3HO8A 3R23A 4O4HF 2X0SA 5CA0F 1DIKA 3V4ZA 3Q1KA 1DV2A 5LP6F 1M0TA 3BSWA 1GSOA 1EYZA 2V5AA 1W96A 2NU6B 2YZNA 3WO0A 5JQGF 1KUTA 2W6ZA 2GPWA 2J9GA 3DF7A 4M9UA 3I12A 4MA5A 3TW6A 1AUXA 1PX2A 4TV9F 3JRXA 2W6MA 3NUAA 4EABA 1C3OA 1WR2A 5HBRB 4YJ3F 2DIKA 3BSSA 4M9CA 3N8DA 3QFFA 1KC7A 3V4SA 5D8DA 4IHJF 2CNVA 4EA9A 1VBHA 2ZDQA 2NUAB 2NU9B 4FFOA 3TQTA 1EUCB 3Q2OA 4TV8F 3WNZA 2ZDHA 3JZFA 3U9SA 2YS7A 1Z2NX 3OUZA 3KAKA 4M99A 3G8DA 2YRWA 1BNCA 4XX0B 4C5CA 4EA7A 1KJQA 4FE2A 4ZQIA 4TUYF 5CB4F 2FPIB 2YRXA 3UFXB 2I87A 1PK8A 4MV9A 2R86A 3BFPA 5BMVF 4O83A 3GLKA 2Z04A 2R84A 4O7WA 2V59A 4ZOLF 2CNQA 2W70A 4XZ3B 4YAKB 3BG5A 5LA6F 3MWDA 2R82A 3K3PA 1T36A 3KALA 1DV1A 4EG0A 3U9TA 4HQ6A 3RV4A 5JQWA 4FU0A 2R7NA 3ORQA 3RV3A 1JLLB 2GQRA 2WYOA 1UC8A 4MV7A 4XYLB 4GGMX 2R87A 3JZIA 3AX6A 3HB9A 1JDEA 3K5IA 5KKNB 5JH7F 2R7MA 4NYEA 3TIGA 3TIIA 3HBLA 5CAEB 3E5NA 4MV6A 4E4TA 3R5HA 1EHIA 5J2UF 4IWYA 4O82A 5J2TF 3R9RA 1Z2OX 4FFRA 4WD3A 1JKJB 4IIJF 3VA7A 2W6QA 2OLSA 2PN1A 2QF7A 3MJFA 3R5FA 2FPGB 4RZQA 1Z2PX 1A9XA 3VPCA 4HNTA 1UC9A 1GSHA 1KJ9A 2VHEA 4I50F 4MA0A 3OUUA 2QK4A 2W6PA 3ETJA 1E4EB 5C1OA 2YS6A 3U55A 1VBGA 2R85A 1OBGA 2YYAA 1BXRA 1CQIB 3VPDA 4ME6A 2NU7B 4I4TF 3JRWA 4O81A 1EUDB 4O7YA 2CQYA 4WBNF 2DLNA 2SCUB 2XCLA 3R5XA 2C00A 4O7VA 4FGRA 2ZDGA 2XD4A 5KX5F 4XYMB 1ULZA 4MV4A 4FFNA 1C30A 3LWBA 4Y8VB 2R6FA 5IYZF 4MV8A 2VR1A 4ZI7F 4MV3A 2GLTA 4EGQA 4L1KA 4FFMA 2W6OA 5CA1F 1CE8A 2I80A 3TINA 4EGJA 3GIDA 5K2MA 5I47A 5HV6A 4O7ZA 2YWVA 2IP4A 4IZOA 2HGSA 1AUVA 1I7NA 2NPOA 1EZ1A 4O2BF 2R7LA 4QSHA 3BSYA 1B6SA 2HJWA 3WO1A 4MAMA 5BPFA 4HNVA 1W93A 1M6VA 4YJ2F 3ORRA 2PVPA 5GONF 4O86A 3KAJA 2CZGA 4O7SA 1KJIA 2Z02A 3U54A 5C1PA 2VQDA 2DZDA 2FB9A 4ZHQF 1CQJB 4J6EA 4YB8B 4DIMA 1GLVA
chains in the Genus database with same CATH superfamily
4OX9Y 5C32A 5H80A 3RRXA 1N2EA 3NATA 4UNRA 3G17A 3KVVA 1BXZA 1YZUA 1XCJA 1OBDA 2NO0A 2EG5A 2TRSB 3D4NA 1JU9A 3T5DA 3TW8B 1M0SA 1P7PA 5AK4A 1AKVA 3RFCA 1Q17A 3N2ZB 4YCLA 3FRHA 4MWBA 4LOKA 4TTPA 3VMFA 2I4NA 5I7OA 4X44A 1P5JA 2AD1A 2ZSIA 1E1QD 1X0XA 3H05A 1J7JA 1VG8A 4RZHA 1MT0A 3LCCA 4YAWA 2VHXA 3R7WB 3VTFA 2NX2A 5M34A 1KEPA 2V6BA 4DHWA 4MVJI 2HM7A 1SVNA 2Y0SA 3F7MA 1MO3A 3O1HB 5SY4A 5THXA 3TLJA 2Q3EA 3L8FA 4REOA 5I9IA 2ATLA 2RGXA 4FE7A 1T2FA 5I7VA 1L1QA 4Q66C 4B3HA 3AB3A 4CLOB 1JZTA 5F1PA 3PUKA 3DEIA 5CDYA 4Q4AB 3U7HB 1WQ4A 3C8UA 3ER8A 3F78A 3B78A 4MAFA 1KHHA 2EL7A 3F71A 4NJMB 4G5GA 1OX6A 1SXJA 1EXWA 1U1EA 1J5XA 5EC8A 2YR0A 4O4HA 5EZYF 1PEAA 3HO6A 4YTEA 2GBIA 3T3DA 4DV2B 2X5RA 4E4YA 4UXJA 3GRAA 5CVCA 3THWA 2WZBA 3LRXA 1BDHA 4FHZA 1AK9A 2F3PA 5KDLA 3B52X 1UDAA 1YAHA 4NAVA 4P0PB 2ZM6H 4B73A 2H06A 3HV2A 1WKCA 3RDPA 5FWYA 5KTRA 5F77A 1CNFA 2G09A 1MU0A 4JJ8A 5H1YA 5CFRA 1G2QA 4HFNA 3KSBC 1S8FA 1PJ2A 5KREA 2RHBA 1JNXX 3RVNA 4I55F 1RYZA 2GCPA 3COJA 4RKFA 5FBHA 3WB9A 2C07A 3VNNA 1M34A 2WICA 4DGQA 1T9HA 4RGQA 2I6FA 1Q2XA 4B44A 4DJFC 2ACKA 1KK3A 1K7XB 1FFGA 2W8ZA 1VIYA 5IPFA 3M89A 3PUVA 4KP7A 3H17A 4L8VA 5FQOA 5H59A 3C6YA 5KOYA 3KETA 2G8LA 4UNSA 1E3SA 2QXYA 3HLKA 5BO5A 3NOOA 5AUOB 4KFUA 5KMGA 1DBPA 3P0JA 4DL7A 2YINC 2H5EA 2WMOB 3Q3HA 3MAAC 2NAPA 1I4TD 2P41A 4L6AA 4RABA 4UUGA 1QF9A 3DOFA 4FIZA 4YNBA 4R2HA 1W0KD 3IG0A 3K30A 4H31A 1P0PA 2ZYWX 3A2LA 1N6PA 2XRFA 1CQZA 1U8CB 4L2IA 3KFVA 1GUFA 3LUJA 2G80A 4NRDA 2NU8A 5LDDC 4B45A 5LUAA 4ECVA 5T57A 4WLUA 4Q39A 3M6UA 4DMCA 5KDDA 4PYRA 3KZKA 5IVPA 3AUSA 2BR0A 1P19A 1U8TA 3JWEA 1Y8QB 4Z86A 3ICQB 1FRZA 1VCIA 3MQ4A 1BSVA 1GDHA 3BGIA 3OTGA 5AM0A 5GV7A 5C8YA 4DCGA 4IXNA 2CY0A 4NJOA 2L2QA 2B4TO 4UJ5A 1X8LA 4XQ0A 1E3DA 4CDMA 3K35A 5I48A 1FE8A 2FGJA 5ALMA 3BD9A 1IUKA 4ZI5A 2HPZA 1T6ZA 4B3IA 1XEXA 2W90A 1KH1A 2FW1A 1QFZA 3HHPA 3KKKA 1F12A 3KQOA 4HGNA 3AF1A 5HRUA 3MHPA 1SIBE 1Y9EA 2GESA 3HVJA 4DUZB 3BT7A 2UUCH 3HO8A 3ER6A 2P9ZA 1FLAA 4WA8A 4O4HF 4DSOA 2NQ8A 2X9VA 3D8BA 4ILKA 3DTGA 3UNXA 3U56A 3N8KA 3R6WA 5DWQA 2V7GA 4M53A 3CR3C 1WLYA 4BYMA 2CE2X 4YLYA 3RUFA 4BMXA 5GZ3A 5IFLA 3A6PC 2PRKA 2XQIA 4HATA 2BFCB 3KAPA 4PSAA 1TGVA 4L4XA 1I50A 3T7KA 1UH5A 2AE2A 3WRYC 1RWMA 4KYVA 1O2DA 4CUKA 3UGJA 4LI3X 3MWFA 1K0FA 1GQFA 1TUEA 2IOQA 2PSFA 721PA 1TLLA 1I1LA 3ANYB 2HQOA 3GBSA 4AL4A 5BQFA 4GVPA 3HN7A 4E3ZA 4J0KA 4NENA 5HKKA 1EKPA 3T9FA 2YMQA 4TUYA 3P9YA 5IC5A 3I61A 5D3QA 1L7DA 1NVBA 3AUUA 2HHHH 3IAFA 1CY2A 3TL3A 3DT8A 3HTXA 1HK7A 4I9GA 4U0KA 4INJA 1B1CA 2GM3A 3PJGA 5KT4A 1MO6A 3TRJA 4Q34A 3H5RA 4FWBA 4LW8A 3QUCA 4A0RA 1BROA 3LX8A 5BR8H 3ZWKA 5SYAA 4BP8A 1BDIA 1TK3A 3I12A 2R1VA 4B0OA 5KNCA 1J56A 4RY9A 2LKCA 5AMXA 4A3JG 3SKYA 1WXDA 1IQ0A 4ERXA 3I23A 2OZLA 1M72A 2RGEA 3Q0TA 4KGVA 4FQ5A 1D6NA 3QVJA 1PI3A 4X62B 3H9CA 4Z0PA 4F3RA 4MO2A 3QFFA 1V5FA 5CT4A 4ZI3A 4Q44A 1ZD5A 1RWBA 2EXXA 1VE1A 1EEHA 1Z5WA 1GPBA 3PGVA 4Y0NA 2FDXA 2ZRIA 3HZOA 3IIEA 1COWA 1UKVY 5K0ZA 1H6BA 2RHLA 2COIA 2QS9A 1QU3A 1NP6A 3FGOA 2ZWIA 3DLBA 3TQTA 2PKQP 4RVUA 3OPMA 4F4CA 5JYEA 1M7HA 2IIVA 4CIWA 3VPHA 2W6JA 3PXGA 3KXDA 3OESA 4O6VA 3SHOA 3PF9A 4C4SA 5AVXA 3U7QB 2JJ8A 2FEOA 4FS8A 4MVJF 4RFVA 4ZT7A 2BZSA 5FL7A 4F1JA 1AG9A 4W5RA 1Q92A 3CLHA 3OF5A 4YMSA 5I8ZA 3ZD8A 1J1UA 2PGIA 4PLZA 5D01A 5JAUA 3W2GA 2JZNA 4A92A 1J9EA 3C4QA 3DTVA 2PU5A 3AJ9A 4R8UB 4BATA 3G8BA 3AR5A 2NVBA 4O4IB 4CEIA 3G6WA 1XZNA 4IF4A 4KRXA 1GLGA 2BH2A 4HWTA 3WL4A 5BSGA 5DNYB 3AUKA 2ZBEA 4BFWA 1NULA 3K96A 4MLDA 2DULA 2PQ2A 4NXNB 1HLFA 4HGQA 6AT1A 2YV1A 3Q3GE 5JFTA 5ADUS 1ULHA 1KDOA 1FF9A 3EXHB 2XADA 5AWFC 4PFSA 3HXLA 4D74A 3VH2A 3WLMA 2QTVA 3ELUA 1UQUA 1WCIA 2I7XA 5I7EA 1NIJA 3BPSA 5KFYA 3X1ZA 4BNHA 4ZYTA 1ZJJA 4JB8A 2OGUA 1CUXA 1R0KA 1XVUA 1NAHA 4NEQA 2I87A 1OROA 3IXMA 4YJFA 2VJBA 1EUQA 5B12A 1SKYE 2COGA 2HXYA 4NBLA 5LBUA 5FDFA 1A0GA 1ZK3A 1Z12A 3RFXA 2HVSA 2BE9A 1TAQA 2C5BA 2AVDA 2I76A 2RHCA 2H51A 3CLTC 3N0RA 4HKTA 2AX4A 5H9VA 4CW7A 2P2SA 4DM4A 1VI5A 5G4KA 1K3TA 3E4DA 2QQFA 1D1PA 4YT8A 4MOWA 5AVWA 5KCMA 1HFEL 2DFNA 2P6PA 3IVGA 3ORHA 1X7ZB 3GEEA 4H0FA 5DXAA 4CHTA 1DXQA 2VPWA 2QZZA 5J4KA 1Z6QA 4D3DA 4KODA 2N0SA 2WJZB 3OSZA 4N49A 4OUKX 2J3LA 3USES 3THYB 1VM6A 1E7QA 3ZU2A 1RLJA 4S1TA 5AOAA 2IXTA 2P2CA 4C0SA 2IS4A 1L7EA 1SQSA 2H48A 4U7DA 4A91A 5IDYA 2WHYA 3JAWB 3EUAA 2OSBA 3KJQA 4DL4A 1E0DA 4HGOA 3R7SA 1DP4A 3D3WB 3SBXA 3JYOA 4FU0A 4RWEA 2HFJA 2VAPA 1IRXA 4DDVA 4OP3A 1RKVA 4EJSC 1FP7A 1UC8A 2CDCA 2HJ9A 3FDXA 3W1EA 4BFYA 3QI2A 3ZUGA 1ILWA 5JDIA 5KOHA 5FOVA 4KPEC 3PC8C 4GGMX 5CTJA 3GMIA 2O7RA 1LJLA 1LXCA 4QUAA 1MH1A 5K4GA 4GPIB 5KKNB 1DRWA 2R25B 3G2LA 2FSSA 4N4AA 3R76A 5IW8A 2BEVB 3UMVA 4DR1B 1G1MA 2VKTA 1GUBA 4QJBA 5C7OO 3D6HA 4MAAA 1P45A 1J8DA 3TNYA 1YR7A 3SIRA 3RKRA 5CAEB 1PR5A 2IXBA 2OXIA 4C30A 2ZIGA 5KTKA 1HDYA 1KK0A 1Q77A 2AHRA 2IQ5A 3HM9A 1DX6A 3HR7A 121PA 3ICOA 2X6TA 1T2AA 3KJIA 4B8YA 2BBTA 4KAJA 4OHRA 1HR0B 3WLQA 2LZ0A 3CMCO 2W48A 5JPIA 3DE2X 3EIXA 4HGPA 4R8RA 3P8ZA 1NQWA 2WWFA 4JSTA 4KLRA 2X0FA 5DWDA 2W2LD 4X97A 5L1KA 1M34E 2NUAA 3L6RA 3C15C 1UMBB 3DUWA 2CMHA 2R97A 3VTAA 2W6QA 2E4UA 2HBYA 4FE4A 2R2AA 4WOBA 4CF3A 4K0KB 2JZOA 5DM2A 1W30A 2OFPA 1GNSA 2RF4A 3A1EA 3A27A 3DTTA 4YGXB 3LDGA 1UPBA 4H3SA 1E60A 1QRAA 4Q7LA 4R1SA 5DTEA 1ZK0A 2DBYA 3H9JA 2VJPA 1LRKA 4QGHA 5KTOA 2Z6UA 1A9XA 3O8BA 1XBTA 3UH0A 1BQ3A 2JDID 3FETA 5JEEA 2E2WA 2FUCA 4IIDA 1KETA 2BFDA 2EP8A 2WMDA 3HPQA 4QYXA 1K8RA 2DPLA 3I01A 3ODGA 1M75A 2W11A 3INYA 4B4WA 1O57A 4D3YA 3JPWA 4E2ZA 4I50F 1M2OA 1YJCA 5FFFA 1EINA 3LRPA 1JIHA 1QHNA 3EA5A 3RREA 1LBEA 3A6DA 4KREA 1MCZA 4X1KB 2C4MA 2B9VA 3VVCA 3DG9A 3O31A 4TMKA 4BP3A 1TKBA 2QN9A 2WINI 4P4SB 3EPIA 4DM7A 5J2TB 1BOFA 2DX7A 1IXKA 3RF6A 2P4SA 3ROQA 2A1HA 3UQ8A 2PV7A 2R8KA 4I1RA 4LYFA 5HJ5A 4J0CA 3RJ0A 4BJ5A 2R8PA 1QO7A 3CF6R 4L9AA 2C2XA 4X8LA 1AX9A 5FOSA 5TEWA 3T7IA 2JLXA 1T4CA 1UC4B 2PS9A 3FZQA 3MM4A 3GTGA 2F3RA 2VSQA 4I14A 3HVIA 4EQ6A 5JI2E 3RU3A 2AVNA 2HLNA 2VHJA 2DFKB 4GICA 2HMSA 1WS6A 3KHTA 1OFVA 1LTKA 1Q0HA 2EIHA 3MBKA 4KKVA 3WOVA 4CVNA 5IN4A 3KQSA 3U09A 4S04A 3J80A 4MDEA 3AQ4A 2KB0A 521PA 1BXRA 5LQDA 1WV1A 2ZWOA 5ENZA 4Y2YA 4Z53A 1EE2A 3U13A 1V47A 1YDWA 2J3KA 3AI1A 3RR2A 2PPLA 4W82A 3A2NA 3W77A 1MHPA 4CMDA 1W9MA 2Z30A 4EJSA 1MP0A 4U2FA 4FIDA 4ROTA 5AK0A 1GPH1 3EVGA 1I2AA 3EMDA 4TS4A 3L93A 4F1KA 1MA0A 1M10A 2H2WA 4WACA 1NW9B 5EMMA 3WWEA 1ISRA 3OWXA 1DBRA 4F86A 4BO7A 3OCJA 4IR7A 5DU2A 4F8JA 3V2IA 1ECPA 1K7CA 2QQEA 1C30A 5IUKC 4N18A 3RSLA 4OSOA 5ITWA 3OE7A 4KRGA 3P9ZA 3CV3A 1CU1A 2B6HA 4OQNA 4ZZ1A 3A26A 3M3PA 1EK5A 1Y8QA 1OWLA 4JVSB 4YO8A 1T8TA 1RXSA 2GN9A 4X6LA 1OGYA 1V5WA 1NXPA 2OSVA 3T7DA 3VYWA 2JD2A 3KLPX 1RJWA 4RTJA 5DHSA 3EGVA 1VZ2A 4PW0A 5JS6A 5JRDS 2CC2A 3BXGA 2R6GA 4ZQCB 5BYBA 2W9BA 1II8B 1J1ZA 4KI0A 1C0EA 3SFVA 3FTNA 3PR2B 6CHYA 5WRFA 1N2IA 2VEOA 2VPIA 3NNDA 4EI2A 3FA2A 1F5NA 3P2KA 3D2AA 1G60A 2XTZA 4ZGBA 4D96A 5K0TA 1OH5A 3ANMA 5DGBA 3GAZA 1G7SA 3OBIA 2YXEA 4FYVA 1OE0A 1YB4A 3TW8A 4EDHA 2OFOA 5ELXA 3BQMB 5CD9A 1OHHD 2XWJI 5EJ4A 5JDCA 1TX4B 2ADFA 5KJEA 4XM2A 1DG9A 2WIJA 4RHCA 2FE4A 2BSAA 3G0BA 1QP4A 5C2JB 3HABA 2J5RA 3I6QA 3OURA 1Q7CA 5DGDA 5T5QA 2NP7A 1NF9A 1FCJA 4TVSA 1STOA 2Q46A 4W4TA 1RZRD 3RLIA 1B6SA 2ZZMA 1QHYA 4HQ0A 1YDFA 1JQJC 4QWMA 5EI5A 3WK5A 4LZAA 4NDNE 1QLHA 4BO2A 5KNDA 4F4HA 1RXWA 1KXZA 4XWTA 4LVUA 2G0NA 1NV8A 3ZPXA 2V4MA 4KGXA 4ZDWA 3SWWA 2A0XA 3FNHA 4PFJA 2MHCA 4QBIA 2QR2A 3OFSA 2CXPA 3LS2A 5HQTA 4NBRA 4XEUA 4M22A 4MJXA 3FKSD 4W9RA 1JHRA 3ZOZA 1CRPA 4HVCA 3PPYA 3HJRA 1EFPA 4H6VA 4JP3A 1BE8A 1KY2A 4NAHA 1Z5ZA 5C8YB 2CZGA 1H66A 1PSDA 4YJFB 3FUTA 3FSGD 3IPCA 4HQKA 1XTJA 4Q6WA 5HWSA 1DPFA 2V03A 1XX6A 2VDPB 2WE6A 1JH8A 5IM4F 3C6KA 2E4XA 2CGEA 3MD9A 4ER0A 2CVOA 2WD7B 2HT1A 2NTJA 3RK0A 2FB9A 2O2HA 1U1FA 1IAQA 3VSBA 1AXEA 3OZGA 4PAGA 1E79D 1ZQ9A 4BMNA 5A6SB 2R66A 1A8PA 1KFJB 3QJ5A 4RACA 1KDRA 2OORA 2WSMA 1U04A 2DRIA 3DUFB 3KOZA 4FZ5A 5AVRA 4EKIA 3IT2A 1QHHB 2PBZA 3GCZA 5HKKD 1CJCA 3GTPA 1J2RA 3PR5B 4O2AF 1XF1A 2OKCA 3EZ6A 1Y9JA 3M0EA 4L3OA 3G49A 4YCBA 1WD5A 4JB2A 2WYHA 3G8YA 3S2GA 1YA6A 5LQNA 2BGLA 2WHEA 3B2QA 1NBHA 3R3SA 5CDSA 1UBKS 1BD4A 1CS0A 4KCGA 1YR1A 1N5IA 4R0NA 1ZY2A 2MSCB 2I3DA 3KREA 2XMGA 3CT6A 4ZK2A 2VTEA 2QJWA 3PW0A 3W2TA 2N9UA 4CN9A 4D9CA 3TQIA 4BL5A 3W9YA 1VKOA 4AWBA 4RTPA 4DKXA 4DR6B 3LBIA 1ZEJA 3H9GA 1M8PA 3HR8A 4QWWA 3AI3A 1VG1A 4IQFA 4LK3A 3W5SA 4LOHA 4FB5A 2CF6A 3PA8A 5UKDA 2GEUA 3IN5A 4QBHA 1QKKA 4U5QA 3B7PA 4TM5A 3GH3A 5HCNA 3ORFA 2N75A 2CT8A 2QD5A 5ERYA 1X7YA 1X9GA 2BC9A 2XYPA 3W1WA 4AS1A 1XJ5A 4YJDA 3IMCA 4FN4A 3SDBA 2GBGA 2C8VA 4I0WB 5JSFA 2FMUA 2CCKA 4ODIA 3TSOA 3C87A 2AXNA 2V3WA 4V38A 1N32H 3SSAA 4OOFA 1SXJB 2FW9A 2WFMA 2AXEA 4DTCA 3K5HA 4C5BA 1DMSA 4BGIA 2OPHA 3GRKA 1AXGA 2OGZA 2HYIC 5LP6A 2XYVA 2O2DA 3FMVA 4F12A 4G01B 2VOBA 1SU6A 4NI5A 1T3SA 4CMBA 1A0IA 4XB1A 4I6JA 1E99A 4ZREA 3R5JA 4XCVA 1B3RA 2AXPA 2CK3A 3S99A 4LSAA 3U4GA 4Q7EA 4CEJA 2XQJA 2XB2A 3SF8B 4YMTA 1Q1ZA 4LZZA 3FOFC 2XKKA 2IYTA 2IPMA 3TBFA 3ROKA 2EARA 2OGTA 4G9BA 4KE7A 5JJLA 2QY9A 1GTJ1 1QCYA 5AI0A 1EDOA 1QOQB 3MHTA 3I52A 1RADA 2Y67A 5EKTA 1FFCA 5LSAA 2O6LA 5E38A 1GNVA 2HBZA 1TEZA 1DFIA 3RAXA 3N8IA 4Q4LA 3K9FC 2IPLA 4KQGA 3T0FA 3NXSA 5SZJA 4TRRA 1HE1C 4K81B 1R8XA 1TF2A 3AHCA 4CG3A 5I7HA 1T6NA 1V7ZA 3BL6A 2EV9A 3MWMA 1A9OA 4PICA 3TAUA 3ZH9B 4O2AA 4BTLA 3MINA 3ZGLA 4AURA 3GRCA 1AMUA 1SXQA 1MA3A 3BL8A 4J75A 3EFOA 4HDOB 2JFHA 2R7AA 5CITA 2XLCA 2A5DA 1T43A 4NWIA 4AWXA 3FTFA 4I6GA 3TTUA 1GZ5A 2WNSA 4R68A 5IXYA 1DO8A 1NOKA 1SBQA 2JAHA 4FKMA 2JFUA 2ZP1A 2KBFA 4IOLA 3K0AA 3GRPA 1TJYA 3NEYA 4F2WA 1S03G 1Q2UA 1NC3A 1EHCA 1XEWX 1XZLA 2R6JA 2R1ZA 3BIJA 3QVVA 3RB0A 4F4XA 3L8EA 4HLQB 2PA3A 4BVJA 4U1RA 4JA0A 3EDYA 3VJLA 1DBVO 2REBA 5IVDA 4RB3C 4YV2A 5HOQA 2JIZD 4ZEVA 3L92A 3MMPA 2FZWA 1DIHA 5EQTA 1U0JA 2DCMA 1U5CA 5TPZA 4CTJA 3MAJA 1PN3A 4EX7A 1HYEA 1L5ZA 2YVLA 3I5YA 4KO8A 4JI8H 1V2HE 2JW5A 4GI1A 1RM4A 2Q8PA 1BA2A 1V16A 3D3NA 3RJMA 3A37A 4Q05A 4F2HA 1OFGA 4LQDA 3DDSA 2HSEA 3P0RA 1SHUX 5GM1A 4G41A 3PR1A 1EBFA 4WZBA 5GWXA 3W5VA 4DR3H 2FFJA 2BGWA 4X5OA 4IGFA 3KSUA 3CE6A 3EZNA 5ICFA 4ACAA 1GYQA 3EH1A 4L85A 4CMCA 4J3JA 5HDBB 1IY8A 1PBNA 5LP6F 5IBCA 2BJVA 3EFEA 3V1KA 4R41A 1FSFA 4EHNA 1G5PA 5IEJA 4G2NA 1KI1A 4EGFA 2W98A 4JROA 2V5AA 3R7DA 5KTMA 2ZQZA 2UXBH 1JBEA 2WWXA 5DT9A 5IARA 2XNDA 1G21A 3OEEA 4YI5A 1JHXA 4Y9UA 4B3CA 4BMZA 4IJKA 2G9QA 3HCDA 3OIDA 4US1R 2XMPA 2C3MA 3EZLA 3BQNB 3OX4A 2B1JA 1CUEA 4FMCB 3TYXA 5JWRA 2GYVA 3IDFA 2P30A 3DF7A 2H4XA 4ZV9A 3L8MA 2V7TA 5TNXA 3T1QA 4M9UA 5GP1A 3JASB 4CF6A 3AIOA 1G20A 3WNDA 1UP6A 3VR4A 1HFJA 2Q5FA 4G8DA 2VOEA 2VP0A 2O4CA 2GK4A 2QTLA 5K3SA 3SZGA 5JAIA 4M2LA 3NWEA 8AT1A 3VAAA 2XLBA 4J1TA 4RPKA 4WKPA 2W6MA 2AN1A 3H5WA 1W25A 2J5QA 5DFAA 1J06A 1KVQA 2IDJA 2XAUA 3F1LA 4RANA 3E58A 4G24A 5TVGA 1A9YA 1QC5A 3HOUG 4GKKH 1J7KA 5J40A 3N8DA 2O7NA 1Q0TA 4RNOA 2VYVA 3QKTA 3E03A 1TCAA 1LUAA 4E21A 3H84A 1KC7A 2FJUA 5IH3A 3V4SA 3AH8A 3CF4G 5JVDB 1QE5A 4Y30A 1ACLA 3ELBA 3VJKA 2HGWA 3GEPA 4R6WA 5GJCA 2HGXA 4MX8A 1NOIA 3A1TA 1WMSA 4AU1A 1JR3A 4GH5A 4KQMA 4X64B 2PUBA 3X1YA 4MR8A 3RC9A 3JQ8B 1XMXA 4LC0A 4ED6A 2XCSB 3A06A 3KSMA 4RU9A 3IQWA 3ONDA 4L3WA 2P0EA 3U7IA 5HIMA 4JXZA 4XM0A 1FFDA 3FWYA 1D6SA 1UBMS 3WSTA 3FDZB 4BNGA 1PDVA 5K8LA 3IA7A 1W52X 2H1IA 4PXSA 3EY9A 1PWZA 1T2EA 2Q5LA 1P2VA 4B4KA 4Z4IA 1C1DB 3MUEA 3CJTA 3OOSA 3HDGA 3OTWA 4WNIA 2F4VH 1X2EA 1OJLA 1P1KA 3N2GA 2HHFB 3EGWA 3R40A 5D1NA 3M1AA 1GJRA 1YE3A 2ERCA 3E5HA 4TTRA 5AOBA 4C2TA 4AKHA 2Q2WA 4C6RA 3ZGNA 3TE6A 3I28A 4YEDA 1QK5A 2PLRA 3LX4A 1N8TA 4TLEA 4AYXA 2WT4A 1EM8B 2GPAA 2FHSA 4X92A 1T1SA 2FLPA 1QVAA 1UKEA 2JI7A 2Z5LA 1CP2A 3KOYA 3AVUA 1SG0A 3C2QA 1JFFA 1NYRA 3W5HA 4NZOA 1S1CA 2QYSA 2P5TB 3IP9A 2AC7A 2PT7A 3SDSA 3ZZMA 1N78A 4BO0A 3U44B 2FQYA 2UUPA 5E0KB 1ZXBA 3QPAA 4JNKA 2PYDA 2CB9A 3AL2A 3M5PA 3S2YA 4E1AA 2C4NA 4JI2H 2Z04A 1WZUA 1YZQA 3V7NA 2CKZB 2GSDA 4O7WA 2ST1A 1D2MA 3SYNA 3B5IA 1CKNA 3ZZUA 4DQXA 1WVIA 2J33A 4RUKA 3OUTA 5JV5A 4C3VA 1RCUA 4XWYA 2DBZA 2CNQA 5IFKA 4G65A 3IAAA 4JLSA 4BXXG 1E3TA 2F8MA 4JI4B 1M2VA 1NW8A 2C9OA 2QRUA 2EATA 2XB4A 1U8YA 1MLDA 1T15A 1FDIA 1Z0UA 2YASA 4XX1A 5E6UB 5EINA 4H1WA 5ULLA 2C04A 3VKGA 1AQUA 1KTVA 4XVQA 1R9GA 3R8XA 3DDCA 4BMSA 1VDZA 2FNAA 1HKUA 1V1RA 1L7XA 3CXUA 1H9CA 5JC8A 2WIKA 3FRIA 1BMTA 1UFVA 1UQRA 2ZAIA 3KEFA 4JU8A 5DG7A 1O94C 1XEFA 2Q27A 5BN3B 3RV3A 1LBSA 1REQB 4WLOA 3S6JA 3TIFA 2JBWA 2UXCB 1KI3A 4R1UA 2XWSA 2GCEA 3M4NA 3C1TA 4FX2A 3KFLA 5AR1A 5IJZA 5LQCA 3HRHA 1NF8A 4RPHA 1E5QA 3LGAA 1QIEA 1UDWA 3IR7A 3UG6A 2QRVA 4IVQA 3D0KA 3AX6A 5ELLA 3EK2A 1OFHA 1G9XA 3IBYA 5JSQA 1E2LA 1IWBB 1JDEA 1XRNA 4MTDA 3MMSA 4BZZA 4EGSA 1NLZA 1GV0A 3IBCA 1FU4A 1HTWA 1L5RA 3LQKA 3NWPA 4DR7H 3PGXA 4KN6A 4O1MA 2HBQA 3RB6A 5DRYA 2I7CA 2LDBA 3PGMA 3TCNA 1FVHA 1GTZA 1H2RS 1WXEA 4LDPA 4ECRA 3LG2A 4PO1A 3EZGA 2PZBA 3IMEA 5ALTA 3A4LA 1KRHA 4E5YA 2QQ5A 1VKRA 3ELYA 2VUMA 3WDSA 4QXAA 2Q5HA 3QU5A 1DBQA 4KN5A 2QXTA 2IS6A 1ZCFA 3K1YA 3R5HA 1EP3B 1WSDA 2O1EA 1K97A 4NECA 5DGXA 4ETMA 5F1KA 4Z3KA 3CPSA 2DKFA 5JANA 2CLKB 4DLUA 4A3FG 2WTUA 1XWIA 3EF3A 3G7NA 3T5LA 3FCUB 3GV7B 1UXIA 1L6IA 1NLYA 3E1KA 3KXIA 2E1RA 1KY4A 2ZE6A 3OHMA 4OHKA 5HBGA 5IAAA 2B78A 1T5BA 3OSPA 5E9WA 2XGJA 3E9CA 3H6GA 5ALOA 4RMJA 2HJSA 5BN1A 4DC9A 2WWRA 4FT2A 4HQOA 3FNEA 3SSOA 1L5QA 3KKNA 4ZI7B 2WA2A 2SCUA 4TPKA 5FTNA 3A1FA 3LOUA 5LZ2A 4C4OA 1KO8A 1D0VA 1OQAA 2P6OA 1PWYE 3L1JA 4M89A 3W5DA 3WLSA 2Q4OA 2PUDA 4CCAA 2NPIA 3R3YA 3WLAA 4CIBA 5JS7A 4ZHQB 3T7SA 4JSYA 5FTWA 2OAQ1 1EP1B 3VR6H 1O75A 3AV0B 1ORWA 2FI1A 2GDJA 4PSVA 3E3LA 1L4HA 5LKAA 2SKCA 4YALA 1P17A 3WGIA 1PVVA 4EFKA 1EVZA 5EPOA 3S1AB 3ZVNA 1T5OA 4PZLA 4C0HA 1EFRA 3UICA 5EIBD 3AOEA 3ORYA 4QNMA 3VNVA 1KEUA 2UVDA 4HSGA 2UXDB 3QP9A 1P1HA 3AY3A 4FOPA 3KJXA 4UHDA 4DL5A 1J2UA 3SKXA 1V41E 1QRSA 1CHNA 4LOAA 3UCFA 3OT5A 4WOJA 1XK5A 4Q16A 4QVIA 4CKEB 2P62A 3O38A 4DJEC 1AGXA 1QDLB 3M9WA 1KZ7B 1RHMA 2ATIA 1SPXA 1UFKA 4PVDA 1R5NA 4INOA 4WK2B 4UZSA 5CU7A 2BPOA 3PT9A 4ZU3A 3NBUA 4A8TA 5EYPA 5AW1A 2H54A 2Y0SE 4LXUA 4A8JB 4FBLA 5KNDH 1XI2A 1TCCA 1O6CA 1UZLA 1B7GO 2CHEA 2F3UA 4N9QA 1U2TA 1CUZA 4L50A 4XA8A 2PLFA 4U7HA 5DW0A 4UUQA 3R24A 4EGCB 2G4VA 3L7BA 3ZVLA 3IAM6 2IYWA 4EA6A 4AYTA 3VR2A 1RJQA 4OGKA 1DLJA 1IB0A 2R44A 1ZGHA 2QRGA 3IAEA 3PDCA 1N5RA 3O8LA 4JJZA 3N44B 1PR6A 2PH3A 3D8RA 2EP7A 1AZTA 3L7JA 3VKWA 1ET0A 2PIAA 3RT9A 4W5OA 4JP2A 3ZY2A 1U7UA 4EO4A 2CNWA 3K92A 2B1GA 4ECUA 3WZ2A 5KTYA 1XWFA 2HW8A 4LNHA 1Q0LA 4PAMA 5F9LA 1UFRA 1Z68A 3CIFA 2P6NA 4NYMR 5IXJA 2O8FA 1BE1A 1N36B 3VUEA 3VYRB 1CEYA 2IE0A 3T95A 2LIVA 2VA9A 4Q1CA 1R1DA 1E2EA 2QYHA 1J2JA 1OI7A 1XNHA 5REQA 5CDGA 3Q5DA 1A69A 3J81A 3WNBA 4R4JA 2R8RA 2XD4A 2BLLA 1A3CA 3EC7A 1N9GB 4HPJB 1U02A 1MQ9A 3UJBA 2YHSA 1VJCA 3UUEA 4MYUA 4JSRA 3T4PA 1XG5A 3O3MB 4FDMA 1FFHA 2OBBA 2IV3A 3W4IA 1HL7A 1O5OA 2CDNA 2GERA 4PGAA 5DM1A 3M6MD 1I7PA 4J0EA 4IS2A 2PX5A 1J8MF 5KYWB 2ATXA 1R0ZA 2Q21A 4JIGA 4ITRC 4XVUA 4AKSA 5ALVA 3VNUA 2BCJQ 3ZNOA 2YMLA 1NMXA 1X1BA 1DRJA 2BMEA 4X62H 1ZGBA 5M04A 1B0UA 2XZDA 1GFWA 1YRHA 1JI3A 3HKZE 2B8NA 1TVCA 3PG5A 4J0GA 4MUYA 5DNEA 3TOXA 1L5HA 3N70A 1K5GA 4PO3X 2HLHA 3P4XA 4XEHA 5JSUA 3B51X 1O87A 3H4VA 2AUNA 1BCSB 3R6LA 1RPTA 1VRCA 4BRUA 5I47A 4MUEA 1ZI6A 4OQPA 4QDZA 4MUMA 2CJXA 1N48A 2QTGA 2BEUA 3IR6A 3O3CA 5I9TA 5BRNA 4MQFB 1UAAA 1NR1A 1UXGA 1PNOA 3HDVA 1RK6A 4LNUB 3DVAB 1U0RA 4FHCA 1I3QA 4F3YA 1Q19A 3GR6A 1JWBB 4EL0A 2Y1OA 1TOAA 3JZDA 3A9WA 3KPVA 3AVOA 2ZJ5A 5EESA 4ECAA 2CLEB 2P5YA 1KAOA 2W2QA 1B1AA 4GLXA 2QKYA 1CULC 2CD9A 1H1TA 2Z09A 2ZTMA 1N1DA 1NXQA 1YOVB 5D3MB 3TLAA 4NARA 1VRWA 1PF7E 3ZE6A 1OU0A 1T0PA 2G28A 4UVGA 2Q4EA 1TU3A 1XLUA 3A9RA 3IX7A 4QZVA 1HQKA 2Y2VA 5ICEA 3C14C 2BUCA 5AW8A 4LV5B 4M38A 2ZT7A 2GH1A 3AM5A 4JI0H 2PG3A 5C5JA 2XZPA 1EPUA 1IEVA 3W4KA 1F17A 2EZ4A 4JBNA 7GPBA 3P2MA 4WLEA 4V1CI 1FA9A 4Y1RB 4YXWA 2QRZA 2UZ0A 1JIIA 2EWWA 4PYQA 5LWQA 3MNFA 3BRQA 1QZUA 1DJMA 3CZAA 4AS3A 4P35A 2P2LA 4S1OA 1W87A 4UDXX 3NBYC 2W8KA 3GFGA 1SYXB 3JQ9C 5A1JA 3PNSA 4RWZA 1UPCA 4RHYA 4RM2A 3COVA 1RYYA 3L7KA 1VECA 3IAUA 1P8AA 1BKYA 3KHHA 3AW9A 5AVJA 2PUFA 4UNQA 2VUSA 1C3XA 1RCTE 3HYRA 1WMFA 4J6EA 5HFAA 3P9KA 3HADA 4EYSA 2I6SA 1RE1A 4UBKA 1IJEA 2BDUA 1DX4A 1ZOSA 3LECA 4NS1A 4CMAA 5I3CA 1PJBA 4QUDA 4Q45A 2DF8A 1T8YA 3HC7A 4OM8A 1G17A 4UFNA 1CR1A 2EZUA 3YASA 4AX4A 4D81A 3O93A 4MS1B 4B3RB 5JCJA 4Z9YA 4YACA 5E6SA 2PIDA 2FZ5A 3NYRA 3O03A 2Z1DA 3BGDA 2AR9A 1NUUA 2HXGA 1XR3A 2P9QA 3ZD7A 1ADBA 4W6ZA 3PNKA 2O5CA 4MRRA 4QDTA 9ABPA 3OX2A 4L76A 4JXXA 1I4DD 3ZR4B 1LCIA 2VPZA 3GPDG 5IDVA 4OBWA 2HIXA 2ZKLA 4RPLA 2DBRA 4ARSA 4BO9A 4WRRA 1XP8A 2HNAA 4N48A 5KCZA 1UBSB 2E4WA 4PS0A 3SHVA 1MO4A 2X58A 3HXTA 2ZAMA 3HZZA 2QPLA 3KOXA 3PENA 4G4SO 4JLAA 3UWSA 1G5QA 5CB4B 4QT4A 2GTIA 1RM0A 3JQEA 5FHRA 1ESEA 4AZ3A 2C7RA 4LOJA 4EHIA 1KWKA 1PKXA 5C37A 3TZLA 2NTVA 3E84A 4DLKA 3ITDA 2PX4A 1REQA 1W0CA 3N39C 4GXTA 4UD6A 5AKIA 4DEYA 1B4DA 2CMDA 2J7KA 4CIVA 3T9BA 3R6TA 2G9RA 3MTJA 4QREA 1BMQA 1E2QA 1ODCA 1JEJA 3GFQA 3I2GA 1Q3KA 3CKMA 3I5UA 1N3LA 3L82B 4X20B 4F9FA 5A3QA 3Q9LA 3SIXA 2G36A 1Z7GA 1HEIA 3IT3A 4N7MA 4RJ2A 4GKJH 3RUEA 1ZUHA 3E8XA 4IZHA 2WUGA 5TJHA 1SXGA 3O8OB 1NPDA 3B1XA 4W1SA 3SR3A 1X8XA 4QXQA 1JMKC 3V8RA 1DGQA 5IASA 2AMYA 1LD3A 3DJYA 1B6TA 2G0TA 3O75A 4V1CA 3NDPA 1LI4A 4I5IA 3IKVA 4YCSA 3CSSA 3HJTA 4J1NA 4OKIA 3D2LA 3RFUA 3W6UA 4Z51A 3LP8A 4DVGA 3KDSE 5JVLA 4IRKA 2C97A 1PYGA 3D0QA 4FYIA 1LLQA 1PD1A 3WLTA 2GTHA 2ZSEA 2YJ3A 4IS3A 3GCWA 3FOAA 3QVUA 3N6RA 1RC8A 1H3EA 4L75A 3V8MA 3X1WA 1NVDA 1ESCA 1U7PA 2NWQA 2XNJA 4HDSB 1GZ4A 4EG8A 4PF1A 3N75A 5J2UA 2R6AA 4BDSA 3MWDB 5FX2A 2FMHA 1FVXA 4CKXA 3VPBA 1PR9A 2OLEA 4OA5A 1PGQA 5CJJA 2EEZA 1ZWKA 1A48A 1MRSA 2IEIA 2Y93A 3RAEC 1NBAA 2A5YB 4LFBB 1EBBA 3DD5A 1YZ3A 3AU9A 4RL4A 2BJHA 4R3WA 1J1IA 4RQBA 1JJ7A 1AJEA 1RYSA 1DAKA 4IIXA 1EM6A 1K9SA 1T6BY 3PKZA 1T2CA 2H29A 3LO5A 4YAJB 5DNVA 3N3AC 5EVCA 1XQ9A 2YN2A 3EFOB 4FGSA 3ROEA 3L6BA 4PV7A 2B3TA 3WR5A 1VL6A 1MAAA 1V4VA 3B2EA 5FBQB 4GL4A 2HVQA 5AXAA 5K0NA 4MQEB 3I0ZA 2FEWB 3C8HA 1SUEA 3ZHOA 4TQSA 2DPGA 4P32A 4UW9A 3ZC3A 2CBZA 3H5OA 4MUBA 3IERA 4F4WA 4NICA 4WK6A 5HGXA 2YHUA 5LYJF 2QAGB 1J2TA 2O6HA 4FYXA 2QT1A 4IJ5A 3MEQA 2QUBA 4HEHA 4RPCA 3SHTA 3LOQA 3SR0A 2Z2IA 2BQ3A 1ZLYA 1GV1A 1M66A 2PFSA 3C48A 1IOZA 3JX9A 3NHRA 4I50A 4YRDA 3AJ8A 5EIOA 3KQLA 3WV4A 3DW1X 2J6IA 3KHGA 1KU6A 5JFOA 4D9GA 1TFUA 5B6JA 4Y2PA 5EQFA 1WXIA 3LYLA 1HRDA 1CZOA 1Z0SA 2JI4A 2Z5GA 5DI3B 2OLJA 2WAAA 1JYEA 2AWNA 5C53B 4FWTA 1IJFA 3W5OA 1K7YA 4NBWA 4QUIA 1P77A 4ZAFA 2R8BA 4A93G 1JZSA 3V8QA 4NY1A 1J0XO 4K2AA 1NQUA 2X5JO 4OHZA 4P34A 4UOQA 1W96A 1JEEA 1ZW6A 3E15A 5DCLA 1ICEA 3WO0A 5JQGF 4GMDA 5EXSA 4ZEWA 4QGGA 1XXLA 3MTIA 3ITEA 4OK5A 3PHLA 4GR4A 2UDPA 4D8XA 3I05A 2FF7A 1W581 3K4PA 2R8JA 3KR9A 4YIKA 4J9OA 1SUSA 2V7XA 1R10A 5DV9A 3KCQA 4HYEA 4WDQA 1IULA 1RLMA 4YRTA 1NBMD 1X1CA 2ERYA 1SEVA 3GJQA 1ICIA 4ID9A 2XZTA 4JLMA 3CRNA 3UIEA 4YASA 4RZUA 2YJNA 2Q41A 2UVQA 2C2DA 3BORA 3CW9A 4IVRA 3ZIUA 4DA8A 4Q9LA 3CRZA 2FOXA 3F4BA 3ON5A 4GU5A 1RHQA 2Z6VA 3QWIA 5FWYB 3CZRA 3W8FA 4J9LA 2V96A 5EKSA 4AK9A 4YV1A 1FPMA 4UUNA 3RUAA 2COEA 4YHHB 2PD4A 3SSNA 4Y2VA 3NZEA 4H59A 2Y0CA 1EKFA 1EVLA 1MOZA 1AE1A 2A14A 2F90A 3VOBA 3GLSA 4KRFA 1QGYA 5KFGA 1XD2A 4OU5A 5CVDA 3AL3A 3DAFA 3N53A 4MR7A 3T1HB 3AEQB 4EARA 2EYUA 5JD3A 1TIKA 2P3SA 1W76A 2QTTA 4RTKA 3MPUA 4NG4A 4WZ6A 2AG1A 2DPYA 4C2BA 2QV0A 4JMLA 3VVMA 4P3OA 3AHHA 3A6JA 4ZT4A 4PNEA 3C5WP 2C03A 1OLUB 2YXBA 4EFEA 2I62A 4GPEA 4R69A 1F38A 2W8BA 1L1RA 1BJTA 3DOOA 4GZMA 4IW3B 5GAJA 1YUBA 1Q6ZA 2FR0A 2JGDA 3U9SA 2FPMA 1VA5A 3QTTA 4G67A 4N7RA 2J9ZB 2YS7A 2VRNA 3CBQA 4RL6A 3GLTA 1XVIA 2ONJA 4CIYA 2FWBA 4NENB 2HSGA 4P83A 4TLMB 3TY9A 1QLJA 4EG4A 3KZOA 5GVSA 1SVWA 5F5LA 3BMQA 3EXIB 4XPIA 5HJEA 4EITA 1O8CA 4BKRA 3KVRA 2CSUA 1VSQA 4JBGA 2MSWA 2AN9A 3EVFA 3OQHA 4JMPA 2R7ZG 3FDJA 3T5MA 3RLFA 3Q8WA 4AY4A 4OV6B 3TPZA 2I1LA 1YK0A 4O2BA 2DVMA 3CZ4A 3VR2D 1TJ3A 2PZKA 3RKUA 1OASA 2DWUA 5IK2D 2IH2A 1WTAA 1EXNA 2ZJFA 1GZ7A 4H3VA 4TL8A 3OHBA 2JEJA 1NE7A 4QHTA 3HXPA 3LBAA 3V7UA 1VFPA 1SBYA 4ZPXA 1U9IC 4DMKA 4GOXA 4LH6A 4IIGA 1K6XA 4X7RA 2DPMA 4H0NA 4HVAA 1I3MA 2QDXA 3AEUA 4P4UA 1Y8AA 1I1MA 4Q1EA 3U9LA 3A3OA 3ZWWA 1H65A 1R0WA 2WPNA 1JFLA 2BRUA 5DHTA 1ZMOA 3DA8A 1DQSA 3T5KA 2I3ZA 1EAYA 2Z3ZA 1EGQA 5B53A 4OQZA 5LR6A 1P5HA 4UKDA 1XA3A 2Q3LA 2WM2A 3R7FA 5IM4A 2X0JA 1RYBA 1XCMA 4DWWA 5K7SA 4LFAB 2OAEA 2Q5QA 1CXZA 2J85A 2PUTA 4U7GA 5CVJA 4K9OA 5CH3A 4GKJB 4KUEA 4OG2A 3QQ5A 3FNQA 3OCXA 2AIRA 1W5BA 2C5LA 4FBGA 4LZNA 3MFHA 1Z0DA 3DM5A 3NEAA 2FRDC 3L05A 5JCXA 3VR3A 3Q41A 1SZCA 1DIGA 3ORQA 4TT3A 3V97A 5CCEA 3TOVA 4PHFA 4D7AA 4QW8A 4PZ7A 4JGGA 3TD2A 2YVAA 1M9NA 4C0JA 1RSZA 2EJBA 1EX6A 4J0QA 4BNMA 3NAQA 1Y80A 3L7AA 1SD5A 2XGOA 4RO0A 4HAVA 4PPQA 1AF7A 1Q0ZA 3VR6D 4L8LA 2C7PA 3GILA 1JG7A 2D2FA 1ZL2A 3C3EA 3Q8SB 4LMYA 3GGPA 4GAEA 3K32A 4KWCA 4OY3A 3RABA 3WICA 3P2OA 4EPXA 3MAGA 4HV4A 4DV7B 4FDAA 1C9KA 2R7MA 3DEFA 4IJWA 4MVJE 5ALPA 4FT4A 4CG0A 2D0IA 1A95A 2BFWA 1RBQA 3IE1A 4B48A 3ZUPA 2A0YA 3EWAA 2VJMA 3CSWA 4K2HA 3PI6A 4OMDA 3ICEA 1HY3A 3TSWA 1QV6A 1T5IA 2AEMA 4QU8A 2DWOA 4KMSA 4TSFA 3Q7RA 5EP3A 1ZGJA 3JD3A 5JY6A 3FTPA 3WIOA 5J58A 3IEVA 4IWYA 4D6YA 2ZT5A 4E46A 3DFIA 4ZOBA 5E1MA 4GI3A 1X1SA 1N0UA 1YQWA 3WYCA 5JISA 1DO0A 1WDMA 4JI0B 5HNEA 3EG9B 3JQDA 3O3NB 3I2FA 4MVWA 3WYAA 5A6SA 1H05A 3GFBA 1HNXH 4N8SA 4EFDA 6PFKA 4FMBB 2NP6A 1WUHS 5AVZA 2HR1A 4DB2A 1X39A 3IVRA 1I2CA 2D0PB 2GD1O 1ML4A 1FFXA 2OLKA 1FU7A 5ITZB 3HCPA 4DR6H 5I01A 2V9PA 3JD0A 4AP6A 2D1SA 4WKNA 4YRIA 2HAEA 3HCWA 4DMLA 4A3SA 2JRLA 2QLLA 4M76B 4J2TA 5I9BA 3WFJA 4DIDA 3T4EA 3TSYA 3K73O 1S0NA 5EGNA 2Y1CA 4ZVPA 4OBXA 3U0GA 2O3QA 2QJFA 4TM8A 3P9NA 3WI7A 1YE5A 4PSUA 5JBNA 1H2ZA 2EU8A 5DT2A 1G3QA 3RBEA 3C3BA 3EXFB 5D1PA 4V0MA 2FWPA 3PICA 4DNFA 3FDIA 3D4IA 1V96A 3EVCA 1K08A 4DLZA 3F6BX 3KTFA 3L6DA 2Q0QA 4BBRG 1PGPA 4U7TB 2AGQA 1FYDA 3ZS9A 4NJEA 1ZOOA 4AY6A 2C2GA 4G0PA 2O06A 3CUUA 3D5QA 5DTIA 2HY7A 4Q01A 1C8BA 1G6HA 4I1SA 2VQFH 4MA0A 3UH1A 4KGZA 4WBNA 1VL5A 2I2XB 4JN6B 3T34A 1PT9A 2B2XA 2GJSA 2JCYA 2PKYX 4PC2A 2BUBA 4PQFA 4PGFA 5GY7A 3RVSA 3X2EA 1NZFA 5C1OA 2VSYA 1R64A 4CNBA 4F4IA 4MQBA 2AQKA 4B4DA 1WETA 4KJZA 1DG1G 3OQ6A 1XDDA 2Y1WA 4L9SA 4EKDA 3QLEA 2HUNA 4MXDA 1N5OX 3U7RA 3WHIA 1NF3A 2H5JA 4F6RB 1HDCA 1U8UA 2H1SA 3E2IA 3CXRA 4MRSA 1EHYA 1SC4A 1VKNA 2JAXA 4BZPA 4EFBA 3I6IA 1YBAA 3FOCA 3R6GA 5JZBA 1Y98A 1D2EA 1NKVA 2XGMA 5F7OA 1G7RA 1XK7A 4MQUA 3AVVA 2VYQA 3ZDDA 2ZZNA 1I6UA 2XW6A 1FP2A 1YOVA 2PT9A 2YY6A 3FW1A 3TZEA 2PSEA 3GLVA 3Q0IA 4N9WA 1S2DA 2I65A 1L6RA 2RI1A 3MWKA 3D6FA 1RWQA 2ISCA 1RXIA 4H1VA 4QOIA 4TV9A 2YZ2A 4D9KA 3TECE 2RH9B 4U7WA 1A9RA 2ZGIA 1HDZA 4RA9B 1XNRB 3RGZA 1GQ2A 2AHOA 3DMHA 4DCUA 2R5NA 3NU1A 3GUCA 3HXOA 3H9UA 2HWKA 3AONB 2PL9A 4TTQA 1AKNA 3TR6A 1XZJA 1E58A 4CKCA 1QP8A 1RRFA 1YU6A 2D5AA 1Y5NA 1UEJA 2UAGA 3EGDA 4DHEA 4DIOA 1G8AA 2YUIA 4XDHA 1HORA 1Y9AA 4RGVA 2OWEA 1Z4JA 1CF4A 4NLGA 4EMTA 4S12A 5A9SB 1S9DA 3QUQA 1QJ4A 1Z5VA 3JVUA 4JKYA 4Y2QA 5BT9A 1NFRA 5GTDA 1B8PA 1EP9A 3EZ9A 3GVCA 5BURA 5KVSA 2O8BB 1OKKD 4YMVA 2HMVA 4Y2SA 1U4OA 4D0GA 1R6XA 4U39A 5H81A 2MMCA 4JJFA 3P2YA 1E2MA 3QX8A 5COBA 2RG1A 1RJFA 3PTZA 5J1SB 3BXPA 4CQNA 1W2GA 2I80A 1G5IA 3NOQA 3GK3A 1PJZA 2XIJA 5HFJA 1UP4A 2YKGA 2FOIA 4Q0MA 1H5NA 3Q8KA 4KK3A 5HVNA 4TV8A 1KC1A 1YQGA 3C6ZA 3AEKA 1FS5A 1ABFA 1N7JA 1NQ5A 3KV1A 3NHSA 1JTFA 3PQEA 5B2FA 1JDJA 3DNPA 5A62A 1IQUA 3Q6IA 1EEXB 2FXIA 3GLFA 3ZGXA 3H99A 4EELA 4TL7A 5IDXA 4RDHA 4CCWA 1F0KA 4ZP1A 1KVSA 2TYSB 3T5GA 2Q8QA 4POOA 1P3DA 1CKMA 2QX6A 1Y3BE 1K66A 3ETGA 5AKZA 4MDFA 1W19A 4R0VA 821PA 4MW2A 3R3HA 4DCTA 5ALJA 2H8GA 1NJ8A 1IPHA 2DGDA 2AS0A 1SU8A 3AB8A 4X6YA 4XQEA 3STVA 3QPDA 3CYFA 4YJGB 4EI7A 5K0SA 1VIMA 5JECA 1W49A 2GEDA 4AROA 4CDRA 2O2GA 1RMQA 1MR3F 5F9FA 1GA1A 1XJ0A 2JIPA 4D1YA 3F74A 1CR2A 4G3XA 3OEYA 3K9QO 4BY7G 1MKYA 3NEPX 2LWIA 1U0LA 1P39A 4ED7A 4NH4A 1WY5A 5KNBH 4AQ7A 2OESA 3DEYX 1VFNA 1BU8A 1TM7E 2WEKA 1W1IA 2X0RA 1E98A 3GFTA 4O4IA 4X95A 5BQ5A 1QH8B 3VQTA 2LNDA 1YDMA 4MQEA 1R8YA 4CHIA 4DLBA 3HBFA 5AVVA 5DF1A 2ZIVB 5A5GA 2QDKA 3S2SA 3BIOA 2Z02A 1QYCA 4DZRA 4JV5B 3V4OA 2DETA 2H18A 2WYVA 3QKWA 4CE6A 2VQDA 1ODLA 1QO0D 4O63O 2Z3WA 4PLFA 2ZLBA 4HCJA 3R75A 4DUYH 1M1YA 4FNMA 3Q3EA 4PXYA 4ZU6X 5A2QA 5IDWA 1M67A 2JJ1A 3UMJA 1QR2A 3MUOA 4TMYA 3NJRA 1ZR4A 4IUDS 1S4MA 1ZESA 4AULA 1F2DA 2HRZA 4IYJA 4A6PA 2OH2A 3L7NA 4H6PA 4D82A 1PW5A 3VOTA 1J8QA 3D1VA 1EWRA 1MNAA 1Y4ZA 5E9QA 3NTOA 1LJ8A 4BN0A 3DE5X 4BBPA 4HDMB 2CVHA 3RBZA 1GG5A 4Q00A 4UCXA 1W6UA 3Q72A 3ASVA 3HJAA 5EERA 1YJ8A 2WMNB 1ZSVA 4L02A 1SKBA 4WOPA 3E8SA 3HZRA 4JT9A 3TE7A 4QASA 1Z6TA 4B80A 1FMJA 3BQ0A 4C4PA 2JLCA 4GT1A 1C3EA 5A2GA 1DUIA 3GW8A 4K3VA 4L4RA 4ARAA 4PNHA 2CVPA 1GFSA 3BGVA 3U61B 2QSYA 3EIHA 4PYLA 4JITA 2VDOB 3T1VA 3BB4A 1VLJA 2DOKA 2YW2A 1DB3A 1EDEA 3C5EA 3COPA 3L5KA 1KT8A 2O8VA 2BFDB 2P7IA 3KB2A 4FYHA 3VPXA 3UJNA 3CLUC 1B6RA 1ZVQA 1CUWA 1XAIA 3R41A 4OP1A 5AW0A 4J9VA 1FY2A 1L4LA 1QG4A 2PX3A 3FCSB 2HMAA 2Q1XA 3COYA 4Q5IA 1O97D 3F5SA 5FA8A 1HNXB 4FC6A 3U37A 4LMPA 5AM4A 3CKKA 2WTBA 4RUAA 3NHPA 5DH9A 3DTYA 4DF3A 4DVJA 4CXMA 2D0DA 2G9NA 2RAUA 3PC6A 3WWYA 2W6CX 4G8JA 2YOGA 4MZDA 2R5WA 1P6QA 2AOXA 5HBRA 5KYWA 1QXSA 1DC8A 4QX6A 3MG9A 4DMGA 5KTTA 4YFYA 2FH5B 3TLBA 4A73A 1H9AA 3BGSA 4W8OA 5TLSA 2HLDA 1G4UR 2YC2C 1M7JA 4E94A 2QT0A 2BMAA 2V7UA 1I1HA 1S4QA 2Q5JA 4WW0A 1YRWA 3GLRA 3TB4A 4AFNA 1S10A 3L0YA 3F5MA 1S2IA 4DWVA 1ABEA 3IFSA 4OXIA 4C04A 5DSTA 3V1YA 3IEIA 1KDZA 3FYUA 1PV4A 3VC3A 5H02A 4NZNA 1XNQB 3C8DA 4ETIA 4F2PA 3WLLA 4CKBA 1KOFA 3VFDA 4PC3A 3C5HA 3NWOA 1M8GA 4HYKA 2PYIA 3O0DA 2FN7A 1V5IA 2JGAA 3S7ZA 2NYAA 4Q9JA 2IGBA 5ESWA 1XU4A 2YFHA 4KIFA 2CEKA 5J63A 4DV0H 1BJKA 5JLJA 5K9ZA 3VJMA 4K6KA 4X9XA 2Q5CA 4ZGGA 1PJTA 3FMFA 2FK1A 4AW9A 1DEOA 2D54A 5EPUA 5BUSA 2G5PA 1H69A 3LUHA 4DXAA 1AF4A 4LFCH 1OPXA 2OBXA 5EJEA 4MUJA 1SQ0A 4GMKA 3V42A 5BUCA 2PEYA 3TX2A 5HKAA 1F2UB 1MV5A 3I2KA 9LDTA 2GN2A 4XJVA 4KSBA 4C3UA 2Y71A 4XD7A 3KHUA 4RV9A 4BNDA 3OT1B 3MOSA 3PZRA 2JGEA 2YL2A 3N2YA 5F1OA 1RM3A 4OL9A 3T41A 3V6MA 2WQZA 5U4QA 3ESZA 2QNIA 1JBQA 3DEZA 4FNOA 4LWZA 4WLNA 4A2AA 3PUIA 3ZTWA 1G59A 2YCBA 5E1DA 1HZZC 4MYHA 1YIDA 1BVHA 2YW9A 2HRRA 1Z83A 2C31A 5FPYA 4TZ0A 4PC7A 3QM1A 4UBMA 2QE6A 4JOSA 2QMHA 3KT3A 4ROSA 4IH9A 3TKAA 2GHRA 2H0QA 5L1JA 4NX2A 2PJUA 4II3A 4F50A 4KQEA 2O7VA 2O07A 3FB1A 4QEDA 3AM4A 2C4TA 4CF4A 1P61B 3B3QA 1P6XA 2X8LA 2VDJA 2I9PA 2H2FA 2VQ6A 5F2EA 4MDHA 4G1FA 1R12A 4JEMA 1ECBA 1OX5A 5E6UA 2WOOA 1PGJA 2NUTA 5F12A 2PKCA 7MHTA 3C0KA 1UEXC 4RCNA 2C8KA 4CKYA 5KVQA 3LUDA 4NYJR 5AYVA 1IBKB 3DZGA 3QNUA 3G6KA 1R6BX 2UVUA 4AIIA 2C5SA 2GF9A 4PRKA 1X8JA 2MDTA 2YYSA 1IWPB 2YWEA 3CGWA 5EXTA 2NU6B 1NMYA 1QNLA 3FJ1A 2P5UA 2ZTLA 4KQIA 1L5GB 1RZ3A 1A8QA 4LWOA 3HGTA 4QQ8A 3UCXA 3EN0A 2H4JA 4MVXA 3EXAA 3RC7A 4CKZA 1RJRA 3MJCA 4DTIA 3H2YA 4GECA 4KW7A 1KFEB 4YVFA 3O2SB 4Q21A 2IYOA 1Y3FE 3O1IC 5AI5A 4DG8A 5LYJB 2XWPA 1ISJA 4MINA 4BAUA 4R01A 5K3EA 4AJOA 3EXHA 1RIIA 3A11A 3JYPA 3HL0A 4FEGA 4NTZA 4NH0A 4BMDA 1BAPA 5AVUA 4MS4A 2Q0XA 4OQFA 4V3CA 3VV2A 4Z4HA 1CUGA 4RFSA 1N2BA 2WZQA 3PR3A 4US0R 1RWXA 1D0SA 4C22A 2GAFA 1T0BA 3DFUA 3ZQ4A 3NUAA 1D1QA 5EZQA 4ER7A 4U2BA 4BX0A 3ANNA 1V3UA 4M0MA 4M7RA 3EULA 2B61A 4Z4EA 3AHGA 3GQBA 2H2DA 3T5BA 2VBGA 3MTBA 4JENA 4RLSA 5CXUA 2GN8A 3DTNA 4NE7A 2BM1A 4UE2A 2V3VA 5G4KB 1PE0A 4LVCA 3G79A 1FNSA 3HYNA 4M1EA 3LT4A 1F9EA 2CNVA 3OC0A 1V25A 4YFVA 3JQ8A 4KV9A 1V16B 4G5OA 1EE9A 4R8LA 5E1BA 2OZPA 2ZBGA 2ZBDA 1NW4A 4GP9A 4XVRA 5EP2A 3K31A 4HUTA 5IX8A 1P1BA 3QYPA 5EOYA 1O6FA 1I4LD 1QANA 3AF6A 4HNHA 3PXCX 4QEZA 4ND3A 4CMIA 4PHTA 2VJKA 3KQQA 3EZ7A 4HAOA 1TJNA 3TG8A 4EW1A 1IBLB 1LPAB 2BBSA 2GRAA 3JVDA 1LFDB 4R31A 2YV3A 2OCAA 2PQMA 1ETUA 3CUSA 4BUZA 4M8LA 3WJ7A 2G9ZA 3LMLA 1TC1A 2HUPA 4ZXPA 2K7FA 2BR5A 2PKRA 2PS0A 4CMFA 3WDKA 4DY4A 2HZBA 3C74A 3ZI4A 3CISA 4CQMB 1XMJA 2DUJA 3MWLA 1O6BA 1EFVB 3QTLA 4RMHA 2XCQA 5DN6D 1KQ3A 1Q12A 3FWKA 4Y6PA 1RYNA 2E3JA 4ZOQI 2KX7A 5M7EA 3GLIE 2JFYA 3A3PA 3CUVA 3I92A 4HWPA 2ZUTA 2V0CA 2PXCA 3AU8A 2F55A 5F9HA 3AEZA 3CKLA 3KB1A 3FPKA 3NHLA 2YX1A 2A9JA 5IBRA 4TUYF 1ORDA 5FPOA 2F1RA 3AG5A 3DDZX 1KNXA 4WBNB 4YA6A 2X5NA 5JCPA 1ISGA 1NVAA 3UENA 3DKPA 3QBJA 1PK8A 1M74A 3AINA 3KEGA 4DWOA 5KHAA 5K09A 4APMA 1Z07A 3BFPA 4JP8A 4ETNA 2P8JA 1E3JA 2VJAA 3I30X 1TFRA 3KDPA 3WRWA 4DCJA 3U60B 4RVFA 4F6RA 3MJEA 2QTMA 4D43A 2WT9A 2R84A 3MSXA 1Z88A 4NU5A 3RS2A 1JXOA 1OZGA 1AV6A 2Z6QA 1PZEA 2INGX 5JG7A 5BV0A 1A9SA 2NUPA 3DNMA 4HX5A 4XR9A 2YWXA 1QRTA 1V7CA 2J08A 3F4KA 5A06A 1A7KA 4RCYA 3TTYA 5F7XA 4RZ3A 1YH3A 4NMLA 5JROA 3DE3X 4PX9A 3I3SR 4PTZA 1VJTA 4YPFA 4DV3H 2PX2A 4IDGA 5PGMA 4BB6A 5BNIA 1U0GA 8LDHA 2VTDA 4PBCA 1WCV1 3B85A 4GPAA 4JWKA 5BOSB 1BDBA 1J22A 1DV1A 2CW7A 3K53A 2JFWA 2EKBA 1ESNA 3U9TA 1HNWH 2ZRFA 3PDIB 3KYDA 3VPAA 4I2VA 4B9EA 5BWUA 3UMYA 5JQWA 4P3KA 1FNMA 3CEAA 1F51E 4PG7A 1ACJA 1V9PA 2KPOA 3DNFA 1GHTA 4KB5A 2AW5A 1Q7RA 4AY5A 1LPSA 3FLEA 1DWOA 2DG2A 3SIWA 3FFBA 3SR4A 4JUDX 4AJHA 4Q3LA 5CH8A 5KYXB 1NWCA 2X0IA 4UHBA 4Y8VA 1SG6A 1X42A 4R9RA 3VZDA 5ITVA 3B9QA 1H22A 2PCLA 3FIJA 3SYRA 1C50A 3SQLA 2ZB8A 4FYJA 5FORA 2IZ1A 4N5HX 1FKAH 2JK0A 4MWSA 5K3DA 4HZGA 4X61A 1U5AA 4UPEA 3K6SB 3E6AA 3KVYA 4FCWA 3N0XA 4WE3A 2BY4A 3FN4A 2QB5A 3BKXA 3MS4A 2B35A 4DBZA 4JJ4A 3ZWNA 5L6MB 5HILA 3MW8A 3EH2A 4CIXA 3FHLA 1L8OA 1U0HC 3WGHA 4BMYA 5DM70 3NBQA 5LMNH 1S3GA 2WHPB 5GIOE 3LU1A 2DY0A 3KZCA 1TE2A 4FJ1A 4CTNA 4UBLA 1W47A 4E5UA 3DLPX 2ZITA 2QQ0A 2IYSA 3B1FA 3AV3A 3BE4A 3K2IA 2ZANA 3MT8A 1FK8A 4TN1A 5DIZA 3GIPA 1G8FA 3DUFA 1LFAA 2QGNA 4LY9A 5E95A 1KYVA 1PLKA 5HS4A 1D6JA 3M4IA 1NM5C 2OV8A 2O0HA 2Y2UA 3A6ZA 4EPTA 3OLVA 2G72A 2R2GA 1HOXA 1WUYA 4BCCA 1QWOA 3U1BA 4X84A 8ADHA 1YCDA 4X90A 4MYTA 4LBYA 4Z4GA 5E8JA 3TQ1A 4CF7A 2ZRKA 4UMEA 4F6LA 2VHTA 1WSBA 3W7VA 5JNWA 4KWHA 2JAQA 5HA5A 4DEXA 2L42A 1TM2A 2X5OA 1CY7A 4MH0R 5T6MA 4CM4A 3NBZC 5ITZA 5H4HA 5HX7A 5IYCG 5LYJA 5IRCD 3VYVA 3GFOA 2FMAA 1VLZA 2VFAA 4I9FA 5K20A 1U7WA 3FUVA 3S8YA 3TBHA 2V9ZA 4TQAA 1VYHA 3KWLA 5CVVA 4LE2A 3VR5D 3WGTA 4C78A 1QQTA 3GIQA 3RIZA 4QODA 2QN1A 1J2YA 1SPBS 2HEIA 4GVLA 5E3IA 2A6PA 1ATZA 2V7PA 4RVSA 4G84A 3RFTA 1H2XA 2O7SA 4X41A 2ZIAA 3MIZA 1ZMBA 1YVPA 4TS1A 5FOWA 5BWRA 2BGRA 1TM4E 3I09A 4ITUA 2CHFA 1X7YB 4H7PA 2Z08A 3KELA 1G4HA 1VAJA 3TY5A 3C5CA 2QMUA 1Z3CA 4LZOA 3GQBB 3SYKA 3MCVA 4JA2A 2EFDB 3HG7A 2OCLA 3RH0A 3RS4A 4GSLA 4Q9IA 4E0BA 2YS6A 4RK0A 2LRHA 1MW8X 1QIFA 4JI7B 1J70A 4R9NA 1Q3HA 1WDWB 2MWMA 3BA6A 2IW3A 1M5UA 1EX1A 1NUSA 3NFRA 4ZQHA 4J3NA 4ES6A 1XV5A 4ZPJA 1VBGA 1V5GA 4K6NA 1U1CA 1XK6A 3QELA 3SYLA 4MPPA 2YYAA 3CO5A 1P91A 3DVRX 3NGXA 1ZVJA 3H13A 1TM1E 3FPCA 4K0RA 4MKGA 3PLNA 4UUPA 3KQHA 5F2OA 1NF2A 2RBEA 4RXMA 1ZW1A 1EG2A 5IT4A 1P72A 1ZNWA 4OA8A 2M2IA 3H3JA 5B3AA 3WBJA 2DFTA 4X6UA 4ME6A 2CL5A 1FQKA 2FR8A 1GKIA 1PYOA 2QIPA 3JQAD 1C9JA 2AMJA 3PNMA 4L5JA 4O2RA 2BQRA 4AD8A 5DLGA 2Z8YA 1F20A 1JDBC 3A6FA 1RI4A 2CJPA 4JBIA 1JJFA 4H0CA 2JAOA 5C5CA 3RG2A 5ENDA 5TT0A 3H16A 1GGNA 2C9MA 1EUDA 3JCZA 3KT6A 4EUSA 3BJIC 2YWFA 4BLWA 4BRWA 5EJ6A 4LXIA 4RJJA 2OV6A 3MF4A 3PEYA 1NIPA 3DPIA 3MWEB 4X7PA 4Z7NB 2PANA 2RIPA 2Y4NA 4I2NA 4I9NA 1TVEA 3D6VA 3LWBA 2J4CA 3LSYA 3HH8A 4GE3A 4WH0A 4FC7A 3Q11A 1JHDA 2Q99A 3GVIA 2E1PA 3KR0A 2IYLD 3W6NA 2GLTA 1OFIA 1NI4A 4G5XA 5J43A 5KFHA 2GGSA 4PLTA 4HC4A 3PPVA 1GSIA 4JYMA 5AKGA 1NWHA 2OENG 2PXAA 1TPZA 1G20B 5CM0A 4K0KH 2ZYVX 3AHDA 3G1UA 1GFZA 4HXEB 5EHNA 4ESOA 3RWMB 3ENZA 2G0AA 5HKOA 1GT91 4LI0A 4NU0A 1FIUA 5JC1A 1DUVG 1KKUA 3EBLA 4PX2A 5FOXA 4UVHA 3S55A 2F1HA 4LECA 3NONA 4HDRA 4DCPA 5M2QA 3QPUA 5G3YA 4LSXA 4A0FA 1JEQA 1OT3A 3BMOB 1OI2A 5HGJA 4RLQA 3QVKA 5FQNA 2NNLD 1Z6YA 2WLTA 4YWHA 4D0SA 3ECCA 3QEMA 4NNOA 1XZHA 1OXSC 1SUAA 2ZETA 1FXWF 2O3RA 3BREA 4MUFA 2IP4A 2OYCA 4WKGA 3CW8X 4EEYA 4A9AA 1BKSB 2CJWA 2EW1A 3ZWOA 2HSZA 3NDBB 4MUHA 4LF7B 2NPOA 4JZKA 4JI6B 2GARA 3IRVA 4PBSA 1PJSA 2E5LH 3A58B 3A1CA 3T3MB 3WB2A 1FJ2A 1DAFA 2XBLA 3ZXSA 3DL2A 5DI3A 4NNPA 4EHJA 2HJGA 5K05A 4IIUA 1SCIA 4MPJA 4CQMA 4NBVA 1QHIA 5EWFA 2FV8A 3FM9A 4D0NA 5K4HA 1U9YA 4Q4CA 5FLXW 1AD2A 1TYCA 1XU7A 1MJNA 4LHEA 2POCA 2Z5FA 1JLSA 4OYLA 3REOA 3WYFA 4CLEA 1F4PA 3DLHA 4WAUA 3KTOA 1AKEA 2CZQA 1QG2A 3I2YX 3OO1A 4C7OB 3M9MB 1JE0A 5LWHA 4RORA 3NTLA 2A78A 5DBIA 3FYCA 4YRBA 5CA0B 4JI3B 2VZ9A 1B23P 4ID3A 5DK4A 3E22A 3KAJA 4YUWA 5I5GA 5T14A 4EY7A 1HDGO 1P2GA 1U3FA 5FB3A 4WCFC 2G76A 1M8FA 1JQDA 1NVMB 1RTKA 1T4DA 2MYUA 3RTCA 3G68A 4BBZA 2M6SA 2PVCA 4DN6A 4L22A 1R0SA 5LZ4A 4ASUD 4EY3A 4BVFA 1XIVA 4CFSA 3WX0A 1OXXK 4GXRA 4ZHQF 1A4RA 1W4AA 3GUUA 3ADPA 3PW5A 2BL4A 1TXGA 2Z2KA 1E61A 2XQKA 3GB9A 3B1KA 5CT5A 2VDWA 3ITKA 4LGCA 5A3VA 2JLAA 1EFLA 1NI3A 1CQJA 3S7TA 3BWVA 4HX9A 2J0VA 2GPSA 1C0LA 1BCRA 4KO4S 5F4BA 1T4GA 2XCIA 4HDKA 1T0IA 2YDYA 4YR2A 1IOVA 2L0XA 2O9JA 4HB3A 4CLDA 1JJAA 4OHCA 2O1XA 2OAP1 2AN4A 2XTJA 1PHRA 1MD9A 5EIHA 1T4BA 2QTAA 3ESXA 1K4KA 5DTRA 3UBMA 4AI6A 5JJIA 2D7CA 4YREA 4B6FA 3UZOA 4FXOA 3UK7A 1OZFA 4DV5B 1TC2A 3QE3A 4E5VA 2XNSA 5DVZA 3F0TA 3HPRA 3UOAB 1HXHA 4OMFG 4D4KA 1AM4D 4WQMA 3R0JA 1ZRMA 1N2SA 2EDCA 4ZODA 3WL6A 3T9DA 1Z7WA 3EDOA 5TQJA 4XIIA 1Z8DA 1CUDA 5CURA 3A1UA 2B8EA 2YZMA 3DBVO 1X3SA 1GNTA 2MCTA 2BHLA 4WJKB 4EF6A 4YRZA 5J2TA 4PWYA 3L4SO 4CR7A 1I9CA 3G5MA 1A4XA 1XUOA 1YI8A 2YNMA 3GOQA 1NATA 4MKFA 2PM8A 4XR4A 3RRMA 4F45A 2OYSA 5DGAA 3JY6A 3GIIA 3FMOB 5CP8A 2FSVC 1LNZA 4A82A 4C5AA 4EPVA 3OZ7A 3RU9A 1I1NA 3D02A 1U8ZA 1U6JA 2GNAA 3G1WA 3N5KA 2CDAA 3KPYA 4PR0A 4XB6B 1HGXA 2HA3A 1W9HA 3IVXA 3ZJTA 1WD7A 2W2NA 1RTTA 1P1JA 1SJ9A 4P84A 3QWAA 3SGLA 2VUIB 3ZDFA 4QGSA 2ZUFA 3QOYA 4JGIA 4JQZA 1RLIA 4EG1A 1YB5A 4G0UA 1Z6PA 2JLBA 1GKUB 2X40A 4QWBA 3B3FA 1ODJA 3FSGA 4ARZA 4A0SA 2G9UA 4NULA 3BFVA 5LP6C 5C46F 3L84A 2BOVA 4RVGA 2V58A 4DV2H 5CVTA 3IVCA 4ZT3A 2VHUA 1I2LA 1JA9A 3LT0A 1ISFA 5F21A 1NFFA 3R7BA 2JLVA 3ECSA 3P9XA 3R9XA 1MXHA 1U7TA 2I6XA 1PNRA 3LP5A 4MB6A 2NVOA 1IXRC 4O7RA 2GCOA 2UYGA 1ZMRA 3I76A 2OT3B 2XMZA 2X7XA 3EF1A 5REQB 5B3LA 1GGVA 2PFGA 2QPOA 2O23A 4X3PA 5ERXA 1L8QA 3TEMA 4W7SA 3NGLA 5DEOA 4P36A 2EJWA 4KN9S 4CMGA 2B8JA 1UK6A 4CCYB 4MV1A 1ODKA 2PFKA 4QOHA 4G1EB 4DV4B 2AOUA 4M36A 2IRWA 2FJZA 1FVFA 4KIUA 2FLVA 4QBFA 1MX3A 3FMGA 2VQEB 2JFBA 1QH9A 1XFDA 3BSFA 3WWDA 3LTEA 4CM5A 2HK6A 4ZCIA 3JAKB 1V6SA 2ZUCA 1E5TA 4HLCA 1XO1A 3SN6A 2FXVA 1KMIY 1G41A 5C31A 2PMCA 1NLUA 3EEOA 4ZVUA 3K2QA 5ECDA 4LBWA 4DRYA 5KQGA 2IZ5A 2EW8A 1TYEB 1WF6A 4FDLA 7ADHA 3A0RB 5CGZA 1UT8A 3HCAA 1HG1A 5TR9A 3RVRA 2I3BA 3T0IA 2R60A 2Q6OA 3CZMA 1UJ2A 2IZ6A 4DLVA 4AJ2A 4BEWA 4C0LA 1IN5A 3E7PA 2FUNB 3C7KA 3TQFA 4ECWA 3QMMA 4A8JA 1JZQA 3KJZA 3QKUA 4GSKA 3S3TA 3UJCA 4BNUA 4MWOA 4WA7A 2R8EA 3NNNA 3AXTA 5KYUB 3DDNA 3FPEA 4DYDA 1JMYA 2JC3A 3KPJA 2N42A 4K28A 3SQOA 2OO7A 4R51A 3I73A 2HEGA 2RH8A 1NJ2A 4FS3A 3Q1KA 2Q2NA 1ZUD1 3DW3X 4KXXA 4FK8A 4Q4HA 1W46A 3G0HA 1S97A 3L6EA 4L08A 3QHQA 1Z75A 4P7BA 4B6GA 1RXYA 2AWOA 5HMLA 5FWXB 1MJGA 3HGMA 4J43A 1F1JA 2PX6A 1YRBA 3N0TA 1BGVA 1N7IA 3C3WA 4MWTA 3W78A 4ZI7A 5KO2A 1EYZA 5BSFA 3FI0A 5C8ZA 2VLIA 5CM9C 1B33N 1YZGA 4GRIA 2VLBA 2PV0A 1UJCA 2FR1A 2I1WA 2VHZA 1TKCA 3DMGA 2C9CA 4U0JA 3UMBA 4AKTA 4OAOA 2C7QA 1LA2A 1ID8A 4OAPA 4NZMA 5CNMA 4C3OB 1UZUA 4Z9AA 3U4MA 4LFBH 1YR9A 1JDNA 2J3QA 4J0JA 1E9AA 1NURA 1KGSA 2QTVB 5BW6B 5JYDA 2WRZA 2Y6UA 5I5XA 4GR9A 2ECFA 2AA3A 1OXBB 2D74A 2NSYA 2PA0A 3D4PA 3H9QA 4ZC1A 4DS3A 1X38A 1LGYA 5H0IA 2KLHA 2WSSD 3KTAA 3WKAA 5JARA 4QICA 2OZLB 1SRRA 1UPXA 3NUZA 1KQGA 1HE8B 3TW6A 4MTLA 4X1KA 1NU6A 3T7TA 4TV9F 1SHKA 4MRVA 1QIHA 3FROA 2B1RA 3ZTYA 2ONYA 1FUYB 1KHTA 1YQTA 3A4VA 3QEOA 4B6RA 3KYHC 1JX4A 2C59A 2CHQA 3NC0C 3IKJA 4YJ3F 1XFAA 4HFRA 5EYPB 5TQ2B 2I8AA 1A0OA 3G5TA 1NPYA 1PZXA 3EYYA 3L1HA 2BKEA 2NO4A 3R3VA 4W1RA 3UG7A 1FLVA 5FTJA 5HIAA 3Q1LA 2ZIFA 5FAXA 4K1XA 3RJZA 4OGLA 1EK0A 5C7YA 1FMCA 4TQUS 4H7FA 1KE1A 2H0AA 1FNNA 3MJTA 3QJGA 4MW0A 3THYA 3ABIA 1T6XA 4G97A 2BGKA 1Q57A 2NUAB 3OKPA 1N1EA 4MGEA 4U6QA 1L5WA 2AG8A 1GDDA 4KO1S 2JIZA 4M8NE 2IKSA 5JADA 3VH3A 1SAYA 3RYFB 3U40A 4A6EA 4AO8A 4FMPA 5DDIP 3RS3A 2BFBB 4DSAA 4X65H 2I54A 3JWJA 4O0MA 3GHYA 2PZMA 2PQ0A 2QZ4A 3K7EA 1SGWA 2OUKA 2ZIXB 3C3MA 3IUPA 2ZDHA 5EWMB 5PNTA 1AKUA 3VI4B 3WTBA 2X6RA 3GO4A 1K88A 1HOTA 1RWPA 5CFLA 1JH9A 4L95C 5EG5A 4TMFA 2XUOA 3RASA 2DEUA 2BFOA 3UAYA 2YC4C 1ZZEA 4N7JA 4JY7A 4RYDA 1SFOA 5D2CA 2CWDA 5FLKA 5BY2A 3GCDA 3EBOA 3IQEA 4RA9A 1ZMTA 2YRWA 2ZULA 2GK6A 2QD4A 4RF3A 1PNQA 5JY1A 4F93B 4NEGA 4O4LB 4PY2A 3ONEA 4IVNA 5JJCA 1MVOA 3SD7A 4XDGA 1JIKA 4P4SA 4ZQIA 5EQJB 5ALZA 3PNQA 4TYPA 4HS4A 4L6IA 5CCBA 4ZEXA 3UJ3X 4Z5XA 3AF4A 3STYA 4D3XA 5KYYA 3HOZG 1V5EA 4IMJB 4HO1X 4DC1A 3MTQA 1XQYA 4RY8A 2E89A 1XMQH 2R86A 2VNIA 1UJBA 3GVPA 4D6XA 1M2EA 3U3DA 3QPVA 1POWA 3W0LB 2V4ZA 3IMKA 4UBIA 2DR2A 2Y8EA 3O1LA 2IXEA 5E4JA 4IDPA 4A0HA 2EX0A 3DE6X 1VL1A 3NT2A 1KDYA 5ICGA 2AEEA 3I4MG 2QN2A 4FZVA 1NQAO 4N7BA 4U7JA 2CCGA 2PDAA 2GO1A 3SC4A 3BK7A 4OREX 1FMLA 4C4AA 3ILXA 5DGCA 1WKVA 5BV2P 4YJ3A 4YP6A 5IKEA 5LA6F 3OZEA 4Y6OA 4YJ2B 5IVHA 4Q03A 3ETCA 3O7MA 1H4QA 3PC7A 5KFEA 1QZZA 4II2A 2DTEA 5TGTA 5JXHA 1INLA 2FP4A 4NMHA 4G5SA 2P40A 5B4UA 1HDEA 2CLOB 3EIQA 3GJ6A 3M2TA 5DOVA 3WQRA 4B6EA 5IKOA 1I9GA 1LW6E 1QNFA 1XTBA 2GQRA 2QOEA 4BQRA 4B47A 3LHFA 5EGSA 2IYQA 2FMFA 5K3CA 4E5KA 5HRCA 5HUJA 4MV7A 3CWZA 3BJYA 2GAIA 1KS2A 4RU1A 5L4LA 5TF0A 2H1CA 2Z0MA 1YTLA 5K4AA 3T3HA 5HTOA 5G1NA 4QDJA 4EKNB 1JR3E 4JP1A 3K5IA 1SQ6A 1RHRA 4MS3B 1I3NA 1R8SA 3IODA 3IUSA 1K6IA 3KQMA 5I5WA 4GVXA 4IHAA 5HCIA 4B85A 1SD1A 4MEJA 4DLLA 4E6EA 4XVCA 1W4RA 4HD8A 1YUNA 4AJKA 1Q16A 2QL5A 2X2PA 3FWZA 1TKRA 2NYVA 1OHHA 4CUZA 4NCJA 1XRJA 2G5TA 3KL2A 1MX1A 2AKAB 4RJIA 3CUWA 4LDZA 3Q8QB 4GZ3A 4A27A 3PJFA 1NVEA 1RXVA 1QGED 1PT5A 4BO3A 2OBMA 5JQGB 1WXFA 3NB0A 1ULAA 1RYEA 2X4LA 3COZA 5FTMA 3RARA 4O82A 1ZJZA 2GYUA 3E9EA 1W5FA 1WB5A 3EASA 1KPHA 3IALA 4BE9A 1USGA 1AB6A 1VJDA 4FYYA 1SCAA 3BFXA 1LPBB 2QP9X 1E9RA 2JI6A 4HN9A 2XF8A 2AG5A 1HQYE 1I2DA 4RVOA 1VLQA 2VN8A 2Y0PA 5L3QB 5CX4A 2HG8A 3RRZA 4P5EA 5J23A 1UPAA 3OZWA 3KT8A 4IEFB 1M2VB 1BEZA 1QH0A 2JHPA 5JZ9A 2CXQA 3H2SA 2FPLA 2QENA 3EXFA 2QTZA 3Q88A 3EGDB 4U63A