1AUVA

Structure of the c domain of synapsin ia from bovine brain
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
306
structure length
292
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLINQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATTEPFIDAKYDVRIQKIGQNYKAYMRTLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synapsin I is structurally similar to ATP-utilizing enzymes.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords SYNAPSIN IA
total genus 80
structure length 292
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1auvA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1auvA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1auvA02
4MA0A 1Z2OX 2ZDGA 1EUDB 4IZOA 4EABA 1B6SA 1M0TA 4ZHQF 2R7NA 3HBLA 3WO1A 2XD4A 2YL2A 4M99A 4O83A 5LYJF 4O86A 3Q2OA 2R82A 2NUAB 3LWBA 4HNVA 2YS7A 5CA0F 4J6EA 3ETHA 1C30A 5JVDF 4FFLA 1UC9A 3R9RA 4M9UA 3TINA 3GLKA 1GSHA 2GQSA 5CA1F 4FFMA 2NU6B 1KBLA 2W6PA 5JQGF 1M6VA 1DV2A 5K2MA 4HQ6A 1T36A 3RFCA 5LA6F 2NU8B 4EA7A 4O2AF 4O84A 3VPCA 2FPPB 4O7ZA 4E4TA 1KJ9A 2R7KA 3U54A 2YYAA 4O82A 2XCLA 3R5HA 4I50F 1SCUB 2W6NA 4QSHA 1KC7A 3BG5A 2GQRA 3TW6A 3U9SA 4TV9F 4FFRA 1CS0A 1CQIB 4MAMA 1GLVA 3JRXA 1UC8A 3OUUA 1OBDA 2PN1A 3RV4A 3BSYA 5J2UF 5JH7F 2FPGB 3MWEA 5C1OA 4NYEA 2R87A 4MV8A 4EGQA 4O4IF 2R7LA 4IHJF 1WR2A 5DMXA 2YZGA 2YZLA 1GGOA 5BPHA 2IP4A 1KJQA 4YJ3F 5IYZF 2HGSA 1EYZA 5BMVF 5GONF 4M98A 2YZNA 2PVPA 2NU9B 1AUXA 1DIKA 5EZYF 4L1KA 4XYLB 3ETJA 2VR1A 3DF7A 1Z2NX 2W70A 1B6RA 3BSWA 2ZDHA 3LP8A 4ZQIA 2CNUA 5H80A 1KJJA 2DLNA 3R5FA 1KJIA 3ORRA 4O7WA 3N6RA 2DIKA 3V4ZA 1A9XA 2VQDA 3R5XA 1OBGA 3K5IA 4FFPA 4I4TF 4YAKB 2GPWA 2NPOA 4TV8F 4O7SA 2YW2A 2DZDA 2FP4B 2W6OA 3NUAA 3OUZA 2W6ZA 3I12A 5LOVF 1CE8A 3N8DA 4O81A 5C1PA 3WO0A 3HB9A 3JRWA 4GGMX 1PX2A 3TIIA 2J9GA 4O7NA 3U9TA 2FPIB 1C3OA 2C00A 2ZDQA 2R85A 3ORQA 1VKZA 3QFFA 3RV3A 2YS6A 3JZFA 2CNQA 3Q1KA 5CB4F 1EHIA 2R86A 1IOWA 1JLLB 4EAAA 4I55F 4FGRA 3R23A 4WBNF 1JKJB 4IIJF 1PK8A 4O7VA 5D8DA 5JVLA 2I8CA 4YB8B 4C5CA 4IWXA 4XZ3B 4XYMB 2HJWA 4FU0A 2R84A 1GSAA 3V4SA 2YRXA 3K5HA 5KX5F 3KALA 5J2TF 2SCUB 4O7TA 1DV1A 2CQYA 4IWYA 2NU7B 1BXRA 1I7LA 2W6MA 2GPSA 4O4HF 5LP6F 3KAJA 3E5NA 1AUVA 4HNUA 5BPFA 2VHEA 4EG0A 2OLSA 3HO8A 2W71A 2R6FA 2W6QA 1IOVA 4FE2A 1Z2PX 2Z04A 3VPDA 3AX6A 2V5AA 3MJFA 4HR7A 4MV4A 5CAEB 4FFOA 5HV6A 1W93A 2YWVA 4MV3A 5LXTF 3U55A 2P0AA 2WYOA 3UFXB 1GSOA 2CZGA 2FB9A 3GIDA 4EA8A 2YRWA 3MWDA 3VA7A 1EZ1A 2Z02A 2I87A 2QK4A 1I7NA 1VBGA 4FFNA 1KUTA 3WNZA 1JDBB 4ZI7F 1A48A 4YBZB 3G8CA 3KAKA 2PBZA 3TIGA 4Y8VB 4O4LF 1EUCB 1M0WA 2DWCA 4O7LA 4WD3A 1ULZA 3BFPA 2VPQA 3RUPA 4DLKA 1E4EB 4ME6A 4YJ2F 3VMMA 3SE7A 3VPBA 3JZIA 4MA5A 4O4JF 4M9CA 1W96A 2X0SA 4HNTA 4MV9A 3AW8A 5FNVF 4XX0B 4O2BF 4MV7A 5KKNB 1E4EA 2CNVA 3KREA 1BNCA 5JQWA 3BSSA 4TUYF 3TQTA 2R7MA 4EA9A 4MV6A 2I80A 4DIMA 4RZQA 1CQJB 2V59A 2YZMA 2GLTA 4MV1A 4ZOLF 5I47A 1KJ8A 3K3PA 5C8YF 1JDEA 2V58A 3G8DA 2QF7A 4O7YA 4EGJA 4C5BA 4O7RA 5HBRB 4YAJB 1KEEA 4C5AA 1VBHA 3VOTA
chains in the Genus database with same CATH superfamily
3LXUX 3GIJA 3KJIA 3HNPA 1R0KA 4PC3A 1XWFA 2YN2A 3DBOB 5FWDA 4ECYA 1C2TA 3WNBA 3C5EA 5EIEA 3LGAA 1LU9A 2VG8A 4HC4A 4EY6A 1B6SA 1UM9B 3VMFA 4E2WA 1Z62A 3VBEA 1XLVA 4LF8B 1YDHA 2HOQA 1XRQA 2G77B 3BWCA 1SHUX 3EQ6A 4Q19A 2GGSA 4FCWA 1JBEA 2G5TA 4N54A 2NVOA 4XASA 2YL2A 1MH1A 4FI3C 2G1PA 4N0DA 1FMLA 2G17A 2PEYA 3AP2A 3FBWA 1JQAA 4OHPA 4UARA 3WGZA 1PG2A 1VP9A 4NK5A 3N2IA 1GZ3A 2BL4A 4B34A 5FEUA 2V74B 3DL2A 3E3LA 3P0RA 5K0FA 1IJEA 1S8NA 4R6XA 1LBEA 5HILA 4G5OA 1KH2A 1U3DA 3L07A 1COWA 4P08A 5CIWA 3I6BA 2DT5A 4E5MA 5I7EA 5M7EA 1V7CA 2XCTB 1KBQA 1EU1A 3RASA 5HKAA 4DIFA 1VSVA 3O82A 4EI9A 2HM7A 3K1TA 3KZXA 3OJFA 5CX1A 3VOBA 5JSZA 3PEYA 2VHVA 2UVUA 4RKYA 2UXCH 3PXBA 6LDHA 5ITVA 3K6SB 1N0UA 2UXBB 3J80W 5IH3A 3FWPA 2VLBA 1FBNA 5JVDF 1C3JA 3EODA 1VYTA 3MXOA 4JL6A 1H8EA 3UWKA 4JBLA 5U1PA 3W4KA 5JAHA 1XK7A 4FJ0A 2XWQA 5JNWA 1A1SA 2EGHA 3CGWA 3LRTA 1Y9AA 4BV3A 1FFBA 1A98A 3LL7A 5DYWA 3AETA 2FP3A 4JVLA 4O2RA 2PT7A 1MABA 3W3AH 4K9NA 4HPJB 5IC6A 4FFMA 5DLFA 1JQDA 2NU6B 1NLFA 3IO3A 3IT0A 5HUQA 1HG1A 4YUXA 4D81A 2JLYA 1D6JA 5C5DA 4O4HA 2FF5A 1R0BA 1GL6A 3FFWA 4RXTA 4URUR 3FTCA 2Q7OE 3LUFA 4DAEA 4EB3A 5IDXA 3T9CA 1MR3F 4KQWA 4CLEA 5J4YA 5D3KA 5KFEA 4C30A 2XUOA 3HB7A 1FJ2A 4WLNA 1XRJA 1L5HA 5BR4A 5IT9A 1HZJA 2DR2A 3F5DA 5ALDA 4H7EA 3C5VA 3QYFA 3LBFA 2YCBA 3LY9A 3N5CA 4NBWA 3O9ZA 4IH9A 5E3IA 1KEKA 3HSSA 5EHGA 1JI3A 3L02A 2FY8A 3TZEA 1E7SA 2X86A 3N0WA 4TKVB 5C4XG 4MS3B 2G9ZA 4U63A 4CHIA 4I99A 1BE1A 3Q41A 4FGKA 2X7JA 4IJKA 4X64H 2ZYHA 2DKOA 2HYDA 2QTTA 4AG6A 3TOZA 4FDTA 1M7HA 2OFPA 1UC5B 5K9ZA 1F4VA 4D44A 2EAUA 2Y0EA 3T5MA 4OOFA 4C78A 1UEIA 4RFLA 4URFA 3KHHA 2AN9A 4WBSA 3C3CA 5IWAH 3TL2A 1GQ2A 2C7VA 1B42A 2WIDA 2ZJ0A 4F97A 4R1UA 2UV8A 1CBUA 4Q18A 1AKMA 1GUDA 3QUSA 4N3AA 4X1KB 1CF9A 3WNQA 3PFKA 3EVEA 3E3OA 3FNFA 2PX0A 1L7BA 4XWWA 4MDFA 3MR2A 3LUCA 4MKRA 1LFAA 4Y7DA 1EGAA 4G23A 3OX2A 2DJIA 5DBIA 3EC7A 1RDFA 4N47A 4AWXA 5KOHB 1UIRA 3IVMA 4CLHA 4HWSA 2CLEB 1KEUA 3KVNA 2HT1A 4RMIA 2V4RA 1VLQA 3F46A 3OLVA 4PX3A 3T95A 3ERCA 2J87A 2R6ZA 1NE2A 4Q37A 4AVYA 1NU6A 3B5IA 5DYIA 2M6SA 5IYBG 3TOCA 1GFWA 4GMFA 3QSYA 4FBUA 1EM8A 3BX1A 4FYPA 4IUDS 2VK1A 1VHLA 1T8UA 3B1FA 1E9CA 1TADA 5KFQA 1L8XA 4K6MA 4PLFA 5AVZA 1AS3A 4RB3C 2G04A 4AKTA 2IYTA 4C3OB 5T14A 1GNPA 4PXYA 5EHQA 3UK1A 1P91A 2YHIA 3VXKA 5AFSA 1RI3A 2ZIXB 2ZYTX 3I2KA 1MABB 4MS1A 3RSZA 3W0LB 1FVHA 3V8VA 5LB2A 1RYSA 1I7SB 3UXYA 4AXBA 4EFEA 1POWA 4UNPA 1P29A 1E0SA 4KHPB 3OCVA 2CSUA 3BFJA 4IHJF 5DMXA 1NF8A 2YYSA 2R62A 3DFMA 3S5JA 3PJRA 1L8AA 3I9V6 3R0XA 3IQEA 3SBOA 4MUNA 1ST2A 3L77A 3QXJA 4PO9A 5D1NA 4B6FA 2NYVA 1XMSA 3M4YA 5CT5A 1H2YA 4XWAA 2FWRA 2H7VA 2GPAA 3DD1A 3R0QA 2WIBA 5BWVA 3FNQA 1QFZA 3UPDA 1BDIA 3KM0A 4XFDA 3LY5A 1W8DA 4MVJM 2YZNA 2FEAA 1N2BA 1VKHA 2Q1XA 2Q1WA 3HKEA 4WLEA 5F5LA 1OHHA 3ZZ1A 4LF5B 4D3YA 1TCBA 3ENWA 1VE3A 1CKNB 1VMAA 1HZZC 3QFHA 3N0TA 1SCJA 1U99A 2DX7A 5DSXA 3ZV6A 4F9TA 4XYLB 2AHOA 3N2LA 2CY0A 3ETJA 2OHGA 4RV5A 3QBJA 3SSNA 4C4PA 1GDTA 2BGGA 5AHWA 5A5GA 3ICVA 1DCFA 5ESRA 4YCDA 3VR1A 2J33A 5KDLA 3RTDA 2DMRA 4Q9JA 1BYIA 1RYNA 1WP9A 4IINA 4LJSA 4WNAA 1HH4A 2JIMA 3WWZA 4AM8A 2E3JA 1JB9A 1P5HA 3GJYA 1DO2A 4AMYA 1G8FA 5BN4A 4H59A 2DPIA 5EE0A 1NASA 4N01A 3EVGA 4HGYA 3GFGA 2ALZA 3GN2A 1E6LA 1MOSA 3DUFB 5I3ZA 3FI9A 2W2LA 4IDDA 5D5HA 4U5XA 4DLYA 5DW0A 3D6MA 3RQSA 5L6LB 1OAOC 2R11A 2YNMA 1F9EA 3I73A 3NM6B 1JU9A 4QA9A 1L5GB 3ZI7A 5BRNA 5LQUA 4MGKR 4P83A 7REQA 1TQHA 2D2VA 4OQPA 2R9VA 4DV0H 1HDIA 1IN5A 1K97A 2LR0A 5EWJB 2QRMA 2KLHA 3K5IA 1C1DA 3HA3A 5JYBA 1ZMOA 3S27A 2AVNA 1QDEA 2WSSD 3RVNA 4F4FA 1E0JA 1XSEA 2BKVA 4P35A 3VJRA 3H1BA 1J8YF 3EG9B 3JATB 3HDYA 2LP4Y 3QV1A 1ZXXA 2EKZA 3E0XA 1SEPA 1SKBA 3ILVA 1GEGA 4PLGA 4DSUA 5K45A 1AC5A 1C0IA 1JHQA 1K8RA 4DPKA 4R4JA 5DOVA 1RI2A 2FE4A 4HBZA 4ZO8A 3VR2D 1QRUA 3HLKA 4RDCA 1TTTA 2FW9A 5EXEA 4IYJA 3HJTA 2OBXA 2J4FA 2B1GA 1OXTA 1N7HA 2QUJA 3GP5A 4L4UA 2GHRA 3N1UA 2HTEA 4OF4A 4QASA 4EBDA 2FWMX 1JUDA 4MQFB 5B58T 4DA6A 4KE7A 3WYAA 4J49A 4ARAA 4J94A 4YV1A 1JDVA 1IBMH 5K3FA 2QM3A 4KE9A 3RSOA 3LUGA 4IDFA 3BXHA 1C3OA 4V24A 3H2SA 4Y6PA 2DFKB 2Q45A 4ZDJA 3DMNA 5JIBA 2IHNA 2NACA 2ZCJA 4JEHA 4LF9H 3T5LA 4EG6A 5CD9A 3U3MA 4L02A 2HREA 4ZT2A 4D96A 1YR3A 3TQ1A 5KINB 1ZCBA 2CVOA 2NSYA 1JQJC 4LWOA 1ZD1A 1M66A 1TUEA 3A6DA 1MX3A 1SUPA 1TPZA 5DM60 1E1KA 1UFVA 4BFWA 1TEZA 1QS0A 4PU0A 1IHXA 2QKYA 4TL8A 2RH5A 2D7CA 1RJQA 1U7HA 2XWSA 3LMKA 3WB9A 3QOYA 3A4LA 3M4JA 4BO9A 3Q98A 4EHLA 3GMDA 4YQFA 1USUA 3ZH9B 3A1NA 2DUJA 2IHYA 1FW8A 3QKRA 5ICSA 3DWIA 4FNAA 4IIJF 1NMEA 5K8IA 5F1PA 1LSSA 5AOCA 5HKKD 1CXZA 5LU8A 3GLFE 3VH3A 1IG0A 4IWXA 1HUQA 1MN6A 3E1SA 3AUAA 2VSNA 3QPUA 4JLDA 4AJNA 1OX4A 1K8XB 1NV8A 5CM0A 1MX9A 4R7TA 5JAQA 1CR0A 3NHMA 4PTLA 2UU9H 3HUDA 4RVOA 3ACBA 3FPKA 1DO0A 5JUWA 4EYGA 4TTRA 3U6KA 3T9FA 5CMLA 2H1VA 1NOIA 5G4LA 3GIIA 3CRW1 3JQ7A 5IJAA 4AMUA 1LS1A 1GD1O 5EZYA 4CMGA 4EG5A 4ENTA 5KVCA 2JFUA 1P8AA 3QJYA 3ZS8A 1F51E 3KALA 2AQ4A 4PIMA 3LQ1A 2NG1A 1UJ2A 3QQ5A 4WFKA 1KQGA 1U31A 3H9JA 1JWLA 3PIDA 2I4RA 3TW8A 1M8FA 3NFRA 1BMFD 3UCXA 4IWYA 4PLVA 1JW9B 5C3MA 1E1CB 2JLQA 3HYLA 2H1WA 4OXQA 2CXHA 2FNAA 3K09C 3AY3A 2A0FA 4UEOA 4CF7A 1QOQB 2G06A 3FDZB 1BXRA 4GMGA 2HIMA 4ND6A 1P39A 1MGOA 2PUCA 1LQTA 4KN8A 3X1KA 4QM7A 2E6KA 3B82A 2VK8A 2WSSA 3OT4A 1XEXB 1T9HA 2AEMA 2ZJTA 1B15A 2ENWA 4OCZA 4UBNA 4WASA 5JS6A 4OP3A 4C4RA 2ZIWB 4M6WB 4B83A 3T3OA 3ME5A 1Y1PA 3BJYA 9ATCA 3GUZA 4EW2A 1PGOA 3QIVA 4AT1A 1S1CA 1SZCA 3EVNA 3ASVA 3HZHA 2C54A 5L1IA 1U7TA 3BE8A 2ORED 3LH5A 3D4OA 4CMJA 1JTVA 1NT4A 1QHXA 2VHUA 1GNVA 3LFHA 4JP8A 3RB0A 3QGMA 1XA4A 3LUHA 4X24A 3ELUA 2BM1A 1IBRA 2C2XA 1L7DA 3PUHA 3RD5A 4L3WA 4K9SA 2QYSA 4FWTA 1ZETA 2G0AA 2WHEA 1GYRA 1O57A 3L04A 3LI2A 3WNVA 2XWBF 3CMCO 1J2JA 3MGGA 4PLYA 1Z36A 2ZJAA 1KSHA 3OE4A 2C4HA 4RIHA 4M0PA 4B8WA 1R12A 5B55A 4B3SB 2HC9A 4DSOA 4R0NA 4Q0YA 1G63A 5BSKA 1LA2A 5LCXA 1HO3A 4J7XA 5JYEA 4PWQA 1RBYA 2DBZA 1ESNA 3NYQA 4BMNA 4JYZA 2IOHA 4HY3A 1EFLA 3BAFA 3PPWA 3QG5A 3W7VA 5JXIA 5SZHB 1EDBA 4BWYA 2CUNA 4PPGA 2C2MA 2ONCA 1JSZA 1PJAA 4ZJPA 2FUNB 5JUMA 3FVVA 4UTNA 4NU0A 4JIGA 4UEKA 4N0MA 3NXSA 1O58A 2V5VA 1X1BA 3GA5A 5J1SB 3TBKA 2F3UA 2BV3A 3BB4A 1SY7A 5FYDA 3S70A 4TZTA 4ZO4A 4MUEA 4IY1A 3ZWXA 4D98A 1PL6A 2E4AA 2IHJA 4BO6A 2CLKB 3JQCA 5BUZA 5EUBA 1RWQA 1W9HA 2G0NA 3K8QA 4WY2A 2GI4A 3D8BA 2Y2UA 3AVWA 5BN1A 1R15A 3G68A 3R5TA 3RYIA 4WK6A 2CUKA 4RJJA 3NEPX 2W2QA 3RWMB 4JU9A 2C2DA 2HIXA 4DV3H 1CZRA 1NXOA 3MT7A 4MEBA 5E6UB 1LVHA 1H0RA 2HIAA 1OB2A 2V0GA 3KQSA 1XZ8A 4LECA 5B1YA 5AXAA 3DDWA 3MWKA 2V3VA 1SUAA 3RU7A 1RQLA 2J4DA 5HNEA 1II0A 3F6EX 2XV1A 5EP2A 2J6SA 2YCHA 3IAM6 1QQ6A 1Z4KA 4DM3A 1BWRA 2G70A 1QIEA 1K0FA 2QTVA 5ELMA 3AHCA 3OWOA 5GONA 1RADA 3OT5A 3RUPA 5DNWA 5LR6A 4DT1A 3IURA 5TQ2A 1FU8A 3IP9A 2YFYA 2WHPA 4ZCPA 1ZQ1A 1ABFA 1I9GA 3HVHA 4JGGA 1E4EB 4ME6A 3IL2A 3H3XA 1QPZA 4IXNA 3RJ5A 3PXXA 4JWTA 2OENG 1DAEA 3X1ZA 2WJ4A 5THKA 1A7KA 1RMTA 3GFVA 3L06A 4G0NA 3WKAA 1OFGA 3RYFB 1AIPA 3IAEA 3MTGA 5EOVA 5HTKA 4M9CA 1ZK1A 1XDBA 5BN3B 3QPDA 4L8FA 3H5TA 5ADUS 3MGAA 4JCCA 1XLWA 4DR1B 2WDTA 3EZNA 4DIBA 3CO0S 3AR8A 1A8PA 4ZDWA 3K2IA 1A50B 5BOSB 4KIUA 5EYPA 3PDIA 3FDIA 3GGOA 4QTZA 3LU1A 4TKUB 4GQIA 2V1XA 4O2BF 1G5TA 2HHFA 2MSDB 3DVAB 3IDQA 2A0UA 4DR4H 3G9ZA 1RYRA 3CHYA 3PF8A 4BIMA 5C8VA 1FFHA 4J9RA 1L7EA 1Q7BA 2QE6A 3MTBA 2W9XA 4U2DA 5IP5A 3REGA 5EJ2A 5LDDC 5DGDA 2IEIA 3NDJA 4IUCS 1KZGB 3VGPA 4ZREA 1FX0B 1P2GA 4GYKA 3H6KA 2E4UA 2A3RA 2FFHA 3SM3A 1A5BB 2D3TA 2P2LA 1PYDA 5LVAA 5I51A 2WJYA 4ECQA 4RF5A 2BHTA 3AF6A 3OFJA 3W6UA 1UAYA 2E1RA 1Z7EA 3EY4A 1FFEA 1SQ6A 1UKBA 1MTZA 2HMTA 3ZK8A 4B4OA 3L1JA 4E5NA 1CQJB 1W0JD 4KXQA 3N2EA 5ERYA 8ABPA 4JLKA 5HFNA 1DFIA 1JS1X 2RHGB 4UDYX 3A9TA 1VRVA 4I50A 5C9ZA 2RG7A 4MWDA 2HBQA 4NFYA 3EY9A 2C4MA 5KDOA 4LRUA 3NVMB 2VAWA 3PE3A 1KRXA 1J0EA 4DV4H 4LJ6A 3WLTA 1QR2A 2DFDA 2Q62A 4CMKA 3EGEA 3UW3A 1PT6A 2PBRA 4NNJA 2ZRIA 1KYYA 1T34A 2H4FA 2QUKA 2WD8A 3H1GA 4XD7A 3S1SA 1BCSB 3EPJA 3NIWA 4LMAA 4W8HA 1A3GA 1A8HA 3H2IA 3HRHA 4FSXA 1P7ZA 4QC2A 4CIVA 4YAJB 2CXTA 3NS7A 3ONVA 1RPJA 1A2BA 3WJ7A 5IJ0B 2XJ9A 3BXZA 1TCAA 1WOYA 3CEMA 1FFCA 1Y1WG 2Z6UA 4G0VA 3FZQA 3ZIAA 3PB3A 1V51A 4BLUA 3ULKA 3DLIA 5B1EA 3KQTA 2EDCA 2R8XA 3UV7A 2ACWA 5A0TA 1ORRA 3GI1A 5CXXA 3NHSA 1DJLA 1Z4QA 2PX3A 3RIEA 4TKVA 2BTQB 2CHFA 3IIJA 4H31A 1NI4A 1SFOA 2O8BB 1QRAA 4BFCA 1E2MA 1K4KA 1ESZA 2COKA 4ZRNA 4KFRA 2ZVJA 4NPCA 5B1IA 5I9IA 4PGFA 3DZGA 4PWZA 2AFIB 4WINA 2OSBA 1OZ0A 2JIBA 2WB4A 3K9HA 4EQZA 4FQ8A 3ZYZA 1U2SA 1USIA 2PJDA 4QULA 3IERA 1PJSA 5K8UA 2QSUA 3ZQUA 2IOFK 4NEGA 1QYVA 4V03A 2DF8A 1KP2A 3AEKB 4I1PA 3NETA 5I7UA 3MQ4A 1YJQA 3H97A 3ILSA 1MNQA 3FOCA 1JLRA 4M49A 3MWJA 4O8CA 1H9CA 4TPKA 2BHNA 1CFJA 3O8QA 4C0WA 3G7SA 4V3CA 3N42B 1Z5ZA 3UA4A 3X44A 1VXOA 1GN9A 2DR0A 3KHUA 4MVJD 5EZ5A 5IMSA 3ORHA 2AQHA 3KC2A 3G8AA 1VDZA 1VJRA 2BD0A 2HA3A 2HWYA 3EVZA 2I4NA 2YIDA 4ODIA 1S2IA 4R3UC 5GJVC 3SFZA 1UP6A 1UZMA 3KHSA 3OOWA 4QXMA 4XUCA 3BQ0A 1F8FA 1FEZA 4J6EA 4ZT6A 1SMKA 3ETHA 4IO1A 4BUJA 3JYOA 2YOGA 1RQGA 3LCCA 4S12A 1UMBA 4EWLA 2A30A 2G9RA 1YZKA 1BXGA 1Y1WA 3R9RA 2QU7A 5CNIA 1J06A 3V2IA 5J4VA 2HI0A 4V2UA 4A2WA 4U9HS 2ECPA 5TE9A 4WCFC 4QBFA 4U7HA 4ZMSA 3MRVA 1F60A 1T5BA 2R7ZG 4S0XA 1QVWA 2Q27A 5JC1A 2VA8A 3HOUG 2WJPA 4EPTA 1T36A 4KSCA 4RZ2A 3M70A 4DV5B 4B3TB 1ZHQA 1U8CB 4MAAA 3Q12A 5B1DA 3T61A 2EFJA 3DBLA 2ST1A 4O84A 3VZQA 4YHHB 1OC4A 3FG9A 4BLRA 4X6LA 3F5FA 2XMRA 1JSRA 2JBHA 1XNJA 4JVOA 4LFCB 4D57A 4K6NA 3JARB 4KI7A 5EC8A 1L4MA 3TTXA 1LLCA 3WQRA 2PZJA 3CKKA 2BR4A 5LWHA 2V7QD 4W5TA 3C3JA 3MS7A 2ZQ5A 2Z2KA 3DO5A 4BWFB 1JHMA 2J6IA 4JNCA 4ZXPA 3UJDA 5EMJA 4CHTA 4O63O 2VHZA 4RDIA 5L8VA 4E22A 1F0YA 3PLNA 2EC5A 2F8SA 3AIKA 4QODA 1LPBB 1W87A 3CX3A 3MELA 2LNDA 4IGKA 4K6GA 1P2BA 1PDOA 4GKVA 4Y0VA 3RS2A 3L8HA 3ZHZA 4FZ5A 1OXBB 1QQBA 1EGQA 3H84A 5KFXA 1KZ9A 5I9LA 1M1XB 3E22B 1ZLXA 1NI5A 1B73A 2FEKA 4IAOA 3ZUPA 1U0OC 4E70A 5K0ZA 4O4HB 3P2JA 1GLNA 4XIJA 1FYDA 1E8NA 4HXFB 4B3GA 2WAOA 1M8GA 2HU5A 3ESAA 1IATA 4JQZA 5FORA 4Z2YA 4WZAA 2ZI6A 3TGWA 4CTKA 1TO1E 5EWMA 4BO3A 4MNTA 4X54A 1JHYA 4RZSA 1PR9A 1X1TA 3A9SA 4JBYA 1NLUA 2YXLA 3HB1A 3IDSA 4YMVA 2AYZA 3O2JA 5B1SA 5GVSA 4FE3A 4TMZA 1VMKA 2IY7A 3K9LA 2WHQA 2JAQA 3T54A 4IDQA 4BYGA 5K4GA 3IPYA 1COZA 2WJIA 2O2GA 1ZHFA 3FJOA 3HCNA 5U4QA 2ODPA 4IZHA 4TVKA 3H17A 3FPAA 3K1JA 4JXZA 3NHWA 3DV2A 1TWHA 2R87A 1Q1NA 1Y8RA 2EATA 2CEKA 2OV4A 3QA3E 4AYWA 4QFMA 1K3FA 2JEGA 3A0RB 5L1LA 1O6CA 1AQIA 3AOGA 1M2OA 1UBTS 3HJUA 3Q7IA 3EFHA 2XBLA 3NHPA 3NYIA 1FP6A 5FP0A 1TGVA 2QT0A 1UPFA 4HI0E 2YZLA 2DT8A 2GOYA 1TT5B 3AYZB 3UMFA 1JEAA 3UJ3X 4AFNA 3L8MA 4PXSA 4Z54A 2DABA 2R60A 4YAWA 2Z3WA 4DV6B 2VPXA 2IVZA 4O3NA 1OBOA 4AWAA 1EYZA 4IMRA 4RLFA 2CDAA 5EKXA 3NAGA 4CGZA 5K6TA 4BNXA 4CL0A 3OSZA 1RRGA 3LP5A 5DI9A 2ZJ4A 2XAAA 1SIBE 4HFJA 3J7AC 3TTUA 1QIKA 2QAGC 4FPXA 3U5TA 4DL4A 3GHYA 4J0DA 5KTYA 1KAMA 1Y82A 1WHTB 2J45A 3OQVA 3E48A 3I05A 1DADA 2QLBA 1E2GA 1FQWA 1KI6A 1PS8A 4YAEA 1Y80A 4B2YA 3NVKI 1YS7A 2H29A 2ZDHA 4D4IA 4MCAA 1DAMA 4AYBA 1T35A 1ET0A 4AZ3B 4PN7A 2JFWA 4QYXA 4C22A 4E6PA 1PV1A 3W1WA 1DRUA 2IXGA 1FLAA 2CXQA 1N3BA 1VBFA 2J5XA 2YJTD 4QYTA 1V47A 2EFEB 2PH5A 3O8DA 3ZH2A 3RPEA 4EJ2A 1CHNA 4ROTA 1WP4A 1ZCFA 3ORRA 2IZ7A 2ZE8A 3PQEA 4DWVA 1FFGA 1FNCA 1OXXK 1YOVB 3UFBA 3O8LA 1FFDA 3VVBA 2ZR9A 2OUKA 3OM1A 1NMSA 3QXSA 4G0YA 3VC7A 2X2PA 3MUFA 4RS3A 1MFZA 2CK3A 4BNWA 4C87A 2JCXA 5KTTA 3KQUA 3T5KA 4AJKA 1G20A 4FFVA 2IIBA 2R6JA 1VTKA 2IF0A 2VJKA 1KEPA 4Q3LA 4P9NA 3E0QA 3ROTA 3TQOA 3U4HA 3KTMA 4H1VA 3MTQA 4AICA 3GTMA 3A4VA 4IIVA 1FS5A 1ONSA 3DCIA 4JBGA 4DJEC 5K0BA 4LC0A 4DY4A 1M6HA 2DKNA 2B82A 5KU1A 4EK9A 3PW0A 1ML4A 1N0VC 2CB9A 1XG5A 2E82A 4BV8A 5B12A 1DGQA 4J9MA 2AXPA 5CA0A 1M7BA 4D5EA 2O8EB 1FNBA 3HBMA 1WSCA 3O4GA 2QR5A 5LP1A 1TKCA 3U44A 1PE0A 5TX7A 2WQ6A 3D8NA 2ZUBA 4PM4A 1JAXA 3IUQA 2ZETA 5FLYA 1GGHA 4QJ3A 3ZJUA 1HQDA 5I9BA 3H1FA 5A0FA 3WLSA 2WPNA 4ZV9A 2VQ3A 2DY0A 1ZX1A 3RHFA 3PKJA 1D1PA 1MEJA 4P3OA 5DNCA 5TGZA 4DHWA 3NGMA 1M9NA 5F78A 2QR2A 4BNZA 3JD4A 3QSGA 3CY6A 3A2MA 4FYJA 4JYPA 2OYCA 2XOEA 1R1DA 3FSRA 4FYXA 1RBZA 3H16A 3AJDA 2WC1A 1R5JA 3HUFA 3JQFC 3K35A 3K9WA 4KK3A 4XH9B 1Z5PA 2YQ4A 1DXQA 4CQMD 3LPCA 1VKZA 2P30A 3GAAA 2O0KA 4CR7A 5KMGB 1JKMA 1MO3A 1T3ZA 2IE8A 1IXRC 3UIEA 4BX0A 5FI0B 4PZLA 1ZD8A 4RD4A 1WHTA 3Q1KA 2ZXEA 4WECA 3C3WA 5IASA 1EHIA 4HNGA 4JDUA 3GMIA 1A9ZA 4P53A 1UOOA 3IDOA 1E3DA 3ZHQA 5EZ6B 1RWMA 1XCGB 2QT1A 4M1WA 3NT5A 4YWJA 1B6GA 2FVYA 1OWPA 3TTWA 3MPOA 3KOXA 1ZOOA 2HHLA 4V0RA 3PPYA 1NBME 2NTVA 2X7XA 1E2EA 2PGXA 4BNDB 1XHLA 2AMJA 4U7PB 1PU2A 4TWAA 3NGDA 4KOAA 4V1CA 4A82A 4K7JA 1F6WA 3M82A 1P0IA 4JI3H 1PK8A 3QU2A 3O8OB 3AVXA 2XVMA 3GTPA 1I3LA 2QL6A 1N3IA 3ACDA 3VU9A 1R5BA 2OH2A 4TLEA 4AD8A 2I8CA 5DI3A 3TLXA 2YICA 4CL8A 5JARA 1UANA 4OQFA 4F3TA 3QOFA 4P7JA 1EE2A 3D3NA 3ZQKA 4G09A 2Q4OA 2WOOA 1WCYA 2YWEA 3NCHA 4OHBA 5H3CA 5I8WA 1G8PA 2PBLA 3AR7A 3MCWA 2NZYA 3N59A 4F5EA 4FJ1A 2H52A 3UOAB 2Y1DA 3NIFB 5JOQA 1U0LA 1CCWA 2Z09A 2UVDA 3UYLA 4D43A 4RFSA 3KQYA 5HDQA 1G8KA 1WXXA 1IBLB 4X85A 1RHJA 1TOAA 1BMQA 3BN3A 4IQ4A 2Z1NA 2ZJ1A 4I6JA 4BMYA 5JD4A 3OKAA 4O7TA 3HY4A 4TMFA 1VPLA 1Y3DE 3O75A 4O2BB 4D0RA 3UJPA 3OZGA 4N1AA 2A9QA 2BVNA 2O7RA 3IIEA 3QVJA 3AK4A 3UTDA 1C9NA 1CYDA 1RZUA 3L0CA 2JVJA 4YO7A 4IIXA 4MW6A 3STUA 4EHDA 2NU7B 3WGVA 3ZBTA 4KVAA 4WOKA 1DIAA 5CG1A 1V8PA 5AVQA 2P9QA 3EASA 2F48A 4ZT4A 4XYMA 5IDVA 4AI6A 3ZD9A 4PZ8A 4FE7A 1RYFA 2X8AA 4IJMA 2JIZA 5LMNH 1MG0A 4OX9B 1M1YE 4C7KA 2FWIA 4ZT5A 4QJFA 2XQGA 5EGSA 2QVZX 4KXVA 4W4TA 1KK3A 4PZZA 4MW5A 4D9NA 4X3PA 2YFHA 2ZUVA 3V1MA 3LDFA 5KYYB 1KI6B 2ISSD 2DFTA 4CQJA 2JCGA 1YC2A 1RYBA 2W71A 3JSAA 3IUJA 1I1OA 2Z9DA 1I0LA 1HE5A 4MITA 5AXDA 5DPMA 4D6PA 2EJ2A 1YD7A 1DL5A 4K6KA 3WGMA 3ASZA 4K3UA 1CUSA 4FOOA 1N2HA 4DRFA 3F7MA 2XRFA 3TSCA 4BHTA 5FTLA 1YHNA 1QG6A 1Z0KA 4WK0B 1C4WA 2JJMA 1CWUA 1M6WA 1C7EA 3MBIA 4IICA 3UMCA 3CVWA 4K1LA 3MQFA 2R8RA 2C83A 5L3QA 4Z6KA 2YMQA 2R4TA 3DT9A 3VJKA 1HY3A 1QMGA 4UFPA 5REQA 2VP6A 4F4DA 3WK5A 3ANNA 1T3SA 5HK8A 4FFOA 1NQUA 1FTYA 1EQAA 1EA7A 1G20B 2CFIA 2H63A 2YR0A 3ANTA 3GJ8A 4I4TB 4PO1A 3WL5A 4TV8A 2FK7A 2P6NA 1XEAA 4DDHA 1DO8A 2NO0A 2V7TA 4YMGA 5DISC 2CZGA 4XGRA 3SR4A 3VQTA 2FPOA 2J0UA 2J5KA 3KNZA 3Q2IA 4POAA 4ZHQA 4N9WA 3CLSD 2VQ6A 2W7TA 2W90A 4CJXA 2XCOA 3MT8A 1T1GA 3LUJA 4MHTA 3MHPA 2MIIA 1BJKA 1F1JA 2P9ZA 4OJNA 1BMTA 3DMGA 1G5PA 3EF3A 5KYTA 2YZ2A 5DLDA 1JHXA 1DCTA 3OZFA 2ZJ7A 3EYWA 3OIYA 4OLJA 3WYFA 3ZZ0A 4BRSA 1K7XB 3G9QA 5K51A 2CVFA 3AR2A 3LYAA 3NV9A 1NM5A 4W6ZA 6ABPA 2P9HA 1O0BA 1MA0A 4N5LA 4KZKA 3R8FA 1NVDA 2IGTA 3TRFA 1JDBB 1HNZH 3G2NA 1MV8A 3UK7A 5JRJA 1W2GA 1IZZA 1FMCA 4U00A 3DZBA 5BWLA 3VHQA 3G6XA 2QDKA 2IRWA 3HYTA 1ZU4A 4IJQA 2MHCA 1ULUA 3H4DA 1RE1A 3N3BC 5HGXA 1QGDA 1JDBC 1Z35A 1AKYA 3ICEA 3QKWA 2HA0A 3OX3A 4BV9A 2C4UA 1ZUNB 2H3HA 1C7RA 2V4ZA 2PTHA 4Z4HA 4XX0A 4EJ0A 2IA6A 1Y1TA 4A2AA 3M7IA 2P2NA 3STYA 4RQAA 4DQLA 4YP7A 3RTBA 4NBSA 3ROZA 1QS0B 3NBZB 3H6HA 3NBFA 1JJIA 1Y4ZA 3HEMA 3IALA 3VR5A 4BL5A 3R5SA 3ONNA 5GV7A 2XC9A 1Z6AA 3OOJA 1ZPDA 4H7DA 2AL7A 2F3SA 4ECXA 2NT4A 1ZJJA 4MB6A 4QDUA 4ZYXA 4IJWA 1WZ2A 1MO6A 1PQUA 1M6YA 2AOTA 4KQGA 1XLTA 3IH5A 3EMVA 1K7EB 4UNIA 2E2IA 2BGNA 2O0MA 4OTZA 3ZLUA 4DW8A 1KFJB 1O87A 2UVQA 1P1JA 3E5RA 3U7GA 3OY2A 2REOA 2SKCA 4QNNA 3RTXA 5H3LA 2FZ5A 5BMVA 3EBOA 2UZ1A 2QL7A 4ZV4A 4GL4A 4W63A 1HZZA 1V9LA 1MP0A 4JB3A 4CM4A 5HQ3B 3U4QB 1IHOA 1HLPA 4JOCA 4OHXA 4TMWA 3RSCA 4DZRA 1UXIA 5BYBA 2PWYA 1EX9A 5CNKA 4QLAA 5HOQA 4ARIA 5IYDG 4MUMA 3SYLA 5A9TA 5KYXA 4YDRA 3O84A 2HU7A 4MV6A 2O9JA 4EFNA 2JLWA 4QQNA 2DCUA 4OQEA 2E21A 3X0DA 4CEIB 1E9AA 1VPDA 2XGOA 3C0KA 3UYKA 3BPSA 3X1XA 4ZYVA 3H2ZA 4LMYA 1FNSA 1VYUA 3R2JA 4KTTE 3X43A 4QUBA 1YC5A 2I6SA 1I2CA 1PGPA 1ZCZA 3V1YA 1NN1A 4LQDA 2W8ZA 3C1UA 3EE6A 3AJ9A 1Z45A 4BKUA 3OQNA 1YL5A 5AKKA 4LZZA 4LZOA 4EHKA 3I4NG 3EPHA 3H4VA 3EB9A 5LJIA 1JQ3A 1XZDA 3BH7A 3M4XA 3WOVA 4ZRMA 2ZRDA 3NC1C 5ALMA 5E4JA 5F2OA 4NCBA 2PUHA 4EL0A 4ER7A 1FDOA 5KX5B 1YQQA 3K6RA 5DCWA 4O7YA 4N8EA 3KR0A 6REQA 5FUQA 1ZMTA 3JQBC 4C6SA 2H3EA 2Z2JA 3BTUA 3D5QA 4LZPA 4C7OB 3KVOA 4M8LA 3HU2A 3QENA 1KS9A 4LH6A 3N87A 4LGCA 1U2TA 3UWMA 4DV2H 3QWHA 1RNLA 1CLEA 1VECA 3L79A 3QZ7A 5DK6A 4E88A 2ZZNA 2I9PA 1JIQA 2RE8A 1NXVA 2RI1A 4L9RA 3T52A 4F45A 5IDWA 5KYUB 4IZOA 3JQ8A 1N9ZA 3IO5A 3ZWMA 4ZAZA 5H5JA 4ZHQF 3O5AA 3DXZA 3INGA 3O7MA 4K28A 3WYGA 1M7JA 3CNEA 4ZGWA 3P9IA 1U6IA 3RSQA 2ZWOA 2EP7A 3B9BA 4B9AA 1BE6A 3TWOA 4F2GA 2H65A 2IYXA 2NUPB 4KKXB 1DIGA 4O1MA 1IRIA 3Q6IA 4DNPA 5J2TA 2W5UA 4O83A 3GIQA 5CVUA 1LLQA 2IYYA 2KSQA 2Z3ZA 1JWBB 3FYDA 3O8NA 3PIIA 1H9BA 2AMLA 1TIKA 2QXUA 1IWPB 2GPJA 5KDDA 4F06A 2QJRA 1JXQA 1EWKA 3U4GA 4PC2A 1ORHA 5ITZA 5JS1A 2JGDA 1F5SA 3LC0A 1U5BB 1IB0A 3MLBA 5ITWA 5EJ6A 3N41B 2H2WA 3OCZA 3UJ8A 5L1KA 2F7SA 2ZWMA 4C1BA 4DQDA 5EJEA 1LZLA 1CS0B 1A9TA 1SC4A 1WBBA 5T3YA 3I52A 3UKDA 1TQ8A 5B5SA 3DAYA 3RHTA 3KEOA 4EJ6A 5KZMB 1A9XB 4BYMA 3TKYA 4M1TA 1C1DB 2AFHE 4MGIR 4Y30A 4C88A 1C3XA 4H3SA 3K92A 4HLNA 4Z4GA 6PFKA 1Y1VG 4LRQA 3CBQA 2JGJA 3NVAA 4PSDA 1MRZA 1M75A 4Y1RB 4FBMA 1EVIA 7GPBA 4O2LA 2ONZA 4MQ4A 4DJJA 3E7XA 1RWNA 1SXJB 4GP6A 3IAHA 1AB5A 2GQSA 5IXYA 3IQIX 5T7BA 1TMOA 2C2EA 5TXGA 3MJTA 2WRZA 3UQYS 2CHQA 1KVRA 3FRIA 3ES9A 3GCZA 1R00A 1YZUA 4L9SA 1PWYE 1DC7A 3AL3A 4JOQA 5G53C 1B1AA 1GM5A 2IMWP 3V4OA 3OQ6A 3ADKA 1HQCA 4XA8A 3RFCA 2CCGA 4YV2A 5CK5A 1I30A 4L57A 3PDCA 3V7NA 3OJXA 1Z7BA 2GN9A 1N7GA 5EMKA 3GTKA 1R10A 5KVSA 3JQGB 3ZCRA 4DAAA 4XYGA 1Z17A 3MW8A 4U39A 1U9JA 1A0IA 5B6IA 3PT9A 2OORA 2Y1FA 1PN3A 3WQSB 3GRAA 2Q3DA 2V6MA 3VPAA 5LZ8A 1J9ZA 2VZ9A 1SIOA 2ZAOA 3ETNA 4PLCA 1EM6A 1HETA 5AOBA 4EFDA 2OWEA 1Z4MA 5DGTA 4ENVA 2P0EA 4UFZA 3Q88A 4L2IB 1EG2A 1PEYA 3LWDA 2GPNA 3AJAA 5FUVA 1FMFA 1VRWA 4LOHA 4BZZA 1I51A 3R7BA 1ZK2A 1BD4A 5BQFA 4CR6A 1BHSA 2GZRA 4PBTA 1N33B 1A8SA 3IAAA 4I50F 4YR7A 1QLWA 2Z1MA 4UE3S 4JLOA 2FN7A 2OE2A 4LXTA 1ISRA 2JATA 4MLZA 2XGPA 2BQ3A 4UTOA 3SLRA 3E70C 1KWKA 3NANA 3JRNA 1ZVVA 4GNKA 4L7VA 4S04A 1E96A 1XVLA 3QOWA 2ZUUA 4MQMA 4Q47A 4AAYA 4K6HA 3ZPXA 4QQRA 5ITZB 4QDKA 1IZ9A 3ZHXA 1G64A 5BQPA 5EJ7A 1WXEA 4JUAA 5EFZA 4BPRA 4M76B 1G59A 3HKEB 2NYRA 3Q40A 2R00A 1PJBA 3HLYA 4BRWA 4Q1DA 2Q6KA 2WEKA 1OZFA 3U40A 2CN1A 5HM6A 3QE9Y 1LDMA 1KZ7B 2IKQA 1GO3E 4HNAB 4R1SA 1CD5A 3PZRA 2JAOA 2WM9B 3RBAA 3VRHA 4GI3A 1MGPA 3AJEA 2JIQA 2GZ1A 1EK2A 1SUBA 1TJ5A 5KG4A 2AC7A 3IP7A 2QUIA 4G37A 4YRRA 3S29A 5JH7F 1Z26A 1ZZGA 1P1RA 1YE3A 4GI2A 4Z3KA 3SBEA 2FDCA 1E9RA 1FRZA 3L1KA 4PAOA 1VB5A 1KR2A 2YDYA 2ZRNA 3WL3A 5SYNA 1OVMA 3B5JA 3SP1A 2R3SA 1WXWA 4OFBA 5AWFC 5C53B 2OCLA 2WVHA 1S89A 1KYQA 4AZTA 2YINC 3CG0A 2CFSA 5J63A 5F64A 4TXHA 2FHSA 1GPBA 1Q7EA 2WPDD 1DMSA 2VP2A 1KDYA 3RC1A 4EMSA 3FCYA 4JROA 3KKQA 5BPHA 4F4ZA 4F5ZA 4D74A 5FQNA 1AN9A 3GGPA 1I1MA 3Q7RA 5BV2P 4CM3A 2NZWA 3PDUA 3WB2A 3JWPA 1CQIA 1N9KA 1UIMA 4GPAA 4LNUA 1R6TA 4JI1H 3A1TA 2ZRAA 4WXHA 3G5MA 3ZXIA 5TC4A 5MFZA 4IQFA 1PNTA 5A1JA 2P5YA 3FDJA 2NT3A 4DMMA 1M74A 1WAMA 2PA3A 4E3WA 4A3SA 3D7MA 1SU4A 4UCSA 3RYHA 2WFZA 3A0UA 3G2HA 1T0UA 4HNQA 4DOMA 4N48A 3AF4A 1PG5A 4MO9A 1GR1A 2FP4A 4R5HA 1RJDA 1TGYA 2GD0A 3H2KA 5BSUA 3K0FA 5CHEA 1G7TA 4IOMA 1ZN7A 4A0QA 1ZZEA 5HW0A 1ARZA 4U0JA 4NG4A 5D51S 1YR1A 1Y6ZA 3FTNA 5JJIA 2QI9F 5H80A 3B6KA 3SSMA 4R1QA 1Q57A 4NV3A 5FX2A 1QWOA 3EIWA 2LBPA 2E37A 1UAGA 4B3XA 3HSKA 3HKDB 3M1IA 1DEXA 3L7JA 1N7JA 3FMGA 3W2FA 3FGOA 3BZBA 1A9XA 2F9LA 3C4VA 2ZROA 1W5TA 2FRDA 4I4TF 1UDAA 2LIVA 3OZXA 4N7RA 1U0RA 4ZQHA 5A4DA 2XMPA 1YUBA 3RREA 3K9CA 2YWGA 2LIPA 3I8OA 4PSCA 4Z1MD 2J6BA 3PUZA 5I9NA 2AD1A 2Q29A 2DZDA 1P60A 5JRDS 2FP4B 2RGUA 3A6FA 3HJGA 1MC4A 3FFTA 4PYKA 1AMUA 1VJDA 3P9ZA 1QP4A 1WDKA 1PZNA 5CK4A 3THWA 2OXCA 4RZRA 1LBHA 3M5WA 5TQVA 3OZIA 5L4SA 5JSKA 5J59A 1J2YA 5LNK1 5ED4A 4O81A 3RR5A 3IQGX 3FHTA 3JQPA 1IHUA 4G56A 1P4AA 3CG4A 4O08A 4QYWA 1PS9A 4GUDA 4KQ6A 3FKSA 1G5RA 3GOHA 2D5AA 2QTWB 3IHKA 3I2YX 3U3OA 4XR4A 2Y1CA 4RA9A 4PZCA 2W58A 4HYTA 3CFYA 2OBBA 4GLLA 4WW0A 2FN4A 3HC7A 2O52A 1MVNA 2Y71A 2QX7A 3ND9A 3PC8C 3TZLA 4YAKA 3BD7A 3BL6A 2GKSA 5LL6b 1RQ2A 1Z7GA 2I62A 3EAGA 3I4FA 1PS0A 1HDZA 1DXYA 3OCUA 3C3PA 4RL4A 1TC2A 4DV0B 1IJKA 3D0OA 2TRSB 3L7DA 1XD2A 5E4FA 1LW7A 2G08A 3PZBA 4MEAA 3FYTA 2R85A 2OAGA 3LC2O 4HNSA 3JPWA 4TS4A 5DX0A 2UYOA 4B4DA 2B0JA 2FK8A 4L72A 4BVFA 3OKCA 1G3MA 2V65A 2AUMA 5AK5A 3CEPB 1JZTA 4KYIB 1QF9A 2O5CA 2RF4A 1UJCA 2C96A 3BD8A 4OXNA 4RTLA 4WNAB 4GM0A 3BF7A 1VIDA 2AQIA 3T7RA 5AW1A 2II6A 4PG6A 3RF7A 4D92A 3LTEA 2LD4A 2ABWA 1KI3A 3ZIAD 2D0DA 4D5GA 1UKYA 2VL7A 4PQGA 4UU8A 2GCOA 3ZK7A 2QP4A 4I55F 2VCYA 1OGIA 4CQLA 1ATIA 4PIPA 3FTEA 3AYHB 3WVNA 4QWAA 2XNJA 4IFTA 2CNBA 4XGIA 1SR8A 3MA0A 5KG5A 1JVNA 4NJEB 4WI1A 5D8DA 3Q8KA 2O4UX 1CLUA 3F7NA 4AMZA 3OTOB 5F9HA 1W5EA 1KO4A 1EDEA 1O9BA 4I4TA 4C5CA 1T0IA 4RELA 2BJHA 4LOLA 1USVA 1H2AS 4X1OA 1A76A 3PSAA 1T1SA 1NF9A 3DAGA 2GCNA 4HDKB 1Z4LA 3T34A 5AQ1A 4LZLA 5JZVA 4ER0A 1Q2UA 3ZR4B 4XVHA 4YCAA 1IY8A 1D1QA 3GNSA 3KZKA 2R8OA 2WU4A 3LF1A 1TM2A 3RH0A 3S2IA 3G2PA 1ZIXA 1YFJA 1X9HA 2X6RA 3VVLA 4BLWA 2FSPA 4FDLA 5EP3A 4DCGA 4LRSB 1IYDA 4R2KA 4QGHA 1CNMA 1E3IA 1QYIA 2XCSB 1QMPA 2ID7A 3OZAA 3GP8A 1LVGA 3BERA 4MR7A 3BCRA 3UMBA 1CVLA 1NQOA 1Q11A 3E9CA 3D54D 4HH3C 4NXMB 4QDOA 1PSWA 2BKLA 3P45A 5JSFA 1IN1A 1QTIA 1ZD5A 4LSZA 3KHKA 1VBMA 5KTNA 1FBTA 3OTWA 4HRXA 4A91A 1T3GA 1QGUB 4L4ZA 1J20A 2OVBA 2OLEA 3G85A 4MO2A 3BGWA 1XXHA 3OU6A 4AO7A 4O4HF 4KOEC 4TS1A 1M8JA 4Z49A 3E9EA 3S8YA 1V3TA 3GPBA 1L3BA 5FLMG 1T9BA 2FRXA 3QFRA 3ZU4A 1UQTA 1A2QA 2EEPA 3C5WP 4UDOA 3SI7A 3HCWA 4ED9A 2MMCA 3WLMA 4FLMA 3RWBA 1AHNA 3U31A 5HKKA 2FN3A 3S8EA 4B80A 3UBTA 5IVKA 1I32A 5BV8A 1KVTA 2J7KA 1FUEA 4RZIA 1WBJB 2TMYA 3RVOA 3GLGB 4RSGA 1SUCA 4JGIA 1H23A 2X13A 4F4XA 2YOFA 2ZJ2A 3VC3A 1WQ3A 4E31A 3HO8A 4OAPA 1ZGBA 1TM4E 3I2FA 3LHFA 3EXEA 4CDNA 3H42B 1L4EA 3CQ9A 3L7YA 1FS6A 1U1DA 3VR6A 4H3VA 4GYWA 1UT8A 1SVMA 5E1DA 4Q7MB 5JQGA 1CERA 1HYEA 1X6VA 4UAJA 4HTFA 4XARA 4P93A 4WXYB 1B0ZA 4RPLA 4CQLB 2ZIEA 2J5RA 3RVMA 2G9UA 3K4QA 4F6CA 5HFAA 1KEZA 1NWHA 1UMCB 2WTNA 2YWDA 1SKYB 1YRAA 1DARA 4D56A 3VR4A 2B9EA 5FAXA 3AWDA 3H20A 2VRNA 3HPQA 3Q87B 2WE8A 3GJXC 5LU9A 1JX6A 4YWHA 1U0GA 4TQSA 1E8MA 4QXAA 3MFIA 1E7YA 1Z4OA 2VRWA 3G0GA 1UUFA 1O4VA 1J2EA 2NNLD 3I23A 3FLAA 3MILA 3VI3B 2O8NA 1ZR4A 1MAWA 1ZG3A 1THZA 4DSAA 1YK0A 1W88B 2OCGA 4BCCA 2A86A 5KFMA 3HUTA 5KYWA 2D00A 2VYVD 3HZOA 5HJEA 1ZNYA 2O3SA 2VK4A 3GBVA 4HJXA 2I87A 5J4KA 2EF0A 2FK3A 3CF2A 2B78A 3BWEA 2D1FA 4QJIA 4BQEA 5K4AA 3M4IA 2HJHA 4RMJA 2H5EA 3PYLA 3IULA 2DY1A 1PDVA 2VAXA 3I5AA 3NWPA 3DYIA 1Z29A 2VZ0A 3W04A 2OEPA 5FF9A 4B71A 1A48A 5JAOA 3KOMA 2FX3A 1FRVA 3DYBA 2AUTA 3TRJA 3UAWA 3ZQJA 1HR0B 4GP7A 3O2SB 4RMGA 1J8DA 1ILEA 2C8KA 1NN0A 2CBGA 4YXWA 5MHTA 5B64A 2XXAA 4US1R 1T9GR 2O3RA 2P8SA 1RHUA 4DMKA 4IGEA 1JH9A 1KE2A 2HIGA 1JIJA 1NF3A 1YRWA 2M32A 3AUXA 3HP7A 2CMFA 4FGJA 4BB9A 4GEKA 3DHEA 2PS3A 4IHQA 1U1GA 2I2CA 4CMEC 2EBFX 3C14C 1S0MA 1DRJA 3IBCA 3BKXA 4QZVA 2D6FA 1Y8QB 1UFKA 4EG8A 3U7EB 2GVZC 5ALLA 3A05A 4BN0A 1N5KA 1W73A 5DGIA 3DE7X 1TB4A 3REOA 2PLAA 2BSQA 2RBGA 3D5TA 4B85A 2PXHA 1Q92A 3H4IA 1BMDA 3GNTA 2H16A 3LGSA 3NDIA 2R1TA 5GJCA 3OI7A 3WLAA 1T8PA 2XECA 2PYDA 5FI5A 5CXUA 4O4JF 8ADHA 2Y4NA 2Q5OA 1TXGA 5CFZA 1EBBA 4K05A 1E9SA 4RENA 1QTQA 1FU4A 2GH1A 4BTVA 4F12A 4R7GA 4CBVA 1P6XA 3H83A 5AVKA 1K08A 1V5IA 3GCWA 1J0CA 1IN8A 1PZXA 1Z0UA 2GHQA 3BD6A 4UM9D 3I9JA 3ROFA 3A6PC 2F3PA 4APMA 3FHCB 5J2TB 4M4SA 4YI5A 2OXTA 3AF1A 2YXDA 1YH3A 1XZJA 1XTSA 1I1HA 4RCZA 1O96B 5EHNA 1XZMA 2BKXA 1DBSA 3EUFA 1Y5RA 4UUGA 5G3YA 3KREA 2E2HA 2BGLA 2IT1A 1AK9A 4L4RA 1E89A 4KR6A 2XUHA 2QEQA 3BL8A 2PNJA 5KOJA 5KYWB 1KSFX 4C29A 5A1TA 5K0TA 1X94A 4INAA 4OBEA 4DCMA 1Z9BA 2QLMA 4CM5A 1J23A 3W2TA 5FOXA 3GV7B 3TRHA 1CPYA 2V9PA 3H5NA 3JQRA 3SE0A 2AXEA 1E9VA 1O94D 4OOEA 4CUZA 3PJEA 4YRGA 8GPBA 1PR5A 1OT5A 3AKDA 1XMQB 2AWOA 5DRYA 2VTEA 3RU2A 2HZ7A 3SEAA 2A84A 3JSXA 3VAZA 4AKSA 3C6BA 3PYMA 4I3FA 4TQGA 1BZYA 1DBWA 2H06A 3RB8A 4ENWA 5I47A 2GBLA 3A70A 3JQBA 3T1QA 2A5FA 2F9MA 3FPFA 3INYA 1U7ZA 4UMEA 4M46A 4N5NA 4NLLA 4R9RA 1KC3A 5FTWA 4Z3DA 4BQSA 3IVXA 4RWEA 3ZU5A 3GAFA 4FB5A 4PCUA 1B3RA 1TCUA 1KMNA 4HX9A 4Q3OA 4UCFA 5FNVB 5DBGA 1UEJA 4MINA 1VOTA 1AHHA 1SA0B 2ACEA 2QTNA 4B2PA 3SDZA 1RQPA 1Q7TA 2EGUA 2RJNA 3Q5DA 1SKAA 1RSZA 3UO8B 3ZLTA 2QVBA 3JYNA 1Y8AA 4L5AA 3DZHA 4NBUA 1XWWA 4UNQA 4W5JA 2GEDA 4Y1GA 3ZNNA 3CVZA 3IELA 1A77A 1S9HA 1FXWA 1N36B 1MHTA 1H3EA 3RRYA 3U4DA 2JAXA 3QVLA 4IDAA 5DMHA 4RB0A 1HSZA 1EUDB 3A6JA 1S4MA 3AYXB 3MRTA 4OYYA 4YAOA 3ZHTA 1FFXA 3OU2A 4JC0A 3QJGA 1M0TA 2R7NA 2JFOA 2OV2A 5D1OA 3TLGA 4YXWD 2PUDA 3L84A 4J6FA 4MQEB 4IOLA 1U90A 3LE8A 2QLNA 1SUWA 5EQDA 1RHKA 1J8QA 3WLHA 5BMOA 2VT3A 1BJRE 4D4JA 4TV9B 1E66A 4ZHSA 1IMJA 3GT0A 2WJGA 1CSEE 4L08A 2DCMA 2GN1A 3KUUA 1N0HA 2XAUA 4KPUB 1JSCA 1AZSC 2BGWA 3CLVA 3NTOA 3L92A 4C3UA 2K6GA 2RD2A 3GWZA 4HQLA 1N6HA 4P4LA 3YASA 2P2YA 5FTKA 2HRCA 3PL5A 1U9CA 4EUNA 1HXHA 3MJDA 2ZOSA 2BFAA 1HNXB 1E3WA 3M6FA 4RC9A 2M05A 2QN2A 4DMFA 4ECZA 1G98A 2E1PA 3FROA 4EHBA 5B3JC 2F9FA 1EFPB 1O03A 1LCIA 1B14A 4G5HA 4ND5A 5EZQA 4DLLA 3TR0A 2H2FA 5DEOA 4RTRA 3N2ZB 1GCGA 3EZ7A 4IV5A 3BMCB 1CDOA 1SYXB 1UDBA 2FG5A 4KODA 1UPXA 3ZI4A 1E2PA 1IUPA 1WHSA 2JBWA 4OU4A 5ALYA 3WSVA 1G3RA 4MDEA 2D1QA 5CA1F 1VA4A 4YECA 1UXJA 4XM2A 5GOZA 5FWXB 1T3LA 2X0IA 5KT5A 2X41A 2XVAA 4EUEA 1K06A 5BWRA 1KBLA 3DOIA 3ENQA 4LDPA 2AFHB 4LDRA 2V7BA 3QE0A 1R4MB 3VKVA 3ZCTA 2JG3A 5GGXA 4FHDA 4ZI3A 2PK3A 3PG5A 4HQ6A 2YWRA 4DC0A 5EXDA 3NWJA 5E95A 5H7XA 2PBFA 5ER6A 3K1AA 1TM5E 2W2LD 2Y27A 1Q15A 4LVUA 4F7DA 3PDHA 3GJ0A 2N9UA 3A1UA 1Z8HA 3RUHA 2ZB3A 1NLYA 3QVMA 4AQDA 1L5NA 5A3QA 1WLSA 3CLRD 2FPPB 2B35A 3KYIB 4Q3CA 4WUVA 2UXCB 5DBOA 4U7JA 4E4TA 1FKAH 5KQSA 1LNQA 2NPFA 3AKCA 1M1NB 1DBRA 3O93A 1S2NA 2R68A 4JUZA 1WU7A 5CVVA 5IK2D 4GC5A 3WWDA 4ECEA 3GF4A 4EPWA 5KFPA 4YX9A 3LQYA 2HSEA 1QYDA 5KFHA 3GARA 1V4YA 1W0JA 3PVXA 2BFCA 2Q2NA 4JMLA 4ZOLA 1JQKA 2GEKA 1VLHA 3E9MA 1ZW1A 3QA9A 3WP0A 5HRCA 5FV7A 2QVYX 3RSGA 1KMHA 2I78A 1GOTA 2UYYA 1EWYA 2HSGA 2ZIXA 3CX6A 2BHSA 3QLVC 3DE5X 1T94A 1D7AA 5LZ5A 3WC4A 3ZTYA 2VF8A 4DJTA 1GQRA 4F92B 5JMTA 2ZZMA 1IPEA 3TW6A 2FLNA 4WT7A 2O59A 1JQLB 3A14A 3MINB 5I9SA 3R44A 3V8BA 5CJJA 3DTNA 2ZAYA 3DZ8A 1FYXA 2EKQA 3KHRA 1A9QA 2XYRA 4XE5A 4DV7B 1RKBA 4R2MA 2QRUA 3VH4A 2ERCA 1C0EA 4F5DA 5INTA 3JZAA 4HRAA 4NZPA 2J30A 3JRXA 1TQDA 4CCWA 1SGWA 2PSDA 2NSJA 4DL5A 1JHAA 3U37A 1QKIA 3WGNA 1Q83A 5LKRA 2SHKA 4LYEA 4Q24A 3BMCA 4BBSG 2GMWA 2UUBH 2VRCA 2I6XA 3MSCA 2FPMA 3OJLA 4BPBA 1D2GA 2YJZA 4GBED 4ABYA 3T9AA 1ZFNA 5JAPA 3CF0A 4C7MA 4RB2C 3O4RA 1D0VA 1DAHA 4G63A 4E5VA 3COJA 1VL8A 4OHWA 4XJVA 2PD3A 4M0CA 3VJMA 1IK6A 5KT2A 3N0XA 4LBYA 3VR4H 2GARA 4II3A 3QHQA 1PNVA 5D6OA 3VZDA 2BMDA 2V7XA 4EW3A 4DCVA 5B4TA 4MB2A 4RCNA 1XE3A 4ZV7A 3T0FA 1YTUA 3U7QB 1V7ZA 3WIEA 2QTLA 4ZYUA 4QAJA 2VJYA 3GGGA 4CL3A 3N7AA 1KJQA 2FR8C 3LY7A 1U2PA 2K4MA 2TSYB 3HVRA 1SU8A 5BMVF 2VRBA 1I80A 2W6JA 3C6MA 4R7RA 1I6LA 2B4KA 4FOSA 4KN5A 4OI0A 5HGJA 4PYMA 3IV6A 5IT0A 6CHYA 1DIKA 1TUGA 4YT2A 4HNAA 5IXJA 4N6NA 2BR3A 2P6PA 2UZ0A 3D7NA 4JEMA 2BUBA 2XT6A 4EBBA 1T1RA 4O29A 2TMGA 4O4LA 5BWBA 5JYDA 3NBZC 3TG8A 2IYOA 1A4RA 1JR2A 1X70A 3T3HA 2HXSA 2FLVA 3CNBA 3K94A 3O7WA 4G07A 4JKOA 5ALWA 4K0RA 3AM1A 4HQRA 2EJ3A 2CBZA 2DU8A 2OGWA 2VTBB 3RK0A 3QEKA 3I4LA 2BFEA 4MUXA 1I94B 5LZ9A 1C41A 1JTEA 1F6DA 4INZA 3GGDA 4JBXA 1E2NA 4YFYA 4BTEA 2H85A 3B51X 3OEHA 3CVXA 5A5DA 2LCQA 3WGOA 2GEVA 5A6SA 3FWHA 4Q1EA 2DLNA 4TMTA 4MWGA 2OM6A 3NUGA 1KJIA 4OH1A 3D6HA 3W1GA 1LD3A 3IBYA 1OC2A 3DT8A 3OFKA 1YIAA 1KDZA 3VC2A 5BSHA 2JIRA 2QW8A 1AMNA 2PT9A 4EJSA 4DUYB 3AEXA 1AQJA 3SC3A 4MRNA 1NX6A 1JYEA 3K6SA 4DR2B 3VKGA 1TAHA 1SOUA 4O4LB 3JVVA 1NVTA 2DAPA 3GDWA 3KKZA 4NS4A 3L4KA 1GG9A 2X7HA 2Z9CA 4TWRA 1JDPA 5HTOA 2N75A 5HX7A 2YWHA 4UC0A 5IULC 2IBMA 4UVHA 2ZYGA 2XCQA 3QFCA 3RFVA 3R6GA 3I12A 1CIVA 1ZOPA 1KOGA 3B1VA 3N8DA 2BFMA 2WTBA 5F7OA 3KQNA 1TF7A 1TD9A 1FYVA 1CW2B 4MVJE 3HACA 5DSZA 4B44A 1USKA 1VMIA 5SYAA 1QP7A 2M1XA 4AYBE 1ADCA 1SVUA 2V4MA 3OUTA 1KEVA 4J7UA 3PNQA 3TD2A 7REQB 2Q8QA 1JHZA 5JADA 1I6UA 1HTTA 3R0JA 3K1AB 4X71A 4NBKA 1HR0H 4GKKH 1QO7A 1WF6A 5H82A 2J9GA 4JI0H 2QRJA 2AK2A 4CMCA 3M4NA 4G5YA 3EC1A 5E6RA 2JRCA 1U80A 1ZEMA 3FUVA 3MUEA 5CLQA 4XZ3A 3HJFA 3TS1A 2YBDA 2NO5A 1JGTA 1PTJC 4GOND 4QQFA 4GLXA 5K01A 1E3SA 4FE4A 3PPXA 1CTQA 1S7CA 4P82A 2QMEA 1ZUNA 1VQ1A 4N6GA 3RRBA 2BFFB 3FVQA 4OHVA 4RFSB 5CVEA 2VTBA 3MD0A 3TPCA 5KNCD 1SQ0A 4HBGA 1ANKA 4J2TA 5GGYA 2NVBA 4NPHA 2O1EA 5BUQA 1Z07A 3JPYA 2Z08A 3QTTA 5IJ9B 1A0GA 3CSSA 3UW1A 3CX4A 1I14A 1KTAA 4EJSC 3HDQA 1CIJA 3G2JA 3I53A 1IOWA 4R98A 4HDQB 3SZLA 5KREA 2KSWA 3WMFA 3SYMA 3RIMA 3GCXA 5K8LA 2POQX 1T5DX 2G72A 2H7CA 1BGXT 4EPRA 4YRKA 2JA6G 4WBNF 3R23A 3KX2A 4Y6LA 3REQB 1Y9JA 3DKVA 2P1RA 4ERNA 4LHZA 5KTRA 1NW6A 3AH8A 3UAVA 4C03A 3K70C 3ZE1B 4O7VA 1NVFA 4FCVA 4I9UA 1WXHA 4DCJA 4HVLA 1Y6GA 4UUBA 1H8HD 1P19A 1XU4A 1KF0A 1GL7A 1QFYA 1HTWA 4BCBA 1APBA 1QOZA 3T15A 4W5OA 1TZKA 2HBYA 3EF0A 3IEXA 4LSGA 1W9MA 3DKPA 3CZ4A 5JXJA 2A3NA 5HQ3A 2WD9A 4GGOA 4IXTA 3H8SA 2IYUA 1DHTA 4C4OA 3OM0A 4MP3A 1JJAA 2ALJA 4H3KB 3RYCB 1X80A 2EJCA 2OL4A 2W2TA 4OXRA 1R3DA 3OURA 4TRMA 3SEQA 1U04A 4RPGA 3L0SA 4IFEA 3BIJA 1U3TA 5L7TA 2XTAA 5JDCC 1Z73A 3G2OA 1TTPB 4KAJA 4LS3A 3O26A 3AFIA 4KR9A 2OPHA 2SCUB 1SPBS 2WP0A 4EITA 4A10A 4A3KG 3L0ZA 2J09A 1E6MA 2CL6X 5KCZA 4QVKA 3VPFA 2AE2A 5DYGA 3IBGA 5JAIA 2OXIA 5F52A 3LT0A 1OA1A 1SULA 3ZOZA 4UE6A 4E7OA 3PC8A 3QUTA 5JSHA 4GE3A 2P77A 2TS1A 2XD9A 2EJVA 2XKJE 1R6DA 4RIEA 1FFWA 1OTYA 3BBPA 4A27A 4R01A 3BA6A 5K0SA 2PKQO 2I3DA 4LQLA 2OQIA 4KMOA 5I8ZA 5KVVA 4BFTA 5KU7A 3GNQA 4DMHA 1DDOA 4OXYA 1G2WA 1AKVA 2HR1A 4ACAA 3KXPA 2EVWX 1BFUA 4DBVO 2R6CA 4N03A 3TNLA 1UMKA 2JK0A 3GBSA 3NHKA 4KYVA 4PZ0A 1J5PA 5J5AA 3P9RA 3NMUF 2QRVB 2RHJA 2CYAA 5HIMA 4JI4H 3DL4A 2BCEA 3GAZA 4FDVA 5EJMA 4IJ6A 4E1BA 4MWOA 4XIFA 3SZGA 4XD2A 2LCIA 3DUFA 1JSXA 1X38A 2JA2A 2Q4RA 2XNKA 4JR0A 3PN1A 3WKDA 2HJVA 4FE2A 4GU5A 2KBEA 3K7EA 5J23A 3GEMA 1MQ9A 3ZJ4A 4CNBA 3K8YA 3ICPA 5H0IA 3Q7EA 1KK0A 4DXDA 4DNXA 5GADl 3STTA 2QR3A 3MJFA 3LQQA 3N8HA 4W1PA 3LVQE 4RPIA 1NQXA 3L4BC 3LHKA 3EA4A 2OAQ1 4FYMA 1PX0A 4QWWA 2VHTA 3CZCA 2NMVA 1TL7C 3WS7A 5JLAA 3W1EA 4EUFA 2OHOA 4RETA 3KYDB 3PK0A 1SC6A 4M0FA 1E1RD 1H22A 3PQ2A 1AV7A 5F1OA 3T5CA 5KMGA 4P4SA 1NXPA 3CW9A 1I9CA 1UQRA 3SS9X 4BVHA 1F2UA 1K1SA 5TSDA 2QS9A 4DR5B 3JQ9A 5MN5A 1AURA 1XMQH 5JI3E 4QNRA 3RTCA 1G6OA 3R24A 4WKGA 5DLGA 1Y7IA 3KG2A 4KIGA 4RK5A 1IY9A 1IQRA 3B1ZA 1E2JA 4G2NA 5KWSA 2EGGA 3QWUA 1UPAA 1ETHA 1ULSA 1U3UA 4HLUA 3OHAA 1XZQA 1QE3A 1F8UA 1RLIA 1SG9A 2FRVA 2ZJ6A 4U2EA 1DC8A 4ZVMA 5ES3A 5JFGA 4B8YA 1KHTA 3MG9A 1JN0A 1T5IA 4IH4A 2EL9A 3IUSA 3PUJA 4RZXA 1RM4A 1DWOA 1UBKS 2QLJA 4J0JA 3SC2B 4MB0A 4MVCA 4PBSA 3CKMA 5JBQA 5TR9A 4D9BA 5CD1A 4BQQA 1C3OB 1GNSA 2C9DA 1BHO1 4X61A 3ZLBA 4O3MA 2EV9A 5TVKA 4LSXA 1GPKA 3WI7A 5JLJA 3AB7A 1DINA 2PSHA 5FXMA 1E2FA 4MW1A 5AOAA 4EG3A 5LOVB 4NS1A 5F7ZA 3BFPA 3HMQA 1NQAO 3JYPA 4LBWA 4PLTA 1EX7A 2OG1A 3F2VA 1KQOA 1A71A 3HBFA 4OX9Y 3T5TA 1TFRA 4XQGA 1PI3A 5CHYA 2ZJ3A 4O3RA 2ECKA 3G5TA 1Z6TA 2C2HA 2YXBA 4IWNA 1Z6GA 5KYVA 5I5EA 2AIRA 5COQA 1GZUA 3JZIA 3OEEA 4OGLA 5AJTA 4ZVVA 3VR2A 4W5RA 1P5JA 4QQ8A 1CYEA 5CVCA 3GTLA 2X0SA 4J7CA 3N2KB 3QX9A 4TYNA 2VP9A 1A2KC 3ED5A 5FADA 2IYPA 2QN9A 3RC2A 3S8MA 3PEVA 4Y8VA 3WTBA 2DBYA 2XB4A 4B4UA 3AW8A 5LOVA 1OV4A 1B3BA 4O8ZA 3EGOA 1Y3IA 1M1YA 5DKFA 2GBLC 1AN0A 3CYFA 5AJWA 3RJZA 1YZLA 1JJ7A 2JGMA 5IWAB 4QM6A 1I6WA 4Q5IA 4UZEA 5LP6A 3LXRA 3GEEA 1L5SA 5KKNB 4TT3A 3JQ7B 3OZTA 2RBEA 4YJ3B 4ED1A 1JDZA 2IYFA 3HDTA 3NAQA 1QIGA 2XMCA 4MQUA 4P58A 1KZ6A 2O7VA 1XZBA 1YXMA 3IPXA 2R7MA 3B36A 2I2WA 3DVRX 4FINA 1ISGA 4PSVA 2JFHA 1TEXA 1J8VA 4JASB 3NOOA 4RD0A 3VYSB 2EOAA 4EZIA 2YX1A 4CV2A 1MO5A 3Q8QB 2VTKA 3S0JA 5E4TA 1R0WA 3CLTD 6ADHA 4NMXB 3W79A 4G5XA 5CYGA 1MTOA 3ZU2A 4DNOA 2FFQA 2XUAA 1JLMA 2X1VA 3WBJA 3D1LA 4E7PA 5F2NA 2REQB 1BFDA 5CTJA 2MSLA 3HL0A 4LJKA 4AF7A 2WSLA 3O3NB 3QEMB 4RJKA 5KWEA 3COWA 1Y1KE 1JBKA 2Z0MA 3IOBA 1Y9EA 2FA9A 3L9XA 2HPAA 2CLSA 2RGDA 2HK9A 2ONYA 4XVUA 3ETLA 1OYWA 4NEQA 1EA5A 4D4HA 4RE5A 3VKWA 3TO5A 2IBSA 2XX3A 2ZEJA 2V58A 2P3LA 4UHKA 1NI3A 4M83A 1TO6A 4BEVA 5KNLA 2Q2TA 2AQ8A 1K2WA 2H00A 1BA3A 2PDAA 2WSYB 3J7TA 4GMXA 3FKSD 5DTEA 3FGNA 5IM4A 4O7RA 4MRMA 3U0VA 1QWSA 2FMTA 3GK3A 2DHEA 4HTAA 3EBLA 2AJBA 3NHJA 4GS5A 2WF5A 1RXWA 4ERXA 1QOPB 2DKFA 1XJCA 1YDWA 3Q9SA 4MRVA 1YCFA 1UBRS 5ICMA 2WW8A 5H4HA 4YJHB 3TVYA 1PT9A 3GVXA 1OI2A 4YYZA 2UXBH 2OCAA 2FK1A 4FCCA 1QNLA 3CRVA 4HG2A 3LY8A 4Y1RA 3KYCA 3S2FA 1Z63A 3CJRA 1OBVA 3M2PA 4OHOA 3AEQB 4QFDA 4DEVA 3A9CA 4OJMX 3WO1A 1X13A 2WFMA 4WCVA 3U48A 1AQ6A 1X1EA 4Q21A 2ECOA 3JX9A 3TDNA 1KY3A 3KTFA 4IGAA 2MOKA 3DHNA 4YCBA 1KOLA 2HAEA 3ZQ4A 1UXHA 3EYAA 1ZL2A 2D0OB 4IEEA 5B6JA 4O86A 1PFKA 2HH9A 1U6KA 1U9IA 3NHBA 4OI4A 4YY3H 1OKKD 3F6BX 5H70A 1HNNA 3WMXA 4B7AA 2UZ4A 2OVFA 3UKOA 3WRVA 1G4UR 1YKGA 2OR3A 5IU6A 5C1IA 3CLTC 2NUAB 4RE6A 4ZT7A 1NSTA 2YVQA 4DVGA 1CF2O 2O8DA 3EIQA 1AS2A 2E49A 2PCJA 2ZU6A 3GLQA 5L7WA 3C8UA 1R5NA 3Q3CA 3EZ6A 2IY9A 1KMQA 5LZ2A 1QZZA 4FNGA 3W5HA 2X6QA 4Y6QA 1TLFA 4JV1A 1KJWA 1QORA 3BMOB 4A2CA 1P3Y1 4NYIQ 1N5OX 4KR2A 2A35A 2FRDC 3CLHA 3U3RA 1VPWA 3D7SA 1OFUA 3R7WB 1AN7A 3E5MA 1MJGA 3ZY6A 1HNWB 4E13A 2FSUA 1EXVA 4YI3A 1WDWB 2NVUA 5KOIA 5CFLA 3T7EA 2AJCA 5JQGF 2O0HA 3ZU6A 1QO0D 3K15A 1GKYA 3OA2A 4XYEA 3SD7A 5IF9A 2J59A 1VKOA 1HDCA 4PFQA 5K2MA 4MW2A 1DNPA 4RABA 1Q17A 3TLZA 1Q22A 3EQ9A 2R5NA 2G67A 4YAUA 3PU6A 4N82A 4O2AF 5JWHA 1K68A 2EXXA 2FUG6 2I8LA 5IKOA 3N2YA 3VPCA 4JXJA 1WY7A 3F6PA 1UZUA 1YRYE 1SVLA 4P33A 3R7LA 2JHFA 3D9QX 5D2CA 4IX9A 2QGFA 1AU9A 2Z4TA 3CN9A 1YQWA 1RCTE 4PFSA 4CFZA 5DHTA 5IARA 1JG3A 3ZX5A 2HDOA 2AFIE 3U54A 3AHEA 3C3YA 4MROA 3U9LA 4WERA 2P1ZA 3I9NA 5AKJA 2YBEA 2HO4A 3UH0A 3QV2A 4L0MA 4PYJA 1SBCA 2GF9A 5ALKA 1X7YA 5T4HA 1L5KA 1KXZA 4H77A 3I28A 3FPSA 4P22A 2D0IA 1RKXA 1D09A 2F1IA 1SVKA 1QQ5A 2UUPA 2RAVA 3D2BA 2HMAA 3ESQA 3TJRA 4H0CA 3E7FA 3BG5A 4R05A 5CLFA 5HKBA 4R51A 1K5PA 1YACA 3MOIA 5AP9A 3I3SR 3ZLVA 3TG2A 3T3NA 4HB0A 1LJLA 4Q1VA 4JELA 2CCJA 2JA1A 1XELA 3RAFC 2Q5JA 4RU1A 4JZKA 3TF5A 3KSRA 4CWAA 3Q5GA 2X8JB 4G5QA 3VR3D 4G1BA 1GLVA 4LJ5A 5I7WA 1V45E 3G9UA 4LW8A 1RLMA 2BEWA 1OAAA 2JCSA 5BQOA 3WY9A 5JEEA 1HQKA 3ILXA 2R6R1 1BE8A 3DOJA 4DREA 5ALHA 7MDHA 4CIWA 4PZ9A 1JIIA 3SVZA 3PWZA 1TRKA 3QKSB 1GL3A 3FPJA 3PFBA 3TIFA 5J2UF 1ZVKA 2CXPA 4OAQA 3ADDA 4MYTA 1RRVA 4XJSA 5EE9A 2PZLA 5C1OA 2HK7A 2QZSA 2XWJI 1U0HC 4XXHA 4RTJA 1SZJG 3SBDA 2BMAA 3RIZA 2BKUA 1A8QA 1JEDA 1IDN1 2QW1A 3OLQA 2V6JA 1Z4NA 1G18A 4ETSA 2O2SA 2VT6A 4PS1A 4ZI2A 1DKPA 1F8GA 3EDRA 3PA6A 1A8IA 5AKXA 2Q2UA 1AHPA 3EUWA 3FMIA 2AEJA 4MUFA 3ZOKA 4LY9A 1CUFA 4EFKA 1GA6A 3EUAA 4PCLA 2I7XA 2JIDA 3OPYA 4PPFA 1U1CA 4UMFA 4BAGA 2OC4A 3EXFA 3VR0A 5KKCA 1L8OA 1E92A 5JCOA 3TYXA 4B6GA 1DUSA 2GR9A 1CJCA 4O25A 4PNPA 1K6JA 3TTSA 3X1DA 5BRJA 3GLIA 4I4IA 3WMEA 4AKEA 4HH1A 4Z8YA 2DPGA 5FPPA 4E07A 4NCAA 1XVVA 2YIVX 4XVQA 3L8FA 5EZYF 2Q0HA 3GJ3A 1ZSVA 4L5YA 4OJQA 3S81A 1K9SA 3TNJA 4QJBA 5KG6A 2P9CA 4DMCA 2GZSA 1OW3B 2C8LA 1PNOA 2C9MA 3NVDA 1LSJA 2F8LA 4CT4B 4UBLA 4Z86A 3U3DA 2FJUA 2ZT7A 1D1TA 3TY5A 3OT1A 1NNSA 4ZI7A 1DAGA 1V1RA 2A5GA 3PP8A 4HD8A 1L6IA 2EJUA 1EVJA 2WJ3A 1E60A 5FBRB 5CCBA 1QF6A 3B3QA 4QOEA 2FMIA 3IQZA 1A5TA 3NRBA 4NBVA 1V5FA 2BLNA 3EGDA 3C6ZA 3QMMA 4U6NA 2O2EA 4Q15A 2G1UA 4TM5A 3NASA 3C7AA 1RLTA 2A57A 3DTVA 3N3AC 4F5YA 1R6BX 5CLIA 4RTMA 3N9IA 2RHRA 1L1QA 3AM4A 3IJ5A 1L5QA 3AF3A 3C98A 3ND6A 4AUEA 5IBCA 1OH5A 3GEIA 3O8CA 3OY7A 2I65A 4WFIA 2W6OA 3LT5A 1EEHA 2JEJA 1YZHA 3F3KA 1UBSB 4XDZA 4XUEA 1QUEA 4OFWA 3E9ZA 1IULA 2BJWA 2NGRA 1J70A 3HVKA 4IOJA 1KQNA 1GLGA 1LF5A 3H8JA 5NULA 4M8NE 3RG8A 3MWYW 3UJ7A 4YGYA 1Z5WA 3IKTA 4KFCA 1ZIOA 2AW5A 3I76A 4FLEA 5A3VA 2O8FA 3EXHA 3O8BA 5EXXA 3U62A 3QVGB 4KDEA 4KACA 3ZUGA 2QT9A 5DG9A 1K6XA 2VYVA 4OYHA 4IF6A 5AOVA 2ZQZA 4J0IA 5EUMA 4XQ0A 5CH8A 3T7DA 3PXAA 1U8TA 3Q9NA 1D07A 2XR1A 3P9YA 3R0ZA 3AIOA 1YBVA 1PT7A 3SZOA 2N47A 5JU6A 1NVVQ 1U0SY 2QLTA 1UT5A 3KEMA 5LQJA 4UMDA 1IY2A 2DH6A 2P2ZA 2Q0SA 3TW0A 3WA6A 4DKXA 5DVZA 1MX5A 2ZQYA 1WMEA 3GPIA 4X1IB 2VPTA 2ZTLA 3UATA 1O8CA 2V96A 3UN1A 4RLHA 3BFVA 1LX7A 3IEPA 3PNLA 1ZAUA 1OFTA 3VI4B 1CY8A 3HCOA 2X0FA 5IKPA 1YKSA 4D3SA 2IEYA 3JASA 4UAVA 1FLNA 3EGXA 2FLPA 5C4MA 2O8EA 1QHHB 2CWWA 3M2TA 4DM4A 3LX6A 1VAJA 3I2GA 2J6UA 2QD4A 3H0CA 5ERXA 1BN7A 3SQLA 1Y42X 5HK9A 3HUUA 4E94A 3EMBA 1E2HA 2VPSA 2Y0CA 3IDZA 3UT0A 1T25A 3Q8MA 2HUPA 1ISIA 1WRBA 1H5NA 3DPIA 5IUJC 1LFDB 2O0JA 3EYYA 4QNMA 5ULLA 2CJYA 2C0CA 2NP6A 1LTKA 2FUCA 2YHAA 1GKUB 3H0KA 1YOVA 3B9QA 4EHNA 1BN6A 3HYSA 1SHKA 1O1YA 3Q72A 3BGSA 4I1SA 1HNXH 1U28A 5TY0A 3LQFA 3P32A 3I30X 3EN0A 4I66A 1YL6A 3MT9A 2PJZA 4IIYA 4UULA 4A2QA 3DJFA 1VE6A 3ZXSA 1PFVA 1BWQA 1LJUA 1P9OA 4FDAA 4OLBA 5DHFA 3SQMA 5BV0A 3AL2A 1DP4A 2W7OA 4UM5A 3I5YA 5ELLA 3T3GA 4WXPA 3IAXA 2BC9A 2WUFA 3JVIA 3Q8PB 1B93A 3DMTA 3KKOA 3P2EA 2CKZB 2JRLA 4PG5A 3SKVA 2QXYA 4TXLA 4N41A 2VDRB 3F7TA 1D04A 1GV0A 2AF4C 2RI6A 4CR8A 1T1EA 7AT1A 1O4WA 3ZVKA 1L9KA 3VDRA 3T1YB 2WA1A 3GFRA 2QJTA 1GQQA 3EXHB 3AOEC 4ITVA 4X6XA 1HKUA 4ZZ3A 4FP9A 5K8TA 2ERXA 2VXBA 3WWCA 2IS6A 3QHPA 3ZIUA 4TLCA 5IEJA 4Q48A 2CHEA 1FOEB 3GVPA 1NTRA 3BM5A 3L2OB 4CMFA 1GWNA 3QLUC 2GPSA 2O3UA 3KZ1E 4QBKA 2CLDX 4RKFA 3RAPR 4CCAA 5KNBA 4ON9A 1NKTA 3MUNA 4J4HA 5LQDA 3GUVA 3K0AB 4UW9A 5JS2A 4OAOA 5AIAA 4MTCA 5B7PA 3F8NA 4K0KB 4IKOA 4IUYA 1W4ZA 2G63A 3JQ9C 4P8RA 4UCVA 1E59A 1KJNA 1H65A 5AR1A 4URVR 4XOUA 4XTCS 2UUOA 3PE6A 2RC6A 3TZQA 2BI8A 3IAM1 2C1XA 4ID3A 1PDWA 1FA9A 1I3QA 5C3UA 5DK4A 3D59A 3Q0TA 2XH8A 5JECA 3KQMA 2P68A 3DGFC 4GLBA 4L9AA 4D25A 1CY1A 1DZIA 2K7ZA 2R6FA 3U3JA 3LUDA 3RIHA 3HKZA 5LB4A 1Z7YA 4FBTA 3E7PA 4L74A 1E62A 1EWVA 1WE2A 2WLTA 2RIPA 1NRIA 4Q39A 3DAPA 2J3HA 2OB2A 4NENA 2NO6A 4HAXA 3RABA 2PRIA 3TR5A 4B3HA 1XL0A 3JVDA 1KVQA 4DPMA 4G1MB 2ZIAA 1E1CA 2XTNA 1F12A 1GCOA 2BW0A 5F73A 4F4IA 3D8HA 2WZQA 2HA6A 3PGA1 1AKTA 4EW1A 2PR2A 3ESCA 2PSJA 3TZHA 3WK7A 5D3MB 2ZRCA 4NVRA 2P0AA 4BBAA 2CB0A 2ZAMA 3OHSX 4QO8A 4V0OA 5COBA 4X9XA 2FB9A 4LUCA 2OGUA 5HR5A 4Y98A 5I6DA