1AV1A

Crystal structure of human apolipoprotein a-i
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
MLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN A-I
publication title Crystal structure of truncated human apolipoprotein A-I suggests a lipid-bound conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 70
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01442 Apolipoprotein Apolipoprotein A1/A4/E domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Apolipoprotein A-I 1av1A00
1AV1A
chains in the Genus database with same CATH superfamily
4OGQC 4DOJA 3HRNA 1DH3A 3WUUA 4KT0J 2M0BA 2WPSA 5AW2B 3TDKA 1GK6A 1PIXA 4EIJA 1RF1A 1D7MA 2K1AA 3Q2YA 1ZXGA 4EI2A 1EDKA 1PPJD 1K04A 2QM7A 3U1CA 2QJYC 1HJ0A 3GHGA 3R4YA 3HUSB 1ZW0A 2PP6A 2W27A 5KLVK 3H1HD 2E74C 1Q2NA 2FBWC 2AXTE 3OJAB 1ZOYC 3HE5B 4TT3H 1KN7A 1BCCG 5AVZB 4U3FG 3SFDC 5B66E 3T97B 1IO4A 2CPSA 4IL6X 2IBZI 1PZQA 5GTIE 1NTZG 2W90A 3L75D 1FOSE 2V4HA 4OH8B 2BCCJ 3M91A 4JYCA 3USSA 1SQBK 3M9QA 3CX5H 1URQA 3L72G 3V2PA 3RL0D 3M0DA 2OYHC 2KNCA 3BCCD 2HR3A 4H44B 5AW5B 1T3JA 2RN0A 3LW5J 3MTUE 1YYCA 4JBZA 2WSSH 2IZ1A 2IBZG 2Q7CA 2MJZA 2QEXP 2O01J 4IFDK 4BRYA 3MD0A 1L0NK 4H0LD 1KQGB 3V4WA 1FS0E 1AVYA 1SQVE 2W6BA 2R3CA 2K9JB 3L73D 1NYHA 5APTA 2H88C 3CX5D 2XDJA 2FYUK 3QH9A 2WSEH 1NTKJ 1Q81Q 1KC8Q 1NU1J 3CWBD 2AEFA 2WSFH 1AA0A 2MKVA 1PGQA 3TGUJ 2M8RA 3ZDMA 3KXDA 2KYVA 1RE3A 3F89A 1FZBA 3P7KA 4IOIH 3V4QA 2KZJA 1IZNB 1CI6B 3H1IJ 1NWQA 5AVQB 2HODB 1SQQD 3GMAA 3H1JJ 1RH5B 2KOGA 1X8YA 1M7LA 3HD7A 2ZFCA 5AW8B 1SQPD 5AVVB 3L70G 2BCCE 1YQ3C 4D6TJ 4NPEA 2HFED 1VQKP 2KIKA 2W8ZA 1JO5A 2YKPA 2XV5A 1W2EA 1PFIA 4UB6E 2IPPA 1JB0J 1U7JA 5AW7B 2Y9YA 2W83C 1BGYD 1QLED 4PD4E 3NTNA 5AW1B 4W7ZA 1MUUA 1HTLC 3AE5C 1JY3N 4H44D 4EYYQ 3AE1C 3H1KE 2OGUA 3L36A 3H6PA 5KAFH 1EDJA 3CCJP 3PP5A 1ZMEC 1EQ7A 1H0TA 4I6MC 5L8RJ 2A06E 3O6QB 2FKWB 5BU5A 1OMIA 2ZT9B 1YI2P 5APUA 2O01N 1ZN5A 3H1HG 3AE3C 3CXHE 1OIPA 1BCCJ 4GT1A 3AE2C 2Q5UA 2J59M 3S9OA 3TGUE 1NAFA 1SQXD 1N7SD 2VRSA 2B87A 3CCEP 1T6AA 3E1RA 1M1KQ 3L75G 1OW6A 3G3ZA 1KB9E 3L72J 3I5CA 1JY2P 2ZVNB 3VOPA 1HJBA 3JCUE 5GTHH 1TU3F 2GM4A 4D6TE 3U1AA 3VP9A 1SFCC 3D6YA 2N1TB 1KD1Q 3GW6A 1M57D 2JJLA 4YTPC 5BVZA 2O1JA 1QEXA 1FJPA 2E43A 3H1LD 1Q7YQ 1P84E 3WMM0 1SS1A 2LKMA 3HUSC 3I55P 2FXPA 3KQGA 2C9NY 3OAKA 2NZ2A 3R2PA 1SQVG 1PP9D 1EDIA 4ZKPA 3HE4B 1EC5A 5AW4B 4GODA 2Y0CA 4O9BA 5C39A 5M1BA 3CWBG 1LT9C 3PH0A 1FZCA 3KYQA 3KZIH 3G4SP 4WBAA 2KZIA 2WT7A 2FFDB 1JM0A 1KYOD 1Y8AA 4BXLA 2H7HA 3FXDA 2B88A 4U3FE 2QIWA 1QL1A 1N73A 1SQQG 5AVYB 2M5AA 2SPZA 3L71E 5K5GB 1FAVA 2RMZA 1NTZE 3L70J 3VMZA 1L0LD 4PD4I 1SQPG 3JSVC 3MZWB 1KORA 5KAIH 4AUWA 1IFMA 1KILB 2GUVA 2WPRA 1VPCA 4NPFX 1M1JA 1U57A 1NTKK 2QJPB 1PL5A 2KSEA 4YXWH 2Q1KA 1VQ4P 2OARA 2E74D 3SWYA 3PJSK 1S5LE 1IFDA 3CCMP 1BGYG 2I1JA 2JWDA 3CXHI 1VDFA 2IYOA 2KP8A 3L74D 1QGKB 1YJWP 1VQ7P 2N1TD 3AEGC 1LP1B 2IZ0A 3ABVC 3BATA 1VL2A 3P8CE 2C0WA 1NH4A 2A06G 1KB9I 4EOTA 1LWUC 5B5EE 2WITA 2YIUB 4YPCA 1GMJA 3N4XA 1W2BO 1SQBD 2WSCH 2JWAA 4B86A 1MFTA 1WT6A 1DEEG 3BRVB 5CJ4A 1G1IA 3RK3B 1YJNP 1BE3D 3MUDC 2HPCB 1VQMP 1FE6A 4DCKA 4JQ0D 3B5NB 3A0HH 3K5BA 1GW4A 1P84I 5APXA 3CL3D 1X22A 4YXDC 1OZHA 3F5HA 4RKUJ 2OYOA 4HH2A 1KV4A 2GUSA 2WVRA 1L0ND 1FOSF 3CMAP 2IYPA 1EDLA 4ASVA 3MIWA 3HE5A 2JP3A 3Q5PA 2WQYC 1EXIA 3PHLA 2FYUD 4PJ0E 3VTPC 1ZR2A 4WB4A 3H1LG 2K37A 1SQVJ 1GZLA 1G2CA 1KFMA 1S72P 1SFCB 1KYOI 2L5GB 5CCHA 3AE6C 2ZT9C 2XKMA 3HTKA 1HVVA 1PP9G 1UIXA 1K9MQ 1EZVD 1NTZK 3CLQA 1NGMB 3D71A 2FY8A 1PPJE 1AVOA 2YKOA 5APVA 1JY2O 2GA1A 4K35A 1QX8A 1S3JA 1N86A 2R5DA 1JEKA 3H1HE 4GDOA 4BWNA 1RE4C 4OWFA 2N9YB 2C0XA 1NTMD 2K9YA 2BEZF 1SQQJ 1LT9B 5TISH 1DD3A 2AEJA 3S4RA 1RF0C 2YKQA 1N7SA 3EFFK 3VMAA 2V7QJ 3L71G 2R44A 3L4FA 3L75E 1OVUA 3V2NA 3V2QA 1L0LG 2N1TC 3TSIA 5DJUB 1S9KE 2Q9IA 2W6AA 4LGDE 3AEBC 3KDPB 1OXZA 1SP4A 2PFXA 3RK3D 3ITKA 2E42A 2OYIB 3BCCE 3WU2H 4R4MA 4UB8H 4Y99B 1DIPA 1FDMA 2JR8A 1BGYJ 3OA7A 2QSIA 2AEMA 2R5BA 3H1KJ 2FXMA 2YXQB 3L74G 2WWWA 3L73E 1CSBA 1ZRTD 2FFDC 3CX5E 3GHGB 1YHQP 1AQ5A 4WY4A 4IFFA 2Y9ZA 3CWBE 1GL2B 2QVAA 1IFPA 1SFCD 1VQ8P 3TNUB 3CC4P 3H25A 1H89A 1KILC 3SWFA 1RQUA 2XU6A 1SQQE 1LWUB 2E5TA 4XE5B 1GK4A 2QJPC 3EQ2A 2IFMA 1M90Q 3D6ZA 3RK2B 1HH0A 4KJMA 1KQSO 2KNCB 1SQPE 1USDA 1KMIZ 1AQTA 1QVGO 3LW5H 1JMBA 1MV8A 2YXRB 1N7LA 4ZNCA 2J58A 2O01H 4WWIA 4L76A 4C7RA 2KS1A 3VN0A 4BRYB 5KJ7C 3II6A 2I8DA 1BGYE 2Z4EA 1VQOP 3Q3DA 2JEEA 1PV3A 3U59A 3CPWO 2JDIH 2E75B 1EZVG 2R3SA 3CCVP 3D70A 2YIUC 1FZGA 4W80A 1YQ4C 1PPJG 1EXJA 4CPGA 4ASWA 1MZ9A 5E79H 1VQ5P 3RK3C 3B8EB 2WTYA 3Q5RA 4RJTA 3Q1MA 3MHVA 1E5WA 2OYHA 4A7PA 1FU1A 3B5NC 5AW6B 5AW3B 5KKZB 1OW8A 3CCLP 1VF5B 1NTMG 4U3FJ 1SQXE 4Y28J 3C1LA 1OX3A 5H2FH 1NTKD 3L71J 1GL2D 1NU1D 2Z5HA 1VQ9P 1L4AC 1NTZJ 1E79H 1HBWA 1YBKA 4K3AA 1G1JA 5KAFE 1R5LA 1M56D 2D2CB 1SQVK 3G6EP 2YO2A 4N78D 2A45H 5EFWB 2IX7C 1LTJC 3C8VA 1NVOA 3G9RA 4MN4C 3CX5I 1NAYA 3BCCG 3H1ID 3LIEA 2NPSC 2PAJA 3H1JD 3RK2D 1FBMA 2Q3EA 2XNDH 2ZXXA 4XFJA 2KLVA 4I2LC 5CCGD 5APWA 3H1LE 5DJTB 4N6JA 3TYYA 4D6TD 3RBZA 2I1KA 3L74J 1SQQK 1LTGC 4QMAA 3IAOA 1PP9E 1H0TB 3L73G 4L73A 2WPQA 2G8YA 1SQPK 3PRJA 5GTHE 3CD6P 1RY3A 1IK7A 4GKGA 1IFIA 2E75D 4PV1C 1N2DC 2B87B 2LXCB 1AV1A 1KYOE 1X79B 1NJIQ 5APYA 3M9BA 1PGJA 1LTTC 2OYIC 1H88A 2YMKA 2ZT9D 3RGUA 3RBXA 1L0LE 4Y99C 3L35A 3TF5A 1BCCD 1OVVA 1R5SA 1VF5D 3KZIE 4I1LA 3H32A 1JTHA 1RF1C 3I56P 1YIJP 1Y47A 3L37A 2K88A 4RO0A 2N9BA 3GHGC 4DT0A 2P7JA 4H13B 1X0TA 3L72D 1JY2N 2PRRA 1DD4A 3A2AA 3FWNA 1OW7A 1GL2C 2BASA 1HWTC 5KLVD 3L74E 4GIFA 1M8OB 1J1EB 2HYNA 2QJKC 5KAIE 2IBZD 1T3UA 3IFMA 3EWKA 4IL6H 3O8ZA 2YNYA 3KHUA 1VQLP 2KUBA 3AEFC 3BASA 2QA4P 4AQRD 3H1HJ 2KXPB 5CBOA 4R4LA 1URQC 1SQBE 2FXOA 3RK2C 1SFCA 3M0DC 2OTKE 1FZEA 1SQXG 5CCGC 1NTKG 1BE3E 4NPDA 4L74A 1FC2C 2W6JH 1NU1G 1HF9A 3L75J 3AEEC 1LJ2A 3GF7A 3E1IA 3HUSA 2ZYGA 1M1JB 2QG4A 2LXBA 1IC2A 3A0BH 3B4SA 4C7NB 1L0NE 1X9VA 3BCCJ 3M0AA 3P8MC 1L4AB 1Q86Q 3H1IG 1LT9A 3T97A 3S1KA 2FYUE 3H1JG 3L70D 2E75C 1NKNA 2G3AA 4M3LA 4N3YB 2POHA 2Y0EA 1OFCX 3C9IA 1LTJB 3M06A 3CCSP 2E76B 3CCUP 1GDTA 4H0LB 3RL0g 1KILD 1NO4A 2NPSB 3A0HE 3L73J 1RE3C 1QL2A 2A45G 1EZVE 1JCDA 1S5LX 1K05A 1L0LK 5KKZC 3CWBJ 1VF5C 2AXTH 4H13D 3PTZA 1JUNA 2FYZA 4HKZH 4Z1MH 5B66H 3HD7C 5AVTB 1NHLA 2D2CC 5GTIH 2NRGA 1NTME 5KJ7D 3GLMA 1KQLA 3FXEA 2M3EA 2K9JA 3KPEA 3JC22 2WPVB 1LTSC 1LT1A 3FGAD 3BVHA 2H89C 2WSEJ 2Q6QA 1GL2A 5CHXA 1GU4A 2H43A 1SQPJ 4PV1B 2ZJSE 1OWAA 4RESB 1YTZT 1USEA 2XZRA 5KTBA 2O3JA 3MP7B 2R32A 2WSFJ 3RK3E 2JKVA 3TNUA 4L75A 2Z5IA 3CCQP 1CW5A 5AVRB 5CJ0A 1FDIA 3VMXA 3G71P 2FYNC 1AJYA 1MFZA 1CI6A 3B5ND 1KZUB 2HODA 2KSJA 1LWUA 1T2KD 1S9KD 1G2CB 5TISE 1YTZI 3HTKB 1RF1B 1Q90D 1YITP 1S4XA 1JY3P 3SSUA 5CCGA 1L4AD 5KLVG 1VQNP 5AVWB 2B9BA 3MUDA 1ZRTE 2Q3IA 2O1KA 1WMKA 3A7OA 4U7JA 3WU2E 2E76D 4UB8E 1SLQA 1QVFO 2HG5D 3IF4A 2NPSD 1SQVD 4LLHA 3MGNA 4EDFA 2P1JA 2QJKB 1SQXJ 1SQBG 2QRXA 1N7SB 2V7QH 3CI9A 1SVFA 3CC2P 1BE3G 1LTBC 3FX0A 1W5CE 4UB6H 5KLIC 1URQB 3O6QA 2KI7B 3QWOC 1DEBA 1ZP0C 2P2UA 4JPZB 4ZKUA 1T8ZA 5AVXB 2OTJP 2YO3A 2KLUA 4H13C 1L0NG 4GOEA 1EZVI 2ZYDA 4I7ZB 4PD4H 1IJDB 2E5YA 3Q5SA 1J1DB 1WRGA 2FYUG 1J1EC 4PV1D 4DZOA 1FZCC 1JMMA 3H1LJ 1BDDA 2BCCD 5AW0B 1NTMK 1RE4A 1FZFA 1R8EA 2KK7A 1FDOA 3IN6A 1PP9J 2OTLP 5BU8B 4WY4B 1RF0A 2WZ7A 3PLNA 3CXHH 1UIIA 2ZAEB 1RQVA 1RHZB 1N73C 2IDBA 5CCHD 2N1TA 5AVUB 3A3YB 4PD4D 3W67A 3NFQA 4JF7A 1K73Q 1J2JB 1YJ9P 3H1KD 4OGQB 4WVZA 4HB1A 1Z56A 1T2KC 1M1JC 1XTGB 1KB9H 5APSA 3RL0C 1NTKE 2A06D 3HE4A 2IFNA 1NU1E 3HD7B 1OVRA 3JCUH 1L0LJ 3CXHD 1XTCC 3NXSA 2QJYB 4N78E 2RKLA 3TGUD 5E79E 2FFDA 2L91A 2E76C 1IFNA 3V5BA 2KS1B 2DW3A 4H0LC 3GF3A 4DJGA 1P84H 3H1IE 4AYCA 2J5UA 2E74B 1URQD 1PGOA 3H1JE 1BDCA 1KB9D 5H2FE 1LGHB 2ZYAA 3AEAC 2XNXA 3NMDA 2ZVOB 3AECC 5KLVJ 2C9LY 1L2PA 2AXCA 3OW2O 2FYNB 5CMZA 1KILA 3EFGA 1FJKA 3V6IA 2CK3H 3TK1A 2B89A 2CPBA 2OYHB 1KYOH 1P84D 3CMEP 4JYBA 1JCCA 1N8RQ 4C46A 3M9HA 1SQBJ 1HUCA 1ZV8A 3FWLA 4WY4D 1AFOA 1VQ6P 1BE3J 2P10A 4LC1A 5KJ7A 1LP1A 1BSNA 2H8PD 1IK9A 1JY3O 1PGPA 1GW3A 3AE9C 4OGQD 1KTMA 2P58A 2HLOA 1BCCE 1L0NJ 2ITAA 1KQFB 3WUVA 1HGZA 4U3FD 5CCHC 1S5LH 3A5TA 2WSCJ 1JOCA 3L71D 3HD7D 3LIDA 4H44C 2FYUJ 5APQA 5KLIB 1NTZD 4OVNF 1GTWA 1IFJA 2HPCA 2UWJE 1KFNA 2D2CD 2YMYA 4ZMDA 1FZAA 1H8AA 3B5NA 2BCCG 3VMYA 3L72E 2ZXEB 3AE7C 1SQXK 1NKZB 1GD2E 1HGVA 2QM8A 3AE4C 1NOHA 3WUTA 3VP8A 5KLVE 1NU1K 2WMMA 4C7NA 4HYTB 1BSHA 1L4AA 5B5EH 2BEQD 2IBZE 3B71A 1FZCB 2OQQA 4KHXA 1A02J 3GG2A 1N7SC 5AW9B 4XA4A 2WT7B 1MKMA 1LTIC 1Y9BA 4IFMA 3SWKA 1LTJA 1K8AQ 3H1KG 1S1CX 1A02F 2P67A 5TJHA 1NTMJ 2NPSA 1S2EA 2QE7H 3CCRP 1ZLLA 1N73B 2M5AB 3P8CD 2PGDA 3VYIA 3BRTB 4I7ZC 2JO1A 4HJGH 5CBNA 4IL6E 1GU5A 3H32B 3W68A 1JTHB 1U7MA 1J1DC 4GOFA 3AE8C 3CC7P 1Q82Q 3TGUG 4TLFA 1LTAC 4PJ0H 1DX7A 3AEDC 3RL0B 1ZR4A 1LNQA 2A45I 2Y0DA 2RH0A 1JNMA 4WY4C 3SFEC 4W7YA 3L70E 3E7KA 2M3BA 2K3RA 1VQPP 1KILE 3V2RA 2LR2A 3UIAA 3N7NA 4D6TG 2KB7P 3P32A 1CZQA 3IR9A 5AVSB 3A0BE 2OYIA
chains in the Genus database with same CATH topology
1AV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AV1 A; 
#chains in the Genus database with same CATH topology
 4OGQ C;  4DOJ A;  3HRN A;  1DH3 A;  3WUU A;  4KT0 J;  2M0B A;  2WPS A;  5AW2 B;  3TDK A;  1GK6 A;  1PIX A;  4EIJ A;  1RF1 A;  1D7M A;  2K1A A;  3Q2Y A;  1ZXG A;  4EI2 A;  1EDK A;  1PPJ D;  1K04 A;  2QM7 A;  3U1C A;  2QJY C;  1HJ0 A;  3GHG A;  3R4Y A;  3HUS B;  1ZW0 A;  2PP6 A;  2W27 A;  5KLV K;  3H1H D;  2E74 C;  1Q2N A;  2FBW C;  2AXT E;  3OJA B;  1ZOY C;  3HE5 B;  4TT3 H;  1KN7 A;  1BCC G;  5AVZ B;  4U3F G;  3SFD C;  5B66 E;  3T97 B;  1IO4 A;  2CPS A;  4IL6 X;  2IBZ I;  1PZQ A;  5GTI E;  1NTZ G;  2W90 A;  3L75 D;  1FOS E;  2V4H A;  4OH8 B;  2BCC J;  3M91 A;  4JYC A;  3USS A;  1SQB K;  3M9Q A;  3CX5 H;  1URQ A;  3L72 G;  3V2P A;  3RL0 D;  3M0D A;  2OYH C;  2KNC A;  3BCC D;  2HR3 A;  4H44 B;  5AW5 B;  1T3J A;  2RN0 A;  3LW5 J;  3MTU E;  1YYC A;  4JBZ A;  2WSS H;  2IZ1 A;  2IBZ G;  2Q7C A;  2MJZ A;  2QEX P;  2O01 J;  4IFD K;  4BRY A;  3MD0 A;  1L0N K;  4H0L D;  1KQG B;  3V4W A;  1FS0 E;  1AVY A;  1SQV E;  2W6B A;  2R3C A;  2K9J B;  3L73 D;  1NYH A;  5APT A;  2H88 C;  3CX5 D;  2XDJ A;  2FYU K;  3QH9 A;  2WSE H;  1NTK J;  1Q81 Q;  1KC8 Q;  1NU1 J;  3CWB D;  2AEF A;  2WSF H;  1AA0 A;  2MKV A;  1PGQ A;  3TGU J;  2M8R A;  3ZDM A;  3KXD A;  2KYV A;  1RE3 A;  3F89 A;  1FZB A;  3P7K A;  4IOI H;  3V4Q A;  2KZJ A;  1IZN B;  1CI6 B;  3H1I J;  1NWQ A;  5AVQ B;  2HOD B;  1SQQ D;  3GMA A;  3H1J J;  1RH5 B;  2KOG A;  1X8Y A;  1M7L A;  3HD7 A;  2ZFC A;  5AW8 B;  1SQP D;  5AVV B;  3L70 G;  2BCC E;  1YQ3 C;  4D6T J;  4NPE A;  2HFE D;  1VQK P;  2KIK A;  2W8Z A;  1JO5 A;  2YKP A;  2XV5 A;  1W2E A;  1PFI A;  4UB6 E;  2IPP A;  1JB0 J;  1U7J A;  5AW7 B;  2Y9Y A;  2W83 C;  1BGY D;  1QLE D;  4PD4 E;  3NTN A;  5AW1 B;  4W7Z A;  1MUU A;  1HTL C;  3AE5 C;  1JY3 N;  4H44 D;  4EYY Q;  3AE1 C;  3H1K E;  2OGU A;  3L36 A;  3H6P A;  5KAF H;  1EDJ A;  3CCJ P;  3PP5 A;  1ZME C;  1EQ7 A;  1H0T A;  4I6M C;  5L8R J;  2A06 E;  3O6Q B;  2FKW B;  5BU5 A;  1OMI A;  2ZT9 B;  1YI2 P;  5APU A;  2O01 N;  1ZN5 A;  3H1H G;  3AE3 C;  3CXH E;  1OIP A;  1BCC J;  4GT1 A;  3AE2 C;  2Q5U A;  2J59 M;  3S9O A;  3TGU E;  1NAF A;  1SQX D;  1N7S D;  2VRS A;  2B87 A;  3CCE P;  1T6A A;  3E1R A;  1M1K Q;  3L75 G;  1OW6 A;  3G3Z A;  1KB9 E;  3L72 J;  3I5C A;  1JY2 P;  2ZVN B;  3VOP A;  1HJB A;  3JCU E;  5GTH H;  1TU3 F;  2GM4 A;  4D6T E;  3U1A A;  3VP9 A;  1SFC C;  3D6Y A;  2N1T B;  1KD1 Q;  3GW6 A;  1M57 D;  2JJL A;  4YTP C;  5BVZ A;  2O1J A;  1QEX A;  1FJP A;  2E43 A;  3H1L D;  1Q7Y Q;  1P84 E;  3WMM 0;  1SS1 A;  2LKM A;  3HUS C;  3I55 P;  2FXP A;  3KQG A;  2C9N Y;  3OAK A;  2NZ2 A;  3R2P A;  1SQV G;  1PP9 D;  1EDI A;  4ZKP A;  3HE4 B;  1EC5 A;  5AW4 B;  4GOD A;  2Y0C A;  4O9B A;  5C39 A;  5M1B A;  3CWB G;  1LT9 C;  3PH0 A;  1FZC A;  3KYQ A;  3KZI H;  3G4S P;  4WBA A;  2KZI A;  2WT7 A;  2FFD B;  1JM0 A;  1KYO D;  1Y8A A;  4BXL A;  2H7H A;  3FXD A;  2B88 A;  4U3F E;  2QIW A;  1QL1 A;  1N73 A;  1SQQ G;  5AVY B;  2M5A A;  2SPZ A;  3L71 E;  5K5G B;  1FAV A;  2RMZ A;  1NTZ E;  3L70 J;  3VMZ A;  1L0L D;  4PD4 I;  1SQP G;  3JSV C;  3MZW B;  1KOR A;  5KAI H;  4AUW A;  1IFM A;  1KIL B;  2GUV A;  2WPR A;  1VPC A;  4NPF X;  1M1J A;  1U57 A;  1NTK K;  2QJP B;  1PL5 A;  2KSE A;  4YXW H;  2Q1K A;  1VQ4 P;  2OAR A;  2E74 D;  3SWY A;  3PJS K;  1S5L E;  1IFD A;  3CCM P;  1BGY G;  2I1J A;  2JWD A;  3CXH I;  1VDF A;  2IYO A;  2KP8 A;  3L74 D;  1QGK B;  1YJW P;  1VQ7 P;  2N1T D;  3AEG C;  1LP1 B;  2IZ0 A;  3ABV C;  3BAT A;  1VL2 A;  3P8C E;  2C0W A;  1NH4 A;  2A06 G;  1KB9 I;  4EOT A;  1LWU C;  5B5E E;  2WIT A;  2YIU B;  4YPC A;  1GMJ A;  3N4X A;  1W2B O;  1SQB D;  2WSC H;  2JWA A;  4B86 A;  1MFT A;  1WT6 A;  1DEE G;  3BRV B;  5CJ4 A;  1G1I A;  3RK3 B;  1YJN P;  1BE3 D;  3MUD C;  2HPC B;  1VQM P;  1FE6 A;  4DCK A;  4JQ0 D;  3B5N B;  3A0H H;  3K5B A;  1GW4 A;  1P84 I;  5APX A;  3CL3 D;  1X22 A;  4YXD C;  1OZH A;  3F5H A;  4RKU J;  2OYO A;  4HH2 A;  1KV4 A;  2GUS A;  2WVR A;  1L0N D;  1FOS F;  3CMA P;  2IYP A;  1EDL A;  4ASV A;  3MIW A;  3HE5 A;  2JP3 A;  3Q5P A;  2WQY C;  1EXI A;  3PHL A;  2FYU D;  4PJ0 E;  3VTP C;  1ZR2 A;  4WB4 A;  3H1L G;  2K37 A;  1SQV J;  1GZL A;  1G2C A;  1KFM A;  1S72 P;  1SFC B;  1KYO I;  2L5G B;  5CCH A;  3AE6 C;  2ZT9 C;  2XKM A;  3HTK A;  1HVV A;  1PP9 G;  1UIX A;  1K9M Q;  1EZV D;  1NTZ K;  3CLQ A;  1NGM B;  3D71 A;  2FY8 A;  1PPJ E;  1AVO A;  2YKO A;  5APV A;  1JY2 O;  2GA1 A;  4K35 A;  1QX8 A;  1S3J A;  1N86 A;  2R5D A;  1JEK A;  3H1H E;  4GDO A;  4BWN A;  1RE4 C;  4OWF A;  2N9Y B;  2C0X A;  1NTM D;  2K9Y A;  2BEZ F;  1SQQ J;  1LT9 B;  5TIS H;  1DD3 A;  2AEJ A;  3S4R A;  1RF0 C;  2YKQ A;  1N7S A;  3EFF K;  3VMA A;  2V7Q J;  3L71 G;  2R44 A;  3L4F A;  3L75 E;  1OVU A;  3V2N A;  3V2Q A;  1L0L G;  2N1T C;  3TSI A;  5DJU B;  1S9K E;  2Q9I A;  2W6A A;  4LGD E;  3AEB C;  3KDP B;  1OXZ A;  1SP4 A;  2PFX A;  3RK3 D;  3ITK A;  2E42 A;  2OYI B;  3BCC E;  3WU2 H;  4R4M A;  4UB8 H;  4Y99 B;  1DIP A;  1FDM A;  2JR8 A;  1BGY J;  3OA7 A;  2QSI A;  2AEM A;  2R5B A;  3H1K J;  2FXM A;  2YXQ B;  3L74 G;  2WWW A;  3L73 E;  1CSB A;  1ZRT D;  2FFD C;  3CX5 E;  3GHG B;  1YHQ P;  1AQ5 A;  4WY4 A;  4IFF A;  2Y9Z A;  3CWB E;  1GL2 B;  2QVA A;  1IFP A;  1SFC D;  1VQ8 P;  3TNU B;  3CC4 P;  3H25 A;  1H89 A;  1KIL C;  3SWF A;  1RQU A;  2XU6 A;  1SQQ E;  1LWU B;  2E5T A;  4XE5 B;  1GK4 A;  2QJP C;  3EQ2 A;  2IFM A;  1M90 Q;  3D6Z A;  3RK2 B;  1HH0 A;  4KJM A;  1KQS O;  2KNC B;  1SQP E;  1USD A;  1KMI Z;  1AQT A;  1QVG O;  3LW5 H;  1JMB A;  1MV8 A;  2YXR B;  1N7L A;  4ZNC A;  2J58 A;  2O01 H;  4WWI A;  4L76 A;  4C7R A;  2KS1 A;  3VN0 A;  4BRY B;  5KJ7 C;  3II6 A;  2I8D A;  1BGY E;  2Z4E A;  1VQO P;  3Q3D A;  2JEE A;  1PV3 A;  3U59 A;  3CPW O;  2JDI H;  2E75 B;  1EZV G;  2R3S A;  3CCV P;  3D70 A;  2YIU C;  1FZG A;  4W80 A;  1YQ4 C;  1PPJ G;  1EXJ A;  4CPG A;  4ASW A;  1MZ9 A;  5E79 H;  1VQ5 P;  3RK3 C;  3B8E B;  2WTY A;  3Q5R A;  4RJT A;  3Q1M A;  3MHV A;  1E5W A;  2OYH A;  4A7P A;  1FU1 A;  3B5N C;  5AW6 B;  5AW3 B;  5KKZ B;  1OW8 A;  3CCL P;  1VF5 B;  1NTM G;  4U3F J;  1SQX E;  4Y28 J;  3C1L A;  1OX3 A;  5H2F H;  1NTK D;  3L71 J;  1GL2 D;  1NU1 D;  2Z5H A;  1VQ9 P;  1L4A C;  1NTZ J;  1E79 H;  1HBW A;  1YBK A;  4K3A A;  1G1J A;  5KAF E;  1R5L A;  1M56 D;  2D2C B;  1SQV K;  3G6E P;  2YO2 A;  4N78 D;  2A45 H;  5EFW B;  2IX7 C;  1LTJ C;  3C8V A;  1NVO A;  3G9R A;  4MN4 C;  3CX5 I;  1NAY A;  3BCC G;  3H1I D;  3LIE A;  2NPS C;  2PAJ A;  3H1J D;  3RK2 D;  1FBM A;  2Q3E A;  2XND H;  2ZXX A;  4XFJ A;  2KLV A;  4I2L C;  5CCG D;  5APW A;  3H1L E;  5DJT B;  4N6J A;  3TYY A;  4D6T D;  3RBZ A;  2I1K A;  3L74 J;  1SQQ K;  1LTG C;  4QMA A;  3IAO A;  1PP9 E;  1H0T B;  3L73 G;  4L73 A;  2WPQ A;  2G8Y A;  1SQP K;  3PRJ A;  5GTH E;  3CD6 P;  1RY3 A;  1IK7 A;  4GKG A;  1IFI A;  2E75 D;  4PV1 C;  1N2D C;  2B87 B;  2LXC B;  1AV1 A;  1KYO E;  1X79 B;  1NJI Q;  5APY A;  3M9B A;  1PGJ A;  1LTT C;  2OYI C;  1H88 A;  2YMK A;  2ZT9 D;  3RGU A;  3RBX A;  1L0L E;  4Y99 C;  3L35 A;  3TF5 A;  1BCC D;  1OVV A;  1R5S A;  1VF5 D;  3KZI E;  4I1L A;  3H32 A;  1JTH A;  1RF1 C;  3I56 P;  1YIJ P;  1Y47 A;  3L37 A;  2K88 A;  4RO0 A;  2N9B A;  3GHG C;  4DT0 A;  2P7J A;  4H13 B;  1X0T A;  3L72 D;  1JY2 N;  2PRR A;  1DD4 A;  3A2A A;  3FWN A;  1OW7 A;  1GL2 C;  2BAS A;  1HWT C;  5KLV D;  3L74 E;  4GIF A;  1M8O B;  1J1E B;  2HYN A;  2QJK C;  5KAI E;  2IBZ D;  1T3U A;  3IFM A;  3EWK A;  4IL6 H;  3O8Z A;  2YNY A;  3KHU A;  1VQL P;  2KUB A;  3AEF C;  3BAS A;  2QA4 P;  4AQR D;  3H1H J;  2KXP B;  5CBO A;  4R4L A;  1URQ C;  1SQB E;  2FXO A;  3RK2 C;  1SFC A;  3M0D C;  2OTK E;  1FZE A;  1SQX G;  5CCG C;  1NTK G;  1BE3 E;  4NPD A;  4L74 A;  1FC2 C;  2W6J H;  1NU1 G;  1HF9 A;  3L75 J;  3AEE C;  1LJ2 A;  3GF7 A;  3E1I A;  3HUS A;  2ZYG A;  1M1J B;  2QG4 A;  2LXB A;  1IC2 A;  3A0B H;  3B4S A;  4C7N B;  1L0N E;  1X9V A;  3BCC J;  3M0A A;  3P8M C;  1L4A B;  1Q86 Q;  3H1I G;  1LT9 A;  3T97 A;  3S1K A;  2FYU E;  3H1J G;  3L70 D;  2E75 C;  1NKN A;  2G3A A;  4M3L A;  4N3Y B;  2POH A;  2Y0E A;  1OFC X;  3C9I A;  1LTJ B;  3M06 A;  3CCS P;  2E76 B;  3CCU P;  1GDT A;  4H0L B;  3RL0 g;  1KIL D;  1NO4 A;  2NPS B;  3A0H E;  3L73 J;  1RE3 C;  1QL2 A;  2A45 G;  1EZV E;  1JCD A;  1S5L X;  1K05 A;  1L0L K;  5KKZ C;  3CWB J;  1VF5 C;  2AXT H;  4H13 D;  3PTZ A;  1JUN A;  2FYZ A;  4HKZ H;  4Z1M H;  5B66 H;  3HD7 C;  5AVT B;  1NHL A;  2D2C C;  5GTI H;  2NRG A;  1NTM E;  5KJ7 D;  3GLM A;  1KQL A;  3FXE A;  2M3E A;  2K9J A;  3KPE A;  3JC2 2;  2WPV B;  1LTS C;  1LT1 A;  3FGA D;  3BVH A;  2H89 C;  2WSE J;  2Q6Q A;  1GL2 A;  5CHX A;  1GU4 A;  2H43 A;  1SQP J;  4PV1 B;  2ZJS E;  1OWA A;  4RES B;  1YTZ T;  1USE A;  2XZR A;  5KTB A;  2O3J A;  3MP7 B;  2R32 A;  2WSF J;  3RK3 E;  2JKV A;  3TNU A;  4L75 A;  2Z5I A;  3CCQ P;  1CW5 A;  5AVR B;  5CJ0 A;  1FDI A;  3VMX A;  3G71 P;  2FYN C;  1AJY A;  1MFZ A;  1CI6 A;  3B5N D;  1KZU B;  2HOD A;  2KSJ A;  1LWU A;  1T2K D;  1S9K D;  1G2C B;  5TIS E;  1YTZ I;  3HTK B;  1RF1 B;  1Q90 D;  1YIT P;  1S4X A;  1JY3 P;  3SSU A;  5CCG A;  1L4A D;  5KLV G;  1VQN P;  5AVW B;  2B9B A;  3MUD A;  1ZRT E;  2Q3I A;  2O1K A;  1WMK A;  3A7O A;  4U7J A;  3WU2 E;  2E76 D;  4UB8 E;  1SLQ A;  1QVF O;  2HG5 D;  3IF4 A;  2NPS D;  1SQV D;  4LLH A;  3MGN A;  4EDF A;  2P1J A;  2QJK B;  1SQX J;  1SQB G;  2QRX A;  1N7S B;  2V7Q H;  3CI9 A;  1SVF A;  3CC2 P;  1BE3 G;  1LTB C;  3FX0 A;  1W5C E;  4UB6 H;  5KLI C;  1URQ B;  3O6Q A;  2KI7 B;  3QWO C;  1DEB A;  1ZP0 C;  2P2U A;  4JPZ B;  4ZKU A;  1T8Z A;  5AVX B;  2OTJ P;  2YO3 A;  2KLU A;  4H13 C;  1L0N G;  4GOE A;  1EZV I;  2ZYD A;  4I7Z B;  4PD4 H;  1IJD B;  2E5Y A;  3Q5S A;  1J1D B;  1WRG A;  2FYU G;  1J1E C;  4PV1 D;  4DZO A;  1FZC C;  1JMM A;  3H1L J;  1BDD A;  2BCC D;  5AW0 B;  1NTM K;  1RE4 A;  1FZF A;  1R8E A;  2KK7 A;  1FDO A;  3IN6 A;  1PP9 J;  2OTL P;  5BU8 B;  4WY4 B;  1RF0 A;  2WZ7 A;  3PLN A;  3CXH H;  1UII A;  2ZAE B;  1RQV A;  1RHZ B;  1N73 C;  2IDB A;  5CCH D;  2N1T A;  5AVU B;  3A3Y B;  4PD4 D;  3W67 A;  3NFQ A;  4JF7 A;  1K73 Q;  1J2J B;  1YJ9 P;  3H1K D;  4OGQ B;  4WVZ A;  4HB1 A;  1Z56 A;  1T2K C;  1M1J C;  1XTG B;  1KB9 H;  5APS A;  3RL0 C;  1NTK E;  2A06 D;  3HE4 A;  2IFN A;  1NU1 E;  3HD7 B;  1OVR A;  3JCU H;  1L0L J;  3CXH D;  1XTC C;  3NXS A;  2QJY B;  4N78 E;  2RKL A;  3TGU D;  5E79 E;  2FFD A;  2L91 A;  2E76 C;  1IFN A;  3V5B A;  2KS1 B;  2DW3 A;  4H0L C;  3GF3 A;  4DJG A;  1P84 H;  3H1I E;  4AYC A;  2J5U A;  2E74 B;  1URQ D;  1PGO A;  3H1J E;  1BDC A;  1KB9 D;  5H2F E;  1LGH B;  2ZYA A;  3AEA C;  2XNX A;  3NMD A;  2ZVO B;  3AEC C;  5KLV J;  2C9L Y;  1L2P A;  2AXC A;  3OW2 O;  2FYN B;  5CMZ A;  1KIL A;  3EFG A;  1FJK A;  3V6I A;  2CK3 H;  3TK1 A;  2B89 A;  2CPB A;  2OYH B;  1KYO H;  1P84 D;  3CME P;  4JYB A;  1JCC A;  1N8R Q;  4C46 A;  3M9H A;  1SQB J;  1HUC A;  1ZV8 A;  3FWL A;  4WY4 D;  1AFO A;  1VQ6 P;  1BE3 J;  2P10 A;  4LC1 A;  5KJ7 A;  1LP1 A;  1BSN A;  2H8P D;  1IK9 A;  1JY3 O;  1PGP A;  1GW3 A;  3AE9 C;  4OGQ D;  1KTM A;  2P58 A;  2HLO A;  1BCC E;  1L0N J;  2ITA A;  1KQF B;  3WUV A;  1HGZ A;  4U3F D;  5CCH C;  1S5L H;  3A5T A;  2WSC J;  1JOC A;  3L71 D;  3HD7 D;  3LID A;  4H44 C;  2FYU J;  5APQ A;  5KLI B;  1NTZ D;  4OVN F;  1GTW A;  1IFJ A;  2HPC A;  2UWJ E;  1KFN A;  2D2C D;  2YMY A;  4ZMD A;  1FZA A;  1H8A A;  3B5N A;  2BCC G;  3VMY A;  3L72 E;  2ZXE B;  3AE7 C;  1SQX K;  1NKZ B;  1GD2 E;  1HGV A;  2QM8 A;  3AE4 C;  1NOH A;  3WUT A;  3VP8 A;  5KLV E;  1NU1 K;  2WMM A;  4C7N A;  4HYT B;  1BSH A;  1L4A A;  5B5E H;  2BEQ D;  2IBZ E;  3B71 A;  1FZC B;  2OQQ A;  4KHX A;  1A02 J;  3GG2 A;  1N7S C;  5AW9 B;  4XA4 A;  2WT7 B;  1MKM A;  1LTI C;  1Y9B A;  4IFM A;  3SWK A;  1LTJ A;  1K8A Q;  3H1K G;  1S1C X;  1A02 F;  2P67 A;  5TJH A;  1NTM J;  2NPS A;  1S2E A;  2QE7 H;  3CCR P;  1ZLL A;  1N73 B;  2M5A B;  3P8C D;  2PGD A;  3VYI A;  3BRT B;  4I7Z C;  2JO1 A;  4HJG H;  5CBN A;  4IL6 E;  1GU5 A;  3H32 B;  3W68 A;  1JTH B;  1U7M A;  1J1D C;  4GOF A;  3AE8 C;  3CC7 P;  1Q82 Q;  3TGU G;  4TLF A;  1LTA C;  4PJ0 H;  1DX7 A;  3AED C;  3RL0 B;  1ZR4 A;  1LNQ A;  2A45 I;  2Y0D A;  2RH0 A;  1JNM A;  4WY4 C;  3SFE C;  4W7Y A;  3L70 E;  3E7K A;  2M3B A;  2K3R A;  1VQP P;  1KIL E;  3V2R A;  2LR2 A;  3UIA A;  3N7N A;  4D6T G;  2KB7 P;  3P32 A;  1CZQ A;  3IR9 A;  5AVS B;  3A0B E;  2OYI A; 
#chains in the Genus database with same CATH homology
 1AV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...