1AVAA

Amy2/basi protein-protein complex from barley seed
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
403
structure length
403
Chain Sequence
QVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFAKGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution.
pubmed doi rcsb
molecule tags Hydrolase inhibition
molecule keywords BARLEY ALPHA-AMYLASE 2(CV MENUET)
total genus 139
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1avaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1avaA01
5HDRA 5HNNA 5EFFA 4FLOA 2WHLA 3MU7A 2EPNA 4UNIA 2VI0A 5ABFB 2C0HA 3WFZA 3SCNA 4DUWA 1MW1A 1ZBWA 3OIHA 3AS3A 2WMHA 4FNUA 2EPOA 3G6LA 5M5DA 3W6LA 4D6FA 4FNQA 5AC4A 1E1EA 3QOKA 4UQCA 1ISVA 1UZ1A 3WUGA 4CU6A 1M01A 2QMKA 4E2OA 3SCSA 2DQXA 3ZR5A 1DP0A 4QCFA 3HU7A 3RDKA 5AC5A 4UR9A 1H2JA 5AYBA 3L2LA 4J3XA 1QOXA 4PRWA 1RPKA 2XN2A 3CO4A 3UCQA 3I3BA 1TQUA 2BY1A 3T0AA 4EANA 4GI9A 3UG5A 3VIHA 1IZKA 1UD2A 1Q6DA 2UY3A 3AFBA 4WKAA 3AZTA 1E9LA 3WQWA 3AOFA 1J0ZA 3GXMA 4NXSA 2VR4A 2WLYA 2BHZA 2V3DA 3T2QA 1DWFM 3KLKA 3T0BA 1GQKA 1JAEA 3D50A 2DSWA 3KZSA 1UG6A 4IM4A 2ZXDA 3AROA 1KXQA 1HL9A 2HISA 1QI4A 1W2PA 2OWCA 3WN6A 1BFNA 3LXBA 2EABA 2WXDM 4LGXA 3B9EA 4CD4A 1UQZA 4FLRA 4M80A 4B15A 4HU8A 1JDCA 2QPSA 1XHGA 2DIJA 2ZE0A 4B3LA 4AIOA 4HTYA 3CZJA 1ITCA 3UESA 3PZOA 1JFHA 1GORA 3DX1A 4NZJA 1HN1A 1GPFA 3UR8A 1HF6A 3NJ3A 5BXSA 1HVXA 2D24A 1NARA 1KBBA 2J77A 5D8WA 1JZ2A 2DSZA 1B31A 1QBBA 4P7QA 4PN2A 2ZUUA 1JG9A 2WK2A 1TQVA 2GJPA 3WDIA 1G0CA 4ZFMA 1KCLA 1W9VA 1VEMA 3LXCA 2YJQA 3GBEA 4F79A 2ZX5A 1MQQA 2FE0A 3DHPA 3W28A 1TUXA 4D71A 4E8DA 2CXGA 4MAZA 2WPGA 1KR0A 3AICA 4JFTA 2WZEA 3H53A 2YL6A 4OUEA 5CGMA 2WMJA 4ATWA 4UZUA 1V3KA 3AHZA 4C7GA 2QV4A 1E0WA 4HA4A 2BV9A 1JZ6A 2B31A 2ESCA 2QLYA 1JI2A 4AD4A 4CVWA 2GJRA 2JEQA 3CZSA 3VKKA 3ARUA 1NOUA 1JZ5A 4PSPA 4KRUA 4H7VA 1GQIA 3MI6A 3VGBA 3ECQA 1SR0A 3KL3A 2A3EA 4IPLA 4KH2A 1R87A 5EMYA 5JUVA 5JIPA 3MSGA 1GOWA 2WCGA 1W1YA 1RP9A 1VAHA 4AMCA 5E0FA 1RD6A 1M04A 3SUSA 2AOSA 4D72A 2V5DA 4R27A 4AZIA 3AI0A 1HJUA 3AIUA 4D6CA 5AYIA 3AMCA 1XCXA 3AS1A 3ZT7A 1EQPA 2PWDA 3NDZA 3BMWA 3ZSTA 1KGXA 4GPNA 5A95A 2DSVA 5LYRA 1V3MA 1XH2A 4JFSA 1QW8A 2DDXA 2YFOA 1KWGA 4JAWA 3QHNA 2VT0A 3THDA 4EKJA 3VD4A 5DT7A 4U5IA 4UFKA 1TCMA 3ARVA 5DEZA 4GKLA 1NOWA 3BUQA 2G4FA 1C8YA 2F7PA 4P7NA 4F9JA 1BGAA 4DO5A 4OJYA 1EA9C 1PX3A 1UR9A 3VOCA 1QI5A 5I79A 4QFUA 2XVPA 4OOZA 1TQTA 4CD6A 1CGTA 1R47A 4MDOA 1SMAA 1LG2A 2E9LA 1PIFA 1HJXA 4HZ6A 2E9BA 4UZSA 3PZMA 1ZB5A 1V3IA 3M46A 4C7FA 3AIQA 2A3CA 1ESWA 1WDSA 4PMNA 3PZGA 3OLGA 3CHFA 1WZAA 1TA3B 1CXEA 3WH6A 1X1NA 1UR8A 1QNSA 9CGTA 2GUYA 3BCFA 5CG0A 4N0RA 2VCBA 2YL8A 4OKDA 1LWHA 3AIRA 1JZ3A 2G3MA 4X0VA 1ZJAA 1E71M 1BF2A 1FH7A 2GJXA 3GXIA 2BHYA 5I23A 5M03A 4DWSA 1HWWA 4AY1A 2BXYA 4JL2A 1JGIA 1NWUA 3VU2A 5GPRA 1V6WA 2CPUA 1GCYA 1EGZA 3S5ZA 4PSRA 2XIIA 3PZTA 1CPUA 3IAPA 1OGBA 3WQVA 4FNPA 3H55A 1GOKA 4TTUA 4PMOA 4AW7A 4BQ3A 3WQ5A 3A47A 4UFLA 1ODUA 4KWUA 3PTMA 4GZIA 5LA1A 1MYRA 3TTOA 1E3XA 1KXHA 5DF0A 4XZWA 1H5VA 1OBAA 1CECA 1GONA 5IDIA 2WW5A 3CZKA 1UWTA 2VRJA 3WNPA 4IUGA 5CXPA 1ITXA 1NWRA 1H1NA 3ZSSA 2VOTA 4JHZA 3OGSA 1GVIA 1HXJA 2CYGA 4ACYA 3WY4A 4AEEA 2GSJA 5E0CA 2FGZA 4CGTA 2YL9A 5FD0A 3U7BA 3ZM8A 5A6BA 4B16A 1UD3A 3W25A 5CSUA 3G6MA 3EDKA 4YN5A 1FHDA 4HOZA 4MJ4A 1HP5A 3VD5A 4CU7A 1Z32X 1AQ0A 2E8ZA 1S46A 1W3JA 5CQ1A 5D9NA 2NT1A 3ZIZA 3VD9A 1VFOA 1UD5A 1X6LA 1JDDA 3AMKA 5GNZA 2ZXAA 2J47A 3TP4A 3ZJKA 1AVAA 3S5YA 5E09A 1QI2A 3CHEA 1U33A 1OD8A 1ECEA 1U30A 1FA2A 1B90A 2V3EA 4AXNA 2J8FA 1V3HA 3II1A 4W87A 4QP0A 2WMFA 1UWUA 2G8ZA 1KXTA 4JCMA 1WAWA 3PZUA 1KWKA 1J11A 3SURA 2XVNA 4M82A 5LA2A 3UR7A 4IPNB 4J3UA 4L4OA 4F9DA 4W8LA 3K4AA 1J18A 5CZKA 2WSKA 1QW9A 2EBNA 3MKKA 1FH9A 3WNOA 1Q6CA 1ZBKA 5BXPA 3PBGA 3EJSA 3SCPA 1E6NA 1E56A 1VEOA 4CD8A 2VTFA 3CBWA 1HT6A 1MFUA 1OD0A 1MVYA 5ABGA 4TTGA 4M24A 2Y4SA 3L4TA 3DX0A 1L0PA 2VJXA 4W8BA 1EIBA 3BAWA 3GXPA 1DWJM 2ZX8A 4AYSA 3POHA 3VIGA 1GHRA 5I6SA 2GVYA 2J25A 1DWIM 3VIFA 2IXVA 2YBTA 3UERA 4P8XA 5HBFA 4TVUA 1M03A 1DWAM 1J0IA 4EE9A 1UR2A 1CLVA 1BYCA 3KL0A 5C70A 2E4TA 4MJ2A 1W1TA 2XVLA 1ISWA 1QI0A 2A3BA 1V02E 3RIKA 1K9EA 2CNCA 3OZOA 3T2OA 2ZWYA 4MPKA 3W38A 2BNJA 3T2PA 2E40A 4DWSC 1CGWA 4LYRA 5GQBA 3D4ZA 4HP5A 3VSUA 5E1QA 4PMUA 5ECUA 3VD7A 3WDHA 4PMVA 1H09A 2O9TA 1VEPA 2Y24A 3EJQA 2DGAA 1UWQA 3K46A 2ZICA 2BY2A 4HOXA 1E6XM 5FL0A 4GXPA 2D2OA 1UKSA 2EAEA 3A23A 1H3GA 4TX8A 4QAWA 1QNRA 5EBAA 3MUAA 2W61A 1R7AA 3FXYA 4XX6A 1JZ4A 1WPCA 3L4ZA 5E6ZA 1CIUA 2Y8KA 5C8BB 4GZEA 5IXEA 1XSIA 4NXKA 1NWTA 2VUYA 1GNXA 4W86A 2WAGA 3CIVA 3WD0A 2XFRA 1HIZA 4OZOA 3APGA 1NOFA 4A4AA 2J74A 3RO8A 4D6DA 2WVSA 1WDRA 3AZRA 3J7HA 2Y5EA 2YIHA 4GQRA 4MNKA 3BUBA 3IJ8A 1GVYA 2VO5A 3GXFA 3WEZA 4W7VA 1ISZA 1CGUA 3BCDA 2EPKX 3ZT6A 2FHBA 3VDBA 2Q8XA 1R85A 2OSYA 2WC3A 1FP8A 1QWUA 2BHUA 1CTNA 3BGAA 1SMDA 3SUUA 2CETA 3DYPA 3AHVA 1I1XA 1E15A 3WEMA 2J7FA 5DFAA 4QLKA 3WD2A 3ARSA 8A3HA 1N82A 2FGLA 2XGIA 2WMIA 3AS2A 3A6OA 1UHVA 4JIEA 1J12A 1BG9A 3KEHA 1RH9A 4ATDA 2VQUA 1HL8A 3CHCA 1PPIA 2ZXBA 4PMQA 2WCAA 3LPFA 4AYGA 3T09A 3DYMA 3ZJ7A 1JL8A 3WKZA 4WKHA 4MNMA 4H8HA 2W4XA 1O6IA 3IANA 4M29A 5BROA 2WHJA 3WQ4A 4RL3A 2BFGA 4Z2GA 2X8RA 1W1PA 5BWFA 2DEPA 1UH3A 1HX0A 1VIWA 4GINA 3HJEA 1UKOA 4KGJA 4AZ5A 1NWSA 5DMYA 2QHAA 1DEDA 3MUZ1 1A3HA 1JAKA 1XSJA 3RILA 4W5UA 3CUGA 2YFNA 3ZR6A 2BXZA 2G3IA 3ZMRA 3D4YA 3AIBA 4Q22A 2WBKA 4XZBA 4HMDA 1W2VA 2WVVB 1OGGA 1ZS2A 5IFPA 2JIEA 2X0YA 3CPUA 3A3HA 5BCAA 3AHTA 3GNPA 1GQJA 3EDFA 3BC9A 1HKKA 4W85A 1W1VA 1WDQA 4YHGA 4AZGA 1US2A 3VX0A 2J7EA 1CYGA 4JHOA 2J7CA 3VO0A 3AISA 3WENA 3K8MA 4GI6A 4M81A 5D9OA 4C7DA 4K68A 1MWOA 3U5UA 3EBVA 4BA0A 5A8MA 1UUQA 1PEZA 4CCDA 4JZ5A 1TQSA 1JDAA 2DPEA 3GM8A 3BH4A 1UKQA 2PBGA 4LX4A 3NDYA 1F4AA 1WP6A 3NSNA 4PMXA 1J0HA 3DDGA 3AYRA 2PWFA 2FH8A 5IHRA 2CKSA 3FY1A 4D6GA 1V6UA 4J3SA 4J28A 1J0KA 1QNPA 3ZOAA 3WMBA 3DX4A 2XG9A 1W9DM 3ALFA 3BSGA 3AMDA 2W67A 1H41A 3CUFA 2OWXA 4M56A 3OZPA 2XYLA 5A2BA 3OB8A 2WSPA 1GOIA 3UG4A 2J4GA 2WWDA 1B3ZA 1B0IA 3ARWA 3CZEA 2JE8A 3WH8A 4U3AA 2OYKA 3WF4A 4AD5A 1JI1A 1R75A 2CBJA 1K9TA 3IGUA 2YDQA 3WL0A 2D22A 3W81A 1MXDA 4W5ZA 1W9BM 4PMDA 3WDPP 3CZNA 4P8UA 4PCTA 1LL7A 2JEPA 2O9PA 3LRMA 1TE1A 2A3AA 2XJ7A 2YOCA 4ACZA 3SIMA 3VUPA 4WKFA 4AWEA 3TONA 2VVNA 1LL4A 1JF6A 5I2UA 2D1ZA 1HKMA 2GK1A 3W0KA 2XM2A 3BVUA 6CGTA 2CBVA 1BHGA 1C93A 2TAAA 1R33A 2DT2A 3WDQA 2PB1A 4UQBA 1VENA 3NUKA 3GXTA 4AISA 3FW6A 1UD4A 3D51A 1CNVA 3W4RA 1FFRA 2VC9A 1TR1A 4Z2LA 1VF8A 2X05A 1CGVA 2VMFA 5JIWA 3L4YA 1AMYA 3SCTA 1E6RA 3ARRA 2WANA 3NSMA 4AZCB 3W53A 3DX2A 1QVBA 2X1IA 3WD3A 1BLIA 3CMJA 1DWGM 1UWIA 2F7QA 2IGTA 4GO8A 5A6AA 2WVUA 1E1FA 1UQYA 5HOSA 4YHEA 4FNSA 1P6WA 2WKLA 1MXGA 1NH6A 4EK7A 5CJ5A 3L4VA 1C7TA 2V3GA 8CGTA 3PTQA 4CCCA 3HG3A 3LRKA 3WNKA 1C8XA 3BAYA 1H49A 1KTBA 4J3WA 1Q6EA 1C92A 2CCRA 4CN4A 3AXXA 1CXKA 4V28A 3DYOA 1MQPA 1EDTA 3MO4A 2WM0A 3DECA 5ABFA 3ALGA 1BAGA 3IJ7A 3AIVA 3ARTA 3SEPA 1KCKA 2PC8A 3WH7A 3VGHA 3F5JA 3N17A 1UASA 3VIKA 1B3XA 1OT2A 1BG4A 4RE2A 3VIMA 1HTYA 1H0IA 2XN0A 4AD3A 1R86A 1UR4A 1TMQA 3DHUA 4QDMA 4UQ9A 1JNDA 4URIA 2D73A 5AY7A 1GQLA 1R7OA 1GOOA 2JF7A 3ARXA 4AIUA 1EH9A 3UEQA 3AS0A 3AZSA 4U33A 3VNZA 2NSXA 4LYQA 2YL5A 3A5VA 4XUYA 1E4NA 3F5KA 3AHYA 3WF2A 1JYNA 3OGRA 3CMGA 3GYCA 4OBSA 1E70M 4AZ6A 5LA0A 1HVQA 3LX9A 3MV01 1A47A 4JFVA 2XN1A 3WD4A 4PTMA 2FYVA 3UETA 4Z2KA 4KMQA 3ZO9A 4FNRA 3WNNA 2XVKA 1JXJA 2DSUA 2D0GA 4AD2A 2XWDA 5I78A 4D1IA 3WH5A 2CHNA 1E0XA 3FNDA 1BPLB 3L4UA 1JYWA 3WQ6A 1KXVA 3FHAA 3W6MA 4E8CA 5A6LA 1ISXA 3O2LA 1KFWA 2CEQA 4HPHA 2PWGA 2BVTA 4OIFA 3CUHA 4TOQA 4U31A 2QMJA 4CN1A 2W62A 3RPMA 5JBDA 4UQEA 2D3NA 1HNYA 2YA0A 3TOPA 1B3VA 2F18A 1XH0A 1OB0A 1V6VA 3MUIA 1C8QA 3VMNA 3CGTA 2CBIA 2YLLA 1JYXA 3A22A 3VPLA 3LXAA 3BVTA 2X2IA 3VILA 3GXNA 1JFXA 4D1JA 3CZGA 5A8PA 3I3EA 3AQUA 5FKYA 4WSKA 1XYFA 5ABHA 4H8VA 3D5HA 3N04A 1TVNA 2A3HA 1J9YA 3OA5A 1O7DC 2F7OA 3RJXA 2X2YA 2XSBA 3U7VA 4WF7A 3ARZA 2EJ1A 5DO8A 4XV0A 4PTWA 3VTRA 4FK9A 2GK1B 4AIEA 1GW1A 4AD1A 2UY5A 2UY4A 2D3LA 4FLSA 4PTXA 4GIAA 5BRPA 2J7HA 2WMIB 5FCZA 3HG2A 4FMVA 4HZ8A 2WVVA 1LJYA 3EMCA 3S2CA 3VX1A 1LG1A 2F1AA 4NF7A 3PTKA 3AXIA 3FAWA 5E6YA 5CLWA 4U2YA 1H0GA 1VBRA 1FP9A 1E40A 3THCA 3BUIA 1EDGA 3EDJA 1V0KA 1JD9A 3BLPX 3HN3A 1HJWA 4DO4A 5E70A 3O9NA 3WELA 1WB0A 2BVDA 1NM9A 4AZHA 4IISA 1KB3A 3VGEA 2IUZA 5A8NA 3A4WA 3FN9A 1WO2A 4TVDA 4D6JA 3TTYA 4CCEA 3CZLA 4ATLA 1U2YA 2UY2A 3AHXA 1VJSA 3RJYA 1LF1A 5A2CA 2WHMA 1ZU8A 2DH3A 4PCSA 3L4WA 3MMUA 1M53A 1OCQA 1XV8A 1Q4NX 2J7BA 3MUY1 4WSJA 2D20A 3ARPA 4CU8A 5D9PA 3WEOA 3GH4A 3GH7A 3GH5A 3WNLA 5HPOA 1HKIA 3K1DA 1EQCA 1UD6A 3CV5A 4KRTA 3WFLA 5A94A 4S3KA 4MADA 4Q7NA 3LPOA 3LPPA 2XSAA 3SCWA 2OYMA 1VFUA 2X0HA 1GJWA 3BAJA 4PBGA 5BXRA 1DTUA 1W9PA 4MB4A 3WSUA 4CD5A 1MQRA 1CXHA 3RM9A 2ZUTA 1W3LA 1OINA 2XFFA 5D4YA 2GFTA 2WYSA 3PZNA 1V3JA 1CEOA 3WUFA 1PX4A 2W91A 2WWCA 4H2CA 3UG3A 1AQMA 1V6YA 2VX6A 4MNLA 4AEFA 4OBRA 5A8QA 4DWSD 3EDEA 4W7WA 1XGZA 1D2KA 2WC4A 2VQTA 2V5CA 1NP0A 1QHOA 4KGLA 4LPCA 3VNYA 1V0NA 1CDGA 4JFUA 3WBAA 3NSXA 4W93A 2YA2A 1UWRA 2F8QA 3WMSA 3BSHA 3VM5A 4CKQA 2PWHA 2W5FA 3VIIA 4DM2A 3F5LA 1EDQA 4LYPA 4QLJA 5IFTA 3BLKA 2Z1SA 2IXUA 2XIBA 1MW3A 1WNOA 4JKKA 4D6HA 1T0OA 3W26A 3SUWA 4CUCA 5JBEA 4HOWA 2XFYA 1NP2A 3NIYA 4OOUA 2EADA 3BVXA 3GBDA 4NI3A 1D3CA 2Y2WA 3EYPA 4MTVA 4DM1A 1XH1A 5BYWA 1V6XA 3EJPA 3PZ9A 3W82A 3FHQA 2G3JA 2YBUA 1V0MA 2WZHA 5IHSA 1KGUA 3S6TA 3QR3A 1X6NA 2HVMA 4N42A 2V3FA 1K6AA 1W3HA 1C90A 2ZUWA 1RP8A 1LLOA 2QF8A 1V08A 2JFEX 2VX4A 5BXTA 2PBOA 1H11A 3OLEA 2VL4A 3F4VA 3SCVA 1KGWA 3WF0A 1YQ2A 4UOZA 1BYAA 4V2XA 2J7DA 1QHZA 5A8OA 1CXLA 1E3ZA 3PZIA 2FDMA 1C7SA 1WDPA 1TVPA 2FHCA 1E4IA 2O9RA 3GNRA 1CGXA 3PZQA 2WMGA 1KBKA 3A24A 2F61A 3WUEA 1OIMA 4RE4A 4S3JA 3K8LA 1OT1A 1PZ3A 1BTCA 5C71A 3WUBA 3A4XA 4D6EA 1VFMA 3B9AA 4GQQA 7CGTA 1QNQA 1IV8A 1R8LA 2F2HA 1VFFA 4WK9A 3ZQ9A 2CERA 2XHYA 5EB8A 1F4HA 4BQ5A 5I0DA 1HP4A 2OW6A 1UKPA 2FHFA 3NYDA 3HMCA 2QPUA 4BQ2A 1GOQA 1O7AA 4ZXOA 3T0DA 2GJXB 5A3HA 2ZIDA 3VVGA 3VMOA 1BYBA 4ZE5A 3VD3A 3WY2A 3QHOA 3SCUA 3PN8A 3WDRA 1MW2A 4U5KA 3OLIA 1DHKA 3O6AA 1UA3A 2WVTA 3HZ3A 2VX7A 4PUEA 2OWWA 1G5AA 3NCOA 2ZXQA 3KE0A 3M07A 3FAXA 4H41A 1WZMA 1L8NA 4UTFA 3DC0A 3WBEA 3U5YA 4P8VA 4NSBA 7TAAA 1W9XA 3M7SA 4NZCA 2PI6A 4ZENA 2PWEA 1R34A 6TAAA 3VDCA 4U3CA 3WL1A 1PJ9A 2C8NA 3BAKA 2WMKA 5CPSA 3E1F1 3L2MA 2ALWA 1UYQA 4X0NA 3RCNA 4WLCA 3A4AA 2JALA 1M7XA 1W91A 3ZJ6A 1EHAA 5CPQA 3GNOA 1HJSA 4AZCA 3EJTA 2J75A 2J79A 2OSXA 4ZE4A 4X9YA 2MANA 5M17A 1XCWA 2XUCA 4LXFA 1VB9A 1KTCA 1JNEA 1LL6A 1BSIA 5JBFA 2GDUA 3RMEA 5A69A 1E6SM 2D0FA 2WHKA 1OGSA 4MB3A 4AZ7A 1UA7A 3CTTA 3N18A 2E3ZA 3ZT5A 4Z2IA 4DUXA 3TTQA 3VDHA 5ABEA 1GHSA 3VINA 4NX0A 1E5JA 2WB5A 5D8ZA 1GOMA 3HG5A 4V27A 2WCSA 3VGGA 1HJQA 5HPCA 4JKLA 1E6QM 1US3A 5M3WA 4HZ7A 2W92A 1ZJBA 3CUIA 2BVYA 2YDRA 2OSWA 4MB5A 2VRKA 4ACZB 3BXWA 3BVVA 2ZUNA 1LQ0A 2VRQA 1PS3A 3BUPA 5CLTA 3WF1A 1XSKA 2JF6A 3IJ9A 5CGTA 5TD4A 4AMXA 5I3DA 1CLXA 1BVNP 4P7RA 1E55A 2EXOA 1W9UA 5A1AA 2VVSA 3N12A 3AIEA 4AC1X 4UQAA 4WIWA 1MW0A 2GDVA 5EFDA 1XD1A 3QHMA 4JKMA 2W63A 2YLAA 3IAQA 2G3NA 4LQ1A 3ARYA 1QHPA 1C91A 2X09A 3MMDA 3AMGA 2DIEA 1LWJA 4NRSA 1TZ7A 1AQHA 1BVZA 2V38A 3I3DA 4AZBA 4Y7EA 3VSTA 1JZ8A 4P7OA 2EO7A 1UR1A 1JYVA 4FNTA 2F1BA 3GTNA 4B9YA 2CIPA 3M6DA 4P8WA 1ISYA 1DWHM 3WDJA 1BYDA 3EJUA 4GO9A 2BY3A 2WBGA 1CZ1A 5GNYA 1PX8A 2VNCA 1E5NA 4TX6A 3AJ7A 1ZBCA 1HJVA 5HXMA 4CVUA 2CESA 2WKGA 3GDBA 3IK2A 4OGZA 1W32A 1KQZA 2ZX6A 1GUVA 1XYZA 1E4MM 1VRXA 4AMWA 2J8GA 2XVGA 2VZOA 5A6KA 2BY0A 3MANA 3AXHA 4XB3A 4TUFA 1Q6GA 3K4DA 2XWEA 3EDDA 3BAIA 3W29A 4GI8A 4J27A 1WCGA 3AMLA 3KWXA 2G41A 2AAAA 2XM1A 3OGVA 4HU0A 2NW0A 5BRQA 2NT0A 1E73M 4PYSA 5A6BD 3W24A 4TVCA 3N15A 5A6SA 4GZJA 4P7LA 1CWYA 3N1AA 1XRVA 3RM4A 3ZJ8A 3B8SA 3D3AA 4F8XA 1OSEA 1TFVA 2XGBA 1TA3A 1JD7A 1WZKA 4J3TA 4HMCA 2E9MA 2EACA 5GNXA 3WD1A 4DUVA 3W37A 4D6IA 3N13A 3EJRA 4B3KA 4R5EA 3A21A 1XC6A 1Y7VA 2RGMA 3VDAA 1WE5A 3BAXA 1K9DA 2YA1A 1SZNA 3SCRA 4MNJA 4HA1A 4J7RA 1K9FA 2ZUSA 1I1WA 4Z2HA 4MDPA 5KZ6A 1BQCA 4TXEA 1EO5A 3MS8A 3CUJA 7A3HA 1IZJA 4HMEA 5D9MA 3K8KA 2ZOXA 5A2AA 1WKYA 1J10A 3JUGA 1YHTA 1GJUA 1ODZA 3CC1A 2VZSA 1G1YA 2Y8VA 3SUTA 3EMZA 1E43A 4AD0A 5KEZA 2J7GA 1WZLA 1ZBVA 2O92A 1D7FA 3MSDA 1JXKA 1EOMA 4HPGA 3OG2A 1UOKA 3D52A 3LPGA 2VZVA 2AMGA 2VX5A 2CBUA 3PHAA 2C7FA 2X2JA 2DT0A 2O9OA 3VIOA 1EOKA 4MB1A 4W84A 2VCAA 3L4XA 2EPMX 4W89A 4UQDA 4WJXA 1QX1A 4JL1A 3T08A 1HKJA 4QLLA 3W27A 2D23A 2EPLX 2UWFA 1H4PA 1B9ZA 3CHDA 1QPKA 1V02A 3OBAA 1JF5A 1Q6FA 4J3VA 4MAVA 2E8YA 1J01A 3VIJA 1MFVA 1XD0A 4BZYA 1CXIA 1OWQA 2OYLA 4UFHA 1PBGA 3WY1A 2XTKA 2YDSA 3AYSA 1FOBA 4M8UA 4UOJA 2EQDA 2WLZA 2WC7A 1JIBA 2YKKA 4W7UA 4PUDA 2BS9A 1EHNA 3OLDA 4E4PA 2W66A 3WH9A 2ZX9A 3HG4A 2ZUVA 1QNOA 3VIPA 1VBUA 2VURA 1CGYA 1G94A 3ARQA 3QOMA 1UH4A 2OLHA 4JFWA 1TG7A 4QCEA 1V0LA 5DT5A 2CHOA 2DSKA 4BF7A 2RGLA 3VSVA 4UFJA 2EEXA 1CENA 1EO7A 1UWSA 1I75A 2FH6A 1B2YA 4UOQA 3DDFA 2Z1KA 3GXDA 2J62A 5A6JA 1E6PA 4H8UA 3SUVA 1G9HA 2F7RA 5FIPA 1UKTA 1E72M 2XPKA 3BLBA 4CD7A 2VCCA 3BVWA 1BGGA 3DX3A 1ZL1A 1FFQA 4UCFA 1FH8A 1QBAA 4DO6A 5A6MA 4BS0A 2ZX7A 3POCA 1J0YA 1KQYA 4A3YA 1EXPA 3AIWA 4BCEA 2E0PA 2J78A 1NQ6A 2PF0A 3VGDA 1PIGA 4ML4A 1SFSA 1B30A 1UH2A 5FL1A 4RE3A 2CITA 3WY3A 1VJZA 3SCQA 3TV8A 5FOOA 4PMZA 2D0HA 3H54A 3TA9A 4FF5A 4PMRA 4UFMA 1UR0A 2DT3A 3U57A 3VGFA 3LMYA 3LRLA 4Z2JA 1GZJA 1R46A 2JIWA 1CXFA 1OIFA 3BUDA 4B9ZA 1E6ZA 4YPJA 2OW7A 1E4LA 1UD8A 2ZWZA 4W88A 3MMWA 4UFIA 4W8AA 3VM7A 4A3HA 4L4PA 3RM8A 2VZTA 3EMQA 4NRRA 4JCLA 3MV11 4ZXLA 1W3KA 1QI3A 3KL5A 3SCOA 1TQWA 4DWSB 3BMVA 4U2ZA 2X2HA 4H04A 4PMYA 4NZFA 1OM0A 3GZAA 3N11A 1B3YA 3CZ8A 5E9AA 3CH9A 1SYTA 3WF3A 4CN6A 3B9DA 5CSYA 2VZUA 4M1RA 4HA3A 3PZVA 1CBGA 5F7UA 3WNMA 1KR1A 4PEEA 3WMCA 1PZ2A 4F66A 1HXKA 3QGVA 5I5RA 5I77A 1C3FA 1FHLA 2WNWA 2DT1A 3CLWA 3TTSA 1B3WA 1QWNA 5I24A 1PAMA 5CPTA 2VR5A 4FLQA 4ZEPA 1B1YA 1E0VA 3WIJA 1J0JA 2WZIA 3KLLA 4EAMA 3N9KA 2CKRA 4BQ4A 3VMPA 4PTVA 3WQ8A 1JZ7A 6A3HA 1V3LA 2DH2A 1IT0A 2ZUMA 1V03A 1G01A 1UZ4A
chains in the Genus database with same CATH superfamily
3DKHA 3T4WA 5BXFA 2WBJC 3LD8C 6REQA 4Z3GA 1A14L 1G7IB 1JZFA 1MJJB 3DG6A 3USBA 4A6GA 3SCNA 3OR7B 4P3CH 5FW7A 1XF5B 5EMUA 1CJYA 4HS8L 3TL5A 2NPLX 3L9EA 1QXLA 3BKJL 2DUZA 4OE7A 4ODHL 3OIHA 2DQ6A 5LCVH 2VP8A 3CV1A 2ED6A 2HFTA 4K6AA 1XYCA 4CNUA 2EPOA 4GE8A 1KN4H 2CK0H 4PV8A 4JZNA 4F57L 1Q3NA 1FIGL 2ZOKB 5FYKH 4RUBA 2QPXA 5IB1A 4JD4A 1ZD6A 4CGUB 3B6SA 4F37F 4QKXB 4M51A 4CU6A 4H6RA 1M01A 3JSSA 2P88A 1QKZL 3QY8A 3II3A 4Y96A 2A9MH 1XGPB 2XFWA 4CBZA 2AGJH 2ISSA 4DLMA 5AHEA 1U4EA 4EP8C 4DP5X 1FFPB 1Z9MA 3W9DB 3MQTA 1ECYA 35C8H 4LCQA 4H1LA 4LSQH 5AYBA 1QOXA 3IT8D 3US9A 2FD6H 3FH5A 5FEBA 5D2VA 2HPIA 2TSAA 5E99H 1EJ6A 2HFGH 1H3TA 1G7MA 4HN4A 5C1MB 3OSVA 3OVPA 3NIFF 2XKNA 3T0VA 3PAJA 3VIHA 3GDKA 1UD2A 4JDVA 3STZA 2P24A 2FGBA 2NY3C 3TBTB 4YYFA 1EEZB 5C0AD 1SMOA 2H3XC 3KYKH 1IAKA 1E9LA 1JHLL 3WQWA 1U4FA 3Q06A 2W07A 4NXSA 2VR4A 2WLYA 1RJZA 4WFHE 2F53A 4XWOC 5BQ7A 4ZGYA 1JOIA 1GQKA 3X11A 1JAEA 3W1NA 1R3LB 1X5GA 5BJTA 3MHZA 4JPSA 3REVB 3C2SA 4HCDA 1QI4A 1T83C 2DI9A 2UYLB 1JPGB 3QEQA 1IEIA 2FYYA 1W2PA 5D2NB 4OLWH 3GSOB 4NRZA 1U3HD 1XF3B 3HLAA 4G3YL 4RZKA 4RMVA 1HAUA 5DJ8A 1HL5A 5LG6A 2YQBA 1S1RA 4FXSA 5HHMD 3MTWA 4LGXA 2OEKA 4DWDA 1HXMB 4FQ2L 2EIBA 4CD4A 3W71A 2AF2A 4L3EB 3U9UB 4FL4B 1LDPL 1H1ZA 4JRXA 4HUWB 4A21A 1JWMB 4L4VB 1TPEA 1PKNA 1XHGA 1J2BA 3L1GA 2EG6A 2XWTA 1S9YB 2XH7A 1KELL 3WYZA 4BQ9A 4IOIA 2ITDB 1HXMA 1IXNA 2VQ1B 1FJ1B 4M6UA 3PQYA 3V4VH 5HSFA 3UYRL 4XCYA 3CZJA 4AIOA 4HTYA 1BGXH 5GSVA 4OQTA 4DWHA 3UO8B 1GORA 3QDME 4JEJA 5B3JF 1A80A 1FKWA 1LP9F 1GPFA 2VFHA 3K72B 2I24N 1HVXA 3CLFL 1VBJA 4AIXA 1GZPB 2GVJA 1DVTA 3E74A 3W6YA 1IARB 1KBBA 4L8SC 1NMBH 4NJ9L 3MLUH 1KDJA 3VC6A 3MPGA 1BVOA 2DSZA 4Q3MA 2PTXA 1B31A 4HJTA 2EKSB 4HPXA 2ATMA 2YQGA 1Y18A 3RVWC 1JCJA 4PN2A 3PV6A 3P11H 2Y7SA 2WN2A 3F7VB 2I56A 1LP9B 1OYAA 3EF4A 4NO2B 3VG0H 3QEQD 1UMLA 2IS7A 4FX7A 5DEGA 4XAPA 1YUHB 3W74A 1S3RA 3GBEA 4JGJA 4F79A 1WIPA 3I6LD 4A37A 2Y8UA 2FLIA 3GU9A 3MRHA 4AVHA 2XWXA 4WU7A 3DBNA 3H6OA 3BJLA 3FBQA 1UM5L 3W11D 1LOSA 5K1VA 5I1DB 1EJOH 4POCA 3TVMA 2E68A 2JIXA 1HU8A 5T3ZD 4M6VA 5HJXA 2ORBL 4H26A 3W28A 1HSBB 4W9HC 3PNRB 4OQVA 5L9DL 3UA4A 4E8DA 1PLGH 2LU7A 4L1WA 2MNWA 3ZY7A 1C5BH 3QDGE 3RVTC 5JMRA 4Q4OA 1REQA 3AICA 3IU4L 3OKNA 3INUL 2WZEA 3CBKB 3SGDH 2VMJA 5ESAB 1L7TL 2ZUQC 4ROPA 2XBDA 3MACH 5DHYB 4HVBA 1NAL1 43CAB 4K8RH 2LE9A 3T40A 4ZTOL 2CIKB 4J1UA 5ERWB 4BQCA 1QR1B 1YQVH 4YLCA 1OGAB 2BV9A 2BO0A 1K3UA 2B31A 2PRMA 1OADA 1AYOA 2CXEA 2VLRA 4Z76B 1U8QA 1C5CL 2A73A 2CNYA 1MHCB 3HI6L 2YCKX 4AK1A 3AGWA 4JM2C 4OCRL 5KZMA 1C08A 1BZ8A 4UQ2A 5ENWB 1DBBL 4E0RB 3VKKA 5ABDE 4GRLA 4LE8A 4LCCB 3LK6A 4PGDA 4TOYL 1JWSB 4PSPA 3Q3GA 3QMRA 3TA6A 1DJQA 3FSAA 3PP3H 5DLMH 1PYWA 3NFSH 2ZNWA 4X9HA 3ECQA 4ZMOA 1GQIA 3CIQA 3ITTA 4KH2A 4IPLA 5GIRA 4LBSA 5E4EB 3F7VA 3IGHX 1HH6A 3QC0A 1ZANL 1N4XH 4GAJH 4LVNB 4Z5RA 1GOWA 1XLIA 4NJAL 3HZMA 5FM4A 2AMUA 2YB4A 4ZMWA 2A73B 4Z8FH 5BS0B 1ES0B 4KZ0A 2JGYA 3VXNB 2HCZX 3CUXA 2ZAIA 3MYZA 3RZCC 1MUWA 3KPMB 2ZWLT 4MD5B 2OJZL 4OLYH 5CU5A 2H32A 3AI0A 4OD2B 1C9WA 3N4EA 1U92A 5DJDB 3PFUA 2PR4L 1FYTD 4ZOEA 5LHDA 3AMCA 1XCXA 3C86A 3GMPA 3AS1A 3ZT7A 2GSGB 2JJTC 4M1DL 4XKMA 3BMWA 3GK8L 5DZLA 2J88A 3UZQB 1H7PA 3VSQA 1AD9B 1KNWA 5A95A 1MUJB 1O6TA 3WK3A 1XH2A 4AM0B 5C7ZA 3RWDA 2XN9D 1A6ZB 2P5WB 2WINA 4HHAB 4HU4A 3H3PH 3BPOB 3SCMB 4M6AA 5I1HH 2HRWA 3RTQC 3X13A 2EUVA 3SODB 5C7HA 2LVEA 3RKDD 4G7FA 4MNGE 2FPVA 5F6IC 1A22B 1NLBH 2XN9E 4EKJA 4YBLC 3M0XA 3ZTJG 3DMMA 3NDOA 3ZKNC 4JM4L 3I10A 4ZFGH 4TPRL 2F84A 2HLFD 5DEZA 5FGRA 1G7PB 3PR2A 3G1DA 1CF8H 1L7IH 3G6DL 5F6IB 3TIMA 3WTVA 2B7QA 4UTUA 2Z31D 5B7YA 2F7PA 5DZOA 5KSUB 2UXFA 3ECVA 1YEFL 4M03A 3DTDA 5C0BA 4K37A 3B0PA 1INEL 3AVEA 1X8FA 3X3GH 3CXDL 1AODA 1B4KA 5IW6A 1UR9A 5I79A 4ZXBC 3CK5A 4L4TA 2EO9A 2X1WL 3BLOA 1TQTA 4K3JL 3QNFA 1NGWB 4M5YL 4TSBH 1R47A 3QIBA 1Z42A 2APVA 2XWJB 4MJJA 4N9CA 4I1NB 4PUKA 1LG2A 2ALDA 2ZKYA 4Q74A 4WWKB 4HZ6A 1N10A 4XP5H 3LSBA 2ZZUT 1HKFA 3T78A 3GBML 2JCCB 1FFNB 1CD1A 1K6QL 2FZ3B 3Q1EA 4MAUL 3UJJH 3W2DH 3MRLB 1ESWA 4HYRA 1OCJA 1HINL 5KTEH 1VGEL 4KKAD 3R8GA 4MXVE 3ITCA 3F64A 2V9QA 4FTVA 1WEJH 1ZK9A 1JPGA 3QEQB 1KG0B 2ITCB 5LIYX 1KV8A 2VLLB 3WH6A 1DV7A 4JRYB 4ISVB 3HV9A 3M64A 3MBWB 2VGFA 5HULA 4JFOB 4XOAA 1WS8A 1HC1A 2DQEH 3PJLA 1EPXA 5F1NB 4PZVA 4KQ3L 3AC0A 1OAKL 3HA1A 2G5BA 4XZUB 4DVBA 4PRID 3SPCA 3AIRA 4QSHA 4JIIX 4C91A 1FVEB 1FH5H 3F05A 4U3XA 3Q3GB 3TBYA 1BF2A 2YWYA 5DCDA 1J9SA 1RKRA 1QBLH 2XTJC 5DJAB 3UBXA 5C9XA 2BHYA 2IMMA 5IB5A 4Z77B 2VXTL 1HWWA 5IHZA 1TJMA 3T0EE 4KFPA 3O8AA 3CYVA 2E9GA 3TWYA 3BW3A 1E5YA 1RUMH 1N8ZB 2IMNA 5KVDL 4IMGA 4HHGA 2DJLA 3BJTA 1XGUB 4XZHA 4ZSOB 3TM6A 1EGZA 1WFIA 2ZUQB 3NPZB 3IGKA 4JAMB 1EP2A 3P0VH 1MCIA 2WGXA 3W0WD 1JNHA 2KZHA 4KJYB 3PZTA 1Z3GL 4M5PA 3FO2B 3MN8A 1QHQA 5JOPD 5DRZB 3D08A 2J4WL 2P9RA 2WLKA 5BOJA 3E6EA 2VDPH 2XZ7A 4JO3H 4BQ3A 4R4BA 1D8WA 1LZOA 3A47A 4LU0A 1M1SA 3PSWA 3JV6B 5TPWL 2N1KA 2PDFA 1ODUA 2XV6B 4KWUA 2JIXB 4PWEA 3M47A 3PPSA 3QEUA 4RRPG 3IJDA 5J1AB 3IJLA 3NQCA 1TJIL 3PTMA 1T66C 2OCJA 2W3ZA 4UANA 3NQ7A 5C6MA 5D7LD 2MQGA 4HV8B 4N20A 3ASNB 4IMLA 4ZXBD 3AWFA 3ESUF 1E3XA 2GY7B 3BCJA 5DZ9A 4WJEA 2ICSA 5EF0A 5EIIB 3NPSB 4MA7H 3CN1A 3WGUB 1H5VA 4XZMX 2K4WA 1FE8L 3GLZA 3G3DA 1CECA 2LV4A 5DEFB 3PNWA 4HK6A 1I9RH 3UXFA 2UUDH 3CH0A 1BVKB 3T8QA 5FEWA 1VCAA 3UPRB 4NIKB 1GONA 3VW3H 1VACB 1KYFA 2BDNH 1A1OB 4V33A 3WBYA 4CNPA 3FK4A 3LEPA 1UT9A 1VBHA 5IGXL 1ITXA 3D6NA 3QWNA 1KYOK 4TNWF 3X14B 4UTAL 3TO4C 4ZX5A 3ZU8A 2VOTA 1Q85A 2BNRB 1S2CA 4YHOH 3T8VA 1NMCB 3UX9B 1N59A 4HN8A 3L3OA 4HWUA 4AY0A 1FDJA 4OGXH 5AKVA 4AEEA 4FHAA 3WOVA 2P8PB 3KW8A 1L4IA 5HYEA 1FFOA 2VJ8A 3AADB 4CGTA 1OHQA 4FL4C 4AZ8A 1VGKB 4IIEA 5HHNB 3GS4A 5DVMA 3VJ6B 3ZM8A 3LCIA 2ZCZA 4B16A 3VRJA 1ZT1B 1FL3A 5IF0A 5CSUA 5ELIA 1ZT7A 2H2SC 4QXVA 3BUTA 3MXVH 4PWJA 1FHDA 1Q38A 1RZJC 1OTUD 1HJBC 5MEPB 4JTKA 3OQEA 2BWQA 1YEGH 3EOBB 2GQAA 3GC4A 4GFXA 3MCMA 3W1LA 2AXGA 5IP4A 5B3JE 1BWLA 3GC2A 5E9DE 1TJHH 3VXSB 3O6ML 4K5NA 4MY1A 3SR7A 2R1YB 1S46A 1AQ0A 3VFMB 5D9NA 2E7DA 4JRXD 1G4RA 2O93L 3FRPB 4NNXA 1VFOA 4QXIA 2OELA 1UOLA 3ULUL 4EUPB 1P5VB 1UD5A 1OGTB 2AXWA 2C7UB 2G5BB 3O4LD 3FFOA 4HWBA 1RK1B 3DERA 5DO2C 3EEGA 1OLLA 3IFPB 4JRXE 5HHVL 4GVFA 1YO4A 3UXAA 1AVAA 2MHAB 1LORA 3VXSA 2JELH 2YGNA 4BZ2H 5HVHB 1U2CA 1W0WA 3BP7B 3O3EB 4ODXA 4ZQPA 2FWLB 2JB6A 3SJNA 5C2BL 1KB5A 3IB4A 3MRNA 1ECEA 1OD8A 1AIFA 1U30A 2QHRH 3W2UA 1NC2D 4J2QA 4MXQD 4NN7C 3MDJA 5IMKB 4Q9RL 4N3TA 2ZSWB 3PHQB 2R1YA 5HQLA 1YZZA 3KGUA 3BIAX 1DIOA 4BWWA 2Q7YB 1I4FA 2Z7ZA 1K2DB 1G1OA 4W87A 3BAEL 5JPNC 1LP6A 3WIFB 4I88A 1PDKB 4EAEA 3T6QC 5HNTA 5EL1A 3VB9A 1UWUA 1OZUA 3WTWA 1CB7B 1WTGT 1J5SA 4WJ5B 3MLZH 3LH2L 4R97C 2WD0A 1EXUA 1KPVB 3F7QA 2HKAA 4PJ7F 3WNIA 4G8IA 3ABRA 3WFBL 1AIFB 3NFSL 3FQRA 3KLAA 5FHBL 3WXWH 2HTKC 2GFBB 3PZUA 1ID5I 1UGKA 3O6FD 1CUOA 4APQA 1XPYA 1LUCB 3MBXH 3JQOB 4W4OC 1KPRA 1HCZA 4NHUA 3GC5A 4GXFA 3M5YA 1N8OE 3LEYL 4P5SA 2NW3A 3RJDA 1G6VK 5KSVB 5D96B 4PL1A 1VGAA 2WSRA 3QZPA 4HYWA 2WWKO 2LAAA 2DWXA 2YCIX 3IVUA 3MW7A 4JUTA 4XTIA 3UR7A 1UJTA 2Y5SA 4P59L 1Q9OB 1P5VA 4X80L 4EQ2A 3RMJA 3K4AA 5AHFA 5C08B 1VZIA 3LEYH 5EC2B 1SU5A 2OG9A 4JHBA 3MKKA 4ORMA 3T0XA 1AZ2A 1FH9A 3QZOA 3OR7A 2BWDA 2CLHA 3EOTH 4XBKA 1O95A 1PLGL 3CVBA 1E56A 4NM8L 2Q6WA 2DQGL 3BQ5A 1K5NB 5EB9A 3I4EA 1KJVB 1FNEB 1HT6A 1I1CA 2GJ6E 5LGZA 3PAZA 4ZBCA 5FOBA 4YCOA 2WQDA 1KBGH 3FZUC 4TTGA 1XCTA 3RKPA 1CBVH 2Y4SA 4HPJA 5FJTA 3DX0A 5KITA 1WAPA 1E6OH 1GK8A 4JFDE 2YZRA 1HNFA 2E9JA 4M8RA 2J56A 1DWJM 3GNMH 2FVMA 5T1LA 4QYOB 4HNNA 2NZ9D 3FT9A 3WJMA 1NSJA 5I6SA 1X5JA 1A8JH 3F2BA 5CFHA 3IRDA 5IZ7A 5DD5H 4XMZA 4F48A 2Q01A 2OI9B 5DS1A 3DTXB 3CK0L 4IIQB 4QTHA 5CGBA 3UERA 4AENB 3U6WA 1DDHB 4UI2A 5HBFA 4PRIA 5FC9A 5TIMA 1XTLA 3QQ3B 4LL1A 1U93B 4UTLA 1M03A 1BWWA 3F85A 5IR1B 4K73A 2VXQH 4HEME 5FIEA 3NMEA 1RULH 2YCLB 3TNBA 1CLVA 2V2WA 1FZOB 1BZEA 3LUTA 1W1TA 2XVLA 4RK8A 4U0RB 4Y9MA 2G0LA 5AVUB 4W9GC 3VQ2C 2C3VA 3QG7L 2PDLA 3CYJA 1A49A 1X6UA 3NSJA 1WK0A 1V02E 2AVFA 4GRLC 3E2RA 1K9EA 5KWYC 1SOQA 4HBCL 5J8OA 2ZF9A 1LQAA 5MEQB 2ZWYA 2V68A 3W38A 1P6BA 3PNZA 5CM1A 4E2DA 1H9DA 5HR7A 4X8JB 3O4LB 2AJ3B 1CGWA 2YYUA 4I3SL 2AKZA 3P54A 3L7EB 5FUCC 3LKQA 3QYMA 3OJ2C 5C0DA 1Q63A 2K4AA 3PF2A 4HP5A 2VDLB 3EYUL 3OV6A 1PZUB 2NXYC 3C60B 3GLDA 2Y89A 5BZZA 3IVKA 4PMUA 4IIQC 2QF7A 3H2AA 2OMZB 1UXMA 2OI9C 3QFJD 3CS2A 4NJ9H 1TYRA 3VD7A 1EFXD 3N85H 1V4YA 1H09A 2GCYB 1Q9LB 5E00B 4PC8A 2DGAA 4KZEL 1H15B 4UYQA 1XL4A 3KXFE 4RH4A 4Z7WF 3FTSA 3LZPA 2VXTH 4BA8A 5INCB 1I8MA 4M7KH 2ZICA 4DKDC 2BY2A 2FATL 4HOXA 2PDCA 5FL0A 3MLYL 2PP0A 2PXYD 1UKSA 1G0YR 3L3OB 3TT1H 1OK6A 1HK6A 3V6FA 3LAFA 2NRDA 1F6AB 1H3GA 2NY4B 3OKKA 1XLLA 4QEEA 1JPHA 1QNRA 5EBAA 1THFD 4PJGA 2Y7QB 4P99A 2W61A 2UWEA 3PUDA 3OG4B 3FXYA 1CN4A 1JZ4A 1FYTB 4C4KT 1JR1A 3NZ1A 1PSKL 3R4RA 1UR3M 1CIUA 2Y8KA 4XSMA 3H4XA 2WUCH 4ONFH 5G5DA 4K39A 2ACRA 3ISWA 5FK9B 3FX4A 1SN5A 5EDXA 3RWIA 3V5KA 3SYAA 1UTDA 4OZOA 3TYFA 2ZRZA 4A4AA 3D0LB 2CWRA 2WQRA 4D6DA 1IGTB 2G0WA 2AGJL 3J7HA 1VGEH 4XVOA 2PD9A 4YXGA 7ODCA 5LBSA 1WV2A 2FJGA 4YEFA 2AKMA 1A9EA 4LAZA 1R9XA 2P8LB 4JFHE 3BUBA 3GC3A 4P2RB 3IJ8A 3DJRA 5I0XA 4O50A 2BOEX 3MRHB 1Y8BA 3V0TA 4B5XA 1VF5C 3DJTA 2XACC 3FO9B 3NCWA 2VO5A 4GKSA 4DGVL 1GVYA 1EEQA 3TF7C 1GZGA 1MUCA 4EVZA 4X4YA 5F4XA 4XI5C 2A4CA 4HFUL 4Q58C 1X98A 2PO6D 4X7CC 3TA4D 1ISZA 1EJSC 4W7VA 2CCVA 3FOLA 4Z3IA 3W1PA 4PJHA 3O45B 4P5KB 4R97B 2EPKX 3R2GA 1A3WA 5L6YH 2C71A 4JGDA 4H6QA 4CSPA 1R85A 3ROOB 2OSYA 3DVNB 2O61B 2DZVA 1FP8A 2WC3A 2CO6A 4AT6A 4FA6A 1TZGL 3WSQH 1UB3A 2HS6A 4JIRA 3LV3B 4KTEH 4LSVH 5XIMA 4OGYL 4GOAA 3RL1A 3TN4A 3BX7C 2BHUA 4F1ZA 1JK8B 2L8AA 3H3KA 4XCEB 5CPLA 1F6AA 1KV3A 3TX4A 3LS4L 4NN7B 3T9WA 3UY8A 1QO2A 2CDEA 5CSBA 2F5AL 5C3TA 3C5ZC 5AALA 4QLKA 2CO7A 2EZ0C 4TUKL 3Q65A 1KCVL 1FXPA 2XQBL 1MLCA 2XGIA 2HFFB 2WMIA 2EDDA 4MD0B 1AJZA 2M26A 2DWSA 1LM8V 4K15A 1EB3A 3TH2T 4CNIB 1BG9A 3EZJB 4MCMA 2ZD0A 3HRZB 2C34A 1RH9A 5LXGL 1KMGA 2FDBP 2VQUA 3TVMD 4AKOA 4A2RA 4DIXA 4KIRA 1HL8A 1CQYA 3OAZK 1BP3B 1PYMA 4C6IA 1FRGH 3N44B 1PPIA 4L2LA 4PMQA 4XP6H 5FS5A 1GKOA 3WLLA 3LPFA 2I5GA 4AYGA 3T09A 5HYJE 2KHAA 4ZFOL 2BSDA 4FG4A 3WK0A 2ED8A 2ADGA 5GHWL 3K5RA 3W2LA 1UP3A 2BP0B 2W4XA 3FTVA 3TBSA 1I3GH 1A5KC 4AM0Q 4XNDA 3VABA 4GW1A 3VYNA 4BCEA 4P4KA 1TTQA 5BROA 4LOUC 2FMOA 5GRXG 4RL3A 3VD2A 3RU8X 2BFGA 2ODOA 2X8RA 3S3GA 1W1PA 3P77A 2DIBA 2DEPA 3SE9H 1JPEA 2XV2A 4AZ5A 1AZRA 2XTLA 3VE7A 2XKNB 3F7KA 4YLQT 3ATDA 2IKHA 4I18C 3PV6B 1XSJA 5IIEB 4GUOA 1OFBA 2YFNA 3ZR6A 4H9XA 3RTQD 3B7RL 4ABUA 4FF9A 2C14A 2A74C 4LSUL 2G3IA 3WXWL 3W1AA 4ELDA 2A6DA 2J12B 1WWAX 4G59C 4PJDE 3AIBA 5DMKA 4Q22A 4RLIA 2LW3A 4AC7C 5DD1H 4GH1A 4OZIA 1KLUB 3MV8B 4Q2ZA 1U8OA 3WS3A 5FF0A 3DK2A 3W39B 3BW2A 3NPSC 2ITDA 3BP6B 3RTLA 3VCRA 4S1RL 1VD6A 1LBFA 2WQAA 4RNHA 1EZVY 4FULA 3MXVL 3CPUA 5D7HA 5IWLC 5BCAA 2VLME 1ZTMA 3QIUA 4HLZH 4M9OA 1C5DA 1WNOA 4ELME 3EB3A 5TDNB 3B6SB 1TJXA 1U8CB 3MCNA 4RZ4A 1RZMA 1BDYA 3PBWA 4KKXA 3IJSA 1W1VA 4MD4A 5JIQA 4NO2A 4AZGA 3VX0A 4KO5A 4M6NH 1WAAE 2J7EA 2ED7A 5JUEL 4G83A 1AI1H 2PO6A 1E9YB 1YBQB 2RGSA 3GI9H 1YEKL 5F7EH 3WHXB 2WTRB 4BZ2L 5DVNA 5BZWB 1Y5WA 3KRSA 1UBSA 3AISA 1V10A 1MCHA 1HYSC 5D9OA 4PFEA 4PP1D 4PMDA 1ZMYA 4XCEA 4MXVF 4GT0A 2VFGA 1XGQA 4E42A 4K68A 3QRBA 4Z7VF 2NUWA 1VYPX 4X7FC 1R3HA 3U5UA 2AEOA 1UUQA 3W1TA 1ZA3B 3M0IA 1IGIH 3S8WA 4TSAL 3WHXA 3VD0A 2Y63A 4CCDA 3VFVB 4XNBA 4JZ5A 1J1PL 4NO3B 2QAPA 1V05A 4ORZC 4ENEC 1EF3A 1XGYH 5JHDD 4BRVA 1UPPA 1IAKB 1UKQA 4NERA 4FS0A 5FYKL 4E9YA 4LX4A 2AK4B 3O6LH 2PZNA 3NDYA 4Z7AA 1YYML 4YGVB 5IBUG 1IBHA 1WHOA 5I1EH 4PMXA 1U8QB 3S48A 3G22A 1TTAA 1QPPA 4KO9A 2WAHA 3GRWH 3RWEA 1GEHA 3IETB 3KRUA 4X3ZA 2BNUA 1EMTH 1L9SA 2HRPL 4PB0H 1ACZA 1I45A 4O4WA 5HWMA 4XHJC 3MSRA 4J39A 4R9HA 3QORA 1EWHA 3KM1A 4HUWA 5IG7A 2HVBA 3SQOL 5JOEA 2PSNA 2Q9OA 1V6UA 2YS4A 1KIRA 3GK8H 4O0QA 1HYRC 2GJZA 2NY2B 2OP4L 3BP4A 3D0LA 25C8L 4J28A 2VDQL 5IROD 3QDJB 1QNPA 3EHBD 5F8RC 2EDNA 3DX6B 4XPFH 1FUYA 2XG9A 4HBCH 2OMUA 3A4EA 4U28A 3OQRA 3A3XA 4GXUM 2J6XA 3OBEA 1A3ZA 1RUKH 4M3KB 2W67A 1GOGA 4GUHA 4M56A 1T41A 1AJ7L 4F5CE 1AW1A 1N7MH 2PF6A 3PPHA 4QEHA 4KK9D 5JW4M 3HBPA 3IDIA 4QHNB 2FSDA 3UG4A 2H2PD 3OGOE 2L7EA 5BUPA 1AFSA 4DHLA 1B3ZA 4HNCA 3PJTA 1AZNA 2NMSA 15C8H 4BH7A 4XMWA 5G1MA 3GS7A 4GG6A 2CUMA 4M4PA 4F8LA 4MJ6A 4PJXF 3V55A 4NZDA 4HXBL 1S7RA 4BFBD 3FQ4A 2Y36L 4F7PB 1JI1A 5G4OA 3KPLA 5C0JA 4A05A 4AD5A 4FA8A 3MV7D 3WUZA 2E59A 5HWJA 3TBCA 4OV5B 4R7LA 1K9TA 4EZJA 3L8QA 2DKUA 3IGUA 2Q7YA 1CI3M 4OLWL 3GHBL 2PETA 3L2NA 2D22A 1MXDA 5JIIA 3R0UA 4Q4QA 4W5ZA 2G9HB 3HAEH 4EEEA 3L5XH 3CZNA 1P0BA 4YTQA 2D9QB 3MJ6A 4XB8A 1KIQA 1AHWC 4NC2B 3RTQB 5TF1H 1DQXA 3V4PH 3BICA 3LRMA 2QGHA 3V4LA 2XJ7A 3UPBA 1G7HA 1RPQA 4OLZH 4IJ3B 12E8L 4M7JL 4RDQF 5ECJE 4Q8PA 4ACZA 1BIIB 4FQ1H 3ZIYA 4Z1AA 1XB8A 4JHAL 1JPMA 1LQBC 4XQ6A 2WQ8A 4ZSOE 2AABH 1HKMA 4FYQA 5DUMH 1QSVA 3MOAL 3DI0A 4B5EA 5CJBA 4Y16D 5C0CE 3EGXA 3WJLA 1ZPTA 4ZUSB 5E8NA 3BYYA 5CZJA 4EI6A 2BOLA 4JPQA 5KW9L 2VW4A 1VYRA 1XIEA 3LCLA 9PCYA 2FYYB 4I0PC 3O6CA 4WHBA 4LW7A 1GY2A 3V16A 1DHPA 3G5XA 3NUKA 1L6SA 3C56A 4KK9C 1TV2A 4AISA 2WBJA 3ETBJ 1UD4A 3QUXA 4MDJB 4ZUVB 3ZHNA 1BLNB 3EOAA 5AYYA 5C8JA 3UZYA 5K5YA 3U4BL 4LP8A 3VFOA 4Z2LA 4Y4KA 5H8UA 4PUNA 4CSZA 4KRMB 2X05A 4RGNE 3T04D 2EYTA 2NUPB 3VFNA 3WUWG 4DFIA 1IGJB 1SNRA 2EDMA 4UT9A 5L6YL 3IS0X 3QJHB 1MLBA 4P9HH 3TSDA 2WXLA 3RX4A 1J9RA 3P0VL 3EB2A 1OAYH 1UA6H 3W53A 2IQAA 9XIAA 4WJG3 1QSEB 2NSMA 2IKGA 6PTDA 2OTPA 2G2PA 4YWGH 3QUXB 4MDJA 1OCWH 4ZUVA 1I85A 4ZDHB 1DWGM 1NOAA 3F8UB 2O1AA 2VDPL 1B4LA 4Q6JA 2F7QA 2KZBA 5DK3A 4G7QB 4HISA 1H3PH 1K5WA 2FECL 1SLWA 4XXCA 2D7TL 2XQBH 4MMZA 1JCMP 1KO0A 4LKXA 3HE6B 4RQQB 4O16A 3WYRA 4QG6A 3EYOA 5JXEC 3D6GA 4XNZB 4JIPA 2NW2A 1A5FL 2DBLL 3C6SA 2XG4B 2HKHL 3JYBA 3KPSE 1YY9C 2Y9RT 1P6WA 5HGAA 1DE4B 2J72A 5EEUA 4HV8A 1R9YA 4HTBA 3RNDA 4EN3B 2BK8A 2F0CA 4H5SB 3PPGA 3P69A 4PJ7E 4FTDA 2J88H 4ENLA 3L4VA 4I7ZC 5IVOA 1XLEA 3EHBB 1C8XA 3LRKA 1KJ3L 3WNKA 4ZX4A 3BAYA 4LHUG 1TWSA 2G96A 1GGBL 2WZ5A 3SDCB 1BZ7A 1MUMA 3RKDC 3FJ4A 3SE3C 2VC7A 5L8LB 4DJDA 1C92A 3EYQD 4CN4A 2CCRA 4DJEA 4DZHA 4ZO6A 5LXEA 3VNLA 1N67A 1O75A 5EWIL 1EZSA 4ETQB 2B1OA 1F58L 4M4RA 1EDTA 3NQVA 3DUSA 5TTRA 5AAMA 2ISVA 1BAGA 3VDGA 1DLHA 3K5SA 4HGWA 1EXGA 4KROB 4NUGH 3SSJA 4DXVA 3SEPA 4BZ1H 4M0XA 4UU9A 1H3WM 1T0NA 3NG5A 4G70B 4S1QH 2Y85A 3KLSA 3F5JA 2NQDA 3N17A 2EDYA 3E1ZA 3VIKA 3I02B 1S5NA 4A3UA 4CLMA 2VL5B 1LLZA 4AZ8B 5IHLB 2ZRXA 1XAUA 4RE2A 4CMMA 1T4KA 5FDWB 1CLYL 1S8DB 1HTYA 1UWGH 4GP8B 5CJOH 2INFA 3CTLA 4O1CA 2BNQE 3ABKB 3OZ9H 5A16B 3KWTA 5JW3H 2HCVA 1R86A 3F4NA 1UR4A 4O18A 3FFCD 5C0CA 3SDYH 4URIA 3FRPA 3VA6A 5AVRB 1GQLA 1N8IA 3GTFA 3W88A 1UXSA 5GRVL 2NW2B 5HGGS 1GOOA 2MJWA 2XSKA 2JF7A 3IFLH 3T4CA 4AIUA 1I9JH 2VLKA 4Y16A 1BWKA 1MNZA 3REQB 4WEMB 4C4KO 1RY8A 3CL6A 1Q8MA 4A3RA 1KCUL 3PWPB 4AG0A 2DQIL 1AFVH 3LJ3A 4QRRE 3TEWA 3UEQA 5DJ6B 4PGEA 2WXPA 4C1LA 3AS0A 1CCWB 4HSHA 1E6JH 5GGRB 4LVHB 3EOOA 3CMOH 2DTMH 5EOQL 1R5IB 4LB8A 5M7QA 2YL5A 1CF8L 3G6DH 4NAQA 2DUAA 4XUYA 4UAHA 1QEXA 4YXHL 3JV4B 4UMGA 2GTZA 3AHYA 1LD9B 2EEFA 4DP0X 3ULVL 5F8QC 5LN8A 3CCHA 4OVUA 4D9LL 5GS1A 2OAAA 3G0UA 3GIPA 4OBSA 4QLRA 2EG8A 1KSRA 5JH2A 3MCLH 1TITA 4IGBB 1TRIA 4PJBA 4LVBA 5G4WA 1SN0A 4YTSA 1KC7A 4KJYA 4QRPE 5I3KA 1P4LB 1OFOA 3FQRB 4PTMA 1RCXB 1H5BB 5FW8A 2REQA 3UETA 4HSOA 4R0LA 4KMQA 1N8ZA 3GBMH 5LGHL 2XJLA 3QA3A 5ISZA 3VG9C 4IJCA 2BNRA 1KUMA 3JV4A 4DAIA 1LTXA 1NAML 3FQWA 3ZMNA 4BSWB 2Z26A 4JAMA 4NQEE 5B8CB 5CBAB 5CIPB 3LLFA 2G3XA 3QQ0A 1KM5A 4LF1A 4R7DA 4OLUL 3PHQA 4HZAA 4GG8B 1RA0A 2AQ3A 4AD2A 4IMLB 3BLLA 4OD1L 3CE1A 1PY9A 3HC3H 1IC5L 3DC8A 3AXLA 3HRPA 2NR6C 3RB5A 2CHNA 1E0XA 1BPLB 4PQXA 4AWSA 1JCXA 4M6QA 4WY7L 4KI5D 4WUUD 4P59H 2INEA 2XZAL 3QISA 3QF0A 1N64L 3CWGA 2XV3A 3GMOA 3NSDA 3T1WA 3W6MA 1FGVH 1YJDL 4ETYA 4OUIA 5J7CC 3DOPA 5A6LA 1ISXA 4WKXA 2NY6C 3O9WC 4JUSA 3E0FA 4IMAA 3QLLA 3FUDA 2CEQA 4N9EA 4QT5A 4MMWA 2W9EL 4OIFA 2QDEA 4JVUA 3BW9A 2QMJA 2W62A 5AB2A 3S37L 3MLXL 4JBRA 4V1XA 3LKNB 4I6KA 4OI9A 2JMRA 4NPJA 3KLAB 3P3SA 5HQMA 2FX9L 2W95A 3KOYA 4PWIA 3Q8CA 4A39A 3KPRB 4FOJA 5E2JA 2X6CA 2M83A 3N2JA 5FLUA 4DP7X 2WLMA 3IDMA 3I84A 2IW0A 3TC7A 3TOPA 4C56A 3HQOA 4C5ZA 2CALA 3BFWA 4KMLB 3GM0A 5MERB 4H2HA 3JW7A 4MA3A 2A2IA 4NQTA 1NVMA 2R4SH 3LZFL 2F18A 4ODSH 3K71B 1Q45A 3VJ6A 2V5KA 5EYWA 1AG1O 3L3IA 3W23A 2PPAA 4OFQA 1K77A 2FX9H 4AC2A 1YHPA 2NY4C 5HQEA 3DAQA 1GW0A 3A22A 2XJKA 1F1DA 1B54A 2X2IA 3VILA 5E2VL 2HX7A 4UIMB 2LFGA 4D1JA 3Q5YA 3UBXB 3GSUB 1ICSA 4GY0A 5KZCD 3M0JA 5ANHA 3BRDA 3DURB 1BF6A 1GCFA 4HMNA 4LC6A 4PJ9D 3AQXA 2ACUA 5HA7A 4P5MB 3N41B 5BNKA 5A2KH 4NQCD 1XL9A 4PHZA 1R5YA 3DFOA 4EUPA 4C6FA 1F74A 4IGBD 1E28B 1AJ2A 4IG2A 3D25B 1TVNA 3QIBD 4IOTA 3BWWA 1LO5A 3C60C 3MMEB 5MP6H 3OA5A 5JQIB 5ECVA 2CC0A 2X2UA 3BIBX 4X6DB 2XSBA 1TQJA 1GC1C 1FWFC 1O5RA 4PRPE 3DFHA 3ARZA 2EJ1A 5SWZB 4JKPL 4N2YA 1BD2A 4PLNC 1HZHH 2RH0A 4US5A 4XV0A 3UZEC 3U0TA 2WXKA 4U7KA 3IJHB 3K6SA 1AHMA 2LLEA 2V37A 4MAYA 4FQCL 2JB5L 4MYWB 4WCYL 1GW1A 2GK1B 3S5OA 4B4FA 2UY5A 3QEUB 2UY4A 2NV9A 3KPNB 1W6LA 2D3LA 4FLSA 4PJ6A 3U1SH 5C92A 2DQUL 2DICA 3HS0A 2HFFA 4HLZG 2WMIB 3V4VL 4WRHA 4FMVA 1LEKB 1N70A 4JY4B 2UX6A 2FIRT 4KHTL 2EIEA 3SZ6A 1GKQA 4X2UA 4QWWC 3VX1A 2H7WA 4A1RA 5IFJA 1LG1A 2DM2A 2UXGA 2N0MA 4WO4D 4NF7A 2DKSA 2QKSA 4HJJL 5K9OA 2QCDA 4RCAA 4DI8A 3NRFA 3ZDZB 4MX7B 3I6RA 4YYCA 1VBRA 1E40A 3THCA 1H3UA 4IIGA 2YPLB 3VXRD 1V0KA 3IS1X 3PUOA 3BLPX 3F65A 3PBYA 3F2CA 2PW1A 2PCFB 5F2FA 2RHEA 4IYKA 3VVWA 1G4SA 3RU8L 1OZQA 3T2NL 2DQCL 2FB4H 1AOHA 4JZOB 4OJAA 3U9PH 3Q9QA 4CADB 2XISA 2HTKD 3FJTA 2A77L 3PV7A 2BVDA 3CQKA 2XV0A 3NZHH 4K7YA 4I1RA 3DWTA 4ZMAT 1WFMA 3F6LA 4PD4K 3VD1A 4PRHE 1XG3A 1NOLA 5ICUA 3UTPE 1P7TA 3FN9A 5D1XB 5A8NA 3PDGA 3EYSH 4UQ3B 3V35A 4D6JA 1MZZA 2IXQB 3H9YA 1Q9LA 2LAGB 2DF3A 1U2YA 1REIA 4OIIL 3AHXA 4KRPD 4GX9A 4ONVA 5CJQL 2OMZA 5GGTA 1E9OB 4DTGH 2ZC8A 1ZWIB 1FNFA 2OQHA 4ZQCA 3TFCA 1KGJA 5AW7B 1P2CA 5KBLA 5CLXA 1NQKA 2CZFA 3W87A 4FXKB 2C1HA 2DZAA 4A6YB 2VEFA 4ZJ9A 3L4WA 3TJPA 4JHVA 2H8XA 2A6DB 2EVHA 3D3FA 3MGTB 4HK7A 1OCQA 5ANME 4Z7UB 5J1SC 3MUY1 4OZFA 2WJFA 3FFCA 3THMH 3EJYD 6PCYA 3LRHA 3WEOA 1Q9WB 1ZLWK 1SHMA 3FZUD 2Z9TA 3DO4A 4Z1PA 1RQHA 3IBOA 3D0CA 5DELA 3NCBB 1G7JA 2NY6B 3WNLA 5JQ6L 2BVPA 3N43F 3LIUA 2BP5M 3U6RB 2BP8A 3M5VA 1TTGA 4JNXA 4D0DA 1U3ZA 1YC7A 4HIHB 3VI3B 3DZ1A 1ZV5A 3MPCA 4LARH 4Q7NA 4Z1YA 5D4QA 4AYBA 4MNQE 4YDNA 3ZE2B 2XWRA 3FQWB 4DN1A 3AG4B 1MAMH 3NCEB 2B59B 2UY7A 4G2AA 4MB4A 3ES6B 1G7JB 2C9QA 4K1WA 4XNUL 5D7IA 2NQ5A 4N28A 1MIMH 4G8FB 1OAYL 1UA6L 3PQYB 1F3DH 3AT0A 5BO0D 1SM3L 2GL5A 4GKSB 5EMJA 5C0AE 3OZKA 4G8EB 4KAQH 1Q65A 3EJZC 4FALA 1E9OA 3B9NA 4Y9AA 5KSBF 2J1XA 4AMKH 2YEZB 3WUFA 3IDYB 3E38A 3T77A 3GLEA 1FZJA 1QLEH 1A7QL 1TYJA 1ZS8B 3FPXA 3MLVL 5AAWC 1P5UA 3M17A 5I1LA 1KRCC 2OTWB 4NZRH 1V6YA 3RFAA 5TE4L 1R3SA 3QJTB 3S5LA 3EDEA 1D7CA 3ILEA 5I9QC 2EVFA 2A9BA 1AUSL 2YEZA 5DJ8B 4W7WA 1TJPA 3SN6N 2QUVA 1XGZA 4DJEC 3DGDA 2WC4A 6ALDA 1NLBL 5AW6B 2CR0A 4W9CC 1D8CA 3L68A 2GSHA 4KGLA 4G5ZH 3ULSB 4QRRA 1A4JA 2MQ0A 1FKXA 4OFPA 1HDMA 3THAA 4ES4A 1TTIA 4C6OA 1EJVC 3STCA 2R2CA 1BCIA 4NUJA 1ELSA 5GZOD 4LOEA 3AUJA 1OTSC 1S2WA 4JANA 5E6IC 4EJ1C 1CBJA 2G60L 1L9RA 3QDHA 4G11A 2BBFA 3RXZA 5EUOE 2ATPA 4HUUB 4U4BA 2Z8SA 2NNAA 5IROC 2O6PA 2PA6A 1KLFB 3VM5A 4JQ2A 5EA9A 3BEVB 3VIIA 4DM2A 1JQVA 4D0BB 2X4UA 5H8DA 4LYPA 1T21A 5E0KA 5IJKC 4GYKA 5FGSA 3B5GA 3N3EA 2MCPL 4HD5A 1VZGA 2XIBA 1G9ML 5BO1H 3QJSB 1RZKL 1WWBX 2BP0A 4B5TA 4WUKH 4ZS6C 5TJWK 3MBEA 3L21A 3RCYA 3VOHA 5G2WA 3QIUB 3O6FA 3TASA 4K55A 2R29H 1VQTA 1T0OA 2VR7A 1CTMA 4CUCA 4RW3A 1TZHA 4XISA 2F8OA 2XFYA 2ZUXA 3ISRA 4RX4D 3D25A 4KK8C 1AGBA 4OF0A 4BWUA 1MCLA 3BVXA 1Z9SB 4DGYH 4NI3A 4M3HA 1HQRB 2K1MA 5DUPH 4MTVA 4PRDA 5C7XH 1V6XA 3IU3A 3VXUE 1UC4A 2A4EA 4KJPD 3SDCC 3K4WA 3REVA 4PE8A 3FH7A 1I1AB 5F7FA 2EEBA 4MOZA 5IHSA 3HNSH 1A25A 3FQXA 2GAZA 3MUCA 3DSFL 3VXPB 1MFEL 1V27A 3KXFD 3LKRB 2NX1A 3ES8A 3L66A 4L56A 1BQLH 3CFJB 5T5NF 3SSGA 1LM1A 2WJEA 2V3FA 3TFKD 3C87A 2OZ4A 1C90A 1ZHKA 5GISL 2GK0A 4K8EA 1BVLB 1FORH 4HWEH 4LCWB 4NAEA 4LLDB 3QHZH 5DI8B 3NFPB 3TBSB 2X7WA 4EF9A 4ATTA 3W7JA 2ZZ6A 1IE7C 1DBJH 1XIWD 1H51A 4G80A 5EBMB 3F4VA 4FX8A 5DMNA 3ULVC 2ABBA 4RDWA 3LBOA 4ZZKA 4F0HA 2R0KL 2P1YA 1G7MB 1IGML 1EBHA 3O6LL 5HDOA 1BYAA 3GUTB 4WDUA 2AQRA 4H13C 2J7DA 2LT9A 3B9KB 4FZ8L 5T3ZH 3ERXA 1XDJA 1HQ4B 3K0YA 5D1QC 4FHJA 2P8BA 1GGCH 3D85A 1NKGA 4IDLA 2OV0A 4GMEA 4PJAA 1W3IA 1CXLA 3HCVA 5A8OA 4Y4KB 4PW9A 1IQDB 4Z6AT 2FDMA 4J8RB 3SY8A 2VFDA 3V8CA 1EP3A 3D4CA 4GC4A 1P53A 4Q7BA 4JFZL 2BPBA 2POTA 5DCEA 2ENJA 1CDCA 4Z95H 1UFGA 2QQNH 1FWSA 3D07A 2GG1A 4GKZB 2VR2A 1EFXB 2R0WL 3CHQA 3P0YH 3T6WA 2O9RA 3PZQA 2WMGA 2V2XA 1D5BA 2DJMA 3O11B 4D2NA 3WTSA 3LZLA 1KTNA 3AYVA 3DU0A 4GD0A 4C6QA 1OT4A 1I1AD 1W8EA 3QULA 4IJRA 3I6SA 1M7IB 1PQZB 1PZ3A 3CDYA 3JZEA 2NV1A 1SY6H 3AT9A 3SJVA 3ZZSA 1GOXA 3ZRCC 6FABL 3A4XA 1IB5A 3L4CA 2NNXA 4UUJA 2QUTA 1TZ8A 3QWRA 1VFMA 4PJFA 1OIOA 1SXZA 1YPIA 1SVZA 4HIIB 1AQ8A 3P93A 3PBMA 5EMLA 1SJMA 7CGTA 5I09A 4RGOL 3ANVA 1Z9LA 5HYSG 4JDZB 3D69A 1QLFA 3G04B 4XVJL 4GA8A 3VTTA 2WMPA 2ZXEB 1OY3B 2X3BA 1MFCH 4LPVA 2OXHA 4TSCH 1K8DA 4O02H 3S35H 3ZQ9A 2CERA 5GGVH 4QIUA 2QCFA 5GJSH 1I8AA 3FO1B 1FJ1A 3ZE1B 2R56H 1JXDA 1KCSL 3SOBH 3GJEB 4WZHA 3BPNC 3EOAB 3H9SD 5AB9A 4DAFA 2Z7UA 5CP7A 5ESQB 1HP4A 1NUDA 1MWAL 2JLLA 4DZBB 1VBGA 2J13A 1KKOA 5C9UA 1UKPA 3NABH 1Z0MA 3HC0A 2D8KA 1YVLA 2CM5A 2JH2A 2O4MA 3QUZC 4XMXA 1X9RA 4M7JH 5GGSA 2R56L 4IRSA 2VABB 2B3IA 3PYCA 4H1LB 5IHUL 2YN3A 4FQ2H 1VHNA 4ZXOA 5I16A 4WFED 3RBGA 4KUZL 3DUGA 1LDPH 3QPYA 4W9IC 4I4WA 2VN7A 3U4KA 3I2CL 4F80A 3RGVC 3M0LA 3APDA 3E2SA 2EE6A 4EBQH 2F54E 2VDRH 4HJFA 3GRWA 3EO9L 4M9PA 1BYBA 2BIQA 3UZ5A 2V5RA 2ZDSA 3N2XA 1NJJA 2R2BB 3TIEB 4JFQA 1JZJA 3V5DA 1YN7B 3QHOA 3TR9A 3SCUA 1E51A 1WBZA 5E03A 3PN8A 1DCEA 4PTXA 1MW2A 5AVHA 1T83A 2IKIA 3WDRA 5ALBH 4U5KA 1U36A 1X5FA 3GTIA 4FNPA 5EZLA 1UA3A 4AQ8C 2WVTA 3BE1H 3QRGL 4FQXD 2KQMA 3HZ3A 5L4JA 1U5VA 3GDLA 4PUEA 2HE8A 3AIWA 3NCOA 3NQ2A 4DZ5A 2ICEC 2ZONA 4IRZL 3FAXA 3ENLA 4HGXA 3MKVA 4EI5C 4BD4A 2VITA 1HHKB 4HK0B 2VMCA 4HCRA 4LSUH 4PJ8A 4JJ5B 4X5XA 5MEPA 3DC0A 4M7ZB 4AMAA 1QPNA 3GSMA 3SFKA 4ZAKB 1S3KH 4HGMA 4DQAA 2JJTA 3BFQG 3CXOA 5ADPL 4ZDHA 4RA3A 1ZALA 4H3DA 4AOFA 3NZ8A 1ZDQA 1A0QH 1ACYH 3DGGA 3TJHD 3IN2A 3TJEH 3UH8A 6TAAA 1DXFA 3A9IA 1EAPA 5HBBA 3N91A 5LQBH 4U3CA 5D1ZA 3BP5B 1XXFC 3UO1L 3IFPA 1MCEA 2I9TA 2VGLM 4L3AA 4AYID 1CWVA 1A4MA 1DE6A 3D18B 2E27L 3DI1A 4XBPB 3C2OA 2UV8G 2JB6B 5F88A 1WKFA 1G7PA 3E1F1 2NCEA 3U36A 2WPBA 4XWUA 3S47A 4Y2DB 5C2XA 4I4WB 5EBGA 1U6AH 5IEKB 4Y9OA 3RCNA 1KFAL 4JFOA 4XWGH 1MO0A 5B21A 3RVUC 5L2KD 3N2TA 4PJEB 1V7NH 3BGMA 2AJYL 4YVVA 4M00A 2DQWA 2X9ZA 1KIRB 2P5WD 2VDOL 5I8EA 1MVFA 3ZJ6A 5CPQA 3NQGA 1E4XH 2EDWA 5DJXB 4K8GA 3DHFA 4LAUA 3QDMA 3FCSB 1A6ZA 4ZMVA 3GNOA 2PYFA 2WIIA 2HUEA 4CSTA 5IROA 1TSIA 2IADB 4IIDA 2CHRA 3B2UD 4LUSB 5I07A 3U36B 4MPQA 4ZE4A 2JI2A 1ZT7B 5KANI 2XWCA 1SHSA 2ZKWA 2FEEL 4X9IA 2AQ1A 4X9YA 5I26A 5TDOA 5TQ2L 3SE8H 1AS8A 1T80A 1XCWA 4ODBD 4LXFA 4E41B 4PL2A 2EC9U 4RPQA 4E5XG 4GJIA 1U8LB 5E4IA 4DN4L 1QOPA 4GG6E 5D2LA 1BSIA 3SJ3A 4HCIA 4A7UA 5JBFA 3RMEA 1UWAA 3VXSD 1EX1A 4JY5L 3KTSA 3WJXA 3ABXA 5C0BB 2BCKB 3CXHK 3O9WD 1GYNA 1TSHA 3KPLB 4GRWB 2BFVL 4MLIA 2PXYB 5AL8A 3VFOB 5AOUA 5G4HC 3MXWH 4LCWA 2Z8VC 3O2DL 1FL6B 1WXZA 2YN5A 4DB7A 3WTXA 5HYJA 4ORGB 1P7QB 4AVOA 4XNQB 2VR9A 3FTYA 5ABEA 4PLJC 4Z77A 3SDDD 1P43A 3VINA 1RERA 4NX0A 4QXUH 5D5MA 5JIDA 1AOZA 4GQBA 1I9JL 1MHCA 4YWSA 1H7NA 2NQHA 3A12A 3BE7A 4UTJA 1HJQA 3HZVA 1E6QM 1YLVA 4HZ7A 2GEQA 2W92A 1CLOH 1ZJBA 1ZGDA 2PGWA 3W00A 4GKOA 3H6AA 4KX7A 3CUIA 2Y1VA 5IJBC 5FGBC 4LCRA 5AOZA 5FDWA 3ASWA 4F0MA 4KKQA 5HYFA 2Y2YA 1WQVT 3WU1A 1R3VA 3E5PA 4TU1A 4I9AA 4R4BB 5LJYH 2NNFA 7ENLA 3TUUA 4BFOA 2ZUNA 1OGPA 1EQWA 1UROA 1LQ0A 3G6JE 4LUJA 2J8UA 1KG0A 4AIZB 2FZDA 3S4SG 4BIKA 3HN8A 3MRCA 3EFOA 5CGTA 1H63A 3JTTA 4PJCB 4P06A 1CLXA 3SW6A 1L0QA 1BVNP 1KACB 1MOEA 4JQVC 4PP1C 1DVQA 2DIKA 4P7RA 4XPAL 1YEDB 2RR3A 5E9NA 2ALAA 1YEFH 5EC1A 4P3DA 1W9UA 1PV8A 3WQGA 2FQEA 2RIKA 5IMKA 4QS6A 3CXDH 1KPUA 1LT8A 3AIEA 4DYKA 5EU5B 4PJFE 1MW0A 5EUOB 4M7KL 4DPBX 4ICCX 1T0MA 4PJCF 4XO9A 4GQGA 3TCTA 4JKMA 2UZXA 4GW5A 5AW9B 1CE6B 4OLXH 4X5WB 1YNPA 4QNEA 5KZEA 1U2HA 1L6ZA 3SKMB 2F7FA 3IDJA 2B7OA 4OIIH 3ZQXA 2FIQA 3H8NA 2MRYA 4LBUA 4YHYC 1ED3A 4ES9A 1N8WA 2NQJA 5LBVA 1CCZA 1E4WL 4Y4FB 1HINH 5KTEL 1MFAH 4NQDB 5AYXA 4FA7B 3BKCH 4RW5A 1HILA 4XX1G 1IBFA 2ODIA 3EYOB 5E8EA 1GOMA 3C3UA 1MAJA 4DJFC 4Q89A 1QMLA 1G9MC 5KVGE 4LHQB 2GSIA 2M8XA 3AABA 4C47A 4BSVB 4U1GB 1AGEA 3SZ8A 3KBFA 1XIWC 3S1VA 4GUGA 1HWHB 1JYVA 2XI9A 1B4TA 4MSWB 3GTNA 2W9LA 3U82B 3O4OB 4LKCB 1ODAA 5HYIA 4UT7L 1XZ0A 3U2SB 3GNDA 5I1LB 1YECH 1BD2B 4GSDH 4ZUTA 4P8WA 4YVPA 2AEWA 1DWHM 1CX9A 2YYTA 4RGND 1A4CA 3EJUA 4M43L 5I8OH 4M1GL 4JFPA 2XLLA 3CMFA 4LNCA 2BY3A 1J8VA 4J6RH 5D30A 4Z5RB 3HNSL 4YEEA 4DPRA 1MG3C 4LAOA 2Q3AA 3C8KB 3KYMA 3L95A 1X5XA 3K4ZA 3L9CA 1ID2A 2VDNH 2VNCA 3LD8B 3NEVA 2WBJB 1HDMB 1PZ5A 2IFFL 2Z92B 3IJEA 1ZZMA 4TX6A 3AJ7A 1CYXA 4HLJA 1WOBA 3QUKA 1S5IL 1TR9A 1QUNB 1XJBA 5HXMA 4B91A 2F19L 1ONRA 1GW6A 3RUBL 1VPQA 3RL2B 1ZHNA 3GDBA 2DOCA 4DN3H 1SYSA 3IK2A 4WW1B 1S9VA 3M44A 4PB9L 2G2RB 2J44A 3OKLB 2K70A 4N2FA 5D72H 3UIYA 2VIRA 4Y5YB 3V4PB 1KQZA 3FGCB 3LHAA 4ZFCA 3LLXA 1GUVA 2IDUA 1IGMH 3O15A 4YTTA 1QRNA 3GJFA 2C16A 2DZBA 3P3TA 1MH5A 4PBDA 4BFKA 1JRCA 1KJ2A 4GEJA 4IFKB 2V63A 1GYCA 5EO9A 2CZNA 2AJXH 2J8GA 3QRLA 5ICXB 4CW1A 1K8XA 1K8IB 1UM6H 2Y7FA 1OCRB 5CCHE 3CQQA 3FUHA 1IAMA 4MNHA 5A6KA 4XB3A 2XG5B 3DVFA 1WBYA 4JJHA 2QT6A 4R7NB 4Y7OC 4YXLL 4TUFA 5CGYC 5AKRA 1WD8A 2PYEB 5FUZH 1TZHB 4NKCA 4EIVA 2V9RA 1QOQA 4DNMA 3BAIA 5GJPA 3MP3A 1IRAY 5JOFA 2QLVB 3SCMD 5BVPL 5KS9F 4O5LL 4RMQA 1IKNC 4GIOA 4J27A 4G2DA 2G2NA 2ZZ2A 3OHXC 5DEJA 3KWXA 3VWJC 3G1FA 1TEYA 1RV6X 4NJIA 3FTUA 2XM1A 3QQDA 4PJHE 3NL5A 5EUOA 2WZAA 1PKMA 3ORJA 4OJDH 5J56B 2C1OB 2NT0A 3HTLX 3MLRL 1NFBA 1RY0A 4PYSA 4OZIF 4U0RC 5A6BD 3W24A 4A2FA 1HFBA 2FD6L 3QQ3A 4UBDC 4Z0SA 1W16A 4GW4A 1YAIA 3CXFA 1ZHNB 2AL1A 3NH7L 4PUUA 2A6LA 4PA8A 4XPHH 3PY9A 4ZVJA 1DN0A 3N1AA 1XRVA 4LLVB 3ZJ8A 3NEOA 4MMXC 3MRKB 2K6ZA 2X6MA 4YSDA 2VUNA 4F8XA 3AM8A 3B1UA 1KFGA 3IRZA 3L54A 4HC1H 1TFVA 3GKWH 4JY4A 4J3TA 1RALA 1SO5A 4F7TB 4P5KA 4IFKA 3RY4A 5GNXA 3NFNA 5DCCA 4D6IA 1JF1A 1ZNNA 3H7VA 4JY6A 4B3KA 2E5CA 3IGLA 4R5EA 2YQ3A 3MRQA 4GJJA 2RGMA 3W85A 4HCGA 3RX5A 1RJYA 3MRFA 1K4DA 3W7HA 2PPEA 3MP5A 2FO8A 3HG1E 3TU6A 2C9VA 5DS2A 1BZQK 2N0KA 2NOYA 1I8IA 2VM9A 5FK9A 3SCRA 3W7EA 4J7RA 4XWOD 2YCLA 3O6KH 2QQLH 3FO0L 3MNDA 4BK5C 4I5XA 5C09E 4L2YA 2XBTA 4PTTB 5I1AA 4Y4HB 4HWEL 4XO3A 1BQCA 4TXEA 1EO5A 3SQMA 4PJIE 3GT6A 3CUJA 1NCCL 3U0HA 2Z93A 4AF0A 5DXXA 3PAYA 1LO0L 2ZA3A 2YW4A 1QUNA 5T5FA 3O7UA 2X2GA 4WKZB 3SDXA 4K2UH 4DIAA 1UXLA 4JY8A 4OCXL 4Q4MA 3USZA