1AVAA

Amy2/basi protein-protein complex from barley seed
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
403
structure length
403
Chain Sequence
QVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFAKGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARLEY ALPHA-AMYLASE 2(CV MENUET)
publication title Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution.
pubmed doi rcsb
molecule tags Hydrolase inhibition
total genus 139
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1avaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1avaA01
2XJ7A 4HU0A 4BA0A 4B9ZA 1SMAA 3AMGA 3I3DA 1HNYA 1B90A 2VR4A 3U5UA 1M53A 1JNEA 3M46A 3OG2A 1CPUA 4NXKA 3WY3A 1XH1A 1BLIA 5GNXA 4HZ7A 4V2XA 1MXGA 4YPJA 1AQHA 4RL3A 4W8BA 4B15A 4EK7A 3AS1A 3VILA 3BVVA 5BCAA 1C8XA 1ZBCA 2VRQA 1GJWA 1XRVA 4OIFA 1TVPA 4WSKA 2FHBA 1GHSA 4P8WA 1OT1A 2FHCA 2BY2A 1CDGA 5ABHA 5C71A 2V3DA 4MNMA 4MAZA 1SYTA 2IUZA 1C7SA 3UCQA 2JE8A 4S3KA 5AYIA 1OD0A 4AMCA 3MMUA 3S5YA 5A6AA 1QHOA 3OLIA 4WKFA 5ABGA 3D5HA 3GDBA 3WDRA 2W67A 1R87A 3HG5A 4AMXA 1FHDA 1MQRA 4ATLA 1DWAM 2ZUWA 3VMPA 4D1JA 4N42A 1GORA 4J3WA 1QBAA 1UR8A 1WKYA 3WQVA 5E1QA 2ZOXA 4W87A 2EXOA 1H4PA 2DH3A 2WM0A 1CXEA 3ZSSA 3WNOA 2OSYA 3GTNA 3SIMA 3WF0A 3WH9A 4P7NA 4B16A 1J10A 1LL4A 4QLKA 2J25A 1KTCA 3N12A 4UFLA 4KGLA 3FAWA 3OB8A 3WH8A 2PI6A 4PMNA 3KL0A 4D6EA 1XC6A 4UTFA 4WSJA 3WF1A 3ECQA 3WSUA 2OYMA 4D6FA 4PN2A 1LL6A 3VIGA 1VFFA 3GM8A 1C8QA 2Y24A 2EPMX 4AD1A 4QAWA 3EYPA 4BQ3A 1E56A 1UD8A 1KBBA 2FGLA 5A6BD 1Q6GA 1FOBA 1QWNA 3UR8A 1E0WA 3WD1A 1LG1A 1E1FA 2Z1KA 1HL9A 5BXSA 2CCRA 4CVUA 1W3LA 1UR9A 3A5VA 5IFPA 5CQ1A 2MANA 3WMSA 1PZ3A 4FLSA 1OIMA 4H8HA 3CZLA 3WFLA 1V6YA 1UWUA 3N11A 1PZ2A 4UFHA 1IV8A 1HVXA 4Q22A 2Y8KA 2FGZA 3NCOA 1XYZA 4IUGA 5FIPA 3KZSA 2XVGA 1JDAA 1Z32X 1LG2A 2G41A 3POCA 3VGHA 3BMWA 3WNKA 2EABA 1WZKA 3SCUA 1HJSA 4PTVA 1W3JA 2ZUSA 5A94A 2VVSA 1NOUA 2X09A 1UQYA 1SFSA 5E6YA 3N15A 1S46A 5HPOA 2J75A 5BXPA 2W62A 4BQ2A 3WF4A 2EPOA 4AZGA 3KLKA 2HISA 4FLQA 1GVIA 5KEZA 2DPEA 4HTYA 4Z2LA 4MB5A 1QHPA 3VD3A 4LPCA 1E9LA 3MMWA 3VX0A 1RP9A 3M07A 5DEZA 3VIPA 1ZBVA 4TVUA 1V0NA 3VUPA 3AXHA 3W4RA 2WC3A 5I3DA 1UD5A 3T0DA 4W8LA 2DEPA 2BVDA 2BY0A 3WY2A 1E6QM 3PZVA 1ISXA 1C8YA 9CGTA 4J3UA 1XCWA 1B31A 3NDZA 2X0HA 1CECA 2FDMA 3KEHA 5A2CA 2WZIA 4MDOA 3PZMA 3W29A 3MUZ1 2WLYA 1M01A 3CZJA 2GDUA 1KGXA 2JF6A 2CETA 2UY5A 3IANA 2BS9A 1HX0A 1TG7A 1GZJA 2PC8A 1XH0A 3A3HA 3AISA 1KXQA 2XFRA 3APGA 2F7OA 3IK2A 2WANA 4J7RA 3GNPA 2ZICA 2VNCA 2XN2A 3I3EA 3BAJA 1E0VA 1IZJA 4UOZA 2F8QA 5FL1A 4UQEA 4U31A 3AZTA 1B3YA 1R75A 2FH8A 1BVZA 2V38A 1VF8A 2O9TA 2ZXBA 4FLOA 1U2YA 3BAWA 4JHZA 4M81A 3AIUA 1UUQA 1W91A 1J9YA 4IISA 2CESA 1V02A 1U33A 1G01A 2A3BA 3FHQA 4BF7A 1UASA 1E70M 2ZX8A 3RJYA 1QI4A 1R7AA 2G3JA 2BHUA 2IXVA 1LL7A 4NXSA 3HG4A 3WDPP 2J7BA 3SCPA 2OSWA 1OINA 3AZSA 3RJXA 1JYVA 3VNZA 2VURA 4S3JA 3OGRA 1J0IA 4KGJA 2XUCA 1H11A 1UWRA 1QNSA 1VRXA 3SCRA 5A8OA 1VEOA 3CZNA 5FCZA 3U7BA 1GPFA 2ZUTA 3UG5A 3K4AA 4W7UA 2QHAA 2W91A 1SMDA 4PMOA 1ZS2A 1CBGA 5GNYA 1JZ6A 1RH9A 1XCXA 3VVGA 3NSMA 3NJ3A 4TTUA 5CSYA 3TOPA 1XSKA 1GOQA 2FYVA 2J4GA 2WB5A 3AMCA 1FP9A 4X0NA 4D1IA 4ATDA 5FD0A 4YN5A 4P8UA 2ZUMA 4WIWA 3WD2A 5CGTA 1W3HA 5CPSA 2VT0A 1BHGA 3A4XA 5A1AA 1HJQA 1W1TA 2VZVA 1CXFA 4ZE5A 1QI3A 1JD7A 2JALA 1KB3A 3MSDA 4WF7A 4MNLA 4HU8A 3WF3A 2X2YA 4MNJA 1PPIA 3B9DA 5DT7A 1DEDA 3IJ7A 3WQWA 1TA3A 3EDEA 1GQIA 2E0PA 3VD4A 1R34A 4Q7NA 3W25A 2VC9A 3M6DA 1EXPA 3W6MA 1MQQA 2XHYA 2EQDA 3TTQA 3VIHA 3MUY1 4AZCB 4W7VA 3VTRA 1XD0A 2YBTA 3AIWA 1W2VA 2X2IA 4W7WA 1GOOA 1D7FA 1UHVA 2XPKA 3FAXA 1KCKA 2VR5A 1TMQA 3PZQA 6CGTA 1VAHA 3IGUA 4FNQA 1E6ZA 1E71M 1KXHA 2OWWA 3EBVA 4LQ1A 2XVNA 3UR7A 2Y4SA 1E6SM 1QNPA 3K46A 1UWIA 2AAAA 4BQ4A 4GIAA 3L4TA 1W9DM 1BAGA 4H8UA 2GJXB 4FNTA 3ARWA 2EEXA 2WBKA 4OOZA 2XVLA 1HKIA 4A3YA 3BC9A 4JAWA 1WZLA 3T2OA 1C7TA 2EBNA 1TZ7A 3CUFA 2W63A 3SCWA 3AMDA 2EJ1A 3W53A 2ZXAA 4QDMA 1G1YA 2GJXA 2OW6A 3AYRA 3OLDA 1JFHA 3SUUA 3WL0A 1G94A 3BCDA 2GSJA 2WWCA 3E1F1 4U3AA 1NWRA 1XV8A 4OBRA 1GUVA 3AMKA 1GHRA 3LXBA 4AZHA 3HN3A 2YDSA 3CZKA 2CKRA 3FN9A 3CMGA 4UFJA 4CVWA 1H09A 1UWQA 2E40A 3SUWA 2WZEA 3UG4A 1VFMA 3L4XA 1PS3A 1U30A 2XGIA 1AMYA 3IAPA 3T09A 2WMIB 1QNRA 2D73A 2W92A 3GXMA 4D72A 2IXUA 4XV0A 1J0ZA 4JFUA 2UY4A 4HOWA 2G3NA 3BVTA 3CHFA 2WHLA 2GVYA 2YLAA 2WKLA 2WMIA 2AOSA 2G3IA 3EJSA 3S2CA 1PX4A 3AOFA 3BCFA 3RO8A 2DT3A 1YHTA 3AHVA 1WZMA 4F9DA 4AXNA 3WQ4A 4TVCA 2YDRA 3RPMA 4J28A 4BQ5A 1EIBA 2CIPA 4MDPA 1HJWA 4NZCA 4P7QA 1CXIA 3MMDA 2ALWA 5I6SA 1SR0A 3RIKA 2F1AA 1XD1A 2GJPA 2QV4A 1W9VA 4DWSB 3GH5A 1GOWA 5A8PA 3CZGA 3RDKA 3SUVA 5DMYA 1LF1A 2GUYA 2YFOA 2WCSA 3AJ7A 1OGSA 3SCSA 4LYRA 1W1PA 4J3VA 1JDDA 4IPNB 1EGZA 3WNMA 3ZO9A 5I78A 3EDDA 3RILA 5I0DA 3BAXA 4ML4A 1WE5A 3PN8A 3TP4A 4JFVA 2ZUVA 1WB0A 3AI0A 3SCQA 4CD4A 1R86A 2CBUA 1UG6A 5CLTA 1K9TA 3L4ZA 2V3GA 3H53A 2EAEA 2J79A 3WD4A 3DC0A 3TTOA 1WCGA 4JKMA 4JFSA 1K9FA 1WDSA 3AS3A 3WELA 2WLZA 3VOCA 4AD4A 2E9BA 4JKLA 3VIKA 2WNWA 1QOXA 3QOKA 4DM2A 2WVVB 1R46A 2ZE0A 3MUAA 3BUPA 4GQQA 4H41A 1J18A 1QHZA 5HNNA 4HOZA 3L2LA 3RMEA 2WMJA 1BFNA 5JBFA 3H55A 1E6XM 4IM4A 4MPKA 2WVVA 3CLWA 2CHOA 5A6MA 3BAKA 1LWHA 1OM0A 3VIIA 5D9MA 5IHRA 4H04A 3O6AA 4H8VA 1TQUA 1H5VA 1BYBA 3CHCA 3K8LA 3CUJA 2Z1SA 3OBAA 3F5JA 4ZENA 4W5UA 5A2AA 1JZ8A 1GW1A 1PJ9A 3WBAA 4J3TA 4Z2GA 1XH2A 1NWSA 3U5YA 3WH7A 3WNNA 1NP0A 4CGTA 5A8MA 3AIRA 3DYPA 1J11A 3ZR5A 4NZFA 1BSIA 2YL8A 1T0OA 3AROA 1NQ6A 4ACYA 1ZU8A 2F7PA 5M5DA 4OOUA 4V27A 2YA0A 4TXEA 3NSXA 3PZOA 1JF5A 4A4AA 1FH9A 1UZ4A 3U7VA 1JG9A 1JZ5A 4H2CA 2QLYA 4PTMA 4JL1A 1W1YA 4CU7A 2CYGA 1CEOA 2ZUNA 1XYFA 5A69A 2D0GA 2BXYA 1HKMA 2FE0A 3OLGA 3W81A 2YOCA 3D50A 4L4OA 1BG4A 1EA9C 1MW2A 3AHTA 1PX8A 2OSXA 2HVMA 2J74A 3EDKA 5D4YA 2WC4A 1V3LA 3BUQA 1UZ1A 2A3CA 3VIFA 4NF7A 3WUFA 3VU2A 2CEQA 1UD3A 1MFVA 2DSZA 2D3NA 3VDBA 4FNPA 1V6VA 1HT6A 4UFIA 1JNDA 1JYNA 3GXFA 1ODUA 1QNQA 1OGBA 3ARZA 1CLVA 5A95A 1OB0A 2WKGA 1HKJA 2JIWA 8A3HA 2Q8XA 3HZ3A 2D23A 5D8ZA 5HBFA 3F4VA 1UD2A 2WHMA 4U33A 4PMUA 4GXPA 3WFZA 4M80A 1CGXA 3S6TA 4UOQA 3WY1A 3ARXA 3GBEA 5E70A 4ATWA 1H1NA 4PMRA 5BWFA 4W88A 2PWEA 3EMQA 3MI6A 4Z2KA 3A6OA 3FNDA 1GNXA 1C92A 3N18A 1ITXA 1UWTA 3WH5A 4A3HA 4D6HA 2VX5A 1I75A 1BQCA 2J7GA 2UWFA 4UQAA 1W32A 3VIMA 1JIBA 3DHPA 1C3FA 4PMVA 1KGUA 4ACZB 1HL8A 2UY3A 1E55A 3SCTA 4C7DA 4UQCA 3RCNA 3DDFA 1BG9A 1V0MA 2PBGA 3CHDA 1H2JA 1FH8A 5JBEA 5AYBA 1UYQA 5D9NA 3L4YA 3WNPA 4BS0A 3WDHA 4ACZA 4WLCA 4DM1A 5FOOA 3HG3A 4GPNA 1H0IA 1Q6CA 3VD9A 3PTMA 1EHNA 3NYDA 3LXAA 3QHMA 2YA2A 4D6GA 1UR4A 5EB8A 3IAQA 2CPUA 1QWUA 4FK9A 1UKOA 4FNRA 5C70A 5M03A 4GQRA 3EMZA 1PIFA 1CLXA 4FLRA 4HPHA 3MV01 1VEMA 1B1YA 2O9PA 1VEPA 3CZSA 3UG3A 5GQBA 4HA1A 4B3KA 1OCQA 2EPLX 5A6JA 3OGSA 7A3HA 1O7DC 2XTKA 3EJPA 3K8KA 1CNVA 1R85A 4QLLA 3ZJKA 2F1BA 3ZJ8A 5JBDA 4NRRA 4M8UA 3LPPA 3K1DA 4HZ6A 1CXLA 2EADA 3CMJA 2DSWA 4EAMA 3WUBA 1UH4A 3LRKA 4KH2A 3A47A 2GDVA 4P7LA 1JZ3A 1DWHM 1M04A 4CCDA 4UFMA 1OT2A 3VMOA 4JCMA 3ZT5A 4C7GA 4MB3A 4W89A 5JUVA 1CGWA 4UQBA 3DECA 3FY1A 4TTGA 1UR2A 4MTVA 4MB1A 1UKSA 3WIJA 2XIIA 2JEPA 4AD0A 2DGAA 3DX3A 2DSKA 5AC4A 1WNOA 2ESCA 1G0CA 1AVAA 1XGZA 3ZT7A 2AMGA 1G5AA 1TQVA 2E9LA 1ISWA 3LPGA 5A8QA 3ARPA 4J27A 5CJ5A 1J12A 1GJUA 2BHZA 2CNCA 1O7AA 4ZXLA 2J78A 2WMFA 5BRQA 8CGTA 1UR1A 3G6MA 3ZJ7A 3GYCA 2J8FA 3BVXA 2ZWYA 2YL6A 4PBGA 1GONA 4CU6A 2D0HA 3QOMA 1QI0A 3AYSA 3BAYA 3VDAA 4P7RA 1US2A 4UZSA 2XFYA 3VGGA 4AYSA 1VBUA 3AIBA 2DT1A 3SCOA 3LX9A 1PX3A 5E0CA 4CU8A 3LPFA 2WSPA 4GKLA 3WEOA 1JZ4A 3WUGA 2OLHA 2VX4A 1JGIA 4WKHA 2E8ZA 4TX6A 4CCEA 2DH2A 3OZPA 1WPCA 1XHGA 1E4MM 4CUCA 2A3HA 2DSVA 4OUEA 4ZFMA 3WDQA 2J7EA 3PZ9A 1E4NA 1K9EA 3LMYA 2J7CA 4DWSC 1JYXA 4J3XA 3KWXA 1TFVA 1KQZA 3ARTA 3CZ8A 2V3FA 3D3AA 1VBRA 4PTWA 1E5JA 2WCGA 1B9ZA 4F9JA 3EDJA 5E9AA 2PWDA 4AC1X 2XM2A 4MAVA 1CENA 4X0VA 3BVWA 1TR1A 2W61A 3WDJA 5HPCA 3AMLA 2DT0A 4CKQA 1C93A 1JZ2A 3CUHA 3VDHA 2D1ZA 4XB3A 4PYSA 4P7OA 3D52A 2J8GA 4KRUA 1D2KA 2WMKA 2CBIA 1K6AA 1EOKA 3TTSA 4HMCA 1NP2A 2BVTA 4PUDA 1LJYA 3GH4A 5C8BB 1EDTA 4PMQA 4RE2A 4PRWA 2NT1A 4XUYA 3D4YA 3G6LA 2XYLA 2EPNA 2VX7A 4D6IA 3CIVA 1JF6A 3T2PA 2VUYA 4PEEA 5JIPA 1CGYA 3VIJA 2J62A 4K68A 1E4IA 3D4ZA 4WK9A 3AS2A 3T0AA 4AZCA 1Y7VA 3VGDA 1WP6A 2BV9A 1UH3A 1FA2A 4MB4A 4AMWA 3BAIA 4AZIA 2C0HA 3DHUA 2WK2A 4NRSA 3UESA 4TOQA 4GI8A 3ARQA 3A23A 4Z2HA 3IJ9A 2X0YA 1B3WA 2F7QA 4RE4A 3TV8A 3M7SA 3ZQ9A 4AISA 1WZAA 1E73M 1XSIA 1KR0A 4NI3A 4Z2IA 3WENA 3WQ8A 2BNJA 1EQCA 1V0KA 4LGXA 4F66A 5IFTA 1FHLA 5GNZA 1F4HA 1DWJM 1QI2A 3MV11 1GCYA 1HVQA 1E4LA 3LXCA 5HDRA 3L4VA 4MADA 3QHNA 2WWDA 2VVNA 1CIUA 4UCFA 4AEFA 2VMFA 2FHFA 4W85A 1UKTA 3N04A 2XN1A 3W24A 1QX1A 2BFGA 4AIEA 3PTKA 3NUKA 3KE0A 2EACA 4CD7A 5CGMA 1N82A 4CD5A 4AZ6A 2ZX5A 4HMEA 1HN1A 4KMQA 2X1IA 2D3LA 1C91A 3ZOAA 1HP5A 1VFUA 3VGBA 1CGUA 2VCAA 4CN1A 4M24A 5I77A 3VGFA 1V3HA 1OBAA 2CXGA 1I1XA 3GBDA 2VJXA 2CERA 1B30A 3A4WA 3BXWA 3VM7A 4F79A 1WO2A 4GO9A 5EBAA 1E3XA 4EKJA 2XSBA 3OA5A 1UKQA 4GZEA 3VDCA 1MVYA 3MO4A 3MSGA 5CPQA 3WBEA 3L4WA 1WAWA 4HPGA 1W3KA 3WQ6A 5BXTA 4U3CA 2NT0A 2GK1B 4YHGA 3WY4A 1JXJA 1FH7A 3AQUA 4DWSA 4XZBA 1DTUA 3AICA 4OBSA 2VQTA 3H54A 3KLLA 4NSBA 1P6WA 2GK1A 2O92A 4LYPA 3B9EA 1C90A 2A3EA 4UQ9A 4GI6A 2G8ZA 3CUIA 5BXRA 3ZM8A 3WN6A 1NOWA 3DYOA 4MNKA 3AS0A 1ZBWA 3BSHA 3VMNA 3CO4A 2WXDM 4WKAA 3I3BA 1NWTA 2WW5A 3WD0A 3GZAA 2J7DA 1YQ2A 1B2YA 4M1RA 4AY1A 1R7OA 2PWFA 2DQXA 2ZX9A 3CZEA 1JZ7A 5CG0A 4AZ7A 3AHYA 7TAAA 1W9UA 2DT2A 5BROA 3CBWA 5DFAA 4D71A 2VRJA 2OWCA 4GZJA 1HJVA 1UQZA 4UNIA 1GQLA 7CGTA 1VJSA 4GI9A 3FW6A 5IDIA 4UOJA 2B31A 4DUWA 2J77A 1UA3A 4JHOA 5I2UA 6TAAA 1RD6A 4QCEA 5CLWA 4TVDA 4FF5A 1MW1A 5I24A 4QCFA 1UD6A 1F4AA 4U2YA 1OD8A 2XWEA 3LRMA 3GNOA 4AIOA 3WL1A 2OYKA 3BUBA 3KL5A 1V0LA 1JXKA 4AYGA 1M03A 1JAEA 1E3ZA 1J0JA 3D51A 4TX8A 3WDIA 3AHZA 4ZEPA 4FMVA 1NH6A 4MJ2A 2IGTA 3W6LA 1V6XA 2JFEX 4BCEA 1V03A 4M56A 1W9XA 3CC1A 1BYAA 4LXFA 1JL8A 3GH7A 1J0HA 1RPKA 3HG2A 5E6ZA 5F7UA 3DYMA 5HOSA 2YIHA 3ARVA 4WJXA 3PZTA 2UY2A 4R27A 1L0PA 1HKKA 4BZYA 1WDRA 1GQKA 2GFTA 1ZB5A 3W27A 3ZR6A 3WKZA 2VO5A 5ABEA 1JYWA 2YKKA 1ZJBA 3OLEA 1E1EA 1X6LA 4E8DA 3ZMRA 2WSKA 1TE1A 5I5RA 5D8WA 3K8MA 2YL9A 1SZNA 5EFDA 4EE9A 5LA1A 3ARRA 1WDPA 1D3CA 2WVSA 3WEMA 5A6KA 1L8NA 1XSJA 3B9AA 3HJEA 1AQ0A 5KZ6A 4JFWA 2F7RA 3ARYA 3PZGA 4AZ5A 1CYGA 2DIJA 1W9PA 2PWGA 1Q6DA 2VOTA 4JZ5A 3WD3A 3AIQA 5FKYA 3MU7A 5LYRA 5JIWA 2O9OA 1KBKA 4OGZA 2XM1A 5FL0A 3EJQA 1HP4A 2JEQA 3WQ5A 1BPLB 5A6BA 4R5EA 3HU7A 3DX4A 2X8RA 2VCCA 2W5FA 1EDQA 1GOKA 3J7HA 1I1WA 1VJZA 1PBGA 1KXTA 2WC7A 4AW7A 4LYQA 2D24A 1R47A 2PF0A 1PIGA 5AC5A 3ZJ6A 4DO4A 4W86A 1V3MA 1R33A 2ZXDA 2QMKA 2X05A 1HJUA 3AXIA 4FNUA 3O9NA 2PWHA 2WVUA 1QPKA 1IZKA 3VX1A 2YBUA 1B3ZA 3CH9A 4W5ZA 5E0FA 3GXPA 3A21A 2WVTA 2YA1A 4DUXA 2ZWZA 3RM8A 6A3HA 1JAKA 3DX2A 1TVNA 3ARUA 2A3AA 5DT5A 2XVPA 2BY1A 5D9OA 3F5KA 5TD4A 3BLPX 1US3A 4HZ8A 3VINA 2XSAA 5CZKA 4URIA 4JIEA 1UD4A 2XG9A 5A6LA 1KXVA 4UZUA 3L4UA 1E15A 1JD9A 1X6NA 2JIEA 3L2MA 4PCSA 2CKSA 3DX1A 3CUGA 1E43A 3VKKA 1H49A 1Q4NX 1ISVA 2OYLA 4E2OA 2Y8VA 4E8CA 4U5KA 2V5CA 1JI2A 1HTYA 2VL4A 4P8VA 1V3KA 4JKKA 1QI5A 2XFFA 5D9PA 3GXNA 2WAGA 4AD3A 3HMCA 1CXKA 4CN6A 1AQMA 4PMYA 5DF0A 2PB1A 3W0KA 2ZUUA 3WUEA 3CPUA 2BHYA 1EOMA 1QVBA 3SURA 1E72M 1TQSA 5GPRA 2QMJA 1HJXA 1QBBA 5EMYA 2ZX6A 3BVUA 4Y7EA 4B3LA 2ZIDA 3UEQA 3MKKA 3AXXA 5EFFA 1PAMA 5I79A 2E8YA 4PTXA 1TCMA 2E4TA 2F2HA 5I23A 1A3HA 1MYRA 3QGVA 3VGEA 3N13A 4HOXA 3GXIA 4RE3A 3BLBA 3EJRA 2X2JA 3PHAA 4GINA 1NWUA 2VRKA 3SCVA 3JUGA 4D6JA 3AZRA 4M82A 3SCNA 1JFXA 4AZBA 3AIVA 1E0XA 3EDFA 3BUIA 2NSXA 4ZE4A 1BTCA 2WZHA 4N0RA 1MFUA 4DO6A 1B3XA 1BGAA 2YDQA 1E40A 3GNRA 4QP0A 1E6NA 2C7FA 2RGLA 4FNSA 3PZUA 1HWWA 2C8NA 1VIWA 4AWEA 1ZJAA 4PMZA 2J7FA 3FXYA 4PMXA 2BY3A 2WHJA 3TONA 4QFUA 2XN0A 1NOFA 1QW8A 4H7VA 3LPOA 2XVKA 2J7HA 3PTQA 4PSRA 3AHXA 1KR1A 2DSUA 1EO5A 1TQTA 1B0IA 3OGVA 2YLLA 4HA4A 1CGTA 4YHEA 4EANA 1QNOA 2ZXQA 3VD7A 3N1AA 4OJYA 1FFQA 2VX6A 3SUSA 1NM9A 3NSNA 4M29A 3MUIA 2FH6A 1NARA 2VZTA 3WNLA 3VSTA 3KL3A 1ODZA 1CGVA 1WDQA 2D2OA 1V3IA 1KQYA 1HF6A 4XX6A 3BUDA 1H3GA 1BF2A 1BGGA 2BXZA 4ZXOA 5M3WA 2DDXA 4UFKA 5A6SA 3CV5A 1IT0A 1W1VA 3W82A 2E3ZA 3PZIA 3WH6A 3LRLA 3ALGA 3ZIZA 3CGTA 2OW7A 2J47A 4PUEA 3VSUA 4CCCA 1LWJA 1DWFM 4DUVA 4AD2A 2V5DA 2W66A 2VCBA 1ISYA 1UKPA 2CBJA 1J01A 5ECUA 5IXEA 1Q6FA 1ECEA 1E6RA 4HA3A 1TUXA 5E09A 2EO7A 3MANA 1VENA 3THCA 4UQDA 1DP0A 1UWSA 1E5NA 2VQUA 4L4PA 2G4FA 4GO8A 1TA3B 4AD5A 3VM5A 3W38A 4PCTA 4JCLA 3W26A 3WF2A 3WMCA 3ZT6A 4UR9A 2DIEA 4CD8A 1V02E 2WMHA 3TTYA 3PZNA 3FHAA 3K4DA 1MW0A 4NX0A 3THDA 4JFTA 5IHSA 4OKDA 3VNYA 3BGAA 5LA2A 3CHEA 3II1A 2YL5A 1V3JA 3SEPA 1ISZA 2F18A 3N17A 2V3EA 1FP8A 3TA9A 1X1NA 4OZOA 4LX4A 2WMGA 2YFNA 4MJ4A 5A3HA 3BLKA 1V6UA 2D0FA 3VO0A 1B3VA 4V28A 3WEZA 2Y2WA 1UH2A 1VFOA 4W93A 2VI0A 2JF7A 3AIEA 1EO7A 4PMDA 1GQJA 1H0GA 1JI1A 3VSVA 5DO8A 2ZX7A 1EHAA 3N9KA 1TQWA 2Y5EA 1OIFA 3W37A 1OSEA 2WBGA 2WCAA 1CWYA 3ARSA 3POHA 3GXTA 1ZBKA 1CTNA 2CBVA 4U5IA 2XIBA 1EDGA 1DHKA 4AIUA 1EQPA 4U2ZA 3QR3A 3IJ8A 3BSGA 5CSUA 1HXKA 1UA7A 3T08A 5HXMA 2TAAA 1KTBA 1ZL1A 3DDGA 3UETA 1GVYA 4F8XA 2XWDA 1W9BM 1J0KA 5ABFB 4XZWA 1J0YA 1LQ0A 3F5LA 5BRPA 1QW9A 4PSPA 4IPLA 1W2PA 2CHNA 1LLOA 1R8LA 1JDCA 2G3MA 3O2LA 3S5ZA 3SUTA 1BYCA 1MXDA 4CN4A 1A47A 2X2HA 1Q6EA 3DX0A 2CITA 5ABFA 1KCLA 2VZUA 1UOKA 2E9MA 3VIOA 2QPSA 2QF8A 4JL2A 2WPGA 4HP5A 3BMVA 5M17A 4GZIA 1KGWA 2WYSA 1V6WA 3B8SA 1HIZA 3T2QA 1VB9A 4D6CA 5A8NA 1CZ1A 4W8AA 3MS8A 4C7FA 1DWIM 2VTFA 1EH9A 2RGMA 2VZSA 4DWSD 4J3SA 1KWGA 2GJRA 2D20A 3ZSTA 4E4PA 1ITCA 1V08A 3NIYA 3PBGA 1BYDA 1BVNP 1H41A 4W84A 1FFRA 3U57A 2PBOA 2OWXA 3A22A 2VZOA 4CD6A 4B9YA 3VD5A 3UERA 1UR0A 2W4XA 5LA0A 1PEZA 3VPLA 1OWQA 2XGBA 2O9RA 2EPKX 3NDYA 5BYWA 3BH4A 4HMDA 1HXJA 3EJUA 4Z2JA 3A4AA 1KFWA 1GOMA 2F61A 3OIHA 3RM4A 4AEEA 1GOIA 4NZJA 1OGGA 4P8XA 1ESWA 1KWKA 1MW3A 3GXDA 1K9DA 1O6IA 1MWOA 4KWUA 3CTTA 3WMBA 1E6PA 1DWGM 1M7XA 4X9YA 4QLJA 2NW0A 2BVYA 2D22A 3OZOA 2YJQA 3W28A 3T0BA 4KRTA 3AFBA 1CXHA 1G9HA 5CPTA 3ALFA 2WHKA 3QHOA 2QPUA 3EJTA 5AY7A 5CXPA 1RP8A 4D6DA 4DO5A 3A24A 5A2BA 4TUFA 3RM9A 3EMCA 1MQPA
chains in the Genus database with same CATH superfamily
4L23A 4HBCH 3VRIA 4BKNA 1YMMD 3ZE2B 1CPUA 3X17A 1MCEA 1FNEB 3O41B 5AVTB 2PDPA 2WZ5A 1JJUA 3TNNB 3TO4C 4GG6B 3GFZA 4M62L 5DUBB 3I4KA 2Z35A 4MYWB 4LFHD 2R1YA 2YZ8A 4MGGA 2GVLA 4OCWL 1BXNA 3OSVA 3ZE2F 1WCBB 1SJEB 1BQHB 3E7JA 3GDBA 5DD5L 1KM4A 1TIWA 3WFAA 3NRQA 3HG5A 4A66A 1NCTA 4G6JH 1XBVA 1DWAM 3NAAL 3MRMA 1WKYA 4GG6F 4JN8A 1JQXA 2BSRB 1P2CA 5CJ8A 1U8NB 4PRIB 3AITA 3SIMA 5C0DB 1GEQA 4D0CB 2F8IA 1HILA 2J25A 1CCWB 1YDVA 3S9IA 2PI6A 5EU3A 1SVBA 1ZVSA 3IPEA 5I0YA 2Y7EA 2OJPA 1VFFA 3S42A 1OFEA 4XH2A 4DWDA 3EBGA 1KBBA 1DN0A 2DOCA 5FX3A 3MV8A 1E9QA 4PJXA 4XP6L 1OAQL 1UWGL 3RAJH 4BK8A 3O2DH 3ETTA 3LCIA 4BUQA 2NWSA 3WLOA 1AC6A 1V6YA 3OG4B 1W8NA 2FUQA 4R5TA 4DAGH 4R96A 3HRZA 1EWDA 3PQYB 2ZAHA 2P5PA 3JVAA 2C18A 1ND0A 4GQZA 3L66A 1BXVA 2L3BA 1QSED 1HAWA 1SY6L 4AC2A 3N15A 1ZLEA 4LCYA 4WI6A 3M17B 5DJ2A 2L7EA 1X1OA 3FIGA 5ERWA 3NK4A 1UM4H 1WAUA 2ZKWA 4N8CL 2YS4A 1JTPA 3QO0B 4JZOB 2NYKA 3X1FA 4JZJC 3VUPA 3DKLA 3EYFA 3U4FA 3LRSB 2DEPA 4YEEA 3ABRA 1EWHA 3UADA 2PTXA 1BJMA 2YPVL 1CECA 2FDMA 2VERN 5DD1L 3WTSA 5GHWL 5I9QB 2HE8A 5I1JH 3UTQB 4G70B 4KY2A 2BS9A 3HF3A 3P14A 1HXYA 2ACRA 4AVFA 1Y6NR 3IK2A 3UAEA 4MYAA 2Q10A 1IZJA 1JCLA 4E3TA 5BW6A 4FCHA 4MMZA 1R19A 2VISA 2JELH 1YEFL 5CEZE 4P3CL 2P7TA 4GSXA 2ZXBA 5IY5B 1J9YA 4YIQA 1GGUA 4PRBA 3QUKA 1SZGA 3WS6C 1UASA 2OTWB 4RA0C 2F1EA 3F64A 1HU8A 1SOQA 4Y19D 1QLFB 3NN8A 2Y6ZA 5J6HB 4KGJA 5JW5A 1AR2A 2NXYB 4GUPA 3NOIA 1H11A 1EJUC 2ATPA 2YB1A 3PJTA 3C5ZC 1VEOA 3C56A 4P4KA 1NCCH 1GZQA 1J5HA 3K4AA 4KNUA 4TIMA 4WXZA 1U1UA 4O53A 3IWUA 2I25N 1ZS2A 2YHGA 3MUUA 3JWNE 3C60D 3L7RA 3QRBA 2CWRA 2WYIA 3HBQA 3UGUA 4KKBC 2C3XA 1N8WA 5JIKA 5JPNB 1FP9A 2NY1C 1D8WA 3ZVIA 4ATDA 3LD8B 3GI8H 3S4SB 4HKBA 4PS3A 1RY0A 3UWWA 3COOA 2ZOWA 1ZFJA 5CIPB 2VZVA 2ZSVB 1W1TA 3LQZA 4I77L 1KB3A 2HXAA 1AG1O 4NJHA 4B3ZA 5FB8A 3NCYP 4BCYA 3LYEA 4QR7A 1KTDB 2VLJB 3MNZA 1TA3A 3WEXA 4Q9QL 1G4SA 1KTJA 1A8ZA 4YC2B 1EXPA 3VB9A 5JQIB 4I2XE 2NZ9C 1LILA 3BH8B 2XX0A 3GVVA 2XPKA 1KCKA 4C4KT 3K5SA 2FFIA 1UXWB 5D2LA 4PJ7F 5HINA 2XVNA 3PSWA 1E4XH 4OT7A 5SV4A 3SQOL 3FONB 3CAVA 4U1SB 1IQDB 5AFAA 5T1KD 5JH2A 2ICES 3IGFA 1SO6A 2Y6SC 4APQC 1S9YB 3CQHA 3VXUA 3E1F1 5JTWA 4KROB 3EWZA 5DJCB 1XGYH 1FVCA 5H35A 3FN9A 4UFJA 4R7WA 1ZV9A 5GIRA 3SUWA 2G5UA 2ZYRA 4XP1H 2H7WA 3MRJA 5BJTA 3IAPA 2VR6A 5C0JB 4U6VH 5EZPA 4OD2A 4JVPA 4E0RB 5U7SA 1XH3A 4NKOB 4LUTB 1UZDA 1PX4A 1KG0B 5DCCA 1AD9B 1NFIB 4F9DA 1DJNA 3CEPA 3MZGB 4DTGH 4CADA 3RFRA 4F8PA 4AAJA 1DQWA 3CJPA 4HSAC 5DVLA 4JTTA 5LNUA 2GUYA 2I5IA 4PGEB 3I6KA 5EMLA 2QCDA 5DJ0A 5IBLD 1EUNA 4BKLA 1N18A 3B37A 1FORH 2QHRH 2VAAB 1OF0A 4NZRL 1GXEA 4M3PA 1P7QB 3QZ6A 2ZONA 3EDDA 3ANVA 5IVOA 1S2AA 4RDWA 3M64A 2A73A 1YDPA 1KV3A 3L4ZA 1LK2B 1KO0A 2QUNA 4F40A 3DETC 5KG9A 3VOCA 4LP5A 1IXOA 2HKHL 2MQ0A 5DJ8B 1G7QA 4PVBA 1J18A 1ZV2A 4HOZA 1A6WH 3L2LA 2WMJA 3RMEA 2EO1A 3CFBA 4PRDA 5CCKL 1GZHA 2O30A 4XPAL 1QUMA 4GSDL 4UOW1 3EBAA 5GGRB 2X38A 5TQ2L 1KTLB 4CQ9A 5LG6A 1ZUAX 4RZKA 5E2UL 2Q3OA 3FTSA 3ZGHA 4KBPA 5FPIA 2Y5TB 3QQNA 5AD0A 2X1PA 2YL8A 4D0DB 2A9NL 4NC2B 4ACYA 1ZU8A 2F7PA 5GGQH 4PUJA 2X4SA 2FO4A 4G2DA 5DHMC 4WO4C 3QUMA 2C9XA 1JCTA 3HB3B 3H24A 2GSIA 2RBLA 4JJHA 5AAWA 2ZP9A 2Q7YB 4Y2DC 4WHYH 5DSCA 4G83A 3HS8A 1XGQB 1NBZA 3LHPH 2DQCL 2SODB 2WC4A 1BVKB 1HQTA 1X1ZA 1OC5A 4NF7A 3D5OF 3TYGH 1PZ0A 2EXSA 3FV9A 4WD0A 1AGEB 4FR6A 4JQAA 3D4CA 2B59B 3JVFC 2CKBA 4JM2A 4XI5D 4FLHA 4JRXB 3ILPA 2WNXA 1DZ0A 3WSQL 1IMHC 5MHBA 3NIFB 1XL9A 3WFZA 4UOQA 4YO0B 4ZTPL 5I7GA 3HVNA 5F4SA 3A6OA 4OCYH 2NY3B 2L7UA 4YLCA 1II4E 4RFNB 4X42A 3BZJA 3DHPA 4PTDA 1J79A 5F1SA 3QSRA 1U8PA 4DGWC 4N3UA 2EE3A 4L8SC 3WIHL 3NGFA 1FH8A 3O05A 3M43A 5CN1A 1UYQA 3NIFF 3Q05A 1NDTA 1LM8V 1HZHL 3A67H 2Q01A 3DFSA 2J43A 4ZVJA 3F6LA 5C0RL 3MLXL 3STPA 4OZHA 3NYDA 3G5XA 2WQWA 2PNDA 1Y0LA 2OJ1A 1H7XA 1AZVA 4NY2A 3IE4A 5IM51 3T0EB 3FVMA 4FK9A 5C70A 2ZZUT 4HKPA 1XAKA 2GK2A 4TOYL 3Q65A 5D8JH 3EYUL 1I9IL 4MWAA 2B7QA 5DD6B 3DX6B 5IM7B 5CUSL 4NKDB 2XTKA 4YHZH 2QJIA 4JW3A 4NFBA 1LDPL 5TH2B 1ZHLA 4M6QA 2ARJB 5C3TA 1SF3A 4HT3A 5BZWA 5E9DA 4U4BA 1ITQA 3QPQD 4Q8OA 1HHJB 1KV5A 2WNGA 2EEBA 2V2DA 1PXGA 4HPJA 1NDVA 1E9YB 2JEPA 4Z78A 2TODA 5KVEH 2ZNXA 4IP7A 3MV9A 1X38A 5KSBB 5D93B 2F8XC 1HFUA 2ARJQ 1GGYA 3UZVA 5SX5K 2J78A 2LV4A 1SEBB 3GYCA 5MEOA 4CNPA 4FO4A 4OUUB 2OMXB 3AIBA 4HS8L 2NY7H 3WEOA 4K8RC 3DU0A 2DSVA 2R2BA 3G18A 2YZ5A 1DN2A 2QPFA 3IGSA 3SN1A 3V55A 2XA3A 2E5EA 3MLWL 1DLHB 1OANA 2H0FA 4ZZ9A 3ZE1E 2Z31B 4IZGA 5FA4A 3QXVA 4JY4B 1RURL 1KJ3H 2XYCA 1J9SA 3N9GH 1JCYA 4XB3A 1BAFL 3DIFB 3OR6B 2WMKA 1QASA 2J8TA 1W2KT 4NPYA 1PLGL 5TDPA 4RE2A 4ODHL 3BP7B 4JX0A 2OSLB 3S7GA 3BPNC 4EN3B 1AFSA 4EBQL 1M9SA 4AZCA 3E3QC 3OSKA 3OJDB 1QD0A 3OQ3B 3T40A 4NQEE 4I5RA 4PUUA 1QEWB 3J07A 2XOTA 3MLRH 3OKKB 1GWJA 1HHIA 5HD8C 5HYQA 4UM8B 3IJ9A 5EOCH 4YUEL 1P5BA 4R97B 4RE4A 5C9RA 2L8AA 3TNMA 1SDYA 1TVHA 3L2IA 4MCYA 5FJUA 2CRYA 3ET9F 2XX1A 2Q71A 1CLCA 4Q8UA 1DE6A 4AQAB 2FJHB 1BRLB 4N90D 4ZDHB 1MI5E 5AVZB 5I76A 5KVMC 3MO1A 1DJSA 1DVFA 2XN1A 4JOMA 3KE0A 4PWEA 5F3HA 1N82A 5E8PA 3DJRA 3GLAA 1W5MA 3W11D 4IL0A 3M0ZA 1DQKA 2NY0B 3ULUE 2ERJB 2VLKA 4BZ2L 1H8NA 5ECGA 4DBDA 3D33A 3K6NA 3PWAA 2DLFH 1AQDA 1A6TB 4NQVB 1XLBA 3CSPA 3Q3GB 4TL5A 2V5MA 3A4WA 4XHJC 3S34H 4DN3L 3TSMA 4YNGA 3MSGA 1GHFL 2NY2C 1W3KA 3CVHH 3K2UL 4OTXL 3IJIA 1JNLH 5GZOC 4LZKA 3FQUA 5JQ9A 1Q9LA 1S4IA 2A3EA 4U7MA 3VH8A 3RL2A 4HJGA 1NOWA 5I1EL 4F37F 3BLEA 1EX5A 4RXFA 5D96C 2FJGB 5T9CE 1WSST 2HVJB 1G7MA 3WMQA 1CFMA 2E7MA 5FUZH 2QDGA 3VI4A 5KETA 4MNHA 2W94A 3AHYA 2IBGA 2DQGL 1KRAC 3OZLA 1G7IA 1U9KA 3SPCA 4IBQA 2PCPB 2K6ZA 2ZC8A 1ZEAL 5BOFA 3W76A 3KMDA 2XWEA 5FO9B 4ADTA 4X9BA 4JJ5A 5AC8A 2PPEA 3RIAF 3QWOA 4DIXA 2JFEX 4HKJA 3TSBA 1U21A 3UJIL 4M56A 3IRZA 4NUJA 3T4WA 4LVOB 1IFHH 2JXMB 3URQA 2UXGA 1WDDA 5XIAA 2VDGA 5LHEA 4X4YB 3SYCA 3ES8A 4W70A 1N4XL 2ACQA 4P2OA 3OLEA 4N2HA 1XXDC 4ZODA 3W1ZA 5TK2A 5KMYA 4R85A 4P2RA 4K94H 2AEOA 4WK2B 4EE9A 4UANA 4CW1A 1FL3A 2FLBT 1ECQA 1O5DT 1RZKH 4LHQB 5FYKH 4N5UA 2F7RA 4BWUA 4UTWA 1JGEB 4YNYB 5FI8A 1MVUB 3CPLB 2E67A 4DF2A 4U10A 4X60A 3P11H 4D8PA 3RZCB 3DXAA 4HIXL 1CFNA 2OEKA 3K4ZA 2MNUA 1UTDA 1VHNA 4OU1A 1V3MA 3BIBX 3K2KA 3WHXA 3AXIA 1DQML 1DDHA 4KFPA 3ARGC 2WVTA 1QPXA 3AB0C 3DERA 5DJYA 5LNSA 2Q8BL 3W7PA 2EG6A 1EAPB 3D25A 5HGHA 4NAFA 2EEFA 2D7TL 4BQ9A 2UVEA 5DWUH 2XG9A 1DJYA 1TZZA 2NNAA 3QEQA 3L3DA 1CD0A 3I75B 4H2HA 4NFCA 4F8QA 4HHMA 2XZ7A 1HTYA 3HW7A 1JOIA 1ONQA 1HS6A 1CXKA 2PDKA 4G8EA 3MV8E 4PJXE 4YL9A 3BHBB 1OF8A 5I73B 5HGDA 1FAIH 4XCCL 1THCA 1JHTA 1DFXA 4JFDA 1YY9D 1U2HA 2Y63A 4P3WA 3E6FA 4YHNA 2BIOA 4POUB 3NQAA 5CZXD 2DQEH 4HZMA 3WS3A 4GPVA 2WZHA 1EEPA 4ZS7H 2QUMA 3WD5L 4WENB 4AENA 2Z4GA 3TJ4A 2RGLA 4DXVA 5KSAB 1PB0A 4G9DB 4ZFZA 4K5NA 3VWJC 5DC4B 3GSOA 2XN0A 3SDCD 2BNUA 4F5CA 3AHXA 2DSUA 3UACA 4PV8B 4OIBA 5JXQA 3MZNA 2DJXA 5EOTB 5KBPA 1N5YL 2LLEA 1U92B 2VZTA 4PJ9D 3L3HA 3KYKL 3RWGB 2X4RA 3HBPA 5IP4A 1BGGA 4JPKL 1OOAA 4Q9RH 1E1CB 4ZXOA 2H47C 2VUOA 2BPBA 1CL7I 2Q8AL 3C2AH 3U9WA 3OXRB 3H22A 1HOEA 2OW7A 2ENPA 4BSJA 4PUEA 4DB7A 3BG3A 3P0VH 1IT7A 1LWJA 3GUTA 1I4FB 4DZ8A 2W66A 3F58H 3QCUH 4L9LA 3CMFA 3O16A 4XOCA 2HFGL 4Q8QA 4I18A 5C8JA 2TRYA 5CP3H 3RKDD 4RFEA 2R1WA 2G4FA 3VXTB 4JCLA 4P5SA 2YD8A 3JTBA 4ZB5A 4NO3A 3PABA 4BH7B 4NN5C 3UR2A 3RGBA 4PD4K 1V3JA 3P4MB 3IIVA 4L1XA 7TIMA 2BNQB 1CLOL 1OF2B 3SY0B 2BX5A 1MCSA 2JIXA 3GC5A 3VO0A 4A2MA 1UH2A 43C9B 3BW3A 1JI1A 2JCCA 4B27A 1UIOA 3GGWB 3QQ9C 3VXMB 3WLTA 3CC5B 3OKOA 3PL6B 2XIBA 4RZBA 1DHKA 4IXHA 1MUJB 1KMGA 2AJZB 1AFVL 3H3PH 4FP8L 3I02A 1KV8A 1JNHA 5T3ZL 1KTBA 2CZ5A 5HYIA 4KZCA 1W9BM 5ABFB 1BXXA 4GKOA 3F5LA 4PSPA 3CEUA 4LSTL 2FBJL 5HI3C 1QTPA 2KZ1B 1GOFA 4C5ZA 3KBMA 4R7OA 4RIRB 3WLNA 3PWPB 5D5MA 5M17A 4GISA 3MQTA 5GJTL 3O3DB 3KGUA 1V6WA 4FOUA 3V79C 3C52A 3ZS4A 5BUGA 1SM3L 3VTAA 4WK4B 2BASA 3NIYA 1FPTL 1T7ZA 1BYDA 1UWXH 5IWLC 1FFRA 5FF4A 3UERA 1UR0A 5C9JA 3BIKA 4A7TA 4MHBA 5JHLL 1SXSA 2POTA 1BEYL 4FJ6A 3VB8A 3CH1B 4N0UB 1ZCOA 4X50A 3W28A 2IH9A 3IBEA 5AY7A 3JV6B 3PUUA 2A7NA 2PU1A 3EMCA 1SMAA 2BODX 3NO5A 3U7YL 2VR4A 1XR2A 5L4JA 2O26U 1XH1A 1BLIA 1OAYH 1FZMA 4G7QB 3IU3A 4R33A 2OJEB 5F7KC 3IJYA 4LMQE 4G8GE 1CLYH 1C8XA 3MA7B 3EZJB 3GJFH 3GMPA 1TVPA 1QFWM 1OAZL 5AZ0A 1H3TA 1GTEA 2GGEA 1RA5A 2AXGB 2YPLD 3IVKB 3W7LA 3E12A 2C9SA 1OTSC 4JO2H 3AU6A 5CD5C 3ES6A 4MNQB 4WZ9A 1EVTC 1NGWA 3AREA 3ZLHA 2AXJA 3BZEB 2H90A 3VI2A 1H4PA 1MLBB 3VFCA 3WF0A 1KTCA 4YIWA 1M6UA 3OB8A 5LIKX 5IVXB 1DQJA 1UA6L 4D6EA 4UTFA 3SB0A 4LARH 3OHXB 2K4AA 4CC0A 3OMAB 1KENL 4H9TA 4YAQA 1UD8A 1CMOA 1NCGA 3C5JB 1I8LC 1SFDA 2WSDA 3WJMB 5L9DH 1MLCA 2VGGA 1LG1A 3BD5A 1A5CA 2CCRA 1OQFA 5MHSD 5IVXF 4D9QE 2F74A 4DI9A 5J9PA 3G0UA 4PJIB 5DGRA 3WG6A 4DBSA 4K5MA 5IFHH 1A53A 1F6YA 5A94A 2GIXA 5FECB 1NOUA 3VKAA 3L5WA 3NABL 2VGLM 3W56A 3BOVA 2BJML 1E4WH 4PJIF 5IB3A 4JB9L 5CAYB 5H6HA 4ZX3A 1CTMA 1E9LA 2C1HA 3VX0A 4Y6GA 3FT4A 2ZF8A 4K36A 1EC9A 2J6WA 4PJAA 4H9VA 1G7HB 3W4RA 1UD5A 1JCVA 1I7ZB 4LBSA 3U6RB 1DPMA 5IHWA 5IUSA 4P5TB 4YOKA 4OV5B 2X4QB 1NMAH 4GRWB 2OMVB 4OV6F 1LCOA 3A3YB 2PC8A 3QV9A 5DQDH 4QCIA 4K5PA 3VFGL 4B3VA 3GNPA 3CT7A 3TBWB 4TNGA 1RALA 5KINA 1IQ8A 3PGFL 1F7BA 3CK5A 1B3OA 1HNFA 2HG5A 3F7KA 5K9JH 3K6OA 5DLCA 4IHOB 4IISA 1TJIH 2A3BA 1AANA 4BF7A 2AJYH 1FFTB 2H3KA 3UG8A 3CMOH 4M8RA 1ERNA 4NXSA 1IR2A 1T8XA 4F9LA 3SCPA 1MRCL 1KJ2H 1FL6A 2AKRB 2VDRB 1NFDB 2OO6A 1JPDX 4LSRL 1GL4B 4AU0A 3W6YA 3S1GA 5A8OA 2ZYFA 4M4RB 4UQ2A 4MWAE 5B8CA 3WE6A 4AYDC 2O56A 3ZUNC 4GKTA 1YEKL 1NGXB 1XLMA 4HWBL 4BFEA 1WX0A 1FIGH 1NFDF 1HEHC 5CLZA 3WLBA 4O2CB 2CM5A 3EYQC 5KZCD 2ZUMA 2YARA 3OZ9L 5FEPA 4LLUB 5F72S 1I2QA 3A4XA 4GYBA 3SIZA 4TQ8A 2EXTA 3HZVA 2YCLB 5JOFA 4ODXA 1U3HA 5EPDA 3VG9C 3UTZA 3TVMA 3VCLA 1R9FA 1A6VH 5TDOB 3TA4D 4FYTA 2OQYA 3JTTA 3VU1A 3WO3B 1MQQA 2CDFA 1T1WB 5EBUA 3W5MA 1T6BX 2GPZA 3R6IA 4LKCA 3V0SA 2IANA 3S9DB 4X83A 1R0MA 1KF9B 1E6ZA 4OCXH 2Z1WA 2VLRD 3PP3K 2BO0A 2NX1A 3QHFH 4LVBA 4G1MA 1E6SM 4N2LA 3EWDA 5F9WB 2OL3L 4WW1A 5INCA 3IT8D 4Q4OA 1WZLA 3JWOL 4U1KA 5FW8A 4H40A 3ZRFC 3BCDA 4ZZKA 4LBEB 1ZZMA 3S35X 1MCKA 2YD3A 1P48A 3KTSA 4K9EH 3LXBA 4LU0A 5BU9A 3M1BB 4TNVF 3UG4A 3T09A 1UZHA 1D6EA 2O5ZH 4P57A 2KZBA 4I5UA 1YEIL 3BVTA 4PRPA 2YLAA 4AMKL 1J5OH 5EG6C 1HH6A 2J1YA 2DZTA 4YTQA 3QXAA 3WKYA 4Z9KB 2PDJA 4KK9D 3JR2A 1I2OA 4MDPA 1NDGA 3TTEA 1UFUA 2IQTA 2UYLA 4FXKA 3QUYD 4Z23A 4MPQA 3EFOB 4Z7QB 3GSVA 3DURB 3EGSB 4OCRL 5FK9B 2QQLL 2XY1A 4J1OA 4XNQA 1TJGH 1UOWA 1OFQA 5C0IA 5D05A 1IWPA 4IQDA 1WE5A 3EH3B 4DFHA 4QJ1A 3O6ML 3SOBH 4IBYA 2PWVA 4Z7QF 3BYYA 3OM3B 2HKFL 2WNWA 1ZAIA 3LHTA 2WVVB 4U1NA 2R7EA 4H41A 4QRTB 2AI0H 3WQCA 4W4NA 4AWUA 2VLKE 1EXHA 1CF1A 5A6MA 2IH3B 1MIEH 3P2BA 2OX5B 1CYWA 2WZTA 4POCA 4N7QA 3BGFB 2KPWA 3OBAA 1CZ8L 2VC5A 3W7MA 2N0MA 4OFQA 3VCRA 3U5YA 3W88A 4UM9D 1LTDA 1RUQH 1A1OA 3PNWB 1TPDA 4J2QA 4OOUA 5KZDA 4M6OH 3H9SD 4TQIA 5K4ZA 1UYWL 4GNVA 3US0A 2Z9TA 5I19H 2QTEA 1OPGL 3SPHA 4QT5A 3M44A 1CB2A 2WV3A 1WAEA 1A9BB 2GT9A 4QGCA 5GGRY 1AZZC 1QFHA 3PXLA 2EDJA 1R3KB 3APMA 4A3RA 4CQAA 3VE7A 1XF2B 3VI4E 4KPHL 4MJMA 1BLNB 1HHKA 2JIWA 3Q1SL 4HN4A 4G7VL 3GYRA 1UACL 2O6PA 5LWYH 2W65A 1NPJA 5EORH 3QFJB 4KZ0A 2ZKXA 4XMPH 2BXVA 3HIJA 4JTKA 5KJRH 1EDHA 1FYTD 2G96A 5AWNL 2EDBA 1VBJA 2HS6A 3F2LA 1M05A 4UQAA 3V4PB 4YLWA 2BK8A 1KGUA 3ICJA 1N6QL 4ACZB 3JS3A 2XHNA 3O0RL 4FQJL 5JXEA 3U4BL 1A65A 3WJJA 4XCEB 1BKSA 4EOUA 4K5OA 5B39B 1E27A 3GHBH 2KBGA 1KCVH 2XZZA 4H88H 3PV6A 4FYSA 2O6DA 5D7LD 1EHNA 3C0JA 3W7CA 2ISDA 4LVNC 4N6QA 4U0QB 3SFWA 5FUCE 1TYGA 1VADA 3S8HA 1FJ1A 1WAPA 5EU6D 1LO5B 4R4FL 1UKOA 4DKEH 1CLXA 1POJA 3BICA 1VGEH 4XD5A 4HA1A 2K6YA 2VRAA 3MYPA 4KAQH 3TO2B 3E0FA 3FQNA 3B0YA 1OIOA 5HYJA 1EZVY 5H94A 3RVTC 4AQ1A 5HI5D 4C6QA 2IDTA 1TZGL 3UPAA 4JNMA 5IQLA 1NQKA 3FSAA 1L6FA 1BQLL 4C6IA 2HT2D 2R23A 4J2MA 2XWCA 2EADA 4V2CB 2BZNA 2YCEA 4JANB 3DXAE 2J1KA 5ESQA 1T22B 2ADIA 2QCEA 2WYZA 2AL1A 1HJBC 1GJPA 2ZZ1A 4A8RA 2IMNA 1ZHBA 1TV5A 1BGXL 1L8PA 5B1BB 5DO2C 1PQZB 1KB5L 1RBOB 3P7YA 5AC4A 2EZ0C 2KL6A 1BVLA 2OMZB 3MRKB 1VIZA 4O15A 4AGPA 2QGEA 3EPOA 1B54A 4HWNA 4OKVB 3HI6H 3QDJD 3RX3A 4J4KA 3ZKND 5DYOA 1NGYA 3ARDA 3QEQE 4GKLA 4CMMA 4BQ8A 2MKLC 1XHGA 3NQBA 1UQSA 4NDMB 1E4NA 2R69L 1AHWA 4JFDE 3BW2A 2PTWA 4AJWA 2UZ9A 2CZDA 4RPQA 4ODWB 4LK4A 3BUTA 2XM2A 3DGRA 1XJBA 5A8GA 3RLVA 2INFA 3WDJA 3QI9C 2VELA 5DK2B 2P8MB 3V7PA 2V2CA 3OKDA 2CC0A 3FPXA 3N3MA 5I6MA 3MR9B 2W0FA 1NP2A 3ZR4A 4PMQA 1RJZB 1J1XL 2H1XA 4TS6A 3S1WA 1IIHA 2KZHA 4LOVA 4NQ1A 1XWYA 5K39A 2FTAA 4GUOA 5I1HH 4AZIA 2L04A 5JDSA 2WJ7A 2AJSH 4TOQA 4D7BA 1N0LB 3KHDA 4S39A 4AISA 3HFYA 4AEHL 2J56A 1MDTA 3UA4A 4LGXA 2V6AA 3IRCA 3DBPA 5B7FA 1L9OA 3L21A 3ITOA 9XIMA 1SHMA 3RWHB 4I3GA 1Z9NA 1K4CA 4TVPL 3NFPB 3LAFA 1X7QB 5JYMA 4H0IA 2BFGA 4HJ1A 3LOTA 5TFSL 2H32A 1CB4A 2JKLA 3G6AA 4QDGA 4NB7A 3R06B 3NA9H 3DVIA 3QORA 2P48B 4F91B 3QZWB 2H3XC 3WIIL 1OBAA 5DMJB 1YECH 1OTTC 2JB6B 5AYUH 3GBDA 1VYSX 5FV2A 1OP3H 5CCJA 1B30A 4I0PC 1U83A 4JFXA 2G95A 2ZTBA 3OA5A 3THUA 2BNRA 4NT6B 3CB8A 3TWYA 3WQ6A 4U3CA 3L4CA 2JCCE 3OPSA 3SE9H 2UZXB 3DIPA 2HKAA 4DWSA 5E6IA 4QRRA 2VQTA 4OBTA 2Y07L 2AQNA 4MCZB 1AS6A 4LYPA 4ZD3H 3NQCA 2Z6IA 4G6FB 5ILTH 3TR9A 3ENLA 2CLRA 1ZBWA 4O4WA 3BE1H 3S96A 4NLHA 5DJXA 3L1GA 2L7QA 1SUJA 1WFTA 1TV7A 4YYCA 1A7PL 5J12C 4DGYL 5JO5A 4M51A 5CKAA 4MA7H 3D18A 3FK3A 5DZAA 3Q1EA 2VD9A 1IVTA 4AZ7A 5D5ME 2C6QA 3LCFA 3O2WL 1HJVA 2XWBB 4WUUA 2MOGA 1E6JH 1WV2A 4HN8A 3SDXB 5KANG 3QUZD 4NASA 1DUZB 3SN4A 4GSUA 4PJDA 2J9YA 4KCUA 3FL7A 1W8SA 3NGBB 3T4AB 4FXTA 4F58H 1OD8A 3HS0B 2OBGA 2VFIA 1O94A 2JTYA 1JRCA 5AB2A 1A6PA 1JZDC 1UEMA 5I75C 5F44A 4ICWA 4P23D 2CW6A 4FMVA 3OG3A 2C1PA 4KK8C 3GFXA 3SDXF 2IIJA 1FWEC 5IZ7A 2OMTB 1IX2A 4LRTA 5C0AE 2K70A 5TQ0L 2AANA 3L95B 4R7NA 3HI5L 1VACA 3VFWA 5I5RA 1HSBB 1W0MA 5EFDA 1M7OA 2GKIA 4PWHA 3AXLB 8RUCA 2Q2EB 2PURA 1JMXA 1PZDA 2XJKA 4MS8D 5FKYA 5IQMA 2O9OA 1KXTB 1JPSL 2OKOA 4NM8L 4JKPL 5A6BA 4K15A 1CFVH 3F4DA 4P2QB 4LPTA 2LAGB 3V0VB 1ZHKB 1EDQA 3NIGB 1IGCL 3O6YX 3EOBA 4JFYB 3EKCA 5AC5A 4XZNX 4W86A 4KRPD 1T3FB 1CFBA 1XTMA 4HVXA 5FACA 4FQPA 1K4DA 1I85C 4EPEC 3URBA 4JTLA 1U8JB 3BPCB 3K1KC 3UGVA 5GRUL 1QSEB 1V55B 1OK4A 3NIGF 5FLVA 1UW9A 4JDEA 1J1OL 3IDJB 3QH2A 4M6NH 3FTVA 4HFWA 1X6NA 4WRLA 5DS8A 3E0LA 4U5KA 1FF5A 4FA6A 3L3OC 4RNIA 2QJGA 2E68A 3ERPA 4XTRD 1OFAA 5AHLA 1OYBA 1CT8A 2HCZX 2FATL 1TQSA 3RWCB 5GPRA 4OECA 1Z0NA 5FYLL 4B3LA 1SPQA 1Q90A 1KEML 5I79A 2E4TA 4G71B 3DPBA 2F8OA 2NV2A 3C6LD 3J8F7 3TR2A 1WA3A 1UOLA 4Y5XB 1NWPA 1TMHA 2QKIB 3RYMA 3U9PL 3MNVB 4Y2LA 5JHDB 4OQ1A 3AZRA 3PWJA 1A4CA 4M5TA 2Y6TE 4ZE4A 4L1HA 1F02I 1WWCA 2YDQA 4IRSD 4F9PC 3GNRA 1CK0H 5ITBL 1K3UA 3HB9A 2HLAB 1R9YA 3D0LB 1W17A 3T5WA 3ECVA 4L3EB 3WLRA 3H42L 1UGNA 2QAPA 3H7UA 3HE6C 1AODA 4OJFL 1RU9H 1H15B 3WIFA 4LOCA 4Y19B 4GKSB 3OKLB 1Z9AA 5J1SC 1W72H 3E96A 5CJNA 1B0IA 5TDNB 5BV7B 3MLSL 3UYRH 2YLLA 5GRYA 1QNOA 4NP4H 4C90A 4NHCL 2WNNA 1FKWA 1J5IA 3DRQB 2AAVA 1OX4A 4EPKA 4P06A 3O8XC 4OLXL 3VSTA 4Q4MA 2IMMA 1X5KA 4ZMYA 1TLMA 4XX6A 1O0VA 4N1EA 1MCPL 4R3UA 3OF6A 2E3ZA 5GRWA 2PYED 3ALWA 1AJ0A 5IXEA 1ECEA 3DDMA 3VFOB 2PABA 1KIRA 2IPWA 2MOQA 4PUKA 1RQHA 3R0NA 4BCXA 1SJVA 1A5OC 3CLFH 2YAQA 1NL0L 1MH5A 3SSGA 3FULA 1JZEA 3T2NL 3V6OC 3NVDA 5IHSA 2F5AH 2I85A 4WHYG 1TJPA 3QIWC 4L29A 3B8TA 1S8DA 4OZOA 1CICD 1C1EL 3UCCA 1B3VA 3SJVB 3U0HA 5LNRA 4X8JA 4HOMA 4B7IA 3M41A 1T03H 5KYYA 1SGKA 5HK4A 4WU5A 2DD8L 3P4OA 1OARH 3G9AB 2CBVA 2PTZA 1T2QH 1MF2L 1CL7L 1OALA 4FQLH 4U2ZA 5BUAA 2CO2A 3IS1X 2HE5A 1LQ0A 5IKCA 4KETA 1CDCA 4XAGA 2NSMA 1MXDA 2ENJA 1Q0XH 1A47A 3HVDA 2WN3A 1NAML 3VXOA 5F7WC 2WPGA 4TQEH 3I9GL 3VGAB 3BMVA 3IXTA 2E27L 1E65A 1D6VH 4LHUB 1YPIA 4JTHA 4LDLB 2IANE 4N0CC 4IFRA 4ZG1A 1T21A 3C3UA 2G2RA 4NYLA 2ZOTA 1KWGA 3H9YA 4HWZA 2A6DB 4UWMA 5D55A 4L8BA 4FJZA 4LIQH 1U42A 3BQUC 2V37A 2ICCA 4YFLI 1XBYA 2OWXA 4B9YA 4W4OC 3QUGA 1PEZA 3O6LH 2WUBL 3EJUA 3A4AA 1OM3H 3E5PA 2OA9A 3OIHA 4B0MB 1TTPA 4ANWA 5D71H 3FGCA 4HG4K 4MTMA 2WZ6A 1FZJA 1P1ZB 4XZIA 3ZL4H 1CXHA 4YZFE 4WWKA 1Q0YH 4K7FB 3EYSH 2WHKA 1NVMA 1T0MA 1KBIA 3GZPA 1QFWH 4Q8WA 1ROWA 3JWOC 5CD3A 3QQ3A 1FWTA 4DP1X 2PXYC 3Q2VA 1MAML 1KRBC 3QVAA 4H25B 4PRPE 2G60H 4RBPK 3LM7A 1A5LC 1A3RL 2XLLA 5I6LA 1X5IA 4UDUA 1S3TC 1WXYA 1GHSA 1NKGA 4IQEA 1G9ML 4CNNA 5DK0B 4CLMA 3K72A 4G8FB 5CWSA 1MJ7H 4LV9A 4IGBA 1EP3A 1FZKA 4AG0A 2V9UA 4R7DB 5BNKA 4WKFA 3UAJA 2YN3A 3GNXA 4JNZA 3D5HA 2C5DC 5A6TC 4AQOA 4E2BA 1BZEA 4D1JA 3C0SA 3DUSB 1GORA 2AQ2A 1GYCA 3WQVA 1A3LL 1T89A 5CINH 1IEAA 2QVMA 3DGDA 1KM1A 1RUKH 3TQVA 4OI9A 4JRYB 2BSDA 3GRBA 2X6VA 4F7PB 4A7QA 4FQIH 3MMEA 4G5DA 3L16A 1CI1A 2VE6B 4G8TA 3NXLA 2IPTL 3FFCA 2EE9A 2NVCA 5KJ7E 3NPUA 2VDKL 1D5MB 1DCEA 3WD1A 5BXSA 3A5VA 3LDBC 4OLUH 1FVEB 2YOAA 5IBXA 1XIMA 4C6LA 5KAQG 3UBXB 1U8IB 2IG2H 4Z7WE 1ONRA 1UWUA 2QADB 3N25A 2OP4H 1TPB1 1IV8A 2KERA 1JRHI 3AZUA 4LESA 4J8RB 1WWAX 1H5BA 3T6XA 1QABA 4E3VA 2FLRT 5IBUB 1FHVA 3S35H 3FU8A 2VLLB 3OMNB 3BWUC 1HJSA 4PR5B 1O5RA 2BINA 3O3UN 3MT1A 2GCYB 1SFSA 2CZVA 2YUZA 5BXPA 3NCJL 3S5LB 2EPOA 1A7QH 2QT6A 4FLQA 2D2CC 2QIIA 4L65A 4QHLA 5B3JF 4FA3A 2I5YH 2E6PA 3NQMA 4RDYA 1FO0L 3KLDA 5I74B 3FU0A 3PZVA 4EI6A 3GM0A 4J3UA 1ONWA 1F11B 4F7EA 2EGZA 3KEHA 2HFEB 1BD2A 4OJDH 3ULVE 2JF6A 3ZDYB 2CETA 3OKEA 1ADQL 1H51A 2VC2L 1DQQA 3BDKA 1Y1UA 4WEUD 3NTCH 3OYZA 1HG3A 2GL5A 1XCQB 3B6SB 4RNRB 2F38A 1LQBC 4M93B 3TYEA 4JPIB 5SX5H 3VFNB 2FH8A 4WVRA 1VYPX 4H0GA 5GGVY 3PP4L 1PO9A 3C09B 2V9TA 3NP3A 1UUQA 3OVPA 3CZFA 2QCFA 4FQ1L 3FHQA 3RY6C 5J11B 1NINA 4MMXA 3U4EB 4YCOA 3CHRA 3V0HA 3P4NA 1U8LB 1FC2D 5MERA 2XWJB 1KN2L 3BJTA 3R1ZA 2AP2A 1QNSA 3RX5A 1T96A 4M7ZC 3R58A 2BLEA 3RMJA 4DGVH 4UZGA 1SMDA 4NAQA 5KSBF 5HYJE 1CBGA 3QRLA 1PWLA 4FXGB 2QEJA 3G24A 1GOQA 2GQAA 4FZEL 3ONBA 3QZOA 1GS6X 1G0DA 2YAMA 3UTSA 3WD2A 2YAPA 1MXSA 3GIYA 5E9XA 5E6RB 4BY3A 2WQRA 4D9LH 2H6OA 5AOLA 2NY6B 1FFPA 5JIIA 4IX0A 5DI8B 4P5MA 5GJMA 1J93A 3QNXA 3C6SA 2I60H 2QR0B 1R34A 2AABL 2EQDA 3HZMA 2NLJA 2P24B 2BC4A 4JPQA 1D7FA 5L2KA 4FNQA 1JCJA 3L9EA 1QKZL 4O1DA 2MNJB 4UT6L 3N5AA 3UWYA 5KYNA 2DIAA 2FQDA 2DBLL 3GDMA 3L4TA 2W9DH 1BAGA 2IH8A 5D1XC 4HDIA 2HV5A 3SQMA 2F9BT 2PODA 3CN3A 1C5BH 1CD1A 4K23L 3GNNA 1L9MA 1XINA 4Y16A 5LIWX 4L1BA 3WL0A 4NNAA 4DXXA 2GSJA 2WWCA 4IEFB 4N9BA 3DHMA 1NWRA 4U3AA 5E93A 3FO1B 2CJUH 4NT0A 2CA3A 4NNXB 1UWQA 3GXMA 4H20H 1W5PA 1WWWX 4ZYKB 3U1SH 2VL5B 2XUWA 1OB1A 4P59L 3FQ1A 4QTHA 3N42B 4NO0A 2DL9A 4G6MH 4QXIA 4TNWF 3HE7D 4L8DB 4QOKA 3RIKA 4NJAL 3HC4L 5JPMB 5EL1A 2G5BB 1Y18B 4FALA 4QQUA 3QEZA 4FFZL 4S3GA 1UROA 1QUNB 3N42F 2P50A 3ZE0E 3BSMA 1CU4L 1A5KC 2FZMA 2VN4A 3PN8A 4A22A 4JFVA 2HJFA 4GAJL 1A9EA 5AL8A 2G5RA 3TTOA 3E2QA 4BFBD 3EB2A 4MKVA 4EVZA 3NPXA 5HHPB 1E8XA 3FDGA 2B3IA 1RZMA 1U6AH 3DGCR 4KV5E 2ASHA 1UUOA 3UDWA 2R8SL 4Z1YA 5LNEA 2WTRB 4H0HB 1A3QA 4ZUTA 1ZLWK 4UAOC 1SLXA 4YHPA 2XZQH 2DTML 3UJJH 2G2NA 2BNRE 1QFOA 1JHKL 1EGMA 5A8MA 3DYPA 4WHTA 1T0OA 3N34A 3NZSA 1A5AA 2A77H 3NSXA 3TJHD 1IM9A 4QRRE 2WCPA 4Z0SA 3IPFA 4XMVA 1MJ8H 4H83A 4JGUA 3QPXH 2CYGA 1CEOA 5HVWA 4QHKJ 4WHBA 3D50A 1OHQA 2G3ZA 3FB7A 3AU2A 5EEVA 3EDKA 3D0VB 2WBJD 1Q9KB 1CFSA 4R2GD 4QXUL 1JYNA 1SO5A 1RJPA 4F2BA 4P46A 2XRAL 1HL5A 4XNYH 4QXGL 3DX8A 2ESVA 1PF3A 4WUUE 3TIEB 3HJZA 2RGSA 4PMRA 1LYXA 2ZC1A 4PJDE 2PWEA 4DJED 1NC4D 1UWTA 4OGYH 5HHNB 4C6KA 4YQXH 5DMKA 3NFNB 5KOVC 3C8KB 5F1KC 5FEZA 4J12A 1R2RA 5H2BA 1E55A 4M7JL 1WA1X 3UEZA 1JWUB 1JVNA 3SODB 5HHVL 4BS0A 2QJHA 3GSWB 4K8RH 1D9KA 3ARFB 4ISVA 4M7SA 3PTMA 3EHBD 4IDJH 3FXIC 2IPUK 1S2CA 1GVSA 1UR4A 3EB4A 5TK4A 3IAQA 4QRPA 3RFZC 2Z34A 3BYTA 4GUIA 2FUTA 5K59F 4PRRA 1TSHA 1PYMA 4O1FA 3FCGA 4K73A 5DTFA 3ZZLA 3ONCA 1ZK5A 3LN4B 4YE4H 5FFGA 3F2DA 5F1VA 4WK0B 1KLUA 2J72A 2V2TA 1BBJA 4NI6A 4GW5B 5J0BA 2DWDB 5AYYA 4CSTA 2J12B 4ZPVA 1FCCA 3S6OA 4KX8A 3G5VB 4KH2A 1EP2A 4Z8FH 4L7ZA 1X5HA 1F56A 1IAOB 2QL1A 1L6PA 3P8IA 1E28B 1P9MC 4W89A 1CGWA 4GS7C 5HHOA 4ZUVA 3ZHNA 1K8CA 5EU4B 3EWYA 3O0FA 1EC7A 1TV2A 4NQED 4J27A 5CJ5A 5BO1L 1TO4A 5I17A 3EO0A 3QDGA 1SU5A 1CB7B 1OE3A 2J6EA 1OSPH 3QOMA 1AKJA 3AYSA 1I8AA 3C5SA 3SDCB 4B5TA 3LX9A 3T8XA 2XZAL 4ZMGA 1UJ3A 2Q86B 5EIIB 1W8OA 4Y7MA 2DH2A 1IRAY 3GAYA 1V79A 2FWSA 1T6VN 3GMLA 1TFVA 2ZCLL 2XJLA 3ARTA 4A6YH 2WCGA 1XGEA 2JKJA 1EHXA 4ZMTA 4BUGA 4X0VA 3PWNA 1A1NB 1VERA 5L88L 3MUGA 1W15A 3W2NA 3TUUA 3D85D 4GIYA 3L67A 4HLJA 2BGNE 2WXJA 4XVJL 4N4PA 3X11B 1EOKA 3BZ4B 4PUDA 1YXCA 4PRWA 4KRZA 1LEKB 4OI7A 4Y1AB 3DROA 4WK9A 3T0AA 1Y7VA 2QW5A 2BV9A 1JZJA 3TYCA 2VDPH 1JGDA 3U79A 3ITTA 4PJGA 2G75B 3MCG1 1EAJA 1UWFA 4N22A 2IKIA 1OE2A 4D2NA 1BQ5A 2PDCA 3WENA 5H2ZA 2BNJA 4FKEA 3V0UA 2CRMA 2IDFA 3R2GA 2GEQA 2CIKB 3G3MA 1TFHA 1CIUA 1K6QL 4FQXC 2FSEB 5D70H 1MN4A 4XTDA 4LCWB 4AEFA 5H8DA 6XIMA 1KFKA 3M7OA 4GE8A 2FYYB 1TREA 2DW6A 5DUML 4GG8A 4XCNA 1A3XA 3WK1A 2CDGB 4HVBA 5HY9A 3F01A 1HN1A 1X5XA 4DWHA 2D3LA 2K8QA 3RVUD 4L1LA 3E6EA 2VXUL 4UT9H 3VWKD 1Q1PA 2XG5A 2R1LA 1ES0B 1AO7B 1I3RB 2PP3A 4QWWD 3LB6C 1BW8A 1X5GA 4G7YL 2EIZA 4KJWC 2GBUA 2ISFA 4XCFL 4L37B 4FHJA 1MUWA 5D2LE 3UA3A 3BAEH 1XF4A 4L4VD 5T1JA 1JXJA 3M1OA 3TURA 2Z2AA 1J1PH 2O55A 4ZAKC 4CC1A 2IAMA 3NJHA 1IC7L 3H1ZA 3UGXA 3H0TB 3H7LA 3S9YA 4BFIA 3N2XA 1OW0C 2BSLA 3QZEA 4K3JL 2VM9A 3O63A 4HS6A 3VXUE 4Y5YB 3LEVL 3GF8A 4WEBL 5DS2A 3IMUA 2EIMB 4J8QA 3TZFA 5IJBC 3KPPA 1Z3RA 1BTMA 1F6LL 4I13B 1DE4B 2OO0A 2DM7A 3BWWA 2DU2A 2OGJA 2GI0A 2QCMA 5IDIA 4HXAL 1NEPA 2HPMA 5E1AB 4M62H 1ZHAA 2ZP8A 3ZHFA 3WL1A 3KL5A 5F1OB 4OGXL 4OCWH 4X9FA 4KQ3L 4DK6A 3BKJL 4JUSA 3RNDA 2YGVA 4RV8A 5H4YA 5DD5H 4YPGA 3B3BA 3IMWA 4F7MA 3V95A 1B0GB 3NAAH 1OP5K 3VOGA 3GH7A 5HOSA 3PU7A 1VFLA 5CC6A 3DARA 4IRZL 1D3GA 1HKKA 5L8KB 4DOHB 3P8JA 3FN0L 1TYRA 3M0YA 1IJ9A 5AUMB 2H9GB 3SGJA 2WQ8A 1QXLA 2HTLC 2YL9A 2IPKB 2QXWA 5LDUA 3MKVA 3TH2T 4HUUA 4O50A 3LEXA 4NZ1A 4CL7A 2ZKMX 1YYLL 3QG6A 3UXIA 1PVNA 2IADB 4LL9A 4UTBL 4XP6H 4FQHB 2VO8A 1OAQH 1UWGH 2I9EA 6PTDA 3QGKC 2DQMA 3U9UA 3WNJA 4XNMB 2WWMD 4MBOA 4R83A 1YN7A 4WY0B 1QR1B 4N2GA 3I6SA 3LYRA 1OADA 3FB8B 3G08A 4NN7C 1QRQA 2F54A 4FOKA 3ZJ6A 4WDWA 4G80A 4XNZB 1T66D 2X05A 1IXPA 3PR2A 3QDMA 4XCYB 4AIZA 2ADGA 3D2UA 3CH9A 1I1FA 3GXPA 4AV0A 1SY6H 5GS1C 3E74A 1G9MC 1KBWA 4WY0F 3DX2A 2J73A 1FWDC 3PHOA 2XQYG 4N8CH 1ADOA 4AVNA 1KXVA 1G87A 2G0WA 3CUGA 1MHHB 2OYLA 2GUOB 4IK7A 1HIML 4G5ZL 1RSYA 2EIDA 3FFCE 4FI4A 4AT6A 2PYFA 2YPVH 3AM8C 1U4FA 4KBXA 1QVBA 5DD1H 2X4PB 1OZTG 5I82A 5GHWH 4Q6IC 1FHNA 3HMXL 2C71A 3CHVA 2CLZA 2AL2B 4H9XA 5DGQA 5I23A 1MYRA 2FIKA 1TZAA 1IXNA 1J4EA 4N8VB 5CC3A 1YEFH 2EYRB 4P3CH 4ZMPA 4QP0A 3DMMD 4F7KA 1XLLA 5CN2A 4KITB 3H6AA 3V35A 4AWEA 1PKNA 4GRWF 1SJDA 2CO6A 1FRGL 1L3NA 3F83A 3PFMA 4OZHE 4JR9L 4TSCL 3E38A 3M5YA 3D06A 4O28A 3MBEB 3FCSB 5CSZB 1WKEA 1XFCA 3D47A 1GQNA 4NKMA 1MCOL 4RGNE 5AHIA 1BD2E 1IT0A 2KAUC 2QPDB 2PPGA 2A9AA 1WS8A 4IBVA 1ISYA 1UKPA 3TKFA 3NEHA 1Q6FA 5KZCB 1C8VA 3IU4L 1P7KA 3W1TA 4I77H 2EO7A 3VKCA 5E9DE 4E9LA 4ONOA 3R94A 3EEGA 4RCAA 2R24A 4LCVA 4Q9QH 3HZKB 4GRMA 2OMUA 4NX0A 1L4IA 4HGKC 3MV9E 4PY8I 3MRIA 3PP3H 3GPSA 4A38A 1KD0A 3LXUX 4JBSA 1ME8A 1R3TA 1XB6A 1RQBA 3VJ6A 5EU5A 5A3HA 3HOGA 1AGFA 2DJUA 2ARWA 1U8HB 4PG2A 1PG7W 2VLRB 3SQOH 4XB7A 4MHHG 2X1OA 4YSSA 4IMCA 3L7EB 2WKJA 1OIFA 3KPLB 4H9MA 3BLOA 2ZG2A 1PHQA 1EA0A 1BV8A 3RVWC 4P2VA 2EXYD 3A4JA 3UTSE 1CQYA 1T7WA 3UETA 1WICA 1U93B 3KCJA 1QW9A 3HI1B 1QOPA 4G8GD 1F90L 3DX0A 2NQDA 2CCLA 3DSFL 1K02A 5GSVA 1GW0A 5DJDB 3WTTA 1QT1A 4GZIA 1QPQA 3GNDA 3KM8A 2YXWA 1FXQA 1HOCB 2V0AA 3QZLA 3QPKA 4HLZH 5L2KE 3BLFA 3MOBL 3SKNA 1SZRA 2EDLA 3IN0A 2P80D 3QUYB 2CLVB 3OVGA 5MENA 3TBTA 4C6BA 3B2VL 4IKKA 2AQWA 1GOMA 2CXKA 3GSNB 4NZRH 2OZ4A 4HPYL 3O2VL 1MW3A 2DZAA 1S5HA 1M7XA 3PTDA 1WF5A 4XBMA 2YJQA 3T0BA 4MXQC 3SE3C 4QF1A 2QBWA 1SFLA 2W81C 1A4KA 2QPUA 4YK4B 3WJYA 3DX9A 5E00B 3SFKA 5A2BA 2HKHH 5JQ6L 2OZ0A 5C7VA 3ESNA 2XJ7A 2WWKT 4KHXL 4D9QD 1S7SA 5CCKH 1M57B 4Z7VA 4XPAH 4S2CA 4Q7BA 3BP5A 1TU2A 4GSDH 4ZPTA 4C58B 1VP5A 1TZHA 4O02B 3RNQA 5TQ2H 1OZUA 1USZA 5E2UH 1ZBCA 3ATAA 1KIQA 4OIFA 5ABHA 1HNGA 2A9CA 3D34A 3DV4A 4WJG3 5C71A 2LFEA 4QOKE 4H13C 1RJYA 2B08A 5BS0D 4HMNA 4UM9B 2DDQL 5EC2A 2A9NH 3UCQA 3ZRCC 1TPC1 3OLIA 2YR1A 1EPFA 4TPRL 4MMYB 1R87A 5CH9A 3KJ6L 3NM1A 1QBAA 1U3JA 1I31A 3B2DC 5E1QA 5AECA 5FS5A 3X12B 1P6FA 3QW3A 3FO2B 7ODCA 4W1TA 3G6JB 2BOFX 4W68A 2DQCH 3N12A 1Z9PA 4XG1A 4RGMB 1GYLA 1J96A 3QJSB 4PN2A 2ALAA 3EH4B 2K78A 4J4PD 3ZQWA 4AYFB 5F2MA 3FUMA 1GZGA 3R5EA 1G0YR 4AGLA 3WSQH 1UB3A 5EGRA 1AR1D 1IR1A 1KYFA 4ZTPH 1YNTB 1JMZA 3G6JF 1PZ3A 3WQDA 2DWEB 5AAPA 2X16A 3WFBL 3PGDA 2HT4C 2DYSB 2CD0A 2R4SL 4HIEA 4LS1A 2PFHA 3LNEA 3PJLA 4RAUA 1NU5A 1LP9B 3WIHH 3VQMA 4O13A 3X14B 1YNTF 3MI3A 1HZHH 1LDCA 8XIMA 1PHWA 5C0RH 3MLXH 2C4FU 4HHWA 1LLAA 4LEOA 1RUAL 4RNJA 3L7FA 4ADJA 1W5NA 2Z93A 2BHFA 5KEZA 4HCHA 1E30A 1U8CA 4X98A 1CD9B 2RFXB 1DYSA 4TLSA 3KPOA 3FQRB 1FLRL 5EU6B 3MGOB 4C8XA 4TVUA 4P2RE 4TOYH 4GBUA 1J2BA 4TUUA 3EYUH 3FF7A 1I9IH 3PPSA 4QHMB 3DFQA 5IW3A 2A74A 1ULVA 5CUSH 5CS7A 2X0HA 1G67A 4D3CL 3B2XA 3MYJA 2DVUA 5DRCA 2BOCB 1N55A 1ZP4A 1LDPH 5KYWA 4F0RA 2ZSWA 4JHBA 1VHCA 3SO7A 4F7CB 2XFRA 4C55A 2DW5A 2Q7NA 4PJCB 3SRDA 1HWHB 1XIHA 1S1RA 5XINA 1JRHL 4A8IA 2W80C 2WJEA 5DXWA 2O9TA 5GGTA 1U2YA 4DO7A 2KDYA 4IU3A 1E70M 5CGYC 5BNXD 2RACA 5E5UB 2XNAB 4AXWB 1O75A 5TPWL 4OD3L 1KM2A 4QRPE 1FWHC 4JTIA 5DQPA 1W1IE 1J7VR 4TX9A 3OGRA 4HS8H 5BRZA 1PEWA 4G43B 5GZNC 2KI6A 3UYIA 5HGAA 2A6IA 5EF0A 1S5VA 4EXBA 1I1YA 3OQ8A 4Q8BA 5I1AB 4F48A 2NTFA 2DUXA 4LVGA 1MJUL 3L13A 4DBEA 1O7VA 3PHQB 3WHE0 3I84A 3TOPA 2N7AA 3MRPA 3OZMA 3T65A 2A6JA 3MLWH 5C0NC 4IOIB 3F2CA 1Q13A 5FYJE 1RURH 5E4IA 2Y1ZA 1EIXA 3TX9A 5FR3A 4Z08A 3U6XA 3W85A 1BAFH 5HHOE 3RCMA 4FOMA 2Y06L 2HT3D 1QRND 4XOEA 4XC1L 1K4HA 1PLGH 2ZKYA 4ODHH 4KO7A 5HJBA 1J05A 4PJBA 3PPHA 3NQFA 4FFVD 3ZHKA 2CUIA 3FZUD 1P4LB 3QDGE 1IBBA 1RHFA 1XD0A 4EBQH 1PE1A 1JPTL 1S2EA 4U1MB 2X2IA 4KJPD 4V33A 1GOOA 5HR6A 3T04D 2PW2A 3PZQA 2NW2A 6CGTA 4DZAA 3CFEB 3AO0A 4F5CE 1XFBA 2PCXA 4FA7B 5DVMA 4YUEH 1P84K 1CUOA 3OC5A 4GIAA 4WJ8A 1CF8L 2OR7A 5A6IA 3EJZD 2EEXA 2XVLA 5MP6L 3O6FA 5BOJA 2EBNA 1KYUA 4GFIA 2DYRB 4MJ5A 3N43B 4LLDB 1XW8A 2HUHA 4KQ4L 1UZ6E 4XAZA 3AYRA 4K0OA 4A8NA 4ADIA 3QUXA 4OBRA 3RTQA 1GUVA 2PO6A 5I09A 3N2TA 1Q9WB 1UENA 1VGKA 1Q2SA 1KFCA 2WMIB 2D73A 1TIMA 5FJPA 3N43F 3BG5A 4BZ2H 1FG2A 4DHLA 3RO8A 1YHTA 4U6XA 3ANUA 4IUOA 3OIXA 4K2SA 3TCLA 1ANUA 4DN3H 2HJLB 4PJGE 1MI3A 1GHFH 5I3GA 1TFPA 3IXAB 4G59C 4XPFL 3K2UH 4OTXH 5D6DC 4HYWA 4HF5L 3V9CA 2VN7A 4EF9A 3LY0A 3L5JA 5JIQA 1SJHA 4EPDC 1IFGA 4EI5D 1JGVL 4H5SB 3ML9A 1QK0A 3VXRD 4PRAA 4UR7A 2RJHA 5EUOA 5I1EH 5E2VL 2W9EL 2Q6WA 2OX4A 5I66B 2PDIA 4ERAA 3SKUD 4TUOB 5IQOA 3WD4A 4JKMA 1DEEB 1KCBA 3BKYL 4POZD 2I17A 2B3RA 4X0KA 4JKLA 5I07A 1QOXA 5EOQL 1R46A 4I8YA 2YEQA 1HKVA 4FP1A 2DQGH 3KPQB 1BFNA 5JBFA 4JXCA 4M43L 2HMID 3HAEB 1F3JB 2GSMB 2XBZA 2YXOA 5HWJA 1YMMB 1ET5A 1JK8B 4C83B 4MD0A 4FRWA 2VSDA 3QUZB 1ZEAH 3F5JA 1EJSC 1GW1A 1ZLSL 1OY0A 3N19B 1NP0A 2X7VA 5I9QC 3C2VA 3T8LA 1QVOA 1W8EA