1AVAA

Amy2/basi protein-protein complex from barley seed
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
403
structure length
403
Chain Sequence
b'QVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFAKGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARLEY ALPHA-AMYLASE 2(CV MENUET)
publication title Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution.
pubmed doi rcsb
molecule tags Hydrolase inhibition
total genus 139
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1avaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1avaA01
2G8ZA 2NW0A 3BUQA 2VJXA 1OGBA 3N15A 4CCCA 1OWQA 2VI0A 4J3SA 4W7UA 1FHLA 4V27A 3WEMA 3VSUA 3DDFA 4OOUA 4UR9A 3UETA 5I77A 3BUDA 1KBKA 4ZE4A 3WD3A 1C91A 2X0HA 4FLOA 1A47A 4NI3A 4K68A 4CCDA 1BGGA 2WMIA 2C7FA 3BAXA 3WL0A 1EOKA 5GPRA 4D1JA 2WWCA 1GOQA 5HOSA 3VU2A 3AMLA 3G6LA 3RPMA 4XZWA 3OLGA 4CD4A 5CPQA 3UEQA 1EO7A 1V6XA 3LPFA 1XH0A 1GJUA 4PMDA 3WSUA 2BVTA 4M24A 1E4IA 1W1YA 4Z2JA 3ALGA 3ZJKA 3AS0A 1E1FA 1AQHA 5I5RA 4JFSA 1C90A 5E9AA 1JDDA 1ZL1A 2F18A 4U5KA 3CHDA 2ZWZA 3W27A 3T2OA 2ZX7A 3WN6A 5IXEA 2J74A 1TVPA 3GXTA 1Q6EA 1JFHA 3THDA 3BLPX 4RE3A 4CGTA 2VX4A 3WNNA 3EDKA 4UNIA 1JGIA 4YPJA 3GH7A 4DO6A 1J18A 4FNPA 2J62A 3S6TA 3WUGA 3EMCA 4B3LA 2CKSA 2AAAA 2YDQA 1ZU8A 1JI2A 3F5LA 1W2PA 3NDYA 1E6PA 3CUJA 4PMOA 5BYWA 4MDOA 1UH2A 3GBEA 4P7QA 4D6CA 1EDTA 3AQUA 4W87A 5BXRA 5HDRA 4H8VA 4WJXA 4DWSA 3WNLA 3O6AA 1V6YA 3SCQA 2JIWA 2D24A 2YL9A 3VD7A 4PBGA 4Y7EA 3VIIA 2VZVA 2OYMA 2EADA 3DYOA 3IJ8A 1C3FA 5M5DA 1E4NA 1VENA 2VQUA 2DIJA 1K9FA 3PZIA 4JHOA 4NSBA 3DHUA 3VIOA 1QHZA 3DECA 4JFWA 3F5KA 3VIMA 5GNZA 3AXHA 1JI1A 3PZTA 4F9JA 2E4TA 2XN0A 4M8UA 1V08A 2XJ7A 3POHA 3WMSA 1FH7A 1CXHA 1J01A 4GO9A 1B30A 2UY4A 3SCUA 3VINA 1G0CA 1XRVA 3ARRA 1HXJA 1JD9A 3WQ4A 3AZRA 3KE0A 3SUSA 2F8QA 4BA0A 1ZB5A 3IK2A 1QNPA 3EMZA 3B9DA 1B9ZA 2DQXA 3WY1A 2EABA 2W67A 1JAEA 4PMRA 1J0ZA 2J7GA 2XYLA 2XGIA 3AS1A 3VX0A 4TVCA 1K9TA 2WVUA 1XYFA 1E73M 1KXVA 1QI4A 4NZJA 3THCA 1W3KA 2GJRA 1B3VA 1FP8A 5ECUA 1UR1A 4AIOA 1JNDA 4H2CA 3LPOA 2ZXQA 1W2VA 2CETA 2W4XA 1B3YA 3MSGA 4PN2A 4UFLA 3WD0A 4WK9A 1QNRA 4PMZA 3BH4A 2WXDM 1GORA 2YKKA 5HPCA 1CXKA 4JL1A 5D8ZA 2FHFA 3OZPA 2AOSA 4UTFA 3WIJA 5DMYA 2DSWA 2ZWYA 4CKQA 4ZXLA 1KBBA 1W9VA 3KLLA 1U30A 3AZTA 5TD4A 5GNYA 1KCLA 1BG9A 2DSZA 3LXBA 1GHRA 4WKAA 2WMHA 3AICA 4ZENA 5JIPA 2BVDA 1XH1A 2VZOA 4IM4A 3HN3A 3CTTA 1MQRA 3ARXA 3UESA 2VR4A 5DT5A 3SCOA 5E1QA 2WK2A 3W28A 4F8XA 1QI0A 4N0RA 2JFEX 4FNUA 4CCEA 2OLHA 4HU0A 2WC4A 2BY3A 1MXGA 3LMYA 5ABGA 4WSKA 1E6QM 3VDBA 1LQ0A 1VBRA 5A69A 2XG9A 1JG9A 4PMVA 1HJUA 3KZSA 5LA0A 3FN9A 1HKJA 1MQQA 5DEZA 1VF8A 3K4AA 3VGGA 2A3BA 4URIA 1PEZA 1R75A 1W9BM 3CUHA 3WF3A 1MW3A 3AISA 1NH6A 3VMNA 3VNYA 3SCPA 4D71A 2QF8A 2F7QA 2E9BA 1W32A 2WWDA 4HPHA 4L4OA 2YFNA 3IGUA 1PBGA 3EYPA 4GZEA 1B2YA 4WSJA 2GUYA 1GPFA 3CUGA 2OYLA 2QMKA 3APGA 2XSBA 3BVWA 2GFTA 3ARZA 3VILA 2CIPA 3UCQA 1FP9A 4HPGA 1GCYA 3KLKA 1QHPA 3ZT7A 1BHGA 1V3HA 1KXTA 5D9PA 1N82A 4NZCA 4P7OA 3WDIA 1Q6FA 1JYWA 1FOBA 2X09A 2Y24A 1H1NA 1JL8A 5A8NA 3W0KA 3OB8A 1V6UA 2CBUA 1QNOA 3VIHA 3T0DA 3K46A 4P8XA 2PB1A 1CECA 3QR3A 1CWYA 3WUFA 2VZSA 3E1F1 2X0YA 4B3KA 2VO5A 3IAPA 1H0IA 3S5ZA 1UWTA 4JCMA 1VEMA 3D3AA 4ZEPA 3VOCA 1QI5A 3WQ6A 1T0OA 3GBDA 3WF0A 5A6BD 1CGVA 1QOXA 1V03A 4IISA 4PTMA 3LRKA 2XSAA 3MUZ1 2WLZA 4OBSA 4W86A 3SEPA 1UR2A 5A6LA 2IGTA 3WFZA 1LG2A 2VCCA 4E8DA 5CG0A 2EEXA 1U33A 1JDAA 4ACZB 3SIMA 2RGMA 3EJRA 3ZSTA 3RO8A 4CU7A 2WNWA 4CD6A 3BAJA 2WZEA 2WC3A 4TUFA 2ZXDA 3CMJA 3M7SA 1H2JA 4P7NA 1IZJA 4AZIA 3VD3A 1MYRA 1AVAA 1O7DC 4FLRA 4GIAA 2VNCA 4GO8A 1TVNA 1H09A 1GONA 1GJWA 4M56A 4XZBA 1HJXA 3D51A 1ZJBA 1Q4NX 1UR0A 1E71M 3W29A 4OZOA 3WNOA 1PZ2A 3WD2A 1OT2A 5ABFB 1UH4A 2WMIB 3T2PA 1JIBA 1AQ0A 4UFMA 3FHQA 2XFYA 1KTBA 2WMGA 2GK1A 1K6AA 3FXYA 3SUWA 4KGJA 3UERA 4AD3A 1E1EA 1WNOA 5E09A 2ZUTA 3M6DA 2VC9A 3LRMA 1WE5A 5A2CA 2E0PA 1W1TA 2ZUMA 3MS8A 2X05A 1TQWA 4FK9A 2XVPA 4M29A 1WZLA 2ZUNA 2AMGA 3PHAA 1PIFA 5JBFA 1EQPA 2BVYA 2VRKA 3AMDA 4W8AA 3RJXA 4PTWA 2GJXA 3SCWA 5CGTA 2QPSA 2VRJA 1P6WA 3MU7A 3ARQA 2FDMA 2J75A 2DT1A 3GDBA 4PTVA 3W82A 4XUYA 3VSTA 3GXPA 4UZUA 3WY3A 3VGDA 2YL8A 5CJ5A 2XWEA 1TMQA 4QLKA 3PZGA 1W1PA 1WDPA 3BMVA 1C8XA 1MFVA 4CVUA 2A3AA 3CZ8A 4P8VA 2YIHA 3ZQ9A 6CGTA 4TX8A 2WM0A 2Y4SA 1CGUA 1EGZA 1KQYA 3TTYA 2J8FA 3FAXA 4MNJA 2XUCA 2FHBA 1TA3A 1VRXA 2ZUUA 1HVQA 3TONA 3N1AA 4ZFMA 3T08A 4IPNB 1BYCA 1GOOA 3BCDA 4UOJA 4D6EA 3CZKA 3UG5A 1UD6A 2E8YA 1J11A 1NWSA 1UHVA 4E8CA 1V0KA 3GH5A 1CXLA 1EXPA 2PC8A 2CKRA 3EDFA 2ZUWA 3DDGA 4M81A 1UZ1A 2V3EA 2PWDA 4GQRA 4YHEA 4C7DA 3SUVA 1VJSA 4PMXA 3CBWA 3KEHA 2EPLX 4W8BA 3CZNA 4UOQA 3LPGA 3GNOA 2V3FA 1V0MA 4NRRA 1HVXA 4NX0A 1ISWA 1DEDA 1TZ7A 2WB5A 3DC0A 1B3WA 4RL3A 1CXIA 1BG4A 2D23A 3PZQA 1EO5A 3VX1A 5GNXA 1K9DA 2XVLA 3RCNA 1VFFA 1S46A 1HJQA 5HPOA 2D20A 3WBAA 2WSPA 1BVNP 4BS0A 3GM8A 1MVYA 1V6WA 1WCGA 2BHUA 5A8MA 4ATDA 5EB8A 3T0AA 3PTKA 1UKSA 1TUXA 3WDQA 1KWGA 4C7FA 1H5VA 1E6RA 1UR4A 6A3HA 4H8HA 3GXNA 2J47A 1E43A 4EANA 1OB0A 1E9LA 4W88A 3EDJA 2Z1SA 2W61A 3MMDA 2EPKX 5JIWA 2OWWA 3BVXA 3VVGA 2ZX5A 2ESCA 2XFFA 5A94A 1E15A 2XVKA 3WEOA 4EE9A 2PWHA 4MAVA 3AMCA 4IUGA 2W63A 3AYRA 3FHAA 2YOCA 3G6MA 1BSIA 4FNSA 3U5UA 4OUEA 2E9MA 1J0KA 1CTNA 1JDCA 3AJ7A 3DX3A 4BCEA 5A6BA 4D6DA 2A3HA 1KGUA 3A22A 3ARWA 3D52A 3ARSA 4CN4A 1C8YA 3GNRA 4Z2HA 2F7PA 2WLYA 3RJYA 2CHNA 1UD5A 2BNJA 2UY2A 1TQVA 1BQCA 1F4AA 1VJZA 4W84A 3VGHA 1KXHA 5M17A 2WVVA 4MNKA 5DT7A 1PX8A 3VIKA 4AD1A 2W5FA 2W92A 4AZCA 1BYBA 1WPCA 1BGAA 4CU6A 2D0FA 1DHKA 1TQUA 1FH9A 1DTUA 4HZ8A 3K1DA 4V2XA 2VX7A 1US2A 4WKHA 4LXFA 1KWKA 4EK7A 4KMQA 3QHNA 3U7VA 1NOWA 2D0GA 5DFAA 3L4UA 1EOMA 3ARPA 1BF2A 1ZJAA 4H41A 3OGSA 4QCEA 2WKGA 5AC4A 3RDKA 1CGWA 2XWDA 1GVYA 5FL0A 3VDAA 1PX4A 4EAMA 3TV8A 3HU7A 4UZSA 3WQ5A 2UY3A 1TE1A 2YDRA 3W37A 3A4WA 1FH8A 3WF2A 4KH2A 2F1BA 1HXKA 1BTCA 4CUCA 1YQ2A 3PZNA 4J28A 4U3AA 3AS3A 1GOWA 3TP4A 1J12A 3BAIA 3N17A 1LL6A 1DWJM 3VD4A 4QLLA 5A8PA 3AMGA 2OWXA 4B16A 2CXGA 3WELA 4QP0A 1V02E 1OT1A 5ABHA 3WBEA 4ZE5A 3D4ZA 1C92A 7A3HA 4Q22A 2PWFA 2JF7A 2J25A 1PAMA 1NQ6A 2BHYA 5BXPA 4BF7A 2DT2A 5HBFA 2VVSA 2WHJA 3NYDA 3DX0A 2DH3A 2V5DA 1I1WA 1Q6DA 3AHVA 4LPCA 2CCRA 1BVZA 1O6IA 4H7VA 3ZT6A 1V3LA 1O7AA 3WY4A 1ZBKA 2VL4A 2J7FA 2BS9A 3VPLA 3WQ8A 5E0FA 3NSXA 1EHAA 1ISYA 1M04A 3OLEA 1QX1A 4J7RA 1H0GA 1C93A 4PMNA 2G3IA 3WH6A 2J7HA 1WDSA 4ACYA 3HZ3A 3WF1A 2X2IA 1CXFA 1OD0A 4AMWA 1VIWA 1PX3A 3BAWA 3W25A 2MANA 4QLJA 3ZO9A 4AZGA 3L4ZA 3TTOA 3RILA 5CSYA 1E40A 4JHZA 1D3CA 2VTFA 1UG6A 1W9PA 1QPKA 4D1IA 5GQBA 3M46A 4JZ5A 2CPUA 2GSJA 3BCFA 3QHMA 1NOUA 4TXEA 2X2YA 1WZAA 1UR9A 3AIUA 3WDRA 1UASA 4NRSA 1KCKA 3U57A 1HJVA 4GKLA 2D1ZA 4LYQA 1UOKA 3O9NA 2IUZA 3MMWA 1VEOA 2X2HA 5M3WA 4AMXA 1H4PA 2F7OA 2J78A 4PMQA 1JZ8A 4QCFA 5CLWA 4AZ5A 1E3XA 2ALWA 2ZICA 2W66A 2WCAA 5AYBA 1XGZA 4FMVA 4KGLA 3WMCA 2XN2A 2YL6A 3WD1A 2G41A 1MXDA 4PEEA 4LYRA 4L4PA 1HNYA 5FIPA 4UFKA 2GK1B 5CLTA 1R8LA 1JYNA 3W81A 5I2UA 1QBBA 2O9PA 4U2YA 1ODUA 1Q6GA 5LYRA 3ZJ6A 1V3IA 1J9YA 7CGTA 1OINA 2BFGA 4AD4A 4OIFA 1HIZA 3BVVA 2XGBA 1GQJA 1G1YA 3FY1A 2WMJA 1WO2A 4M80A 4BQ3A 1MWOA 2DGAA 3DYMA 1NOFA 1E4MM 4OBRA 1E5NA 2DIEA 1UWQA 1UZ4A 1F4HA 1JZ4A 3MMUA 3PTQA 2DH2A 1CENA 3VMPA 2EJ1A 1OGGA 1UH3A 3WNKA 2OWCA 1GOIA 1CGYA 2G3JA 1XD0A 3ARTA 1CZ1A 2PBOA 2CNCA 2JE8A 1J0YA 1HWWA 4JFUA 2CHOA 3AIRA 2F2HA 2JF6A 3EBVA 3IJ7A 3NIYA 1NM9A 4PUEA 5BROA 2XN1A 3LXCA 5I23A 4J3UA 1OGSA 1JXKA 4HOXA 5CZKA 1R33A 2J8GA 1B90A 4TVDA 1VAHA 3IJ9A 2EXOA 2CESA 1VEPA 5A2AA 1UR8A 2EQDA 2VZTA 3VM7A 3AHTA 4GI8A 5LA1A 1G9HA 1H3GA 4MNMA 5CQ1A 4JCLA 3KWXA 3L2LA 2NT1A 2JEPA 1PJ9A 1W1VA 3ECQA 1WDQA 2ZXBA 1ISZA 3I3BA 2YBUA 2YA0A 3FW6A 2CBVA 3SUUA 4HZ7A 3CHEA 1QNSA 4OKDA 3B9EA 5BCAA 1XH2A 2WVTA 1WDRA 3A3HA 2J4GA 3CZGA 3GXFA 3MI6A 3AHYA 4OOZA 1Q6CA 3H53A 2Y5EA 1QI3A 2WBGA 1XSKA 4J3WA 5EMYA 4M1RA 1V3KA 4X0VA 3OBAA 1XSJA 3ZM8A 1RD6A 2NSXA 2WHMA 3W6LA 3A4AA 2V3DA 4U3CA 4LYPA 4CD5A 3HG4A 2WZIA 1Z32X 3M07A 4FNQA 2EACA 3GXDA 3GYCA 3VGFA 3AIQA 4MB1A 4HTYA 1SMAA 1EDGA 2O9OA 2D0HA 4Z2LA 4W85A 5EBAA 3I3DA 4AD2A 3WY2A 4DM2A 2OSWA 1ZBCA 2VMFA 4UQBA 4PCTA 2O9TA 1CXEA 4W89A 2ZXAA 4AW7A 4CD7A 1DWIM 1R86A 2DSVA 3OLDA 4KRTA 1VFUA 3QHOA 4UQEA 5A6KA 4AC1X 1PIGA 3W26A 4MPKA 1VB9A 2WYSA 4U5IA 4BQ4A 4CVWA 4PYSA 1XYZA 3CH9A 3VUPA 1C8QA 4Z2IA 3BLKA 3WF4A 4NZFA 5A6JA 2G3NA 3AFBA 2WHLA 4D6HA 1CGXA 4Z2KA 1JF5A 1PS3A 4HMEA 1SMDA 4QDMA 1KGWA 1HJWA 3SCVA 1LF1A 1TCMA 1E3ZA 1VFOA 1SYTA 5FL1A 1GOKA 4JIEA 1SFSA 4MB3A 3AROA 3WD4A 5HXMA 2DT0A 4P7RA 3L4WA 1B3ZA 1J0JA 4PCSA 4JFTA 1UD4A 3AS2A 2J7DA 3CLWA 4TVUA 1K9EA 1UD2A 1EA9C 1OIFA 3PN8A 2BHZA 1GUVA 4GQQA 1EH9A 1DWFM 4AY1A 2CEQA 2YLAA 3VNZA 4AYSA 2DDXA 4CU8A 4IPLA 2GJPA 4P8UA 4TTGA 1EHNA 1E6NA 2DT3A 3MKKA 1G94A 1DWAM 1XD1A 2ZX9A 3WKZA 3BAYA 4KRUA 3WNPA 3CUFA 3D50A 3VO0A 4AISA 3PZ9A 2X8RA 1SZNA 3NUKA 3QOMA 4DUVA 1NP0A 3WH8A 4NXKA 2OYKA 1LL7A 2J7CA 4FLSA 4AWEA 1RP8A 3N18A 1OM0A 1DP0A 5BRPA 1G5AA 4WF7A 2D3NA 1GNXA 2W91A 1W3LA 2PWEA 4AZ7A 4B15A 1KQZA 3MV11 3VTRA 3H54A 2YFOA 1HP4A 1JD7A 4DWSB 4PSPA 3N9KA 2E9LA 1V3JA 1JXJA 2FE0A 1X6LA 1UWRA 4JKLA 3BAKA 3ZMRA 2OW6A 1TQSA 3SCTA 2XVNA 2XIBA 3AHXA 3MUAA 5AC5A 1JAKA 1V0LA 3PZOA 3PZUA 2X2JA 1RP9A 5CSUA 2FH8A 1B31A 5KZ6A 2VCAA 4J27A 3AIWA 4JAWA 4MTVA 4PMUA 5M03A 4DUWA 1A3HA 4CN6A 1E6XM 1C7SA 3HG2A 1GZJA 1UQYA 3TTQA 2J7EA 1KTCA 3PZVA 3VGEA 1CPUA 1QWNA 2EO7A 4W93A 1CEOA 4GINA 5C70A 4PUDA 1GQKA 1UQZA 4Q7NA 2WMKA 4LX4A 1H41A 3KL0A 2PBGA 3I3EA 4J3XA 1GW1A 3GH4A 3A4XA 3AHZA 1ITCA 3A23A 4HU8A 3EDDA 2D73A 4UQAA 3VGBA 3DX2A 1JYVA 4BQ2A 3HJEA 4AZHA 1WKYA 3WFLA 4TX6A 5AY7A 4MB4A 5IFTA 3OG2A 2Q8XA 2XTKA 1ZBVA 2E3ZA 4ACZA 3U5YA 5A6MA 4DUXA 2OW7A 1LWJA 1UWUA 1RPKA 3LPPA 1YHTA 4HP5A 1HP5A 4HA3A 4ATLA 2YBTA 1GQLA 1LWHA 1BLIA 3ZOAA 5A2BA 3EJPA 3JUGA 1W9DM 2BY1A 1CBGA 3AIBA 2WPGA 5HNNA 1QHOA 4AIEA 1JYXA 5C71A 5ABFA 3GNPA 4ZXOA 4JKKA 3K8KA 4CD8A 3PZMA 3EJQA 1BYDA 3L4VA 4WKFA 1LJYA 5E70A 3ZIZA 8A3HA 3CZEA 1OCQA 4AD0A 4F9DA 1QI2A 3HG5A 3VIJA 5IDIA 3AOFA 5BWFA 3II1A 5CGMA 1FHDA 1EDQA 1UD3A 2GDVA 1WZKA 3OLIA 1ZBWA 9CGTA 2O92A 3ARVA 2VT0A 3T09A 2CBIA 3J7HA 3B8SA 5D4YA 4UCFA 1HT6A 4D6GA 7TAAA 2JIEA 5JUVA 4X9YA 3W6MA 2CYGA 1TQTA 2PWGA 4GZIA 3WQVA 3TOPA 3MSDA 3GTNA 3QGVA 1UKOA 4HZ6A 3TA9A 2C8NA 1EIBA 4W7WA 1E72M 1RH9A 3ZJ8A 1E0VA 2OSYA 3PBGA 3MV01 1MFUA 5A8OA 1E56A 4MB5A 3L4TA 2BY0A 1MQPA 2YL5A 4TOQA 4A3YA 5I0DA 5EFDA 5IFPA 1XV8A 1HF6A 1E4LA 5BXTA 3WDPP 4KWUA 2XFRA 4ML4A 1UUQA 3OA5A 1PZ3A 3CHCA 1KB3A 4UFHA 3WUEA 1GVIA 4AEFA 5FD0A 2DEPA 2C0HA 1I1XA 4MAZA 4DO5A 1J0HA 2J79A 1EQCA 1NWTA 3VD5A 2TAAA 5DF0A 4UOZA 4MJ4A 5LA2A 5FOOA 4P7LA 3VIPA 1HX0A 1CIUA 1JF6A 3W24A 2HISA 4B9ZA 2ZX8A 2DPEA 4U31A 1UKTA 4YN5A 3CGTA 4AXNA 3A21A 2Z1KA 5A8QA 5D9OA 5E6ZA 3AIVA 3CPUA 2FYVA 4X0NA 3A24A 5A6AA 5FKYA 1CGTA 2ZX6A 1L8NA 2EPNA 1FA2A 4E4PA 3EDEA 1M7XA 4GPNA 1E6ZA 3BXWA 4WLCA 3NCOA 1DWGM 4RE4A 4B9YA 1NP2A 2VZUA 2B31A 2FH6A 4UFJA 4MDPA 1V0NA 5I79A 1Y7VA 4GZJA 4FNRA 1UA7A 3GXMA 1JFXA 2QHAA 4H04A 4GI9A 2CBJA 4D6FA 3CIVA 4JL2A 3BMWA 4GXPA 4C7GA 3AIEA 3CUIA 4HMCA 1KFWA 3POCA 1HL9A 3PTMA 2ZOXA 1WB0A 2VCBA 8CGTA 3BGAA 3WH5A 3BSHA 4Z2GA 1NWUA 1UA3A 2E40A 2A3EA 3A5VA 3CV5A 3SCRA 2V5CA 3CZJA 2XVGA 3ARYA 3NDZA 3VDHA 3LRLA 3WDJA 3EJTA 1M53A 1E70M 5IHRA 2PF0A 3RM4A 4HA4A 5DO8A 4PTXA 4FNTA 1R7OA 3VKKA 1J10A 1OSEA 1R85A 4LQ1A 4AIUA 1UD8A 2BXYA 3BVUA 4D6JA 4AMCA 1KR1A 2XIIA 4OJYA 1B3XA 2Y8VA 1HJSA 1R34A 3EJSA 1ODZA 2D22A 4A3HA 1AQMA 4S3KA 2EPOA 4RE2A 4AYGA 2Y2WA 1E0WA 3O2LA 4DWSC 1QNQA 5JBDA 4PSRA 3ZJ7A 2YLLA 2QLYA 1QBAA 1E5JA 2BY2A 4GI6A 2F61A 1D2KA 2X1IA 2YJQA 3MUIA 4F66A 1GQIA 5D8WA 2IXVA 2GJXB 4EKJA 1JZ7A 3GZAA 1CLXA 5A1AA 3ZSSA 2UY5A 3AXXA 2NT0A 2WCSA 4UQ9A 1ISXA 3K4DA 4QAWA 3OGVA 3DYPA 1SR0A 1DWHM 3WEZA 3N11A 1V3MA 3KL5A 2VX5A 4XX6A 3RM9A 1LL4A 2ZUSA 3N12A 2WBKA 5BXSA 1US3A 1UKPA 3CMGA 5A3HA 2XM1A 2VRQA 1M03A 3W53A 3QOKA 2WANA 3OGRA 4W5UA 2VR5A 2F7RA 1CDGA 4BZYA 4MJ2A 5F7UA 1X1NA 1TA3B 4FF5A 3WH9A 3W38A 3K8MA 4UQDA 3CZSA 4MADA 3BUBA 3AI0A 3GXIA 2G4FA 1W9UA 3N04A 4W8LA 2EBNA 3OIHA 1W9XA 1HTYA 1TR1A 3OZOA 1TG7A 2HVMA 1E0XA 5BRQA 1FFQA 4HMDA 5EFFA 5AYIA 3AZSA 4YHGA 1JZ5A 1BPLB 1UWSA 2F1AA 3WL1A 1OBAA 1OIMA 2FGLA 2WMFA 4A4AA 3CHFA 1BFNA 4AZ6A 3VSVA 1H49A 2XM2A 1UKQA 2V3GA 4N42A 2WW5A 6TAAA 1VBUA 5ABEA 4PRWA 3VIFA 2WHKA 1PPIA 1VFMA 3ZR6A 3ARUA 5C8BB 5A6SA 1R46A 2FGZA 3SCSA 4JKMA 2VQTA 1E6SM 1QVBA 4JFVA 2BV9A 2D3LA 1HKKA 1B1YA 4AD5A 4AZBA 4AEEA 1M01A 5D9NA 3WMBA 1R87A 1LLOA 2WC7A 1B0IA 3L2MA 4S3JA 4HOWA 2YA1A 4H8UA 3EJUA 4NF7A 3UR7A 3BUIA 1NARA 2J77A 1ITXA 5CXPA 4WIWA 1CYGA 2CERA 4LGXA 1CLVA 3SURA 3EMQA 3S5YA 2WVSA 1CNVA 4V28A 1XCWA 4QFUA 2BXZA 1W91A 3BSGA 3N13A 1HN1A 4TTUA 3LXAA 2GVYA 4HOZA 1W3HA 2WSKA 2QV4A 5CPTA 1AMYA 1XHGA 4W7VA 1E55A 2VVNA 2DSKA 2QPUA 3AMKA 3CC1A 4OGZA 1ZS2A 2VX6A 2A3CA 5CPSA 1XCXA 1KGXA 2PI6A 3AXIA 1JZ6A 3VM5A 1ESWA 2WVVB 1I75A 2YA2A 2DSUA 2VOTA 2ZUVA 3S2CA 1R7AA 4XV0A 3DHPA 3RIKA 2WZHA 1KXQA 5D9MA 3SUTA 5E0CA 4AZCB 1X6NA 3MUY1 2QMJA 3NSNA 3RMEA 4DO4A 3FNDA 4D72A 3DX1A 3CZLA 5I24A 1U2YA 4W5ZA 3BC9A 3L4YA 4DWSD 1NWRA 3HMCA 5JBEA 5FCZA 1HL8A 5I3DA 1L0PA 4R5EA 3CO4A 3DX4A 3HG3A 3FAWA 1LG1A 1JNEA 3IANA 2EPMX 5I78A 4U2ZA 3WENA 4CN1A 3B9AA 2E8ZA 3F4VA 4BQ5A 1V6VA 4UFIA 5E6YA 4P8WA 1BAGA 1GOMA 1D7FA 1UYQA 4DM1A 3VIGA 2XPKA 4XB3A 3SCNA 4HA1A 2V38A 1JZ2A 1V02A 2WAGA 2RGLA 3T2QA 4M82A 3VD9A 1MW1A 4D6IA 2VURA 3UR8A 3A6OA 4NXSA 5A95A 1KR0A 2EAEA 5KEZA 2IXUA 1OD8A 2G3MA 3D4YA 3KL3A 2JALA 2Y8KA 3VDCA 4UQCA 1HKIA 1XC6A 1GHSA 3U7BA 1JZ3A 1QW9A 1BYAA 1IZKA 4F79A 1G01A 2FHCA 3WDHA 4MNLA 3UG3A 1W3JA 1MW0A 3UG4A 1QWUA 3MANA 2O9RA 3VMOA 3W4RA 2D2OA 3A47A 2CITA 2GDUA 1MW2A 4J3VA 1ISVA 4ATWA 5IHSA 4R27A 2WKLA 3K8LA 2VUYA 2WCGA 3MO4A 1HKMA 5I6SA 3WUBA 1XSIA 1WAWA 3ZR5A 4U33A 2W62A 3RM8A 3TTSA 2ZIDA 3WH7A 3AYSA 1WZMA 1J0IA 3WQWA 3NJ3A 1C7TA 3D5HA 3H55A 3BLBA 3L4XA 2XHYA 3T0BA 4E2OA 2ZE0A 4FLQA 1TFVA 1WP6A 3ZT5A 1H11A 3F5JA 1FFRA 3WNMA 1IV8A 1QW8A 1R47A 4J3TA 2J7BA 3BVTA 3IAQA 2OSXA 3NSMA 1IT0A 3BUPA 3ALFA 4PMYA 1UWIA 2UWFA 1ECEA 3LX9A 2JEQA 2YDSA
chains in the Genus database with same CATH superfamily
1UUOA 2G8ZA 4TF4A 4DFHA 2F9RA 1OGBA 3OB0H 4ZQOA 1RFDH 4HNCA 1Q63A 3UVAA 3HLAA 3EX1A 3BUDA 5DK2A 5GGQL 1A47A 1LXMA 5BNXD 4RZCB 3N3TA 3VU2A 2EILB 3BGFC 3QZLA 4L4MA 4CD4A 5EBUA 4G6AD 4Q7DA 4A7VA 2JJSA 4EI5D 1V6TA 2HUEA 4NZUH 1RK0B 4DGIL 4O1DA 1XBZA 4UQ3B 3ARFA 1XPYA 2GOUA 1HWGB 5AENA 2ERJB 4EI0A 3G1FA 4P5KB 2NSQA 4CGTA 4X3ZA 2E75C 3NGJA 3DU0A 3NK4A 3II2A 2NLJB 3DX5A 4KTEH 4M7JH 3V35A 1DIEA 3H42H 1W2PA 3KTSA 2HKFH 4L4VD 1RBAA 4X6EB 4HAGA 3MY9A 3CFCH 4GZ7A 2ZD0A 5FDYA 3SOBL 3WUWB 3NZQA 1DQJA 4PBGA 3RCMA 2VZVA 4BI6A 1RH8A 2VJ8A 3Q1EA 1QJWA 2PYEE 1VFHA 1KM5A 2ZUQB 3U9PH 2A4CA 5CJNA 2FLIA 2CAKA 2FJHA 4PP1D 3WBDA 4GT7A 2QLVB 3PZTA 1RK5A 3CSYA 3RWJA 1B30A 1UXWB 3VINA 3B43A 4H6EA 1QFUL 2QGDA 2ITEA 4QIUA 4XZ9A 3L2NA 3BWWA 4QBXA 2XGIA 2YN5A 4XP6H 5DO2C 5M94B 4NZJA 1DVXA 4PUKA 1W3KA 2MCPH 3X1GA 1W2VA 4JFEE 1OP9A 1SHXA 3MZTA 4UFLA 5LBGA 3DHDA 1U3YA 5DURB 3SM0A 2AW2A 4B5SA 2OL3H 2WQRA 1NFBA 5GNYA 4XPTL 3LXUX 3PNRB 4HKBB 4X99B 2ID5A 3B0XA 4GXMA 2BC4A 2ABBA 3GDTA 3QHFH 3V2AR 3CN4A 3ZS4A 3NN8B 3W1ZA 1KELH 1MXGA 4AU0A 4LT7A 1MJ7H 1Y6NR 5T3ZE 1FIGL 1EBGA 3VXPA 4PTDA 1MQQA 1DQWA 2PP3A 2XA8H 2UZXB 1A4KA 5E5RB 3TWBA 4E3VA 5DZNA 2HJKB 4CNIB 3RO6A 3JWOC 3VNYA 3BG3A 3W1LA 2BZCA 3LCGA 4MLJA 4XP9H 1UA6L 3FOMA 3SGGA 4FQ1L 1RULL 5A2JH 3NDYE 4EN3D 4RPPA 4ZMPA 4Q8TA 3LHYA 5I19L 2H3BA 4LKXB 4G1EA 5J11B 1GCYA 1QHPA 5A16B 3ZXWA 1CFNA 4NZCA 3FXGA 4LAKA 2AK4A 1HYRC 3WDIA 4ZFOA 1N55A 2W80C 4PVBA 4PYHA 1NDGA 4AGMA 1CECA 4CVZB 3FKKA 5C3IA 4I6VA 1MRQA 3IN0A 3C5JA 3KYKL 5ICXB 2QADD 4NAQA 2VMEA 1NIFA 1EFXA 4B9GA 3TVMC 3VYPA 1QOXA 1MF2L 5JDSB 4BFNA 5E5LA 2YGYA 2C4XA 1BF6A 3MUZ1 1YBQA 3MOBH 3RUGF 3PR2A 1LQSR 2J5LC 4CMHB 4ACZB 2RGMA 1NANI 3U2SA 2IDUA 3I6EA 4OZGE 1OVZA 4BINA 2NQ3A 1HJXA 2OM5A 1E71M 4FTVB 3T2PA 1KYDA 3MRLA 3UJTL 1AGDB 5IW3A 3C8DA 3WXWL 1XLCA 2IANB 3OQ3B 1MCWM 1FWFC 4PFHA 5DZVA 2P9RA 2IPTL 3CX2A 4FULA 1FWRA 3NOYA 1WE5A 2E0PA 4CMMB 5F3BA 4V11A 3KFTA 2XVPA 4R7NB 4ZFGH 5IM51 3FF7A 3UYPA 1FDZA 3W9DB 2GGGA 2CR3A 1BWKA 3IV8A 4LUSB 3QIUD 4US5D 3U25A 4DK3A 1RUQL 4X7CC 1SZFA 1PF3A 3SKJH 2L8AA 5LBSA 3AU1A 1X9QA 4IGMA 1ZT4A 2DQTL 3N44B 1AQKL 3UU0A 2Y1VA 3SRDA 2NCMA 2Y4SA 3QLDA 1KENH 1TA3A 4OD1L 1H62A 1BYCA 3MOAL 3IDXH 2WYTA 4MD4B 3B2MA 5I1DB 4C1KA 1UHVA 3DIVA 1UZHA 3QQ1A 3WD5H 1YNTA 4BWTA 4Z18A 5T8GA 3IT8D 2NY5L 3U4AA 5CGQA 4WK0B 5C2GA 3TV3H 3S6CA 3QUXD 3BN9D 3BKMH 4RGNE 1R9XA 1UATA 4J3OH 1BVNP 2GIYA 7XIMA 1R5VA 3MBEB 4ZFFA 1E6RA 1P84K 5LXVA 4FHAA 4EXKA 4AIZA 1PZCA 2H6PB 2IXQA 4ZUUB 4AL8H 1SHWA 1YC7A 3BVXA 1B3IA 1F4WH 4YUEH 1X5GA 4JPWL 2OQLA 1U36A 3KHQA 5BW7C 3SJVE 2NOYA 1E9PB 5FV1L 2EKGA 5E9DA 2XTJC 4E0CA 2UXTA 1JDCA 1XBDA 5HJBA 1N7KA 4MFHA 4HS3B 1E9ZB 3LZPA 1N3NA 2YAQA 5C0FA 4Z2HA 3EYQD 4KCTA 2D3JA 3M1OA 3CCHB 3JWNH 4NENB 2DMCA 5JHLA 1VJZA 1PB0A 3JZYA 2XFGB 5DT7A 5ABTA 2WLNA 5GRYA 1SFLA 1F90H 4ZNEA 4ELKA 3ERXA 1S3KL 1L2QA 1HL5A 2VX7A 5E1HB 4WNSA 2I5IA 4KMQA 3RVXD 2NQJA 1YMMD 3ARPA 3MSPA 1A3RH 3ZKSD 2DORA 1CS6A 3EOAA 3W6YA 2YMXL 3FUFA 2ZTJA 2YDRA 3W37A 3EOBB 2F1BA 3F7QA 5IF0A 4FOUA 5C09D 4L0YA 1UCWA 3O8XB 4L8SC 4X6DE 1KJ2B 1I7RA 4HT1H 1RZJH 3V0WL 4LOCA 1KFGA 4BQCA 2YD2A 3NYDA 5T1KD 2FWSA 1UP3A 4H7VA 2VRAA 1Z42A 5B7ZA 2BWIA 5TE7L 2OR9H 1LK3H 3VGAB 3VFNA 1KFJA 3KPSB 5C1MB 4N2FA 1ZTXL 3E0GA 4LY4A 5EC1A 5GZOC 4ACYA 1CXFA 1VIWA 4JHWL 5DEGB 2PGFA 4CLMA 1AP2A 5DR5H 3S3BB 3C8HA 4RX4D 4O51A 4UAHA 4E38A 1IGWA 4HGKC 1V5XA 2KMWA 3T6ZA 3M46A 4POZD 2BLEA 1JUEA 1OY0A 2NQ5A 4LYQA 1UOKA 4E36A 4ICWA 1X5HA 4L5FH 5LNSA 1Q6QA 1IEAB 3X2QB 4HCHA 5DVOA 2PCEA 1LVEA 2W66A 4XXCA 2G41A 5T5NF 2EP6A 1FORL 3I7QA 3WIAA 2FT6A 3QY7A 3JYCA 3SGJA 3QNZB 4P2VA 1WWCA 1F6FB 3ENLA 2XGBA 1OEPA 4AV0A 3UTPD 1UMYA 3UAAA 1I1AB 3KAOA 1HZHH 2GI0A 4Z7NE 1E4MM 4EXBA 2PTDA 5CFAA 2NY3B 4EPBC 5K1JA 4V1DB 3WNKA 5DS8A 3M9YA 4M1CC 3GF8A 4G5AA 2CLEA 4DVBA 2CHOA 3IJ6A 4D8PB 2I9EA 4XT1C 3B9KA 3L5WA 4HOXA 1IGYB 2AF2A 5KN5A 4BE6A 2F58H 4AJWA 4HB7A 5BWAA 3FSAA 4NQVB 1VESA 3KWSA 4GG8B 5KZMA 4ENLA 1HSAA 3RX8A 1NAMB 1Z9NA 3EX2A 1ZRUA 1H7XA 1ACYH 2AQOA 1QNSA 1KDJA 3LNFA 4JJ5B 1WDRA 3QQXA 1E5AA 3MI6A 1RJZA 4J3WA 1TOXA 5EMYA 2I9TB 4ZXBD 3B7UX 3ZLHA 3P0YH 1J8RA 3C6LD 1A7PH 1U93B 4G7YL 3V10A 3I3DA 2Z8SA 1TCDA 3PJTA 4AYDC 3O6MH 1YE4A 4S2CA 5DQJA 1DWIM 2L0DA 3RKPA 2BINA 4NQSB 2CDGB 3RRAA 4F33B 1H5BC 5SWSA 1L7TH 3M47A 3AW5A 3SQLA 5AKTA 1JFQL 2NVDA 3Q2LA 3GSWA 4IRZL 4MB3A 3V6OE 1AGCA 1O12A 4YOKA 3WSQH 4FS0A 2GEEA 4X0KA 4Z7WF 3CLWA 1VYPX 4LLMA 3RGVD 2KERA 1RIVL 4L1GA 1HKWA 5KVGE 5DFVC 3MC0A 2BCKA 3UA3A 1J1PH 3THAA 3FU7B 1MUCA 6REQB 1T6BX 1FLTX 3G6DL 4QNPF 1XF3A 4DETA 3WL9A 4ZFCA 1XR8A 4PB9H 4EI6A 5ITBL 4QITA 1WOAA 3D2TA 1IE5A 1XTMA 3LKSB 3CX5J 1JMXA 3GRGA 2LR4A 3HE6C 4G8GB 3N9KA 2ZP0T 2A77H 4JKNA 4LSRH 3SDXE 4MA8H 3DJRA 3KDOA 4NN6B 3TLQA 2FH8A 4P57B 1I1YB 2CQVA 2GYIA 4JRXA 4M93B 3US1A 4K39A 4LHUB 4HNLA 4FA6A 1M7IB 3MROA 3TWCH 5HHQB 2ZAGA 3EWWA 3K2MC 1G9NC 2WMKA 4UM9B 2H8PB 3KPPB 3GH4A 1F02I 2VAJA 3T04D 4NP4H 1BEYL 2KZWA 5PCYA 4JM2B 3EGDA 3CEPA 1YN6A 1BQKA 2GTZA 4Z9KB 3EBGA 2ZWNA 4ZAKB 5LJYH 4PW4A 2N7BA 4NO2B 2Z2BA 1OF2A 4NILA 1W0VA 2MQGA 3QRHA 1FWIC 3T2NH 2YB4A 3RWHA 4HV8B 5CBEA 2JKAA 3FYIB 3OHMB 3S3SA 3EJQA 3X17A 2RR3A 1UGNA 1LJYA 8A3HA 1JVNA 2CZVA 3HG5A 4I87A 4WKZA 1T04A 3ARGC 1FFNB 1FWGC 2XWXA 3EPMA 4HU3A 1IIGA 5D4YA 1YYCA 2QEZA 3JS3A 3DX7A 5F7NC 3MHFA 3KW7A 1C08A 3HN5A 2D2JA 2KUTA 2TSBA 1A3QA 5F9OH 3HRZC 3AITA 5KJ4A 2G5BA 3VW3L 5G2IA 3MV01 5A8OA 3AB0B 1AS6A 1MFNA 4ABQA 4A3YA 2DLTA 1ZP3A 4RW5A 4YLCA 3QPEA 4HWNA 1KB3A 4R97B 4RAUB 1EJFA 2C0HA 2QCDB 2UYLB 1CLYH 4JY5L 3PJSB 4RFEA 1WUEA 4PRIB 1YSOA 6PAZA 3O0RH 1HX0A 4F2BA 3W24A 3W7HA 1W5PA 3BGJA 2A5UA 5I6NA 1JVLA 4Z3EA 2V30A 2HRLA 2P5EE 2FPYA 2X88A 2KHAA 3H7RA 1PSKL 3MRRA 4MAYD 2HFEA 5L2JB 4GFIA 2IFGA 1FKXA 4YGAB 3RDTD 4JBRA 1OX4A 3G5XB 1NF7A 3UFIA 1E4WH 1VCVA 1SRDA 1H8NA 4YSAA 4L8DB 1EEQA 4DVRH 3W39A 2CBTA 2UWEB 4OFVA 2GCYB 3ZE1B 1UA7A 3U7YL 4JL2A 2LU7A 5DSCB 2EEBA 3BL3A 1CZ8H 1PW3A 4PLKD 4HMCA 4X22A 3LHZA 5EN2A 5DHVB 4KVNL 3FT0A 2ED7A 2XQYA 4NKCA 3R10A 3NGBC 4GMSL 3E1ZA 3FTYA 1KPVA 5C6WH 2FKPA 3FRUA 4OM0L 5JXQA 2HPIA 3WEAA 1P7QD 3H9HA 2NR6D 4LQ1A 1KR1A 4ODVL 4EXPX 3PAVA 1OOAA 4PJEB 1AQMA 3PDOA 1JWSA 1KRMA 1PYFA 2E7LC 1AKJA 5D1ZI 4Z77B 3BICA 4NASA 4PG9A 4ZNEE 1KCUL 3NTYA 2GJXB 3KBWA 4WKXA 3MCKB 1PLCA 1FHNA 1S7QB 2N0KA 3UAEA 3NFUA 2G95A 5GS3A 4M6MH 4BCZA 4NLAA 1MI3A 1EVUA 2WMPA 1Q0YH 1ZAIA 3W00A 5JPNB 2XM1A 2VRQA 4A8NA 1UC6A 3CBRA 4PCNA 4MJ2A 2OAAA 5AZEH 4FZIA 4MADA 3V1PA 1Z3GL 2OJPA 4ZX6A 3CXHJ 4YZFF 2X0VA 2BSTB 4ILSA 4JFED 2WAQA 4D0BA 4P4KA 4R4ND 4D0CA 4Y9EA 4P2QE 4KJQC 2CLVA 1K4DA 4PGDA 3BKCH 3M6YA 2ARWA 1DQVA 2FWOB 5KSAC 3PWNB 1QVBA 3PS6A 4AYMC 2XWJA 4NNPL 1TJ2A 4K3DL 3T0WA 1HHHA 1R3IL 1TTJA 4YVVA 2VFGA 5F4XA 1NARA 3K6NA 1MDLA 1LRTA 4XE0A 4M61B 3FUDA 4P23B 3RJOA 2OMAA 5T3ZD 5ERWA 3EMQA 1P1MA 1UW9A 2PPDA 5IBXA 4MD0B 5DMGC 3UJSA 1SF5A 1MRCL 5JXAH 3FYOA 3ULVF 3R1GL 2ZRWA 3FT2B 1MDAA 3LKRB 1PKOA 1JZFA 2VDRH 2WD0A 1Z9SB 2V5KA 3VM5A 5JPMC 2BDNH 2QT3A 2F7FA 4YBQC 1GGBL 1DJZA 2FTPA 1X6NA 4RQQB 1ZGDA 1LK2A 2ZA1A 3NSNA 3PWIA 5I24A 2FBOJ 1K85A 2MHAA 2VMDA 3FXIC 1OGPA 4O1CA 1PKNA 3NJFA 4ZTXA 4GRMA 2QR6A 1VLIA 1SM3L 3S3JA 1DQTA 1F7BA 3R43A 2QTEA 3FCUB 4DXVA 3BV7A 4LSPL 1ONWA 4W68A 3S1WA 1V6VA 4G1MB 1BQLH 1VR6A 5C9WA 5H35B 2OZ4L 1I1FA 3KYAA 4Y2LA 1NKOA 3QUZC 1QRND 5F71A 4YYCA 2WLIB 5EU5B 5E6IB 2GB2A 1FL6B 2XFXB 2G3MA 2BP8B 5LXGH 2K4AA 4UQCA 5T1MB 1CG9B 3P1VA 3E6FB 4GIRA 1MW2A 2WUCL 3S98A 2RAMA 1YNLH 5BW6A 1XGRA 2WCGA 3QBUA 3PJUA 2LU3A 3LB0A 3V0IA 3RQ3A 5D2VA 2PD5A 3BDKA 1QPXA 3F4NA 3H55A 2E59A 4O9HL 3R4DA 1A49A 4TO8A 1GAFL 2NY6D 4XRCB 4RIRA 4GXUN 2AQ1A 3IAQA 1E4KA 2HRPL 5HDOA 1IFRA 3FB7A 2G4GA 1TEGA 2VKZG 3P67A 3GKAA 4L7ZA 5EEUA 4CCCA 1TZHA 1VCGA 3NPSC 3VC5A 4V27A 1HDMA 5SWSE 4XMUA 5CU5A 2DQJH 3ABZA 3V7AE 4KPHL 3WL0A 2DUZA 4Z7OB 2CKBA 4PRHB 3W3BA 2QZ5A 1MRFH 1VYSX 4BH7B 5GZNC 4OV4A 2BVTA 3RL1B 5DUBB 4X4YA 1AQHA 4U4MA 5H94A 4U1MB 1TZGL 2DD8H 3W27A 1WKFA 1L9RA 4MF4A 3LLXA 2J74A 4OB5L 2X7VA 2ICEA 4RDZA 1I8IB 4Y9AA 1YECL 4Q8PA 3WNNA 5EY5A 3IVUA 3E3QE 3RWFA 2A2QT 5EZJB 3ZDYF 2CZNA 1LROA 1T1XB 3NCXA 1BOYA 4RGND 2D03H 1PS9A 3BKYH 4J8QA 4Y0GA 4P7QA 4EOWH 2K9FB 2PTTA 4W87A 5BXRA 3E5PA 1CDYA 1L0QA 3SR7A 1B4JH 3CWGA 4QRRD 1J9CT 1G7VA 3E80A 3FOKA 2V82A 1GS7A 1A0QL 2IAMA 1RZ7L 2X4PA 1XF5B 1VCAA 4ADTA 3V4UH 3K2UL 1JI1A 1FZOB 2HX8A 2VC5A 1D5MB 3POHA 1D6VH 4JN8A 5CEZE 1NCAH 3QHTC 1G0CA 3VG0H 2VJ0A 3AZRA 2YGQA 3I02A 4HJGA 3GJEB 4OFPA 3LCLA 5C08E 1S2CA 4C4KO 5LGHL 2OGJA 2PP9A 3V4VA 3P4OB 3CQQA 1K1DA 3OTRA 3L3DB 1K9TA 4P46B 1XYFA 1EUTA 4DPQA 3U83A 3CEUA 5IJCC 4LVBA 2EH8L 3S37L 4N22A 4RZBA 4GSXA 4WK9A 4N2IA 1OG0A 3N9SA 2FO1A 2QR0A 3RU8H 2XXFA 3JV5A 4Y9GA 4M7ZB 4N6RB 5F4SA 1SBSL 2ZWYA 2DQIL 2EE6A 4DKEH 4ZX3A 1XX9C 4JRYE 4IQEA 1GHRA 4WKAA 5ICYB 1NBZA 3UTSA 2VZOA 2UXVA 3HN3A 4GAGL 4LAZA 1EJWC 3P11H 4JY4A 4GSDH 1N64H 1LD9B 1G4TA 4KUZH 1M5WA 1LQ0A 3AREC 1INQA 5DJXA 4WI8A 1DBAH 4JZNA 3W9EB 1NCCL 3BEVB 4K23L 2A74B 3OEXA 4JGMA 1UWEH 3EO9H 1UXSA 3V9FA 5IHWA 3OSKA 2DJXA 1JNLL 2ZQ0A 5K9QI 3TBYA 1MAKA 3QA3B 2YLKA 2Q8AL 2CIKB 3APDA 1OP5H 2XSBA 3SYQA 2X3CA 1BSLA 4OZ4A 1U21A 2CIPA 4JGDA 1AI1H 2WSRA 4S2SB 4IIQC 2X2GA 4IL0A 3V7AG 3CV1A 3JWDL 1AQFA 1VZIA 1UJ3A 1LO3H 3I50H 3HA1A 3M0ZA 2XY1A 3QUMH 4D9RE 3BZEA 4WV1B 1LM8V 5AVYB 1TZ9A 1JCTA 1KCRL 2R29L 5T9CE 4IISA 4DZAA 1R24B 2R91A 2R39A 1CFQB 5CPOA 1XBYA 1G6RH 5CG0A 4U05A 1QVOB 4MA7H 2GT9B 4EVZA 3MLSL 1X7FA 2OYPA 3RZCC 1N10A 2WC3A 3BVJA 3VD3A 1KPUB 4B96A 4PYGA 3UZYA 2Y1ZA 4ZMVA 4KI5C 1I8MB 3EF4A 4DJFC 4IHOB 3NZHL 1UR0A 4H26A 2WMIB 1TSRA 2DM4A 4UTTC 1GVEA 4U1NA 4JUSA 2UZ9A 5KETA 2E7HA 2Z7GA 4YHML 2YGNA 4IMLB 1KTBA 1E1CB 1IJ9A 3F04A 3FXYA 2PDPA 1RUML 5KSBA 4HIHA 3MRDB 4F7EB 4R34A 3V55A 4W4QA 4EMZA 3GAYA 4UM8B 4NKIL 1ZHNB 4Q8NA 3DNKA 1R3TA 3S47A 4QRPB 2YPKA 2JTYA 1E9OB 3AXKA 1YEHH 5KANG 3G9AB 1BXNA 3AMDA 5LGYA 3KOFA 1C1EL 2VXVH 3GHPA 5CGTA 4GNKB 4UT7H 4A7QA 1YDYA 1T7YA 4P5RA 4DJMA 3W82A 1ZLVK 4UZUA 1OM3L 1TETL 1HS6A 4DP1X 1TMQA 1VADA 2YC1A 1IKNA 4JZJB 3UTQB 3C8KA 5HDQL 4WDUA 4X6CF 3QCTH 4FX6M 2E47A 2OGYA 2E5EA 5F9WC 1P9MC 2J9XA 5EOCL 1BWLA 1P69B 5F8RC 3HAEB 4B27A 4UDUA 4E8CA 4XNQA 3QUYA 4LCSA 4WHYH 4HPOH 2Q5BA 1K8DB 4ZS6C 5CEYB 3NWRA 3VD1A 4BSVA 5AOMA 3ULAB 1MZZA 1BVOA 2IH1B 1Z5HA 2XVLA 3CAVA 3IFNH 3E6EA 3QZ6A 3DOIA 2CFFA 4PMFA 5FHAH 3T0AA 2W9MA 4OTXL 2V7NB 3WDQA 2CDEB 4C7FA 4JDEA 1SY6A 3NL2A 3TJEH 1U58A 4LOUD 1DDHB 2EO9A 5JIWA 3PQYE 4YCOA 4GNJA 3VVGA 1J1XL 1BV8A 3SSZA 1WV2A 4B9IA 1EJ6A 4OUEA 4UTLA 2J27A 3TL5A 1ZSDB 4WI6A 2JK2A 3PL6B 3ABKB 1ZALA 4Q6IB 4X7TB 1H8OA 4OY9A 4I0PD 2WO4A 3T0TA 3E9AA 2F7PA 3SDAA 1AXIB 4IH3A 2X70A 4NAFA 3AC0A 4XVSL 3QYCA 4MNKA 1B4TA 1XJBA 4ZCWA 4N0UB 4N6EA 1N0XH 5CJMA 2SEBA 4G8EA 1O95A 1AR1D 3FA4A 1MZRA 3FN0L 1BD2A 3L4UA 2B59A 4MQXC 4RR4A 1E5CA 1NGPH 2EE9A 2EHHA 1WICA 3EPOA 1PNCA 4YWGL 1AGEA 4HK6A 4GWEA 3CAWA 3H2NA 5GJTH 4HCDA 1E4HA 4QD2E 2ADFH 4J28A 1F8TH 1LL6A 1SQ2N 2K3HA 5CR1A 3L3OA 2ALAA 4IL2A 1FV1B 4O58L 2VVSA 3V4PB 3TZVA 3MDJA 4ZPVB 3HQPA 4K2SA 4OLWL 3BT2H 4O4WA 5DQ9A 1K4CA 5F44A 2VN4A 4LVOB 3R8QA 3SPVA 1RIHL 4NQQA 3OLEA 2GUOB 3QXAA 4DERA 4MQ7A 3ZLQC 1H3VA 4XCEA 4MLSA 2YAPA 3IXTA 3BP6B 4JIHA 1G87A 5F2IA 4W6YB 4NUJA 4H7CA 1DUZB 2MNWA 1VFBB 1HH6A 2R1YA 4NBXB 4WJEA 3HNVL 3O3AA 2NRDA 3OAUH 2E77A 3S7GA 3Q2DA 1YYML 4GYKA 3K5SA 1RVGA 1T83A 3ZN6A 4NRSA 5I66A 4IOSD 2NY5C 4Z7VA 3MP4A 3FU8A 4O02L 3RIFF 2ZYFA 3IMSA 2BVPA 4O0QA 4OQ1A 1ME7A 4QJ4B 4DUOA 3HI6L 1DSFL 3BQUC 5D7IE 1QKZH 2HB0A 4WUUA 5CLWA 3S2JA 5TJWK 3MJ9H 1VBGA 3GIVB 1I82A 3WMCA 5ESVB 4G82A 4MKVA 3LV3B 3V1HA 4MWFA 2X12A 1NQKA 5D7HA 2VLRA 4V15A 1R8LA 1JYNA 2PUZA 3K6DA 5B38B 4ZUWB 3B1TA 3QPZA 4S39A 3E0IA 1IGFH 3UXIA 4HC1L 1UT1A 4PR5A 5E4OA 1V7MH 3RWCA 1EZVY 3P3UA 3VG9C 1ZLSL 5GS0L 1L9SA 2P5ED 1FP5A 3MR9A 3V0JA 1GGIH 1UH3A 3RVVD 1TJHL 1S9WA 5F7WC 3FFCE 3N1FC 2OG9A 1AGFA 5TQ0L 2VQ1A 1OGSA 1JPDX 1TX2A 1U41A 1R33A 5IKCB 4TVDA 1F5WA 3AUOA 2PLTA 4KX7A 1WX0A 4UT6H 3WQOA 5C07A 3GDCA 3ECQA 4FQLL 2YKLL 4HHAB 3ANUA 3FW6A 2AQPA 1TZOA 3MRKA 1S78C 2WVTA 4HEPA 5KYUB 4OZFA 1ZSXA 3D0AA 3W01A 4PW9A 2WBJB 4E41E 2B1AL 4APQC 1Q0XL 2WHMA 2G37A 5J3HD 4FAAB 3DSNB 4Q14A 5F1KC 3GGWB 4N6FA 2KQMA 4FYTA 3B06A 4Y16A 4ONHA 3GMNB 3CDGA 1M7DA 1NBYB 4M00A 4CVWA 4HJEA 3IPBA 3VUPA 5LCVA 4H7ZA 2JI3A 1NFPA 3RTQA 2XIMA 2G3NA 1KCBA 4D6HA 5CAHA 4M6UA 4H5SA 3L3IB 3LH2H 2X3AA 3H2WA 3QXDB 4HZAA 5B22A 3WD4A 2Q01A 5AHIA 4JIIX 1B3ZA 2HVKB 4PBDA 2FATL 3WCZA 3TFXA 5KS9A 1EA9C 1Q7QA 1EH9A 5KVEE 1GW9A 4QXWA 5AW4B 1G1OA 2OMXB 5C0AD 2GJPA 5EORL 4Y9CA 3VE9A 3UTSE 4A38A 5MI0C 1OHZA 4Z17A 4XN1A 1A14L 2WXPA 1RY7B 1UB6A 4P2QD 2H6RA 3NL5A 5FGCE 4H8WH 2ENYA 4YFEA 4RGOH 2P43B 2J7CA 1GH7A 2VC2L 4HJJL 3T1FA 4M8VA 4GQGA 1XCQB 1IAIH 1FNEA 2VDRB 3H9SB 3OVGA 3LQAC 1U8LA 4E3TA 4ZW6A 4RWYL 1WDDA 3K72B 1QRKA 12E8H 1NTDA 1OABA 4WSHA 4WEBL 2BZ7A 4FFYH 1DTNA 5DD1H 3WS3B 4GW1B 3AIWA 1QNIA 4HNNA 4XPGH 3HPJB 5E95B 2Z4TA 1A3HA 2APXA 4BQ8A 3BH9B 4BZ2L 2V68A 1E6XM 3HFFA 1POKA 2HVOA 1QWNA 4XI5C 1I3UA 1SDDA 2GVGA 1SJCA 1P4UA 2Y69B 4Z6AT 3KPQA 3I3EA 1EJXC 4M6VA 4IW4C 3L5XL 3GB6A 1B0GB 3WKPA 3A13A 2IG2L 2QVIA 4PA8A 1KNOA 3U5YA 4AOFA 4QY8B 4DZBB 4OECA 3D25B 3LPPA 3GLDA 4UILH 3RPIB 2UUDH 4EDXA 4M48L 5H8PA 3KDNA 3QBTB 2CM6A 4HUVA 1PNDA 1YJDL 3WBWA 1NCBL 2Y7QB 4YHYB 1QD0A 4KVCL 4EVNA 1GGCH 3A67L 1OCQA 3GQYA 2OCCB 2WQXA 2MH4A 2F6UA 5FO7A 2C9AA 3K3QA 5CGMA 1Y65A 4E0RA 3CU2A 3S9YA 3MXVL 2WJFA 2VT0A 3APNA 3B8SA 2YAHA 4JFHE 4X5WA 7TAAA 3F2DA 1XO8A 2VZ3A 3SZKC 3MSDA 4OKVB 4TUOB 1T4WA 4XZHA 1E0VA 5T3XH 1G43A 1IM9B 1R5IB 3E5BA 1MQPA 1KYAA 4Y8FA 2HROA 1KD0A 2BLFA 4DJDD 2VCOA 2JGYA 1UM4L 2MPVA 3V8CA 1K5WA 1OGTB 3KYMB 3QWOA 4HZLB 4X6FA 2AQNA 2GJNA 5DDHB 2DPEA 1UKTA 4AXNA 3Q1SL 2JK5B 3GTTA 1F2QA 1RZKC 4BZ1A 4JZOA 1OYAA 4QSFA 2WXNA 4W9KC 4ECLA 3RAJL 2J20A 3D18B 4NGHH 1M3IA 1J87A 4GBXD 4PLOB 2AJUH 3ECUA 4OUOA 1TU2A 1P7HL 4Z1YA 2XKNA 3D34A 3USBA 2B31A 4MASA 3BK0A 1REIA 3GMQB 1WCBA 2CBJA 4D6FA 3AWEA 4PZVA 3PTMA 1DXEA 3P14A 2XIOA 2Z7KA 1GMEA 3L48A 3WH5A 2HEJA 1NWUA 3UF9A 3CV5A 4HKZA 3UGUA 3SDCB 4APXA 4RZCA 3VDHA 4I3RH 4Z0BH 1C9DA 1FVEB 1XYLA 1GXEA 1ZRQA 3E7JA 1ASQA 1PEWA 1RV8A 1OARL 2RIKA 5CINH 1TV5A 4YBHA 2MQCA 1OM9A 4AYGA 2FEDC 1X5FA 1DJSA 4LOVA 5HNUA 3MO7A 1F13A 4JPKH 4FQ2L 4K8GA 2YR3A 1L6YA 4AFYA 2BG5A 3CN3A 3P81A 1A64A 4N5EC 4AC4A 1QA9B 4GQ9H 4S1QH 3RM9A 1W5MA 3INUL 5C08D 1PY0A 4GLEA 2XUWA 2LGNA 3MYJB 3QUHA 1Z69A 4PRNA 3GXIA 1GL4B 3OC8A 5HI5D 4ZMWA 1TR1A 1UM6H 3BCJA 5EF2A 2OQJB 1UWSA 3QI9D 4K7FB 4MA1C 3MNWB 2QSVA 3WK3A 4NRXB 5D09A 4AM0A 1UKQA 4L56A 1OSZB 1HSBB 4IGBC 2CR6A 5ABEA 5D1QC 5FW6A 2VWSA 3O6FC 1Q38A 4NWUH 5CZXC 1LL1A 5FKAA 3TBSA 3V0FA 4JRYD 1KB5L 3RL2B 5MEQB 4C65A 1AYRA 1U8QB 3EJUA 2LQRA 4NF7A 3WLKX 1A6UL 5HGBB 2G0KA 3NR0A 2VXUL 5DYOB 5SX5K 1AANA 2HG5B 3SURA 5GRUH 1A4JB 1CNVA 3MO1A 5SWZA 4M3HA 3A12A 2FRGP 4Z7VE 2J24A 2DSKA 1FPTL 1XLDA 1SM9A 1BZEA 1JGEB 2YA2A 3S2CA 4MGGA 1UROA 1D7KA 2WXKA 1KXQA 4XN9A 2YZRA 5L8JB 3JVGC 1K6QH 1AXTH 3NN8A 4I3GA 4XZNX 1G6RB 5JBEA 3W87A 3B2DC 5KVDL 4OVVA 3GNDA 3T0EC 3KLHC 3UAJD 2HJKA 2Z9TA 4MUPA 3V0TA 4AZUA 4WWID 2BSBA 4BQ5A 4D9RD 4Y4FB 2G2RB 3HBPA 4I9XA 4UMCA 4OZGF 4JBSA 2GUUA 1IT9L 1XGPA 4O1FA 4L9LB 2JKSA 5I1EH 3ULSA 3EO0A 2ZKHH 1IB5A 3KJ6H 2NX5E 2VQ4A 2DPKA 5BUPA 4C6EA 4OLUH 1GZHC 5SX4H 5IOBA 4YXLL 3CX5K 3W4RA 4AWJC 3IAGC 5C07E 2GDUA 7TIMA 4XNXL 4P05A 4KT2A 3W1XA 1WUZA 2YWZA 5AVRB 1C7TA 3S1VA 2OMUB 1TFVA 5BPPA 3QS3A 2QQLH 4LAQH 3WNMA 3KBHE 5ACLA 3QRGH 3BUPA 3C5ZC 5ICUA 3EOTL 2XYCA 1FGVL 1Z89A 2FR4B 1CUOA 2XINA 4XAWH 3IJYB 3I75B 1Y8BA 1W1A1 2OO0A 5FK9A 4UR9A 1PZUB 3KWUA 1V4YA 1NUFA 4ZE4A 3ITTA 3RA7H 4FTVA 4IMKC 3G0XA 3E9UA 1KM1A 4OD3L 2B16A 4KY1L 3U4EB 3QDGB 3MBWB 4KJPD 3WSUA 4EOUA 5EO0A 1VH7A 3KPMA 2F53D 2R83A 3R2GA 3F7RA 4CMMA 3A64A 3N29A 2X6VA 3P5YA 2EVJA 2E86A 5DUML 5I3FA 5HGHB 5FCUL 4ADIA 3NYKA 3VZZA 3MRFB 4OV9A 1RIUH 1E3FA 1GOFA 1Q90A 3T6XA 2AVFA 4ZMNA 4UNIA 3FQTB 3F58H 3W9DA 1Q2SA 4FNPA 4LUSA 5JORA 5FHBL 3KBPA 5U4NA 4YSDA 1AJ0A 1U8CB 1EB3A 3B3IA 2W8CA 3AQYA 3KRZA 3LCXA 4NNCA 1YPZA 3TH2T 3VD7A 1I3RB 4LALA 1OC7A 3PQYD 4ONGL 5FFOA 4BSJA 2YXWA 2Q2EB 1HE8A 4HUXB 5BZZA 1YPXA 4UT9A 5ADPL 2JELL 2YRLA 1ZENA 3T4WA 4FQHB 4TVPE 4QRSA 3SKNB 1SJEB 3PNZA 4F9LC 3F5KA 5J5EA 1TJRA 3L9YA 4FJ6A 3I85A 1P7KB 2Z35B 3OAWA 4BJHA 1XF2B 4HUWB 3K1GA 4HG4J 1HXJA 4ZTYA 3QY8A 3TYFB 3MBEA 1FUYA 3B9DA 2X7LA 3ZLGA 3OZ9L 3CZUB 3US0A 4ZUUA 5T1JA 4DAGL 4JFFB 4OZHA 4LGPB 1F3JB 3TYDA 4A6YL 1Z5LB 4XHJD 1E9PA 2ZVIA 1DQDH 2VR6A 4PMZA 1GORA 2C4FT 4M5YH 4X6DF 1QFWL 2NZIA 1IAOB 2BOCB 3MLUL 3V9CA 4JOMA 4JDTL 4XNYL 5E51A 4M4PA 2AOSA 2MCMA 1HHKA 3WIJA 2NZLA 4YHKH 2WBXA 3OB0K 4XPBL 5D2TA 3M8OH 4LLUB 2V7HA 5CEXB 4S10A 5IHLB 1E4XI 2P24B 4F8XA 2HXAA 3LQAL 2ZPKH 3EZ4A 2BY3A 3KLAA 5I1GH 3FS9A 2QDEA 4HEPG 3WQCA 4HT3A 4Y5VA 3SE3A 1Z0NA 3UO1H 4FI8A 4Y2DC 4F3FA 5DJ6B 1T03L 2X4QA 4NKMB 1NCDH 5JOFB 4MHHG 1F6AB 3VNIA 1MNUL 3RVUD 3IMVA 2O4EA 3Q6GL 4HPHA 3P73A 3LD8B 2P8LA 3KXFB 5F7YC 4PTUB 5GGUB 1O6SA 2NUPA 3FT4B 1IC7H 2GFTA 1D9KB 3BP5B 3IXAB 4R2GC 5CUSL 4W9JC 3QIBB 5DWUH 3S3GA 2PLMA 1Q8JA 1ZGLA 3BP4A 1KPRB 3OMZA 1XM3A 3R6IA 2Z64C 5AWNH 5A8NA 1H0DA 1OHQA 1JPTH 1O6VA 4K2UH 1WUFA 4PJ9C 3IAPA 2ZCZA 1RBLA 2ZXEB 2VWTA 2CLMA 3FYEB 2YXMA 3WQ6A 5A6BD 1GW0A 1YEEH 2HWZH 4Z7NF 3S5SA 4WW2B 3QAZC 2V9RA 4DI9A 4W86A 3MRGB 5JW5B 4RMQA 4HJUA 3CMJA 1LDPL 2HKHL 4QXTB 4CNOA 1S7TA 4H9TA 1Q4NX 5AHEA 4OZOA 3WNOA 1UP2A 1MFMA 3FFCD 5EBWB 4WO4C 1XGYL 5F88B 1KLGB 2FCBA 5AVZB 1K2DB 2XWRA 2NXYD 4CBPA 2CU9A 3NL3A 1E1EA 4H9UA 1KEGL 1P0KA 2DY2A 4XGZA 1W1TA 2DLFH 4PAZA 4AVFA 2X05A 4FF7A 4YR6B 1CU4H 2LE9A 3UPWA 5IROA 1GQNA 1DQKA 4FX5A 1NUDA 4E41D 3N9GH 2ADJA 3W2DL 1FJ1B 3UWUA 4LU0A 1T5WB 1YE6A 3TYAA 3NO1A 4EPDC 1L3NA 4D8PA 2XZQL 1RZKL 2PEVA 1G7UA 1CT8A 3EWCA 1IGYA 3BP7B 1CGSH 1MUWA 3ZQ9A 5EO9B 2WM0A 1HZLA 3HE7D 1P4IH 2VDKH 4NQVA 3T08A 4DHGA 3CSBA 3DEQA 1QT1A 3WJSA 1T7VA 4NZDA 4IRJC 4A21A 3TESA 4JJ5A 1XT5A 2ZC8A 3QQNA 2AK4E 1D5XB 2WB5A 5ACMA 1S46A 1EL3A 4P8QA 4BEUA 2OMWB 5LN4A 1BM7A 3GM8A 1FWCC 4U3SB 3DX6B 3U2CA 5CEWA 3IDYC 5TPWH 3MLYL 3KBSA 4Z8FH 4PJIB 2CO7A 2EPKX 3JWDC 2CDGA 5IBTL 2DQMA 2BFVL 1N4XH 3QN3A 3UC2A 1RK1A 1YUHA 3NZGA 3WO3B 3AMCA 2FGWL 1MXSA 4U7MA 2E9MA 3UP8A 3VTAA 2C71A 4D6DA 3BXNA 1ZLEA 3S5LB 3SDXF 3D52A 1GR7A 4GKSA 2DLEA 5HMSA 5SWZE 4PJDB 2C15A 4X7SH 2NY0D 1ZY9A 2LVCA 3VGHA 3M7WA 1AH4A 3KTXA 2KZBA 5HYQB 4WDWA 3L2IA 2KBGA 1TCRB 4MZ3A 4L3EB 1KXQE 4GGBA 3UY8A 4PVMA 4LXFA 1XDLA 1UPMB 5IW1A 4Y9NA 1WFJA 2W0PA 4HCGA 3MUGA 4AVKA 2QSCL 3IJEB 1NGQH 5FL0A 4ZUSB 2PDUA 4GG6B 3UBXI 2CLOA 3LKSA 4Q58C 3I6KB 4R9OA 3UYRL 5F6HJ 5E8EB 2VEIA 4B16A 1PKLA 2VKXA 5E9NA 4PS4L 4KBXA 3LS5H 5TDNB 4XWOD 1CE1H 3LB6C 5B1CA 3IIPA 3FPXA 1FDLH 3Q0HA 5C0JB 2J88H 1F3RB 5E0FA 3FRPA 1FCQA 1M04A 4RWHA 3PK7A 3AFLA 5TQ2H 2BIQA 4R7LA 3WF1A 3G6JA 5FDWA 1JZDC 4ORIA 4YX2L 5GGVH 1A8ZA 4DK6A 5EPDA 3RILA 2ITDB 1FA4A 4ZMLA 1W5NA 3KAAA 3MRPA 2ADIB 4JFZL 5CZJA 1JS4A 1NOUA 4TXEA 4I18B 3U57A 1RZMA 3W83A 2XN9B 1W2KT 2ZJSH 5M3WA 1RAKA 2ZUYA 5DRNB 1QTWA 4HWBA 4NZRL 4K5PA 1KC5H 4HV8A 5AYBA 4OCWH 2DTSA 4FMVA 1OP3H 5E9DE 4L4PA 1ZXKA 3UH8A 3OM3B 3OAYK 1WAAA 1GVQA 3IRSA 3FGCB 2O9PA 4PUBL 1ZDQA 4N1EA 2A6DA 2VDHA 2KZHA 4YXHH 4QG9A 3RGTA 3GEWB 1I3GH 3UZJA 1MJUH 2PYED 1JN6A 4ICXA 1Z9MA 1DV7A 4J40A 4AVIA 1MRDH 1M7UA 3PTQA 2LT9A 3QHZL 3LCFA 3QUYD 3TN0B 3QK0A 4N2CA 1A22B 2JE8A 3WEXB 1HWWA 2O55A 4KNQA 1S9VB 1QTPA 3EBVA 4GJJA 1ZEAL 1RUPL 1SVBA 5KBDA 1I1CA 3G5VA 2OL3B 2MPAH 2UYLA 1OL0A 2EQDA 3VM7A 1ZE3C 4F9PA 3UDWA 5FYKL 2OJ1A 2IQTA 1S5HB 5IMLB 1BIHA 2YUWA 1YPZE 2E67A 1BGXL 1ZLDA 4QX4A 1M7JA 3TC6A 2NT1A 2B9AA 4E9QA 1P0SE 4FFVD 2YCKX 3CFJB 3CDZB 4NT0A 3PBVA 3C0JA 1XH2A 3N2BA 3M0HA 3QJTB 5IFHH 3S96B 3U9UA 1MREL 4Q4KA 2PDNA 4N2KA 2WWKO 5AVXB 3D3FA 4JW3A 4ADSA 2AJSH 4FNQA 1I7ZA 5FIEA 3VGFA 3M5YA 3W1TA 4J12A 4AD2A 1YNPA 5TDOA 1ZBCA 2BH0A 4B4FA 2H5UA 2QDWA 1B9BA 3V5HA 5D1ZC 3ECWA 2YSSB 3QYNA 2AL2A 2WYSA 1HKFA 4AG0A 4NJ9L 3U0HA 2HRGA 1II4E 3WF4A 3OWRA 1L9NA 1FO0L 1YIXA 1DQLH 4K3JH 4A2RA 4QDMA 3F83A 3OZKA 5F97E 1EV2E 4M9PA 1AXSB 3UC0L 3G04A 3B9VA 3L4WA 3KVJA 4JFTA 3W3OA 1P6AB 4LPWA 3NQDA 5AOJA 3ROOA 2V5BA 2QQ6A 3QIWA 3IMTA 1GUVA 3Q2NA 1E7UA 3FC8A 3HZYB 1TKKA 1XGTB 5EB9A 1IGJB 4IPLA 4XMXA 3I4EA 3N19B 3VKCA 1NIEA 4F2MB 4NJAH 3GK0A 3ZE0E 5KZCB 2YBVA 3MCKA 2FFIA 5CBJA 3UMNA 4DPRA 3QOMA 4DUVA 2XG4B 5AC6A 2NW3A 3QO0A 3T77B 4AWEA 1ZGLM 4QOKB 2D3NA 4PQXA 2N0MA 4G7EB 1V3JA 2PCXA 4IU3B 1MNNA 3QPKA 1EAQA 1X6LA 1LMKA 5F96H 3BAKA 5GS1A 2VLJA 3CLFL 3EH3B 1AG6A 1GMIA 4QHPA 3HR6A 2YX0A 2AGKA 4P2OC 2EINB 5I8EB 5GS0C 5ACZB 2BSTA 4BFOA 4KCVA 3FT1A 4JE0A 3ZYOA 2PP0A 3MLRL 4HUUA 5AW9B 4ZFQA 4IXXA 3VXSA 1TPVA 1TSIA 4W93A 1CFSA 3IN2A 1NFAA 3ESNA 2IDSA 2NQHA 3WE1A 3JXAA 1GW1A 3BW2A 4FXTA 5IOPB 3UZVB 3WJJC 4H2HA 2P45B 3VGBA 3EYSH 4FR6A 3V5FA 3ULVL 1L6XA 3BPLB 3DOSA 5INDB 4M61A 1IXQA 4P23A 4RFOH 2OMVB 3G1AA 3QDMB 3NSFA 5DRWB 3PP4H 5K2ZA 5ICZB 3L7FB 4JY6B 2GC4C 3G1YA 4FQIH 4BUHA 3FL7A 5A2BA 5KTEL 3SRKA 2C4FU 3FT2A 3KS0H 1PL9A 5AOUA 2FNWA 3P77B 2HXTA 3FQRA 3B97A 4L3FA 1N18A 2VR8A 3CZEA 1P1VA 1A0CA 3VUAA 3ECVA 4GQBA 5DXXA 4R5XA 3TF7C 1E8WA 2NX5D 5IHZA 1FC1A 4C47A 5IVNA 3CHXA 4JO4H 5IBLD 3OD3A 4P2RA 2C91A 4B5EA 4UCFA 3A6BL 5C0EA 1UTDA 2VN6A 5CZVL 2R2EA 5E1AB 2VXTH 4J1UA 1AYOA 4QRTB 4G1MA 4ZUVA 2X42A 3PBYA 3D2UD 2KH2B 5I0DA 4P3DA 1HF6A 3AWGA 1P5UB 3FONB 4RAVA 4KWUA 1AO7A 3HQ1A 5EU5A 3WFEH 2XFXA 1I1XA 3NPUA 1FFTB 4O1EA 1NWTA 1CC3A 3HPXA 4N2BA 5DFTA 3LKPA 5AC8A 4DP4X 5AW0B 1U8MB 3VIPA 1TFPA 1OVDA 5KSUA 2AJZA 2IOMA 1LBFA 2BVOA 5K39B 2PGRA 3CC5B 2OI9B 5E6ZA 4E4UA 5EFIA 1EJVC 3SJVD 3MV8A 3FQ1A 2O5XL 1Q72H 2WCPA 1HJCA 1UGKA 3A24A 3ZTJG 2XPGB 4F8LA 2JB5H 3BQ5A 3E49A 4NQCA 3LY0A 2V8LA 3L17A 1KBGL 4Z3HA 1NLDL 3MX0B 5J8LA 2AC0A 4JRXE 5IVXA 3ZLFA 2PTVA 3H12A 4XRCA 2RCSH 1JHKH 1KLUB 3C0LA 2DBJA 4Y9OA 4PJ8D 1KKOA 1FHGA 2DJUA 1GY1A 5GRVK 1GKOA 2CO3A 1RURL 2GLKA 1IBDA 3EA2A 5HUPA 2X41A 5C0RL 2VXSH 5I30H 2DKUA 3SCRA 4G2AA 1A65A 4WWKD 3LBOA 3NDZA 2KZKA 5FJRA 4GJTB 2Y85A 5E0QA 5DO8A 2BXYA 4HSCX 3C2AH 2TSAA 3FH8A 2I1OA 3LDVA 1OALA 2R69H 1G4RA 5JHAA 1ZPUA 1AOZA 1KM2A 3DVGB 2Y7MA 3FUJA 5FI8A 4N20A 4TVPD 4P5TA 5CWSB 4F66A 1YJDC 1JZ7A 3ZO0A 3EXSA 3K2KA 2ACRA 1HESA 1T2JA 3SY0A 3X3FH 2KS0A 3O41B 1BW8A 4G56A 1R0AH 1QSEB 4LLDB 2ATMA 2GTWB 4W9GC 3OKEA 4IDJH 4LB8A 2YUVA 5LSMA 4N4YB 1A1NA 5EU4A 5F8QC 2P3YA 1XXFC 3DBSA 3W2MA 3W38A 4FFZH 4ZQMA 3H2MA 1FFQA 5A2FA 3GHBH 5DHMC 2APSA 1XF5A 4B4HA 5D7JA 4Z76B 4R26H 1H49A 1BQGA 3D07A 3W7OA 3WKYA 1VBUA 1FZOA 2FX8H 4N7QA 1DQMH 2WHKA 4TV6A 3T71A 2IMRA 4JKMA 4PB3A 5HMFA 3W2KA 2WINB 4A8RA 3SGKC 3VI4B 5KSWA 4LSBA 2EGZA 3WS6A 2IDCA 3BGGA 1DEEB 3VFVB 3PPCA 4YDKL 3SYOA 1E67A 1IWPA 3L3DA 1NIBA 4DJEA 1CTMA 1BRLA 5GSVB 1EPVA 5CXPA 4GUGA 1DSWA 1EVTC 1OFQA 1YEIH 2VEFA 1TVBB 3S5YA 2XH4A 2R14A 3ARFD 2NXZB 4GC4A 2NY1D 3GYRA 4Z7UF 3KPLA 2X30A 5EWIL 3PTDA 3Q8CA 2A6KB 2Q6ZA 1XLMA 2WKOF 2BOGX 5C9XA 1WKEA 5CPSA 1PHWA 1RQ5A 4AITA 3SE6A 1TIWA 1I75A 3E6HA 2VOTA 3PPGA 3RIKA 3MGTB 4AF0B 5E0CA 3HFML 4RNIA 5DRCA 5D72H 1U2YA 4IIDA 4DX3A 1D3HA 3BC9A 5ID0B 1MPAL 4JCWA 2ADGA 3ZTCC 4IRSC 3HMCA 4KQ3L 3EJCA 4JVPA 5ESAB 4RMVA 1WISA 3P4NB 5IM7A 4WHTB 3MA8A 2RQ8A 2F5AL 4GW4B 1LEKB 2UZIL 3FAWA 4KTYA 2A74A 2YK1H 4RZKA 2VABA 3UY7A 5BRZA 4GFTB 3QA3A 1TEFA 1YDOA 1JZ2A 2DQGH 4ZUTA 3N4EA 3UACA 4M82A 3VD9A 2CK0H 2VURA 3HB3C 4LDOB 4PHXA 5DD3H 3MRIB 2JALA 4GW5A 2YYUA 3APYA 1E2ZA 3EXTA 1QWUA 2Y36H 1MCDA 2YBRA 4IMCA 4XXWC 5ECJE 1J6PA 5KYNA 4N2OA 5IHSA 4UTMA 2PWUA 3AAMA 1XR9B 1W1IE 5F0MB 2Z31A 3UTZB 4FGMA 3NJ3A 3QQ4A 2ZE0A 4PJHA 4XNMA 1NGYA 5GGSB 4K5MA 3KZPA 3WLLA 4MZYA 4PI2A 4ZO8A 5FF6B 4DCQA 3DV6A 2ATSA 2I25N 2JEQA 1UOZA 3LEVH 1QOPA 35C8L 5HVHB 1KPUA 4Q8UA 3UETA 1EIXA 1YDVA 4OFDA 1SOKA 4ZSOA 2JIXB 4ICCX 1WA2X 1G9MH 4PJFA 4AV5A 2PGWA 4CCDA 1HAUA 2WMIA 4OTKA 3UL4A 2C0AA 4S11A 4LSUH 1Q2RA 3G6LA 3RPMA 2X4RB 2P5PA 3AS0A 2V2XA 5IRPA 5I5RA 3H2PA 4G80B 1CFBA 3DBXB 3QPXL 3PGDB 1YY8A 1ZHNA 5SWQB 1G7IA 4QRPA 1A3XA 4RE3A 3FRPG 3EDKA 4JPSA 2J62A 4G5ZL 5D1XA 5FSDC 1EBPA 1ZU8A 4MTMA 3NA8A 1JXFA 2AK4D 5I5MA 1YDNA 1WFUA 3A3YB 4KERA 4MDOA 3FO9B 2I9UA 1JZJA 5MKGA 3NQ6A 3IU4L 4W81A 3SCQA 1EFXD 4LEOB 1RULH 4HJTA 1YDPA 1Q66A 4L1BA 3NTCL 1G4EA 4UR7A 4M7KL 3H0TB 4IT1A 1VENA 2VLJE 3HAEA 3NJLA 1W6WA 1FN4B 5G1MA 3KGUA 5B8CC 3IWVA 2XQYG 3NQFA 5CEYA 3TO4A 3VIMA 2EIJB 1KIPA 4BGLA 3UCDA 1UB3A 3S46A 4ZZFA 2P47B 3FSWA 4Z3JA 3SYAA 3QM3A 4MGXA 3CB3A 4NI6A 5FAJA 4BK5A 1X8FA 1PL3A 1KY6A 4NZ5A 1XRVA 4WDTA 1JD9A 3UZ5A 3IK2A 3EMZA 4NT6B 4HIJB 3T8VA 3VYOA 1QQDA 5C9JA 1VGEH 2DWYA 4Y4HC 5G5DB 2PCPA 3O1NA 3V7MA 2PDGA 1R2SA 4HKPA 5KG9B 1MCKA 1JNDA 2GBVA 3HPFA 4H2CA 1SOSA 2ISSA 8FABB 3MSGA 3VOIA 4P07A 4NS0A 1ME9A 3VWJB 3PL6A 2YKKA 3C60A 4Q6IA 4X7TA 3DFHA 3T0CA 2GQ3A 1EA0A 4J8RA 3R4RA 3FU5A 2FK9A 3QW3A 4JKPH 2RA1A 3B8VA 2VO8A 3KHJA 2RFGA 3O2DA 5GSRB 4HK0A 3MSYA 5L9DL 4N0FB 2FVKA 1XYCA 2OMZB 3HQOA 4EIBA 1H8LA 7PCYA 1BYPA 4H00A 2BOBA 1CD1B 4KV5F 4I5RA 3QLLA 4XOBA 5CP7A 5CPNA 4LCUB 5F7EL 4BQ6A 1BFVL 4P2RE 1W9BM 4KIRA 4WFHE 1S5NA 4UTWA 1H1ZA 4G6FD 4ENZA 4HK3J 4FQXC 5E4EC 3DAQA 2A9ML 3MI3A 3O3EB 2XOTA 3MT1A 5CBIA 2AFNA 2VAAB 5CM1A 2XXGA 3GSRB 2DMGA 1E27B 3BFWA 4HGWB 1FV1A 3TC3A 5D7IF 3ARZA 3R4IA 2J1YA 1FQ9C 4HPGA 1Q65A 5BMFH 3F84A 2E5CA 1WA3A 5D9PA 4AUYA 2V2WB 3DFNA 5JW3H 5I75B 5FJJA 5B39B 1H1NA 2YMOA 2GUOA 3T0DA 3QR3A 4LRIC 1A02N 2K78A 4XBPB 4B3KA 3MAWA 1SEQL 4KH9A 2V37A 1VEMA 5E9DD 1DUZA 4NQCE 4B9JA 1IFHL 3TROA 3LRKA 3VVVA 3WFCL 1BX2B 3KR3L 4XVEA 2DQCH 5HY9A 4XTRD 8XIAA 1QNVA 1AQ8A 3PXHA 3QFJA 3NQ2A 1WYIA 2WNWA 3UBFA 3GTXA 4R4FL 5BS0A 5AVQB 3O3RA 3HLKA 1TVNA 3CFBB 3QZWB 4XWGH 2Z34A 1G7QA 1P7TB 2H3KA 4CQ9A 1UJPA 3V4BA 4E9YA 4ZG1A 4X5PA 4MPQA 4LUTB 2FVMA 5IUCA 1P0DA 3L5MA 4GRLC 5RUBA 4HHLA 5B38A 1X5ZA 5BV7H 3IPEA 3MS8A 3LS4L 4GOAA 3DGGA 2ZUNA 5D71H 2H1PH 4W8AA 4JDVB 4N2DA 2V4LA 4LCQA 5JQ9A 1TVHB 3LN4A 4DKFH 3W5NA 3S36H 3NIGE 3EWBX 3DG7A 2B81A 3BAEH 3EH2A 3S5OA 1SZGA 4AHQA 2XWEA 5C2CA 1VBHA 3U9IA 3RP1A 3SKMB 4FJZA 1P0NA 4QKTA 4ZO9A 2YIHA 1SOQA 5I1JH 4C90A 1DJHA 3OJDB 1A21A 1XIWA 1GOOA 3QJZA 3PJNA 1U3HC 3FIGA 2GY7B 3DMMB 3NQIA 1J7VR 3FQUB 1OP5K 4BSWA 5HGGS 1EXPA 3MNZB 1P4LB 1RJCA 4ZSTA 3KEHA 3SN1A 5M95B 1V0MA 1KRAC 1DVTA 3UZQA 4YLWA 5HPOA 1RK6A 2XSXA 4P4RB 2PS2A 3G5EA 4GA8A 3GGWA 2L3BA 2B4CH 2NUTB 1WFIA 4QHMB 1SO6A 3CXDL 4EXQA 5EHFA 4JHWH 2J9YA 4YSRA 4JQIL 1KM6A 1YHPA 5J6HB 3MRJA 1K8CA 3V16A 2Z1SA 4IF2A 5IVZB 3FOLB 2P5WA 4S0SD 4MWAA 3U6WA 2PWHA 2H2PC 3L21A 1JV2A 4K0OA 3F62A 3WJMA 3L3IA 1OAQH 1SJAA 1W0YT 2IPGA 3ULUE 5GGRB 3QQDA 3S6OA 4GVFA 1YEKH 3AQDA 2J6VA 2YGPA 3ARBA 3OKMA 3MMTA 2QL1A 1SUJA 1G7HA 3HVNA 4BFIB 2D0FA 4BYHA 1TQUA 3B9KD 4MDIA 2J7LA 1HOCB 1I8UA 1US2A 5KSBE 4P9HC 2D0GA 4LV4A 4OT1H 2XVBA 3GIQA 2GHZA 2HLAB 4KKLC 1QLRA 2WTRA 3P0XA 3L12A 2DN7A 3T1WA