1AVAA

Amy2/basi protein-protein complex from barley seed
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
403
structure length
403
Chain Sequence
QVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFAKGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARLEY ALPHA-AMYLASE 2(CV MENUET)
publication title Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution.
pubmed doi rcsb
molecule tags Hydrolase inhibition
total genus 139
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1avaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1avaA01
1YQ2A 3RJYA 3B8SA 3BAJA 2VZVA 4MB5A 4GPNA 5ABEA 1OGSA 2A3HA 3BVXA 2PB1A 1NP0A 5A8MA 2Z1SA 1OGBA 3WQ6A 3L4XA 3EJRA 3A5VA 2YIHA 3IJ7A 3D50A 1WZMA 3S2CA 4CD7A 3LPOA 3SIMA 2DT1A 1LLOA 3FHAA 4CCCA 3BSHA 3AICA 1FHDA 4PCTA 3RCNA 3EDJA 1QNRA 1ZB5A 1W9PA 3WDQA 3WD3A 4PMXA 4BF7A 4DO6A 1XSKA 4A3HA 1KTBA 4D6JA 2XFRA 4IPNB 1A47A 1KR0A 1DWFM 3CH9A 1EXPA 2VL4A 4A3YA 2WMFA 1UR4A 2XN2A 4CCEA 3SUVA 3WKZA 3HG3A 1MXDA 5E09A 1W3JA 3BUBA 4ML4A 1M04A 2W66A 2WVUA 3KE0A 3PZIA 3L4YA 4B9ZA 3AIUA 4NX0A 4TVCA 3E1F1 1UR8A 4B3KA 3BGAA 3LX9A 4B3LA 3MS8A 1J12A 2BVTA 4UOJA 2O9PA 1QI0A 5FD0A 3ALGA 1OD8A 2VQTA 1V6YA 2YLLA 3ZR6A 2YOCA 1IV8A 3BVWA 3CBWA 3CZLA 3W37A 1V3LA 3J7HA 2OSWA 2ZX6A 1UWTA 3SCSA 5C71A 1BTCA 3AJ7A 5LA2A 3WF4A 2DQXA 1UKQA 3AS2A 2CIPA 1BQCA 4FLOA 3MU7A 4F66A 5A95A 1R7OA 3BVUA 2O9TA 4GXPA 4UQDA 5EFFA 3CZKA 1B3XA 4BZYA 1UD8A 4UR9A 2DSVA 3F5KA 4B16A 3PTQA 1BGAA 4MAZA 4E8DA 2WHMA 3B9AA 1U30A 3FXYA 3VD9A 3VSUA 3NCOA 4HA1A 1MXGA 3AXHA 1JZ5A 5D8WA 1O7AA 1DHKA 3AQUA 3SCVA 1CLVA 1G01A 5M3WA 1CGYA 4QP0A 1BG9A 4BQ5A 1EH9A 2DPEA 3GXDA 2VCAA 3L2LA 1MW0A 3T09A 2DEPA 3DHUA 1C90A 2BHYA 2C0HA 4FNSA 1XH1A 3OLEA 1ISZA 1AQ0A 4HU0A 3AMLA 2WANA 5D9NA 2XTKA 1VBUA 1C92A 4U3AA 3OG2A 1VJZA 3WL1A 1UASA 1E6XM 1ZJBA 1FP9A 1CXIA 1JNDA 1GHRA 4W5ZA 1LG2A 2ZICA 1HX0A 2VR4A 1O6IA 4CD8A 1GVIA 1IZJA 3O2LA 1QBAA 5BRPA 5A6SA 1UWSA 3AYSA 4WKFA 2VZSA 4CGTA 5GNZA 3TTQA 3O6AA 1JD9A 4UQEA 5A8QA 1TUXA 1QWNA 2EAEA 2YDQA 4FF5A 2CBJA 1E73M 2BVYA 1PIGA 4Z2LA 3WH7A 4KH2A 1JXKA 4P7OA 3MO4A 1B90A 3W53A 4H2CA 4AZGA 4AMCA 1W9DM 2WZEA 5EMYA 5LA1A 4Z2KA 3QGVA 1H4PA 3CUIA 3GXMA 4U2YA 4IPLA 1MW3A 2GFTA 3PBGA 2Y8KA 2G4FA 2J74A 2YBUA 4E8CA 1UA7A 2WHJA 3IAPA 3PHAA 3DC0A 2ZOXA 3AZRA 4D1JA 1VJSA 3AZTA 2W62A 3W38A 1Q6DA 1HP4A 3PZ9A 3IANA 2W92A 2VRQA 1JNEA 1D2KA 1E9LA 2D23A 1W1YA 2WNWA 1VFUA 3PZNA 3CMJA 4GO9A 1GQKA 3ARQA 3LRMA 1N82A 3H55A 4XUYA 3BUIA 2J8GA 2RGMA 4AD5A 1UYQA 1G0CA 5D4YA 1QX1A 4XZWA 1CPUA 3BCDA 3DDGA 5GNXA 4NZJA 1BYAA 5FCZA 3L4ZA 1F4AA 4H8HA 3NIYA 1FH8A 2CXGA 3A4WA 2YKKA 2VOTA 1C7SA 2F61A 4MDPA 2GK1B 3LPFA 1ZBKA 2E9MA 2WBGA 2O9RA 4PMOA 4UNIA 3OB8A 4D6GA 1CGUA 1K9EA 1UH2A 5EFDA 1JZ2A 1KXQA 5A2BA 5EBAA 2XVLA 1CGWA 3WQWA 4GI9A 3WNLA 1KGXA 1GOWA 2E40A 4B15A 2BXYA 4JFSA 2JIEA 4J3UA 5LYRA 4D6IA 1EOMA 3ALFA 4FMVA 4U33A 2WMHA 2XUCA 5JIWA 3PTMA 4XV0A 4J28A 1BAGA 1GNXA 1V6UA 2G3MA 1J0ZA 5FKYA 1TVNA 1OSEA 3CGTA 1E6ZA 2F8QA 3VIFA 4UQ9A 1V08A 5DFAA 5E70A 1MFUA 1OWQA 2DSUA 1QHPA 2YL6A 1OT1A 2Y8VA 5A6MA 1MWOA 1LL6A 3DYMA 1KXVA 4EE9A 4NF7A 3KL5A 1FHLA 2VX6A 2VX7A 4OJYA 2OWCA 3VX1A 2QHAA 4W88A 3GZAA 5BXPA 2VI0A 3IK2A 2WM0A 1R85A 4NI3A 3O9NA 1E56A 3BC9A 4QLKA 7A3HA 3ARRA 2XWEA 3D3AA 2AMGA 2E9LA 3CHFA 4UFMA 2FHFA 4U5KA 1UD5A 3F4VA 3WQ8A 5HBFA 4AZ7A 3VDBA 3L4UA 2QV4A 4PMUA 1OCQA 1E6RA 3BLKA 2XM2A 3W0KA 9CGTA 4P7RA 5IXEA 3QHMA 1XCXA 1JI2A 3II1A 3N1AA 1LJYA 2DIEA 2GVYA 3WDRA 4LYPA 2WBKA 3PZUA 4PTVA 3SCWA 4ZE5A 2YL9A 3A21A 2EADA 1JL8A 1NP2A 4OUEA 3BAYA 5FL1A 1VEMA 4UQBA 1OD0A 4GZIA 1CGXA 1W3LA 2YL5A 1WB0A 3AHYA 3WMSA 2VCCA 2WSKA 3AIVA 4RE2A 3ZMRA 3GNRA 1EOKA 3BLPX 1C93A 1D3CA 5FIPA 4JL1A 2VJXA 3OA5A 4JL2A 2D20A 2ZUSA 3N12A 2F7RA 1ITXA 1EDGA 3RDKA 1WO2A 3ZIZA 2XJ7A 1E0VA 1BSIA 3EJQA 4MNMA 3VIHA 1HKMA 2EPLX 1ZBWA 1Q4NX 3A6OA 3AYRA 3A23A 1FP8A 1ODZA 1ZBVA 3AIEA 2XVKA 1ITCA 2FH6A 3M7SA 3W26A 1E4IA 4W93A 4CU8A 4MB1A 3VD3A 2ZUUA 2VURA 2JIWA 2OW6A 3GTNA 5I6SA 4D1IA 3SUWA 2XVPA 1AQMA 1GJUA 4OGZA 5CPQA 4W7VA 3ZJKA 4PRWA 5A8NA 1CNVA 3KZSA 4TOQA 4AY1A 3AIQA 3VU2A 1C8QA 1CYGA 4C7DA 3HG4A 1TQVA 1WDRA 2WB5A 1M03A 1JYNA 3AMGA 1E1EA 1GPFA 3ARPA 4GO8A 1M01A 3NYDA 1J0JA 3OZOA 6A3HA 3VVGA 5A1AA 1V6XA 2WAGA 4CN4A 4AZHA 3BSGA 4FLQA 2D1ZA 2UWFA 1R8LA 1R87A 6TAAA 1HJQA 1E5NA 1KQYA 4ATLA 3ARXA 4F8XA 1AVAA 4AYGA 1E5JA 4EANA 4JZ5A 2MANA 1V6WA 4HZ8A 2JEQA 1JZ7A 1XD1A 1CXLA 3L4VA 2PF0A 1SMDA 1TQTA 3WY3A 3WFZA 3WQ4A 1GQLA 2CBIA 4JFWA 1GOQA 4FK9A 2CBVA 2YLAA 3WF3A 2VMFA 1J0IA 4X0NA 5M17A 3ARZA 1EQPA 3AOFA 2OYLA 1R33A 1QPKA 3MMDA 1W1VA 3UG5A 2EO7A 2V38A 5D9PA 3CC1A 3ZJ6A 4PEEA 3GBEA 1MQRA 4RE4A 1GW1A 2DH2A 3VM7A 3RJXA 1E15A 3WF0A 2GDVA 3W28A 5AYBA 3EMQA 1K9TA 5CGMA 5BROA 3VTRA 1KGWA 2XFFA 5AY7A 4ACYA 4F9JA 1BVZA 4MTVA 4CD4A 1JF6A 2FH8A 4U2ZA 1UD6A 1HJWA 1AQHA 2F7QA 3F5LA 5BCAA 2ZX8A 5HDRA 5I24A 2E0PA 1UD4A 1H5VA 5DF0A 2WPGA 5E6YA 2EXOA 1R86A 2G3NA 1EQCA 3AMKA 1GOMA 3G6LA 2ZWZA 3KLLA 4JIEA 1T0OA 2G41A 2GDUA 3SCPA 4AZIA 2WVSA 2CPUA 1CTNA 4AD3A 2E4TA 2J7GA 1MVYA 3LRLA 5CZKA 1GORA 4HOXA 3WEZA 3ARVA 2JE8A 3AFBA 5A8PA 1E3XA 3BH4A 1C8YA 2YA2A 1JZ3A 3I3DA 1NOWA 3WQVA 1Q6FA 1XC6A 2Z1KA 4PMVA 3EBVA 3KLKA 5I78A 4C7GA 4R5EA 3AS0A 3ARSA 4AW7A 1E6QM 4AIEA 4CKQA 4TVDA 4QCEA 1HVXA 3CZEA 1XYZA 4E2OA 3ZJ7A 8CGTA 3CPUA 3WH5A 3VMOA 4MJ4A 1JDCA 1HTYA 1GOOA 4GI8A 2FDMA 1V3MA 1GJWA 4C7FA 1I75A 1OIFA 3VNZA 2J78A 1S46A 3WNKA 4PN2A 1JYWA 2VUYA 2X1IA 3NSXA 4W89A 1E6NA 3W4RA 3GYCA 5CQ1A 5CPTA 1CGTA 4GQRA 3CUJA 1SR0A 4W8AA 2X05A 1E71M 2QMJA 2VZUA 3VIMA 4ZE4A 1UR9A 4OBRA 5ABFB 1QW8A 2BFGA 2WSPA 3CUFA 1TQSA 3W6MA 4NZFA 3ZT7A 1B3VA 2WMKA 3T0AA 2J47A 1PZ3A 1BG4A 2OLHA 5HNNA 1W2VA 3VIOA 1BF2A 3LXAA 3IJ9A 2EEXA 1KGUA 3AXXA 1U2YA 4P8UA 3K46A 4DO5A 3ZQ9A 1XCWA 1VFOA 1RP9A 3N15A 1JYVA 3ZT6A 2ZXDA 3CZGA 3B9EA 4AZCA 2DT3A 2HVMA 1MW2A 5EB8A 4AIUA 1E4NA 3FN9A 3NSNA 1E0XA 1DP0A 2EPMX 3WY2A 1ISVA 3UEQA 2V3EA 1TZ7A 4UFJA 1K6AA 4QAWA 3HMCA 2EABA 2WC4A 1KCLA 1CXFA 4DWSC 5E9AA 2JF7A 2F7PA 2VX4A 1V0NA 1QI3A 2VQUA 3ZR5A 3M6DA 4BQ2A 1JZ6A 2WLZA 3BCFA 1GQJA 1H0IA 4N0RA 3A47A 4DWSB 4WIWA 3W25A 5CXPA 3KL0A 3AMDA 2XGBA 1TQUA 2XHYA 3WD2A 3WH6A 5D8ZA 1JDDA 3QHNA 1UH3A 4HMEA 4AD4A 2JFEX 4WSJA 5A2AA 1J0KA 3ZOAA 1OT2A 2VNCA 3CTTA 5IFTA 1B1YA 4GI6A 1EIBA 3VGFA 5CGTA 2DH3A 1B2YA 1CXKA 4YHEA 1B0IA 3SEPA 3DX1A 1EDTA 4JCLA 4YN5A 2X8RA 3WY4A 2J8FA 1VB9A 3APGA 4CUCA 4UZSA 4AD1A 1PAMA 1C8XA 3VIJA 2Y5EA 3W27A 1ODUA 4UZUA 3EDKA 5TD4A 1TMQA 1UH4A 4QLLA 3UETA 1Z32X 3K8KA 4TXEA 3AI0A 1VBRA 4HMCA 3VNYA 3POHA 1H3GA 2F1BA 1DWAM 3WMBA 2VVSA 3EMZA 1QI2A 1SZNA 4H8VA 2ZX5A 5GNYA 2G8ZA 3MUY1 3TOPA 1LWHA 1O7DC 1WZKA 1GONA 1M53A 5E1QA 3WH8A 1UR2A 3FNDA 2O9OA 3WY1A 4L4OA 1V02E 1HT6A 1HN1A 1BYCA 4MAVA 3OZPA 2X09A 3WDHA 3HN3A 4P7QA 4K68A 4BA0A 4TTUA 5KEZA 2J75A 5AC4A 1CZ1A 1J0YA 2CHOA 1E4MM 3AXIA 3A3HA 1WZAA 1Y7VA 1W91A 3QOKA 3VMPA 2WXDM 2ZXBA 3HZ3A 1WP6A 2Y24A 1G9HA 1QHOA 1VAHA 2E8YA 2HISA 1KB3A 4NSBA 1W2PA 4OOZA 5A6BA 3ZSSA 3TTYA 2V3GA 1JYXA 1QNPA 1HIZA 4Z2GA 3TTSA 2DSKA 3I3EA 1BGGA 1J10A 2BNJA 3ARYA 1G94A 4D6CA 4PUEA 3THCA 1HP5A 4F79A 2OYMA 5F7UA 2A3CA 4CU7A 3PZOA 2XVGA 4MDOA 4PMDA 4FNQA 1XSJA 2VRKA 3CZNA 5A8OA 1VEOA 3VKKA 3THDA 3POCA 2X2YA 1CIUA 3LPPA 3ECQA 2CKSA 4AWEA 3BMVA 1P6WA 5DT7A 3DHPA 1W32A 2VO5A 1X6LA 2Q8XA 4XZBA 4FNPA 4B9YA 4P7NA 4XX6A 3UR8A 4NXSA 5CSYA 4AISA 5CG0A 3BXWA 2J7CA 3MV11 4H8UA 4PMYA 1HXJA 2OWXA 3VDHA 1PPIA 4AEEA 3VD4A 4W8LA 4OKDA 3NJ3A 3BUDA 4KRTA 1UZ4A 1V03A 4FNRA 2YA0A 2YDRA 5ABFA 4WSKA 5DO8A 1JI1A 4WJXA 4J3XA 2CESA 1TE1A 4M80A 2VZOA 4LYRA 4W7WA 1XHGA 1JXJA 2ZX9A 3DX2A 3HU7A 6CGTA 1UQZA 4CVUA 4UQAA 1KR1A 4ACZB 1WNOA 1HJSA 1US2A 1MW1A 2J79A 3CUHA 1NWTA 4HMDA 3DYOA 1QI5A 1UWQA 3W6LA 1Q6GA 2DT2A 5A2CA 1ISWA 1B3YA 4PMQA 3NSMA 4M1RA 2C8NA 1PBGA 3SCRA 4UFIA 3N9KA 1IT0A 2EACA 2ESCA 2GJPA 3S5YA 2OWWA 1W9VA 3F5JA 2ZUNA 3WF2A 4HPGA 1VEPA 2JALA 3MKKA 3WD1A 4W7UA 2ZUMA 4W8BA 1J11A 3BUPA 2PWGA 4MJ2A 5JUVA 4UFKA 1LWJA 1C91A 4CVWA 3AIRA 1G1YA 2YFOA 2W5FA 2ZXAA 1R75A 3A22A 1ZBCA 3GM8A 1EO7A 4OIFA 5I3DA 2ZXQA 1KWGA 1ECEA 4Z2IA 1FH7A 4W86A 1KBKA 3VIGA 1V0LA 4ATWA 1HKJA 4E4PA 1ZU8A 2BHUA 4H7VA 1NH6A 1TVPA 1K9DA 1NOFA 2CKRA 3VSTA 3VIPA 1XSIA 3GNOA 2VZTA 3WNOA 1XH0A 1DWHM 2VR5A 2WK2A 1HWWA 3AMCA 4JKMA 1J01A 3M46A 4GKLA 4H04A 3WUEA 2D2OA 1MYRA 3SUSA 4ZXOA 2J4GA 4GZJA 4X0VA 3LRKA 4HU8A 3KL3A 3MANA 1UG6A 5CLWA 4DO4A 2Y4SA 3RM4A 4JHOA 3AHXA 4NRSA 1W3HA 3WDPP 5AYIA 3LPGA 3CMGA 2BHZA 2D3NA 4HTYA 4D6HA 1VIWA 1TQWA 4CD5A 1XD0A 2VVNA 4D71A 5A6JA 1BPLB 2PBGA 1HJXA 3DX0A 8A3HA 4PTWA 3EDFA 5IHRA 3AHTA 3RPMA 4JHZA 1WE5A 1BFNA 1HF6A 3BVTA 1GCYA 4ZEPA 2J25A 4WK9A 3S6TA 3VX0A 3MUZ1 3VDCA 3RM9A 3T0BA 4AD0A 4AEFA 3TTOA 3WNNA 4MADA 1JF5A 1C7TA 3U5UA 1RD6A 2F2HA 4Q22A 2WLYA 1UKOA 4M81A 2DDXA 2ZUVA 2WZIA 4TUFA 2D3LA 2ALWA 1TG7A 3RIKA 1R47A 1XH2A 1GZJA 2V5CA 3WENA 4WKHA 1X6NA 2GJXB 3ZSTA 4M56A 2A3BA 2BY2A 3PZGA 4W5UA 4UFLA 3W24A 1QNQA 1CECA 2X0HA 1WDQA 1NWSA 4QLJA 2FGLA 3TA9A 5HPOA 1H11A 3I3BA 2J7DA 4W84A 3VOCA 3BAWA 1NOUA 1WDSA 3DX3A 2GK1A 3OLDA 1PX3A 5JIPA 3N13A 3VSVA 2X0YA 5I5RA 1BLIA 4MB3A 1EO5A 1WCGA 3D52A 2W91A 3DDFA 4TVUA 1E40A 2F18A 3K8LA 2V3FA 4AZ5A 3HJEA 4MNJA 4DUWA 1H0GA 4ZFMA 3OGRA 3PZMA 3VGHA 2J7BA 1QI4A 4TX6A 2CITA 3KEHA 4TX8A 1JG9A 3EDDA 1L0PA 2D0HA 3BAXA 4UQCA 1D7FA 1C3FA 3QOMA 4CN6A 2WMGA 2XN0A 4DUXA 3CIVA 2G3IA 3VMNA 2XYLA 3OIHA 3CUGA 2EQDA 4AMWA 2UY4A 3SCUA 4J3VA 2WMIB 2PWDA 3NUKA 2WVVB 3CHCA 4CD6A 1V3JA 5DEZA 5I79A 1QWUA 1K9FA 2CCRA 1QVBA 1VRXA 3UERA 3MMWA 1JD7A 4URIA 3VUPA 1ZS2A 3FHQA 2WKLA 3QR3A 1J0HA 3N18A 1VENA 1IZKA 2WCGA 2QLYA 4KGLA 2J7EA 4X9YA 3B9DA 1UKTA 1UKSA 3VPLA 3WDIA 3RO8A 2VTFA 1HJUA 3WF1A 5D9MA 2X2HA 1HL9A 2VT0A 1QW9A 4WF7A 1EGZA 1H2JA 3MUAA 4H41A 4RE3A 1UQYA 3WSUA 3MMUA 1JAEA 1BYBA 5E0FA 5A94A 2W63A 2XVNA 1XYFA 3BLBA 3OGSA 1JGIA 1HJVA 1Q6CA 3EMCA 3FY1A 4JKLA 5BYWA 1HKKA 3AIWA 2EPNA 4HOZA 2PWFA 3T2QA 1UKPA 4IISA 4ACZA 3BUQA 3GNPA 3AS3A 2PWHA 3DYPA 4AMXA 1Q6EA 1W1PA 4MNLA 4JCMA 1R46A 2RGLA 3OGVA 1TR1A 1W9XA 2XGIA 2WHKA 1FFQA 2PBOA 5M03A 4KGJA 3GDBA 3SCQA 4HA4A 2QPUA 5I23A 1NQ6A 1KWKA 3ARTA 1HKIA 4D6FA 4WLCA 1FH9A 7TAAA 2WYSA 5A69A 4GIAA 4FLRA 2GJRA 4U31A 5IFPA 5DMYA 5ABHA 2DSWA 2BXZA 3VGGA 2IXVA 3VIIA 4V28A 3U57A 2D22A 5BXSA 1BVNP 1OM0A 5CLTA 4UFHA 3BVVA 2F7OA 1VFMA 1E72M 3A4XA 5A6LA 4J7RA 3WIJA 1QHZA 2XSAA 2A3AA 4UTFA 3UG3A 1RP8A 3PN8A 2E9BA 2W4XA 2CYGA 2XWDA 1E1FA 2TAAA 4AZ6A 1DWGM 3WBAA 1V0MA 3OLGA 1WDPA 2YFNA 3AISA 3EJSA 5I2UA 2NT1A 3VD7A 5GQBA 2QPSA 5C70A 1KQZA 3FAWA 1WKYA 1UD2A 1TA3B 1JAKA 3SCTA 5BXRA 3H53A 3WMCA 1UZ1A 3UG4A 2QMKA 1OIMA 3HG5A 1W3KA 2WWCA 1SFSA 1UA3A 3U7BA 3CLWA 3W81A 3WBEA 4PMNA 3NDYA 3GXIA 3GBDA 2Y2WA 2IGTA 1V6VA 5CPSA 4KRUA 4FLSA 3WFLA 3ZM8A 1W9UA 3GXTA 3OBAA 1KBBA 1CENA 5GPRA 1H09A 1LL7A 3D4ZA 3WUGA 1VFFA 4IM4A 2BS9A 1OGGA 1LF1A 5C8BB 1E4LA 1OINA 2UY2A 3W29A 3GXPA 1GHSA 3GXNA 4R27A 3VM5A 4PBGA 1ZJAA 1V3IA 1KFWA 4PCSA 1UWUA 3MUIA 1E55A 1PZ2A 1G5AA 2ZWYA 2GSJA 1UR1A 2FGZA 1R34A 2GJXA 7CGTA 2CNCA 2YDSA 4BCEA 1EHNA 1M7XA 3D5HA 1CDGA 3SUTA 4XB3A 4LPCA 4W87A 4HA3A 1J18A 3EDEA 3RM8A 1PS3A 2CHNA 1HXKA 3EYPA 4NRRA 3WNMA 1H41A 3T08A 4JFUA 4D72A 1U33A 2WC7A 3D51A 1GUVA 3N11A 4V27A 3N04A 2J7FA 1W1TA 4DM1A 4F9DA 3MSGA 2WW5A 3LXCA 1MQPA 2AAAA 1HL8A 3FAXA 1JZ8A 2BY0A 4PYSA 2YA1A 1ZL1A 1MFVA 3VD5A 3VO0A 2XM1A 2J7HA 1L8NA 2ZUTA 3VGEA 2D0FA 2V5DA 1H49A 2ZE0A 2B31A 4DUVA 1E70M 5CJ5A 1PEZA 3EJPA 4LYQA 1CXHA 3GH5A 4AZBA 4YHGA 1UOKA 2JF6A 4P8VA 3CZSA 4AD2A 3MI6A 1DWJM 3L2MA 2WMIA 4FNUA 2WVVA 4J27A 2OW7A 4PUDA 1BYDA 4Y7EA 1GQIA 4FNTA 1RH9A 1QNOA 2EJ1A 4UCFA 1HVQA 1FA2A 1E6SM 1V3HA 3IJ8A 4WKAA 1E0WA 1UWRA 5BRQA 5A3HA 4HP5A 2WHLA 4JAWA 1TCMA 2PC8A 4CCDA 4PMZA 3UR7A 1FFRA 4AIOA 4Z2HA 1XGZA 5HPCA 5HXMA 2CBUA 4UOZA 4NXKA 3SURA 4HZ6A 1JFHA 4OOUA 3JUGA 3U7VA 2D0GA 4J3TA 3HG2A 1ISYA 1XV8A 4OBSA 1B3WA 4A4AA 4HOWA 4M24A 2CETA 4P8XA 5A6KA 3D4YA 3SUUA 1NM9A 3PZQA 1DTUA 3SCNA 2GUYA 4U3CA 4V2XA 5HOSA 2YL8A 5DT5A 4QCFA 4D6DA 3AHZA 2UY3A 2FYVA 3WQ5A 1QOXA 1B31A 3L4WA 4J3WA 1LG1A 1AMYA 2VX5A 2XG9A 3PTKA 2YJQA 1UUQA 1I1WA 1B9ZA 3PZVA 4YPJA 2G3JA 5E6ZA 2D73A 3UESA 3N17A 3OLIA 2XN1A 4M8UA 1TFVA 1UR0A 1OBAA 3LMYA 3U5YA 2EPOA 3CHEA 3MSDA 3PZTA 4PMRA 1R7AA 4LX4A 3A24A 4UOQA 3CO4A 1NWRA 3CZ8A 4KWUA 4MPKA 1B3ZA 4S3KA 3T2OA 3WH9A 3S5ZA 2BY1A 2E8ZA 2OSXA 2E3ZA 2D24A 1JDAA 1WPCA 3GH4A 1LQ0A 2OYKA 2PI6A 3K4AA 2J77A 5IHSA 4CN1A 1PX4A 4MNKA 3VDAA 2X2IA 4EKJA 4EK7A 1KXTA 1CWYA 3G6MA 1KCKA 2IXUA 3ZT5A 2IUZA 1QNSA 4MB4A 5JBDA 5IDIA 1MQQA 5M5DA 1XRVA 3DECA 2NT0A 3RILA 4PSPA 1BHGA 2DSZA 2BV9A 2YBTA 3WEMA 3K1DA 3AZSA 1VF8A 2ZX7A 1US3A 3VILA 1V02A 1LL4A 2VC9A 4RL3A 2EPKX 4LQ1A 1TA3A 2PWEA 1NARA 4L4PA 3MV01 3AIBA 5BXTA 4EAMA 2EBNA 2X2JA 4AXNA 2OSYA 4DWSA 4GINA 3TONA 4J3SA 5D9OA 3ZO9A 1PX8A 2AOSA 4ATDA 4GQQA 1WAWA 2BVDA 3DX4A 3T0DA 2XSBA 3NDZA 1JIBA 1UD3A 1DWIM 1GVYA 2WC3A 1JZ4A 4PSRA 3K8MA 3AROA 3SCOA 5FL0A 3A4AA 5A6BD 1E43A 4BQ3A 2XPKA 1SYTA 4ZENA 3UCQA 2W67A 3CV5A 2CEQA 1GOIA 4NZCA 2FE0A 1EHAA 3GXFA 3BAIA 4AZCB 5A6AA 5ABGA 4KMQA 4M29A 3K4DA 3IAQA 2NW0A 1ISXA 5AC5A 3WELA 2O92A 1DEDA 1E6PA 3WN6A 1CXEA 4Q7NA 4PTMA 2WCAA 3GH7A 3IGUA 1UHVA 2F1AA 4U5IA 2DT0A 3WUBA 2QF8A 4CU6A 4HPHA 2VCBA 1CGVA 5ECUA 2A3EA 4GZEA 2BY3A 1V0KA 3ZJ8A 5JBFA 2WVTA 4DM2A 4Z2JA 3KWXA 4HZ7A 1EA9C 4BS0A 2W61A 4M82A 1PIFA 4LXFA 1WZLA 2FHBA 4TTGA 4PTXA 3WNPA 3AHVA 1A3HA 3CZJA 4JFTA 3LXBA 3WEOA 1J9YA 5BWFA 2ZIDA 1E3ZA 4W85A 1W9BM 4ZXLA 3ARWA 2V3DA 4S3JA 4LGXA 1OB0A 3T2PA 5CSUA 3BMWA 4AC1X 3RMEA 2WCSA 1JFXA 1SMAA 1FOBA 2WZHA 4IUGA 3W82A 1EDQA 1X1NA 3VGBA 3TV8A 1YHTA 3AS1A 1CBGA 2XFYA 1RPKA 2C7FA 4QFUA 3FW6A 3M07A 4D6EA 1PJ9A 3VGDA 1H1NA 3VIKA 1ESWA 2DIJA 2XIBA 4QDMA 1NWUA 4BQ4A 3EJTA 5I77A 3H54A 5I0DA 3EJUA 2UY5A 3WD4A 1F4HA 2WMJA 5JBEA 3WL0A 1CEOA 3WUFA 1CLXA 1I1XA 4JFVA 3BAKA 5KZ6A 2FHCA 2J62A 2WKGA 4P7LA 1GOKA 3L4TA 3QHOA 1B30A 5FOOA 1QBBA 3CHDA 4JKKA 5E0CA 2WWDA 1HNYA 3WD0A 1KTCA 3TP4A 2XIIA 1V3KA 3WDJA 2CERA 2VRJA 2DGAA 1KXHA 4N42A 5LA0A 1UWIA 3ARUA 2JEPA 4AYSA 4P8WA 4OZOA 2ZUWA 3VINA 4DWSD 2NSXA
chains in the Genus database with same CATH superfamily
4CVZB 3APNA 3HHMA 2GJLA 3GDKA 3PFUA 5FW6A 2XWBA 5CJNA 3ZKXC 2BDNL 5JHLA 4IJRA 1TMCB 4YGVB 3QLLA 2VGBA 2VZ1A 4PGCB 1H15B 2YIHA 3ROLB 3SKOB 4Y4HD 4PJ5D 2B1HH 4LOFA 4LNCA 5FS5A 3DIVA 1YMHB 3KRZA 3D18A 3C5SA 3QIUC 3SSZA 2YPLD 3AXLB 5LVEA 3IMBA 4YSPA 1WFIA 4O52A 3FOMB 5ABAA 4AZ8B 1D5XA 2P5EB 3CH9A 3REQA 4EE2A 3HGOA 2WJDA 2HVBA 4ML4A 5AYTA 1OVDA 4GSDL 3W1ZA 3U2ZA 4MJID 1NMBL 1JPGA 4AH2A 4OCNC 4UAOC 1GKOA 5LAXB 3GHEL 5TJWK 3ISRA 4B0MB 3EO1B 1BM3H 5IMKB 3ZGIA 1X8FA 5C7HA 2YOCA 2B1AL 1F74A 1N0XH 3VXSD 1V3LA 2R94A 3VAEA 2ZX6A 2DJSA 1UWTA 3QNZB 5DC0A 2QUVA 3WF4A 2H7WA 1Q8MA 5G4MA 2FPYA 2XG5A 5J57B 3CFMA 5F7AA 1XWVA 5F7BA 1C9DA 1I1FB 4O2FB 2F6AA 1TNMA 3T0EA 2WSQA 4D0CA 5JW4N 4NC2B 3QEHA 2Q2EB 1CLVA 4K94H 4Y1AE 1S7VB 4HC1H 2DEPA 3ARDC 1A6WH 4KZEH 1CJYA 4FNSA 1D7CA 6ALDA 3QCVH 3R1ZA 1C92A 5DI8B 2PODA 5DR5L 1NCWL 4OT1H 1E6XM 1UJQA 3CFJB 1QUNA 4DJEA 4M7ZC 5FGCE 3U2SB 1OCZB 5DHYA 3NL6A 2DY2A 3G0UA 1M2VB 1UB5B 2X70A 4IMDA 4WKFA 1JUEA 2GBAA 1XINA 3BOFA 3NAAH 5GGUB 5IVNA 5JHDB 4HU2A 5AZ1A 3HI5L 4WNQB 3CAFA 2VN5A 3NQDA 1OY3B 3WG7B 2WPBA 2P0IA 1FWSA 3CNYA 5CSSA 5EMKA 3LH9A 1SW3A 2H3XC 3IAPA 1JV2B 3IDXL 2F5BH 4C6NA 2ZA1A 4J6RH 3E74A 1Y07A 4IIQB 3TLRA 2HVOA 5F7HA 5FKAB 5LGJB 4KFZC 1T20B 3HR5B 1UYQA 4GG6A 5HJXA 4HK7A 1I1AC 3O05A 3GHPA 1QLEH 3D1MC 3LLDA 3W87A 3VQ1C 1TELA 4ZX5A 2VQ1A 2BG5A 2BIQA 2NXZC 3SDYL 1U8HA 1AQKL 4IGBA 2WY3B 5EBAA 3PCYA 3STEA 1IBHA 5EOQL 3MZGB 4OIIL 3T0ED 3P67A 1H62A 2BSRB 1U0QA 1GNXA 4EDWL 1MLCB 3LCWA 1V08A 5DFAA 5DJAA 2YSTA 1PLGH 3OAZK 4W9GC 4Q89A 1R0AH 5CEYA 1CYXA 4ZZFA 2Z7YA 4D2JA 2ZG2A 5A2KH 4E9TA 5FM4A 3C2YA 1J5IA 5H1WA 1J4EA 5D2VA 2BVQB 4AQAB 4DJED 4DN3L 2KPWA 4R53A 3VGAC 2C3GA 4QXWA 1THCA 2Q8BH 1XG4A 3RURA 3CHFA 3SD2A 3VDBA 3BWWA 4NSKB 4M4PA 2NY6D 2VMCA 2QULA 3TZNA 5SWZB 2P48B 1M7IB 4NFBA 3II1A 2HX9A 3DX9A 2CO6A 1AG1O 2QQ6A 3NDOA 3MCKA 1J5SA 3AHYA 2Y36H 5LNVA 3GSNL 1BWWA 1D3CA 5IFHH 3HFMH 3PDGA 1ZSHA 2F53B 2J5LC 1BSIA 4WJ5A 1ZBWA 4IFKA 3A6OA 1FP8A 1UXMA 1Z3RA 1ZBVA 1HILA 3TNOA 3ZRCC 1E4IA 2BC4B 1EYEA 2IO5A 3MWCA 4BFRA 1TX2A 1BJ1J 1I1RA 1XT5A 2R1XA 3R2GA 5BVPH 4IGBD 2WB5A 1JYNA 4X99B 2AVFA 3NGBB 4V1DE 3EGSA 1XF4A 3N29A 5JW4Q 2EC8A 4M9OA 1R87A 4N85A 3GVGA 2B39A 5I15L 3UXKA 3W2DL 2MANA 3VQLA 1YNYA 4GYPC 3Q1SH 4H25A 5DZ9A 3WQ4A 1F6AA 1T8QA 4NIYE 2ED6A 1U3JA 4I18B 5DURB 3U4EA 3ARZA 4WHYG 5DZOA 3AOFA 1NIDA 3KLSA 1BVOA 1W1VA 1S5IH 3NZSA 4BQ6A 3CC1A 4UCGA 2P8MA 4PEEA 1XFPA 3HRPA 1P69B 2D7TH 1REIA 3L7EA 3K72A 3TYCA 1P5VA 1MFEL 1NAMB 2EICA 5ABZA 3T0TA 5DANA 2B2XH 4M8QA 3SOBL 1YY8B 4YFLI 2FSEB 2UZ9A 1EJRC 3EO0A 2WZAA 1U36A 4I5BB 3RB7A 4AKPA 1H5VA 2WPGA 3EYUH 2VDRH 3RWHA 5K39A 2Z8WC 5DEFA 4JOMA 2HMCA 5DK2B 3MUHL 4GISA 2BP1A 1MIML 1O68A 3U2CA 5D2LE 1EWHA 2OR8A 3EWWA 3LNEA 3KGSA 1AZZC 4Z7VA 4TXVB 1FNEB 3U46A 3H56A 3KYMB 1E9QB 4F80A 3SPHA 2F54E 2A6DA 3ARSA 1EZLA 5K33A 4NP4H 3FT1A 3ZLHA 5HYSG 1BRLA 1YECL 2DQEL 1P84J 3RTQB 2WQAA 2I9UA 3PGDA 3N40F 3QFDB 4L4JA 3WFDH 3KXFA 4LSRL 3VNZA 1JPTL 4E4FA 5I74B 4FFYA 3AYTA 4UTBH 3TCTA 3W4RA 2HLFC 4FI7A 5CPTA 3CUJA 4OCWH 1MVUB 1VP5A 1P6BA 3O41A 2PA6A 2NNAA 3DBSA 4CNSA 1M1SA 2NPLX 2OFQA 2EG8A 4QTIH 4QSFA 4JO5A 5AAMC 3HB3D 4IIBA 4JO4H 3H7BA 5HMDA 1DN0B 3GQYA 3LQLA 3VFLA 3NQVA 1MCHA 1R5WA 2VLRA 4G9FA 4IHCA 2RJMA 4WX2A 2HVMA 3EBAA 1RK0B 3LRHA 5LBGA 4Q4OA 3ZKNC 4PRHB 4L8SA 4C6PA 1H9VA 4NQEB 2F19H 1PZCA 1KNOA 1KCLA 2G2PA 1DE4B 3V4UL 4LSUH 2EVJA 4CQ8A 1MI5B 1J1OL 4N87A 4XNAA 3CDYA 4BZ2L 3KGRA 2J7LA 2FJUB 1EDHA 4EI6B 4JO8A 3TPUB 3JV0A 5T1LA 3WKMH 4P4RA 4MBRA 2WMPB 3DTXB 3BUYA 3DG6A 1AG6A 3G5WA 1XCQA 4JHBA 1E5CA 3QQ0A 2XTJB 2QQLH 2J2ZB 1GJIA 1WXYA 1VGKB 3GRWA 1KEMH 3TBVB 3BGGA 3P4NA 4M9PA 1B0RA 1YEWA 5JMUA 4XISA 2DH3A 4JW3A 1XQLA 3HPLA 4HFUL 1TVDA 4LSVL 2LQRA 3O3AA 1S5WA 2BSTB 1UCBL 2J8FA 4ELME 2O7QA 2KL6A 1UADC 6PTDA 3VIJA 4JQ4A 2WQSA 3KXFD 2V5YA 1GZQA 4OCXL 5TD4A 1TMQA 1CDYA 1UH4A 3DC8A 1Z32X 1JCMP 5EU7E 3T78A 4XD5A 1EEYB 3M64A 1CG9B 1P1MA 3ZDZF 1X44A 3JWNC 2CZFA 4MY9A 3N14A 4MAVA 1R24A 4RMUA 2MOVA 2DTML 5KEZA 1I3GH 5C7VA 1WZAA 1Y7VA 4K0OA 3WLOA 1VFAB 2E8YA 3V5DB 1FZMA 4X22A 4OOZA 3RZCC 4G9FD 2VLRD 3KVQA 3I3EA 1BGGA 1WIPA 2XICA 2V9QA 2TSYA 1YYML 3MRLA 4YDMA 4ALAC 4DK6A 3NFSH 4XP5H 3KYOB 3QJUB 2O61B 4W9CC 4W9KC 3TQPA 1R3QA 5K59F 2O56A 3LV3A 5T1LD 3BLIA 4HUUB 1TZGL 3L1FA 5SV4A 2KDYA 5CSYA 4AISA 4P5UA 3IGHX 5AOKA 2FZBA 5DHVA 3ZXWA 3HIJA 2FLMA 2X1RA 5J12C 4W9IC 4AEHH 2DI8A 1JP5A 4OU3A 2PCPB 3DV4B 1DQQB 4CVUA 3WQGA 3WIAA 1CLKA 1MFAH 2IBGA 5BU9A 3CFUA 5GJMA 1ML0A 4FS9A 4HGMA 4L6OA 3F5JA 4Q6KA 3WF2A 1KMGA 5IK3A 5I1AB 3N9GH 1GPWA 2PWGA 4A2FA 5B80A 2MCAA 1G1YA 2FD6L 2G9HB 3GM8A 1Z9LA 3MRIA 4XCCL 1PO9A 5SWSE 5BW6A 3ULVL 5INDA 5L0QC 5L8KB 1VGEL 4E4PA 1ZU8A 3EFDL 3MLSH 4LUJA 2YW4A 1I8LA 1G0DA 3OQRA 5D37A 1E30A 1TKWB 3S6DA 2D4FA 4A66A 4QGTA 5F1UA 3BPOC 4J3OF 1LTDA 5F1SA 1JXGA 5AYIA 3CMGA 1XGRA 3DBPA 1HJXA 3GKFA 5EGRA 5T1KD 1HF6A 1EZVY 1ZS8A 4WGWB 3CWNA 1YAIA 4Y9GA 3RM9A 1SLVA 2BJMH 4PJHA 4HUCA 3LYEA 2QL1A 4G6JL 2WLYA 2XC8A 4DIAA 3WIHL 4GZ7A 2ZUVA 1TG7A 1KTKE 2VEFA 5C09E 4H9YA 2Q8AH 3Q45A 3DGGA 4P9HC 2FGLA 3WJSA 3TT1H 3QCTL 3FQUB 4NEHB 3CWHA 4W84A 2FWSA 1J8VA 5AOMA 3T7VA 1EO5A 4AAJA 4X6BA 4EIVA 2J1KA 3C12A 4ZMAT 1TTAA 1AIFA 3SBQA 4DUWA 2GJNA 4PV8B 3S36L 5D1ZB 4NENA 4GIEA 3EDDA 4HS8H 1G7IA 2HFEA 2NWSA 3KCJA 4PUJA 4UQ3B 2CLHA 4UOW1 2BSEA 3DRTA 5TFSH 4XO3A 4PGJA 3TBBA 3MMWA 5EUOE 3OX8B 4UILL 3IWUA 3HUJF 4PJCF 4Y9MA 4M48H 5HQEA 3L3GB 5IBTH 3DGDA 3ZHNA 3WLBB 4ZUSB 2R39A 3WSUA 1V93A 5KZDA 3OAYH 4W9ZA 1HKKA 4WV1B 4PJAF 5DVOA 3GHBH 1BD2A 3AS3A 1E9ZB 5GJNA 1DBKL 2EE6A 4DZBB 3CUXA 3DX6A 1NDGB 4PWJA 4PWGA 3QJHA 5I1CH 4PGBA 4HJWA 5FYJD 2R4SH 5I23A 3CFBB 1NQ6A 3AQYA 2GHWB 5CPOA 3FGCB 3U7YH 1CT5A 2AXFB 4PRPA 3LM7A 1BAWA 4BCXA 1YC7A 3DPBA 4ZAKA 4PJGE 3V7AG 3CHQA 5IVZB 3JUYA 3UZYA 7PAZA 1KXTB 3OKEB 1SY6H 3FTSA 4UTFA 3UG3A 2FDSA 5FO7A 2XWDA 1RZ8A 4BELD 4AZ6A 5ICYA 3CEUA 3WBAA 4ERAA 3AISA 4PRDA 4ZZKA 4HUNB 2PDJA 5BXRA 3TM6A 3CC5B 4OLVL 3G5VA 1XI3A 1KDJA 4MMZA 1PCKA 5TQ0L 2YQGA 1MHHA 4PMNA 2YEVB 3UXIA 3BTNA 3GBDA 2MHAA 2NY5C 1U3HA 2ADFL 4Y4HC 2EUZA 2BSED 1CENA 5GPRA 2BS9A 1OGGA 3WQEA 3PHOA 1OINA 1XIFA 1UZGA 3GXNA 3S88H 3C8NA 3SJVD 4OGYH 1U42A 3R4IA 4ZFCA 3Q06A 3TFCA 4Y9NA 2ZWYA 4JIPA 5ESQA 5JXAL 5JOPD 2YDSA 4BCEA 3DUUB 1H60A 4ZS7L 4OUIA 3B1UA 1PS3A 1KFGA 1HXKA 4NHUB 4G7FA 3USBA 3F4WA 4QRRA 1BD2D 4CAGA 2WC7A 1Q1JL 4B9CA 4XNBA 4Y5VB 2X4RA 5LBSH 1MNZA 1A5BA 1UWAA 3FF7A 1F45A 3NTYA 2ZE0A 4FA6A 3EJPA 3GH5A 3TWCL 1HHJA 3PUCA 4QRPA 5HJYA 4PRPD 2P5WE 1UXWB 4ZAKD 5IF0A 3LCYA 4TNWF 4IRSC 1F00I 2L7JA 3IS4A 5FHBL 4LCQA 3LQAL 1HVQA 2VLKE 3FUDA 4R7XA 3DIFA 4CCDA 1TYEB 1TTRA 4RLDA 4UOZA 3EXRA 4DPAX 4QRAA 4AV4A 5DHXB 4LRIA 1OKEA 1Z9AA 4YFLF 3HO8A 5KTEL 4L3EA 1NCJA 2A4CA 1Q3NA 3OMAB 3W74A 1U3HD 1QOXA 1A3WA 4IMLB 4HT1L 2MKLC 3KLAB 1I1WA 1JRHH 3T4CA 4Q7BA 1FE8L 1DUZB 1ZXKA 2L7UA 3NJFA 4IZGA 1FL5B 3Q05A 4G8GE 1QSFE 4FF7A 3T5WA 1RFDH 3A24A 1BWKA 5KVEH 1R19A 3QJSB 3KR3H 3FTUA 2E8ZA 4Q6IA 5IB5B 4CN1A 4OZ4B 2BSDA 3KZ8A 1IBYA 5KBDA 3FTGB 1KCKA 4QRRD 3C9NB 1VSCA 3LHTA 3RN6A 3RGTA 5C6TL 2EKSA 1X7QA 3F7KA 5I6KA 1ZZMA 2K7PA 3UADA 2W60A 1CYWA 1BLNB 1BHGA 4PJ7A 4TNGA 4QXGL 3U0TA 1D5ZB 1LL4A 3VUAA 1FVEA 2DAVA 4MDJA 3DSFH 1UROA 3AREA 3MV01 3RYMA 2ANUA 5EMMA 1W17A 4GRWE 4AXNA 4JO1L 3W1UA 4XN1A 4DWSA 2HT2D 4QRPD 3H0TB 2FTAA 3TEWA 3WQFA 5LKNA 2AJSH 6TIMA 3T0EC 1AQ8A 4TUJB 3RUGB 5CSGA 1QOKA 5GGRA 4E41E 2BP8A 5HHOB 1R3JB 3K5SA 4XP6H 2WZ6A 4Z95H 1MHCA 1QFWH 4E42B 2H0JA 3IYLW 4Q7NA 1SBSL 5IFAL 4PUUA 2CIKB 3FO1B 5EORH 5IQ9A 4I1PA 2GGGA 3EYFB 2X4SA 1YNKL 4YSAA 4L3ED 5CEZD 2ZKWA 3AWFA 4DJEC 1I6NA 4PJ8B 4F2ME 4PFMA 4YR6A 3WIFA 3O3EA 3W3BA 1DSYA 4PRRA 3MYJB 2DLEA 5D7JA 3PJUA 1P7QB 3U2OA 3WEOA 4H44C 5BWFA 5EZIH 1SRDA 1BXUA 1X3DA 3T2PA 3SRDA 5EIVA 3HZYA 2VE6B 3B7RL 2X2UA 3GUGA 1ANUA 1M6OA 1RPKA 4QFUA 3Q6FB 3K2MC 3ZLFA 4DJMA 3ZN6A 2ENYA 2ZUQC 1BMGA 4CNOA 2WMJA 4CVXA 3W5MA 3WL0A 4A22A 5CP7B 1SHMA 1HIMH 5E2UH 3C5XA 1ICQA 2AJZA 1AMXA 1ND0A 3ZE1B 4NM4H 3ARED 2DW6A 4H88L 1P7TA 3ARUA 2EVHA 4K7VA 1KO0A 1UUOA 4DWSD 3FYYA 8FABB 4RMTA 1NDWA 2JV6A 4NCC1 5TIMA 1IC0A 4OFKA 4C60A 4MS8D 4NZ4A 4HU3A 1WRFA 5I6LA 3UIYA 3PHQA 4IGBC 1F11A 2VCOA 1MWAB 4BCZA 1FSKB 1NP0A 2IQ0A 2Q76A 3GNDA 1XF5B 5E8PB 2XWXA 3SIMA 5DJ2A 4JEJA 3H1ZA 3MFFA 3RCNA 3WLTA 3G1XA 4J1UB 2LR4A 4WTZA 1E4WH 2VKWA 3S4TA 2NVAA 2R23A 5K9OB 1J9RA 3BW2A 1J8HE 3NIGB 4UTWA 3MXWH 2C3ZA 4W70A 2Z93B 5DVKA 2KZHA 1GC1H 4ZW6A 1B2WL 4J2XA 4EZMA 5HDQH 1CB7B 3E1F1 5D7JD 3BGAA 4IIHA 1AHWB 3O11A 1DVTA 4NZRH 4ZYKB 5G5IA 4RWHA 1NCBH 1HCZA 3J7HA 1RI8A 3KVMA 3GSQA 5AC6A 1FFOB 4ZW3A 3F4NA 3O6MH 4YTSA 3B0VC 3PWIA 3BW9A 2CIPA 5D4IA 5H8PA 1IFHL 4ICCX 3NCXA 1KLFA 4Y8DC 2Y1HA 3IKCB 3PTQA 5GVJA 4MTMA 4R34A 3VSUA 3NCOA 4MHBA 1TB3A 4BA8A 4DF2A 4B5XA 1DHKA 3D6GA 2VR3A 1CGYA 1UGNA 5FF0A 1FVDA 4TV3A 4NUGH 1RZKC 4CADB 5MENE 4M7KH 3DHUA 4U1IA 4O50A 5FEWA 2QCCA 1CB2A 5EA0H 1CFTA 4DN1A 1A3XA 3GMMB 3MOQA 1HX0A 1O6IA 1TV8A 1BMWA 4Z78B 4FFTA 4S2SB 5A7EA 5HY9A 3V4VB 3NQGA 4C56A 4JS7A 5C9JB 1L2QA 4CNUA 3ECBA 1P4LB 4CGTA 3TTQA 2QSCH 1GSKA 2ENJA 4NWUL 1LBFA 1UT2A 2OJ1A 2ARJA 1XGUB 2GSIB 4KH2A 3WH7A 1IBGL 2HJFB 1IBZA 1B90A 1IGML 1YO4A 4X7DC 3P9MB 5D7LA 4APXB 4HIIB 2C3WA 4ADTA 4QRQA 2M1KA 2EXSA 2YBUA 1IE7C 1XHHA 1ZTXL 3MV8B 3HB3C 5ESVB 1U4FA 3H8NA 1HP4A 5AOLA 4XRCB 3TEYA 3UTQB 3L08A 3D05A 2HG5B 3OYXA 3TT3L 1UXLA 2BX5A 3BHBA 3QY6A 4HLJA 3F2BA 2P76A 1BBJB 4Z7UE 5I6OA 1K85A 4H8HA 1FH8A 3E2HB 2J1XA 1MSPA 3QLDA 3CDZB 4HCIA 3KFTA 4HHMA 4LV4A 2QAPA 4DPPA 1TWZA 5DQDH 4N22A 5C07B 2NY7H 5A7BA 1LO5B 2G3MA 4GO6B 5FKYA 2VDHA 4AQLA 3MNVA 4CA4A 1NFDA 1S38A 1XGQB 4DRSA 5JR1H 4I9MA 4D9LL 1RUML 2R1PA 2CJTA 3CK5A 1J48A 4BF9A 3DX8A 3QUYD 2ICWA 3KEDA 4DHGA 3QQDA 3FUNA 4DQAA 2FEDD 3QO0A 2ISDA 3GZAA 3KDMB 2CLRB 4C56D 2WKJA 1KFAH 3II3A 3ZTNH 2JK2A 4Q6JA 4Y2NA 5J5DA 7REQA 1G7HB 4TSAL 5FL1A 2E9JA 1OL0A 3CK0H 1EB3A 2X10A 3GNRA 3C8KB 2XI9A 1SVBA 4MA1B 1MF2H 3UWQA 1OV8A 3M0YA 3PWUA 4KQ4L 2V5MA 4FEMA 4HTBA 2JTYA 2DQJH 1HKMA 1CIDA 2OP4H 3BGFC 3HFYA 4WI6A 2VFGA 3M7SA 1XRFA 4HX1B 3VD3A 3LZFH 1QRNB 2J8UF 4FQXB 2H5UA 4LCCB 4K7PY 1GJUA 4L8SC 1HL5A 2C71A 1EZVX 3DK2A 1X4XA 4BUHA 3OW1A 4LEOB 3E6HB 3P1VA 3U9UA 4ZMNA 1OCNA 1GPOH 4AZHA 3FSUA 4PTUB 2YXXA 3HW7A 5C97A 1R8LA 3SDOA 3DOHA 4OIAA 3GS4A 1JVLA 1SSDA 2VERA 5KAQG 5B3SB 2QR6A 3WFZA 4IJ3B 3IDGA 2H1PH 1M7DB 4XNMA 2WOYA 4I9TA 1U93A 3DJ9A 5F3FA 2YLAA 4KRPB 3N6HA 1EJ7L 5L2JA 2OYLA 4NGHL 4IIGA 3PPGA 1IMHC 3VXQB 1TE6A 3AQDA 4FTVE 3WEXB 2K9FB 5JU6A 2UY6A 4B27A 4UQ2B 3QNFA 3KPRE 3P82A 3MGOB 4WENB 4C6BA 3P4LA 3RWCB 4YSSA 5AAPA 3GRGA 3ARFB 1GMIA 2VFHA 5AFDA 3TCLA 4QO1A 3HI6L 1OGTA 2IPTH 4ISVB 1R86A 1L6PA 4TS6A 1AH0A 5DEJA 1IWBA 2J9ZA 4JNZA 4JTUA 5IB3A 2WZPA 3U36B 4YWSA 2BVEA 2GT9A 3ULUE 3VYNA 1N67A 4PB0H 5I76A 1BF6A 2PCFB 2NV1A 1GHFL 4X63A 3SW6A 3GZQA 3PL6A 2W8CA 1HVXA 4E2OA 3O6DA 4AGMA 2HKHH 4YEEA 2AQ3A 1YJDL 1G7LB 4GFTB 1EQWA 4K3JH 4KETA 4EJ1C 3PNRB 1I75A 3K1GA 4PB9H 2HVNA 3W39A 2VUYA 4F2TA 4UMAA 3KPSE 2HS6A 4AJ0A 1GTEA 2R9HC 5IBUB 2YD6A 4G9DB 2ZNXA 5LWYH 2GI0A 2MOQA 4LEBA 1NSNH 1BG4A 4JPWH 4K8RD 2W0FB 3IVKB 4FQQA 4U1GC 1QOQA 4OZHF 4IK7A 5PTDA 2QVFB 5AQ0A 4MVAA 3ALPA 4LCYB 5G55A 2A7PA 1UOWA 1KGCD 3FJ4A 3GI9H 4OCRH 4GEIA 4X9IA 3RMJA 3CZUB 3P30H 3G08B 2V5JA 1ZANL 5CJMA 3CN0A 1SBBA 1TPWA 2JF7A 3QQNA 2VX4A 3QW3A 1I9RH 4UYPA 2ZPKL 4OLXH 2FB4H 3L3OB 1I8LC 2OL3H 2JNZA 4U1SB 4XT1C 1EXGA 3S5NA 4US5A 4KK5D 1J93A 1ZVYA 3CFDA 1TZHA 1MCPH 2OODA 1HUVA 3PL6D 3CSTA 1EDTA 1H7WA 3AUJA 3NFPB 2VSMB 4MKTA 5HGDA 3QG7H 5D1QD 2QDGA 2H3NB 3T3MF 5E00A 1C8XA 4UNTA 2DMCA 3W2KA 1WBZA 3QFJE 2PLKA 3K8KA 4A7TA 1H3GA 4L1DA 2OPCA 3STZA 1FNLA 3RDTA 2CDFA 1EKOA 5IRPA 1VACB 3CX5J 1IGCL 4NJHA 5EEVA 2OPJA 1RZIA 4LSSH 2XPGB 2W1NA 2OKMA 2V5KA 2Z3FA 3Q6GH 3RY4A 1MCOH 1VAHA 3IWPA 3FU5A 2HISA 4FERA 3NL5A 2C34A 3SCMB 1FO0B 3N19B 5T33L 5BOOA 2BRQA 4FNQA 2P10A 3P74A 1XSJA 5FKPA 1OF6A 2OT0A 4TVPE 3FVDA 2HZHA 5GGVY 4XX6A 1LXMA 2AEQH 5EO1A 3ZS4A 4PIBA 5J1AB 3VG0H 2PPDA 4KXBA 4US5D 4L80A 4AENA 5JUEL 3S4SB 4I2XB 5C6WH 3BP4B 3AU1B 5DHDA 1T0NA 2H9GA 2ZX9A 1A22B 3BDKA 1CL7L 3QXBA 3WLMA 3OKMA 2PDCA 1YQVL 4HSQA 1B3OA 2E74C 5I6XC 5ICZB 5FX3A 2DIKA 3MCNA 3WOVA 2H1LM 2HKFL 3M1OA 3RDTD 4XNQA 1GG0A 4ZAKC 1KIPA 2OEMA 3VFVB 1ZBCA 3FU6A 2HN7B 4C83A 4FFZA 4KXDA 7FABL 1NLDL 2G4EA 1V0LA 1U8JB 2BHUA 4H7VA 4PW4A 3U9WA 3VI4B 4NT0A 3E5BA 4HIBA 4A1RA 3FDWA 2HNHA 4MMZC 4OQ1A 1GYAA 4PJ5A 2Y4SA 1W3HA 4PBXA 3WDPP 1PGRB 1U3HC 4HTYA 1FCGA 1SDAB 3S8FB 1DJSA 3FS9A 5B38G 2F5AH 3ORJA 4FXKB 3S9ZA 5C0CB 2OTPA 2WLIA 3F7LA 1BECA 3T6ZA 3C6SA 4JHZA 3MPCA 1XYBA 2LW3A 1J1XL 3R19A 2PN5A 4Z17A 4LVHB 3IJHA 3WJXA 1MJJB 2F2HA 5I7GA 1R9ZA 3C5ZA 2BHFA 4IJTA 3MKCA 3W24A 1V10A 4OGQC 5DGRA 3D30A 2X0HA 1WK0A 2BNUA 2DOCA 2WLLB 4I0PA 1T1XB 2MSPA 4LKXB 4IG2B 1W5PA 3HBZA 1ORSA 1JPST 1U3YA 4R2GB 4QSHA 1KN2L 2J7BA 1NDMA 4C4KO 1B4KA 1L0PA 3NESA 3INOA 4PLNC 1OK8A 2I07B 5DHMC 4K23L 4Y4KD 2XYLA 1NGQL 2X6CA 1JWMB 4G6FB 3GIVB 1DLHA 5D4JA 1FRBA 1KTRL 1OC7A 3HGSA 5J8LA 1V3JA 1PIIA 3NQMA 5I79A 2CCRA 1Z5LA 4XPGL 1D7KA 4Z8FL 4YC2B 3LDBC 2Y22A 3MRRB 1F58L 4E4UA 4YFDB 3GSVA 5DVLA 5GRWA 3S83A 1ZWIB 4LRIC 5D9MA 3MJMA 1UQYA 3EXTA 3CV6A 5A94A 4HGWB 4TUOB 5T5NG 2C9SA 2IQ9H 5EF0A 4P46B 3KPOB 1XDTT 3JTTA 4WTQA 4U4MA 3VKJA 4R7DB 2PWHA 1FZOB 5U7SA 1KXVC 3GSMA 5C0QA 4NG3A 2KZBA 2XQ0A 3SO5A 4O19A 1XRTA 1ASQA 3MMEB 1ACXA 1X38A 3WXVH 3UYRL 4Q6IC 4JTJA 3IFLL 4AVNA 5IQOA 2APXA 3C5ZD 4JRYA 2DSWA 2AGJL 4KKBD 1XBYA 5AVTB 3ZR4A 3CXDL 2PDPA 3VFNA 3FJLA 3S37X 4NN7C 5FFLA 3WJJC 4WY0B 4FXSA 4NUJB 4OD3H 1WYIA 4EUPG 1Q7MA 2GQAA 4I0PD 3PWLA 5DMKB 3AREC 1HE7A 2JKXA 3MN8A 2YC1B 5E8EB 3H53A 2IV9A 4YVPA 5HGGS 1W72A 2GYIA 4R8WH 5F70A 3SE8H 1W6WA 3WFEH 4TNVK 3GIYA 3ELQA 1Q8AA 2FJFB 3ZM8A 1JE6A 1Q9WA 1CD8A 3GXTA 3OBAA 3MA7A 1G9MH 5XINA 3W29A 4OSUH 4R27A 1QOPA 4GNKB 2OTWA 5DLMH 5SWUA 1E55A 2ATKA 3F85A 2C3VA 4E0RB 1RJLA 5AUMA 2FBJL 3NP3A 1FDYA 4YDIL 1CDGA 5CZTA 1RZ7H 3RM8A 3GVVA 4G42B 4BSVA 4JFUA 1CI1A 3CCHA 3MUXA 5D7JC 4AEIL 5JIMA 1YDVA 3QTPA 4TV5A 2O4EA 1SXZA 1ZDSA 3ISIX 2NZ9D 4A04A 2D0FA 4J12A 3VFGH 4JUSA 3SKJL 5KBMA 1ME8A 1KB5A 4GJTB 1S2WA 5IGXL 5L9DL 4N5UA 4PTDA 4ZTOL 4P8VA 5A8GA 5LCVH 4JRYD 3W7MA 4X80H 5GS0L 1PNDA 5CKAA 4Q7IA 1G4EA 1ET7A 3JS3A 4FNUA 3NZHH 3NABL 1V55B 1GQIA 2OMZB 2XZZA 2DZBA 4BZ1L 2EJ1A 5C9KA 3Q94A 4JTQA 4KERA 4MS6A 5BO1L 1JK8A 4PJIF 2D8KA 4L5ZA 3UZ5A 1NIUA 3O9WA 3QDJA 1ISYA 1T5XA 4OBSA 2D2GA 2VSKB 2ZOUA 1FO0H 3IB4A 2CHWA 3L12A 4HOWA 3SUUA 2AJ3B 2Q7AA 3PFMA 3WCZA 1Y0LB 4DZAA 3TFXA 5I3JA 3LNGA 5T5FL 1THAA 1IEAA 2JKEA 5HR7A 4QWWD 2VR7A 3URQA 1W1IE 1AMYA 3PTKA 1G7VA 3N2CA 3ABZA 3U5YA 3ZZLA 2COQA 1JGEB 5AB2A 5BRZD 1PCXA 4NRXA 4UTWC 3CZ8A 3AU2A 4Y5XB 4MPKA 5ICXB 2HP4A 3T2OA 1ECZA 3HHSB 2RBLA 4BQ8A 1A5FL 3RL2A 3CFTA 3TYGL 3VDAA 1CD0A 4RX4A 4EKJA 1H1ZA 1JQXA 1A7NL 3FA5A 2O6CA 1YXCA 5IDIA 1IIKA 1FV1B 2PRMA 5E8OB 1H3WM 1UWEL 1H3PL 4K7PX 5TK4A 2X9ZA 4RL3A 2EPKX 3RHWF 3DKLA 3BURA 2V5RA 4PJXB 1CE1H 2VABB 3DI3B 5ANMB 2N0MA 1GGYA 1LORA 4NZ3A 3ZDZE 1PX8A 1T89A 4ATDA 1CR9H 1JZIA 1RHHB 2UY7B 2YCLA 3NPXA 4XCFL 3A4AA 2OX1A 2QJJA 5JW5A 2W79A 4HYTB 5A6AA 1MIEH 2DJUA 5EIIB 1NY1A 2KERA 1ISXA 5E6SB 2OMWA 1DEDA 5C6MA 4PGZA 1RHFA 3O2DL 2K6WA 3O9WD 3QDJD 1YYCA 4K5MA 1T2JA 4EVNB 5EN2A 1T3FB 1IQ8A 2V7NB 2HRPL 4LSDA 2NXHA 4PJEB 2GGJA 1XDLA 4FQ2H 2XSKA 4PR4A 2B4GA 5K59E 3DFHA 1S5HA 2OLDA 1G7MA 2KQNA 4XODA 2VAJA 3QR2A 4K8HA 4XMKL 1U4EA 4E5XA 4TQTA 1I7UA 1J8SA 2CIIA 1OWWA 3SGKA 1HSBA 1HO1A 3BMWA 4B5UA 2C7UA 2MCPH 3TV8A 1CBGA 1A5CA 3BW3A 1GOGA 3QIBB 3M07A 1L9QA 4D6EA 1ESWA 1NGZA 4RX4D 2H90A 4ADUA 3HAEB 2HTLD 3QUML 4BFJA 1RU9L 4FX7A 3IK4A 3VXUB 3L5LA 3WD0A 1FIGL 3EOBB 5C92A 3NQ8A 1V3KA 1AW1A 5F72S 1JN6B 3NRPA 5AB1A 2ZQ0A 4OZOA 4HV8B 2VXVL 1XAUA 2WV3A 1G69A 2ZJSH 3B0PA 1D8CA 2A3HA 1J9TA 5INCB 5BV7C 4GKSB 4S2CA 3L4XA 4ODXB 4XCNA 1EUTA 3WLLA 2G75B 2CBPA 1FZKA 2B4CH 1YDPA 4H83A 4PG9B 3QNXB 2I9EA 2Z7UA 4D6JA 4L8DB 4XBMA 1CBVL 3CVHL 5EPMB 1A47A 4AMKH 3HE7B 5C0AB 35C8L 3LNIA 1H50A 4PS3A 3TYZA 1I9EA 4QHNB 4OB5H 4PGDA 1OFPA 4V1XA 1HGWA 3APDA 5IJKA 3FUJA 3WLSA 4XMWA 1FIEA 4XBJA 3KP0A 3ALGA 1M71B 3O3DA 3RA7L 4YHKH 4FSAA 3PC0A 1KBIA 2EYSB 5C71A 2VFFA 1BTCA 2QKIB 3IJIA 2QR0A 5CSRA 1IL1B 1A6AB 3O2VL 2PKDA 1NOLA 3TL5A 2Z25A 5FJRA 3HS8A 2NLJA 4KAQH 4I3SH 1GH7A 2F74A 2GEEA 4XP4H 1T0PB 3VFRA 2VAAB 4MDRA 3IRDA 3FQTB 3LEXB 3W85A 3EUUA 2XPYA 2CZNA 3KW8A 3ZZ1A 3C2OA 1OLZA 3L17A 2CLVB 5J6GB 2BHYA 1G7JA 1ISZA 1T4KA 2ZF9A 4HCRL 2NRDA 1P0EA 4OLUH 5FM5O 4HJSA 2E6DA 3VRJB 2CUHA 2XT1B 4LH8A 4GW4B 3KWUA 2BRRH 4EQ3A 4Z7WF 2W5PA 1XKYA 1XIWA 4FX5A 3HUJE 4JM0A 2XXFA 4PJCE 1KC7A 1HEZB 1I2QA 1QWNA 4DP0X 3ECUA 2GZXA 4FF5A 2P43B 2RCSH 3WLKX 4MNHA 1R30A 3WHE0 1P0NA 1JNNH 5I1GH 2FEEL 5EMYA 3S97C 4OJFH 3QGVA 5D2NB 4ELKA 4IPLA 1I2RA 1ZLSH 3W2UA 4PJAE 3SE4A 5AW6B 2ZOXA 1KTJA 4R0LA 2CLMA 5BOJA 2JI2A 4LT7A 4K8RC 1D2KA 3VXRE 1E9LA 1W1YA 2GY7B 3PZNA 3CMJA 3B8WA 3H7UA 1OCWH 1MOEA 1G0CA 5E5CA 3WIIL 5DN1A 5I8CA 3VZZA 1OX5A 2FX9L 4UF7C 2XLLA 5F4WA 4MDPA 1KYUA 1SN0A 2E9MA 4KCUA 2I5QA 4TR9A 3HCVB 1LNUB 1YDOA 1KXQA 4KOCA 4FQCH 2X4QB 1IJ9A 2J9XA 1XM3A 4RZ5A 5IHZB 1CX9A 3CEPA 4LLUB 3IWVA 2OLSA 5HNTA 3IRPX 3UCDA 3STBA 4EI0A 4P2RA 4DKFH 4KK5C 2CALA 5IFJB 3BWAA 1A1OA 2ZUXA 5T1KA 4G1NA 3L13A 4P5MA 1IGYA 1IM3B 1U95B 3QQ4B 3PL6C 4JYFA 1E9OB 3NO3A 1EXUB 3AABA 2JCCB 3D33A 4GQ9L 2OWCA 5HHPB 4XWUA 2QHAA 1T5AA 3QG6B 7A3HA 1E5AA 3D3AA 1LYXA 3OWEA 1XIWD 1A7RH 5DVNA 1JNLH 5AW9B 1OCQA 2H26B 4UV4H 1DV7A 1Z7JA 1O7SA 3KGTA 1JI2A 2MNWA 1XLKA 2DIEA 3IMTA 2WWNA 2FIKA 5IW3A 2CHXA 4X9FA 3GHTA 1OD0A 1WB0A 3ZMRA 4ZMZA 3C5QA 4HC1A 4NASA 4IL2A 2CO3A 1EJSC 4KZDL 4BHUI 4NZUH 2PDXA 4HHAB 3C2FA 1E0VA 2R15A 4ZNCD 1UR3M 1J5CA 3AYRA 1ODZA 5IUSA 5D04C 3IPEA 3WU1A 5EZJB 4CILA 3KPLB 4ATTA 4DKEH 3IIZA 3SUWA 2C1GA 4N28A 5CPQA 4OGZA 1EBHA 3DESA 2NUTB 3CHOA 4DETA 1SVCP 1WJ3A 1K2DB 3TBWB 1Z2KA 3O6CA 1NPUA 1WDRA 3OSVA 1E1EA 1GPFA 3L45A 5HHMB 3OZOA 2X1UA 1PFCA 1CMOA 3S96B 3KRSA 2DYRB 4P2RD 4GKOA 4IJCA 5D8JL 1F6YA 2EZ0D 4HZ8A 3VB8A 2GUOA 1K7XA 1RA0A 2ZBTA 2TODA 2R2EB 2J66A 3WY3A 2J72A 4R26H 3TXVA 3S6OA 4IP4A 1AMKA 5M17A 1CICB 4MWAB 1R33A 3HHRB 3CFNA 1S9KC 43C9B 3ZJ6A 3LI0A 4RA0C 3RQ3A 1GW1A 2GJ6A 5C9ZA 1NCAH 2OZTA 4HIXL 4UT9L 2AQRA 3RDTC 3D39A 3SGZA 2XFFA 3N4FA 2FH8A 4S3AA 4MMXC 3VD2A 3LQMA 3W7PA 4JDTH 4LCIL 3OMZA 1NAMH 2G5RA 3ZK0A 4NPJA 3THMH 9XIAA 4MA8L 2QZ5A 1OAQH 3S35H 3SYCA 2APFA 3G5ZB 1N4XL 5DA4A 3E2RA 3W9EA 2IQTA 3I3DA 3QH3B 5LDSA 3PQYE 1XC6A 3BISA 4MXWL 3VA6A 3B05A 4NS0A 3SJVA 4RRPG 2OQJA 3JYCA 2YXVA 3DFOA 1MFNA 1OD7A 4INFA 2ED9A 2R1WA 5ERWA 3HMWH 3NIDF 2VMDA 4RISH 5LQBL 3FUKA 2J78A 5AHLA 1XGDA 4PN2A 5HR6A 2DWEA 4KDTA 2PPGA 1KY7A 3V0FA 3CS2A 3UVAA 5I9QC 2X6AA 2VELA 4K7YA 3CH8A 4QHMA 1QW8A 2FRGP 4Q74A 3GTVA 2LTQB 3TZVA 1T1WA 1GIGL 1DBJL 4U6VH 1T4WA 1FNGA 1JMZA 2GJ6D 5FA4B 2JQMA 1U8MB 2VITA 1BIIB 4H01A 5I18H 5IEHA 4XVSH 3D39D 1WT5A 3TH2T 3NSNA 5ITBL 2EPMX 2OMTB 2HYMA 3B97A 5E8DH 1PDZA 4KESA 3H8AA 1ZT1B 4FOJA 2F7PA 3HV9A 5KBPA 4GMEA 3ZR5A 2ZSWA 4C57C 1JZ6A 1L9NA 3BCFA 3IIVA 4WIWA 1KPRA 2X7WA 2XHYA 4RDZA 1ZVSB 1BREA 4KJYA 1AH1A 2VC5A 2BZDA 4IRJA 2X28A 2PW1B 5H2ZA 2E86A 4MA7H 2C91A 1J0KA 3AWGA 3ZOAA 3BKML 3OPUA 2OK0H 2QCNA 2FK9A 5CGTA 3K2UL 2V37A 4M5ZH 4YHZH 4W4QA 1OWRM 4PN6A 1OP3H 4JPIA 5AZ2L 1QYGL 1B6UA 3WYRA 1TJIH 1DBML 5I5MA 3SQRA 4CUCA 2GBUA 4ZTPL 4Z77B 1F05A 3QXVA 3L68A 4EQ2A 1GZPA 3EGDB 1H61A 1GTNA 3W02A 4HMCA 3C5ZC 4XBPA 4LCUA 2ZX5A 4KKBC 1OAJA 1DSFH 4KEMA 2J71A 3D3VA 1A3LH 2ZWKA 5F7NC 4M6QA 2DWDA 4NQVA 3TC7A 3C60A 3TZVD 4I0PC 1N0LA 3QOKA 4A39A 1W1ZA 1L6FA 5C54A 4GB9A 1TQJA 3ROLA 3TTSA 3JR2A 3DXAB 1DOSA 1UG9A 3ARYA 1G94A 1QR1A 1YMHA 3GSNB 2DQIL 4KQ3H 4LDOB 3S3PA 2O4MA 5LJYH 4UTBA 1PSCA 1CI5A 2W9LA 4ZSOE 6ENLA 5FACA 3I02A 1UWFA 2GABA 1E3FA 3IGKA 3BT2H 4PMYA 2MWCA 1VCVA 4JTLA 3GJFB 2OWXA 3NL3A 1TMHA 1QEWB 3O45B 1FWJC 4W8LA 5FJJA 4IRJD 3MCYA 4H20L 2OR2A 4KRTA 4PFHA 4G71B 4IYKA 3JWOH 3EO1A 4WJXA 4Z08A 1HKLH 5IMKA 4B9JA 3G9VA 4O54A 2CESA 1XF3B 1OF2B 1TE1A 1IT9L 4M80A 1XHGA 3P2TA 1SGJA 3MX0A 3UEZA 1US2A 5LDUA 3OPSA 1QQDB 3ZRSA 3US0A 1F2XK 2NZ9C 5DJ8B 3QC6X 3LENA 5DU7A 3N5AA 2HT4D 4R4FL 5JPMA 2C8NA 3C5JB 3K2IA 4FI6A 3PSVA 3QKEA 5PAZA 1D5BA 2GJPA 3S5YA 3KYNB 3OAUH 2Z35B 4GUPB 4W8BA 3FCGA 1EEZA 3D3VD 1NMAH 1UM5H 1Y6NR 3U1QA 3C60D 3SODB 1LLZA 1S7VA 4OIFA 4F8NA 5KBKA 1PZDA 4C6DA 1KBKA 1HKJA 3PB2A 1S5MA 3CFJA 4MNGA 4P57B 3GQFA 4X6CA 3W1NA 1DWHM 3U2SA 1NWOA 3MV7B 1MJ7L 4KDWA 3KBFA 1M2VA 1UB5A 2FYYB 4YLQT 3G6JA 4Q8MA 1WICA 1UG6A 4QWWC 1NBYA 2C3XA 3MCG1 1VIWA 1F6KA 3NGJA 1Q9KB 2EH7L 3W7KA 5IZ7A 1ETZB 3QPYA 3DX0A 1QFPA 1HHKA 8A3HA 3E3HA 4HN8A 4PBDA 3S6TA 2X4PB 4Q9CA 4AWUA 4YHYC 3DK0A 1FHNA 4Y9EA 2BNQE 2IALA 1C9WA 3DO7B 5CCHE 4ZFOL 1M68A 2ZADA 1MFDL 1H6TA 5IQLA 1XH2A 5ECVA 2NY6C 2CZEA 4M56A 2OSLB 2R8SL 3SO7A 1X5XA 2IH9A 1AD0B 4E68A 4JGMA 3E2VA 2AGKA 5E94A 3DDFA 1TPVA 1SJVA 5SWQA 4MD0A 1LP9B 4N8CL 2OZ4L 4PA8A 3T04D 3ERXA 5E99L 4CKVX 3V55A 2D0HA 3OVGA 2QCEA 4NY2A 1MLCA 1NMBH 3SO3C 1IXOA 3LD8C 4REQB 4HHHA 3GHEH 2WMIB 1R3VA 4M03A 2GTWB 1MDRA 4UU9A 1QWUA 3GO1H 5D7IA 2B1AH 3VXNA 3RKDD 3BO9A 1LDPL 1XR2A 3N18A 1FG2B 3NCJL 3CMOL 3O9WC 2VT0A 1QW9A 3KHJA 3V4PL 1DQDH 1PHQA 4DZ8B 3S5LB 3UR2A 3UJEA 2ICWJ 3NT0A 5MP6H 1LYQA 1M7IA 3N2OA 1CF8L 4O4YL 3GSUB 5I3HA 2X53A 2R1KA 4JCMA 2RGLA 3OGVA 1UM4L 1A2YA 3QRLA 3GDBA 4JN2B 1J8RA 4XIMA 3ARTA 2VXSH 4QHUB 4PJFF 4JQ2A 7TAAA 3ATYA 2X7LB 6PAZA 4U31A 5EH1A 1GGOA 1SJCA 1Q94B 3KRUA 5J8OA 3RYSA 3N44F 4FD0A 4I9WE 1A3RH 3T0XA 3VGGA 2DI9A 3ARGA 4V28A 4NCC2 2IC2A 2HTLC 1O6VA 1VFMA 2BC4A 2XV2A 5L8JB 5FJOA 1UZ8A 3OVRA 3ROOB 1QHZA 4D8ZA 1JPHA 4I5XA 4L5FH 3UAAA 2X1TA 1L9SA 3FT4B 3RBGA 5ISZB 3VD7A 4LEFA 4FFWD 4X99A 4JREC 4UMSA 4LCWB 4U1HB 4X5XB 3MNDA 2YZ5A 4PBWD 1T89C 1OFBA 1FC1A 5GSVB 3DI0A 3INUL 1A50A 3CLWA 3VXMB 2F38A 4FADA 4C6QA 2F8IA 1U41A 3UTTE 5FAAA 1P1ZB 4KIEA 2WP3T 1FYTE 3QUYA 1ZJAA 3FJNA 5DSCB 4UWQB 2D9QB 3DA0A 3MBEB 3SDYH 1HWHB 4LAJH 1AQKH 3PXJA 1R34A 5EOQH 3CPRA 4FQJL 5GHWL 1K6WA 2DLHA 2J1ZA 5I0XA 1L2UA 4G9PA 3EDEA 4EI5A 4HJGB 4MD5A 3O0RH 4XZUB 2J56A 4L8CB 1YY8A 4F9DA 3MSGA 3MRQB 4D0BA 5DYOA 4ZJ9A 3SGKC 3F7YB 4I5BA 5BS0A 2DV6A 4N1EA 3EKLA 5AD0B 1HKWA 1J9SA 4AZBA 1CXHA 1DJQA 2AQTA 4UMCA 4DN3H 4KUZH 4Q8NA 1NBVH 1A1NB 3FYIB 3ARGD 3B7TA 3CFQA 3JWDL 5HVHC 2WVVA 1KCSL 2FT6A 5B39G 2G0KA 3KYMA 3ZFHA 4OZHE 4ZMPA 5F96L 5HYJB 2DDQL 4AIOA 4POZD 3EKGA 1TSIA 2CBUA 2EE3A 7PCYA 3RE0A 2BMKA 5IWLA 3RTQA 1B3WA 4O16A 4A4AA 2OMXB 3QFDA 3GSNH 4GBXB 4URTB 2YL8A 3D9AL 4RLIA 1CD1B 1MVUA 1DFBL 1UWGL 4JPGA 4H8QA 1TFVA 3LMYA 5DURD 5AVZB 4Q6YA 1WXZA 4QT5B 1SY6A 4KWUA 2XX0A 2XWTB 3FF8A 2D24A 4K73A 4EI5D 5J1SC 5CSZA 4HIHA 4A6YL 2EDNA 2ATPA 2F9RA 3VD1A 1MZRA 3C75A 1MJ8L 4E2VA 3T42A 3VH8A 4WO4A 3T3ME 1AC0A 3HZVB 5IJKC 3ZO0A 4PRHA 5DZJA 1CDJA 2OJZL 2ZX7A 1T0MB 1L9WA 1V02A 1A5OC 2E59A 4HUMB 4HW6A 2UZYB 5LIYX 5BS0D 2EXYD 5KAQF 1T04B 4Y96A 3TCSA 4EAMA 3TPUA 2C0AA 4E9YA 3DTXA 3UBXB 3MDWA 1ORQB 3NDZA 1JIBA 1ZT4A 1GVYA 5C2UB 2DLIA 4L4TB 3K8MA 5FC9A 2J2ZA 5E03A 3VXGA 1UFGA 3K7UA 3TBVA 2WW8A 3TBSB 3GG0A 1SXSA 1UUSA 4M8RA 1ZV9A 3O6FB 3N73A 1E4XH 1MFEH 2FGWL 3RJOA 1JHTA 1TTPA 2I27N 3SRHA 3N41F 2N01B 3IGUA 2BSTA 1FHUA 3T8QA 2LT9A 3NN8A 4OWGA 1JJKA 3RTQD 2NUYA 1K4DA 5LBSA 2ZZ3A 3H9SE 1HJBC 2Y7QA 4JANB 2VCBA 1ASOA 4EBQL 3E3QC 2PGRA 3HE6B 2LHAA 4JTRA 5G2WA 3B43A 3R79A 1ZPLA 1EEYA 2DLFL 4HZ7A 1BQLH 4G7EB 1XIWC 3WNPA 3ZE0B 3AHVA 4RPPA 1A6ZB 1V77A 1OFDA 4ZXLA 2JELL 2ZOKA 5CMAB 1EDQA 3REWA 1AR1D 5ENLA 1AGCB 3V5DA 4WHTB 3SE4C 4I6VA 2BOCB 1MZZA 5H8MA 3UZQB 4R0LC 1YECH 5BUGA 4DERA 3EOTH 1JPTH 5E08H 4IS6A 4LAOA 4ENLA 4WO4D 2NQLA 5FOOA 1G9EA 1RH8A 4PRHD 1I7RB 3L8QA 3CPGA 1IXQA 4NQED 5GZNA 3QZWB 1CTMA 4IX2A 5GISH 3BH9B 1X5FA 3CE1A 4S3FA 3UWZA 4HUUA 1JERA 3T2NH 5DTFB 2ZAHA 4KTEH 4H7ZA 2VR9A 2WKOF 4GLRI 4Q8VA 1YG9A 2GITA 5CIPB 3TCEA 4PMEA 1RLBA 2FX7L 3A5VA 4BY3A 3UTSA 2FZDA 1OARL 4YSEA 4M5PA 3MACH 2NLYA 1MWAH 4ZRGA 2PCPA 2IAMB 1W9PA 3C08H 1WUNT 4PMXA 2DEXX 1JEZA 4N5ED 4OFPA 2EZ0C 2X7VA 5T9CE 4RNIA 4HFWB 3LA4A 3UH8A 1ZCOA 1EZ2A 1IQDB 2PFHA 4PVBA 4RGMB 1F76A 3V4UH 5D1QA 3RLGA 2VWEC 1J1OH 3TV3L 4Y19B 2E7MA 2X1XR 1RCXB 4CCEA 3MO1A 1N68A 5IIEB 3KS6A 5I1AA 4Y88A 3FO2A 2QDVA 2AXGA 4TVCA 3MRFB 3VJ6A 4ZXBB 2Z92B 1YYLH 3NACL 3LCLA 3QN3A 2G9HA 5HDLA 3PNWA 2BODX 3PY2A 1KSRA 1WQ5A 3SCSA 3AJ7A 4FQHB 2DQXA 1UKQA 4K94C 5HGBB 5A95A 1R7OA 1X5KA 2MIZA 4YTQA 1O1ZA 2JK5A 4XCEA 4EDXB 5EMLA 3VOFA 2VISB 4AEOA 4B16A 1I8KA 1KCRL 1XL4A 4I0KA 1KBJA 3VD9A 3MGTB 4HA1A 1MXGA 4OF5A 5GZND 4NKOB 4JHWL 3T4AA 2ADAA 3QI9B 5DRWA 1TJGH 4LU5H 2CM6A 2LU3A 3V0TA 1SW7A 1FHGA 5D9NA 4F2UA 1UASA 1ZJBA 3MOBL 3H23A 5DCCA 4O58H 5ADOH 1LG2A 4NKIL 1EMTH 1T2XA 1ICSA 3UTSD 3B3DA 1AG0A 2AJXL 4ODUA 3FJTA 4RUBA 2P46B 4C4BA 4FEIA 3ZL4H 2EAEA 4JTGA 2BVYA 1VPYA 5KITA 1JXKA 3H7VA 1NCDL 4AMCA 3V4VH 4LUIA 3GRBA 2CK0L 2A9NL 3WUWA 1TZGH 4LT9A 3QZPA 2ICCA 2LU7A 4PULA 4L9XA 1KM6A 5D1ZA 1E8XA 1VFSA 2WXJA 2W92A 2O5NA 2PWUA 2IQAB 3HPSA 3VZYA 1W0VA 3RVUD 2G9KA 2BM3A 3N34A 1H19A 1EX0A 3B6SB 4YXKH 2J8GA 5MF5A 3APCA 4UQ3A 1DL7L 2QJDA 5C9UA 3IFOB 3DDGA 1BEYL 4XP1L 2FPVA 1C7SA 1FL3B 2NUPA 1V7YA 1TVBB 1M3UA 1T6WA 1UH2A 3WLBA 2BWDA 2BWQA 1P84K 2OX4A 1UC6A 4HALA 4GKNB 1QDSA 3FEMA 1BSLA 2D7QA 2A7RA 1RALA 2VH5L 4Y9CA 4DZBA 4R4BB 1NDGA 4CL7A 4PS8A 2R69H 3ULVH 1MWOA 5D1XE 2Y07L 3C8DA 5E4EC 1AO7E 4NF7A 1VGEH 3CFBA 2YLHA 5KUKA 1VA9A 4G8FB 5BXPA 4MQ7A 1WG3A 4NC0B 2Z24A 5I30H 3W2NA 3BWUC 5DFVD 1NAL1 1WFNA 5B3NA 3F4VA 1TOXA 1T5WA 2YZ8A 4KDTC 1TV3A 2O6DA 1E6RA 1LEIA 2XVBA 3QJQB 2V2XB 4ZMYA 3PFQA 3DFYA 4TKWA 3SCWA 4PIRF 1NP2A 1XR9B 5C0EB 4JY6B 5I1LB 1CGXA 3KNBA 4YHIA 3M0XA 3TZVC 4KY1H 4ONHB 5D1ZD 4P2QE 4DVBA 4WKZB 4NOBA 1MN4A 4FQLL 1TYJA 4G6JH 4OTKA 2BS71 4Y4KA 2F15A 1ZLVH 4JZNA 3R0UA 1ITCA 4H0GA 1WT5C 2FSDA 4I77L 1X5ZA 5I6SA 4LVFA 3QCTH 1K3UA 1FTXA 5E2WH 2A6JA 4PRWA 1YNTB 4M3JA 4OZFB 3D3FA 1EFXA 5EV7A 4QHLB 3EOLA 3AMGA 3NYDA 4HPOL 3VVGA 2OZ0A 5CPMA 1Y65A 3S36H 3RWIA 6TAAA 3GG7A 1E5NA 4L1XA 4PJIE 4IRJC 3ARXA 1ZPUA 4Y9PA 2RGSA 4LRNL 4DNHA 1AVAA 5B21A 4Y5VA 1ZEAL 5BZDA 2OT1A 2V63A 1LQBC 3O7UA 1SMDA 2Z1BA 5FO2A 4NAFA 3V5FA 5EB9A 3FBQA 3ENEA 5CD3A 4UILH 4KEZA 3MRCB 5F9AC 4DPRA 2AVGA 3IU4L 3V6OA 2VHLA 1OZQA 2XGZA 3OYZA 4B3ZA 2HT4C 4O2EA 1V8EA 4TL5A 1KF9B 4HIJA 4K2SA 1K9TA 3SYAA 2AV1B 3B3BA 3CFKA 2FX8L 4PU2A 4IOFD 4W9FC 5T5NF 3W1MA 1OANA 4LP8A 1DBKH 1T1ZA 1UD6A 3C60C 3K6NA 3QV7A 1KLYA 5IEKA 4JTIA 2HT2C 1I9IH 5DF0A 1ME9A 4C5YA 4HJUA 3AMKA 3CV1A 3G6LA 5BZAA 2E75C 3PBMA 4XKYB 2XZQL 5BQ7A 2BP5M 3MTRA 2AEIT 1FJ1B 3WEZA 3NJMA 3FOLB 5DFTA 5M95B 1FL5A 2BGNE 3OQ8A 1WBXA 3KLKA 1EFXD 3CH1B 2EP6A 3ES6A 2E1WA 4M6UA 1F41A 4J2PA 2MUCA 1ZHNB 1WZ1L 1HTYA 4LDLB 4OLVH 1AZBA 2DFAA 3STGA 4A21A 3MWAA 4XPHL 2HJPA 3TH3T 4AYDC 2V30A 1R3LA 1ZP3A 1VESA 4G6ML 3P7YA 1DDHB 4IMKA 5TBOA 4OBRA 2BFGA 3NA8A 3CN3A 3SDAB