1AVAA

Amy2/basi protein-protein complex from barley seed
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
403
structure length
403
Chain Sequence
QVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGPHMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFAKGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFFDWGLKEEIDRLVSVRTRHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFKVAAHGNDYAVWEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution.
pubmed doi rcsb
molecule tags Hydrolase inhibition
molecule keywords BARLEY ALPHA-AMYLASE 2(CV MENUET)
total genus 139
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1avaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1avaA01
2ZUWA 3EDDA 5CLTA 1EOKA 1KCKA 3VGDA 4GO9A 1M53A 3SCRA 4H04A 4XV0A 4CGTA 3UESA 1U33A 3WDRA 3VD4A 3DECA 3BXWA 3CC1A 5BWFA 5DMYA 4YPJA 3RM8A 2WANA 1JL8A 3B8SA 1WDQA 1GNXA 2CBIA 4PMUA 3SCUA 4N42A 1R85A 5DT7A 4DWSD 3TTYA 4TOQA 1PEZA 3EJUA 4MADA 6A3HA 4W86A 1VFFA 4ACZA 2C8NA 2A3HA 1ODZA 2CETA 2J8GA 2WK2A 1QHOA 1BF2A 1F4HA 4GZJA 2VX7A 1VFUA 3WY3A 2W62A 1LWJA 2ZX6A 3L2LA 2EQDA 3A4WA 1J0YA 1CNVA 2DH2A 3EJTA 1BFNA 2CKSA 2FE0A 1I75A 2WXDM 2OWCA 3KZSA 5CG0A 3AIUA 3NDYA 2VQUA 1MQQA 1CLVA 1E0WA 1HJUA 2W4XA 2DPEA 4UFHA 2ZXAA 1KQYA 5AYBA 4EAMA 4W93A 2E9LA 4C7DA 5ABFB 4ZFMA 2WVTA 1XH1A 2Z1KA 1EO5A 1JAEA 3GBEA 3EMCA 3L4ZA 4PMRA 3AFBA 4CCEA 5M03A 3ZM8A 2F7RA 1PX4A 5HBFA 4MJ4A 5AYIA 1S46A 1GVYA 1K9TA 4UFMA 1HJSA 2C0HA 3OGRA 1SMDA 4AMXA 1PS3A 2EEXA 1GPFA 1W32A 4CD6A 4LYQA 3WNOA 3WDIA 3WQ8A 5FKYA 4TUFA 3BAXA 3VGFA 4FNQA 1PAMA 1K9DA 2J78A 1CENA 1C93A 5JIPA 2GK1A 3A47A 1HKIA 1JFHA 2BVYA 1BQCA 4TX8A 4PMVA 4OOZA 3NSMA 3BVTA 3BUDA 4MDPA 3A4XA 1M01A 3WH9A 3KLLA 1VRXA 2RGLA 5CPQA 1GHRA 2CITA 5A69A 3ZT5A 3SCWA 1HVQA 1VEMA 4M82A 3VPLA 1FH8A 3BC9A 5IFTA 3OGVA 2CESA 2EABA 5FCZA 4UFJA 2Y2WA 3GXFA 2J75A 4H7VA 5E0FA 6TAAA 2Z1SA 1VB9A 2PBOA 3POHA 2VZTA 1UR4A 4PBGA 1BYBA 1WP6A 3VU2A 1EXPA 1JXKA 3ALGA 2JEQA 4HMDA 3BVUA 1JI2A 1BTCA 4CVUA 1CGVA 3VO0A 1W9DM 1J0HA 3CGTA 4W84A 2X1IA 1O7DC 1C7TA 3A5VA 3SEPA 3QOKA 1JDDA 2DSKA 4NSBA 1UR9A 1R87A 1XHGA 1UKTA 1W1TA 2D0HA 2BS9A 4A4AA 4EANA 3W27A 8A3HA 2V3EA 1TQUA 2YBTA 1Q6GA 3VVGA 3DDGA 2PWDA 4XZBA 1FHDA 2VURA 3DX3A 1ISWA 5LA2A 4JFUA 4WSJA 3DHUA 2WMIA 4NRSA 4JFWA 1HWWA 3W82A 1HN1A 5DEZA 5GQBA 4EKJA 3L4VA 3VNYA 2VX6A 2WMFA 4JCMA 3WF4A 1UKSA 3L4UA 1UZ4A 1P6WA 1NOUA 1XGZA 3WD4A 4CD7A 4GI6A 2XGIA 3RDKA 2PF0A 2ALWA 1EO7A 4DWSB 1XYFA 2V3DA 1JZ6A 3BAIA 3TOPA 3CZ8A 3LXBA 5ABFA 4YHGA 4DM2A 4MB5A 3UCQA 1NWUA 2WHKA 2YDSA 1DWAM 3EMZA 3L4WA 3AIRA 3LRMA 5GNYA 3W81A 4JKMA 5I2UA 4P8UA 3AHYA 3WQVA 2Y8KA 4CCDA 5GNXA 3D4YA 3L2MA 2D1ZA 1OT1A 1HVXA 3TONA 2GVYA 3H53A 2JALA 3NIYA 2UWFA 5EBAA 1ISVA 3WNPA 1W91A 4HP5A 3WBEA 5A3HA 5BCAA 3AIWA 2EJ1A 3EDKA 2ZUMA 4PTXA 1FHLA 2NW0A 2A3CA 4Q7NA 4BQ4A 4UOJA 1WE5A 5FL0A 3D51A 3PTQA 3CZNA 3QHNA 3LXAA 4D6FA 3PZQA 4W8LA 4DUWA 2GJRA 4U2YA 1BYDA 3EYPA 1CTNA 4TVDA 1VFOA 2DEPA 3IANA 1CGWA 4CUCA 2J7DA 1UD4A 4QLJA 3GXIA 1UWIA 2EPKX 4CKQA 1E3ZA 2OW6A 4DWSC 2F18A 3KL5A 2BHUA 1UOKA 2DT1A 1NM9A 4Z2JA 3WMBA 2IGTA 3F4VA 5DO8A 2GDVA 4ZE4A 1UH2A 1MQPA 1HP4A 2ZXDA 4E8CA 1KXHA 1UZ1A 1PBGA 1CEOA 1QHPA 2FGLA 7A3HA 3S5YA 4AD0A 1R47A 1W9UA 1OT2A 3WL0A 3AXXA 1G94A 4AIEA 2UY4A 3VGHA 1OGGA 4L4OA 2X8RA 4W87A 3VUPA 2BY1A 1KBKA 1MW0A 5M17A 2W63A 4UZUA 2PWEA 4FLOA 3AIVA 4LXFA 1CZ1A 4FLRA 2X2YA 2V3GA 4D6IA 2WMJA 4OUEA 4UQAA 2PC8A 2XGBA 3U57A 1GZJA 4HU8A 2BVTA 3WH6A 1DEDA 1DWFM 1CECA 1ZJBA 1XD1A 1HKMA 5CSUA 3CTTA 5A1AA 3BUIA 3WSUA 1V0NA 2YFNA 2VZSA 2AAAA 3ZMRA 3UETA 1QWUA 3VOCA 2WWDA 4QDMA 4OIFA 3OG2A 2WBKA 3VM5A 1HJWA 3AOFA 4AZCA 3SUVA 1E4IA 2EPNA 3LXCA 3GNOA 2VL4A 5KZ6A 2VTFA 4P7LA 4QCEA 3PHAA 1JZ4A 1W9BM 4HZ8A 3VIGA 2WCGA 5D9OA 2CPUA 1V6UA 2JIWA 2VUYA 5DFAA 4B9ZA 2WKGA 1HTYA 1MW3A 1E6XM 2OYLA 1W1YA 2ZIDA 2GUYA 1DWIM 2ZWZA 4NI3A 2UY2A 1E55A 2DT0A 4NXSA 4WKFA 2OWWA 3BCFA 1H11A 1V0MA 2XN0A 3BVXA 5A6SA 5HNNA 1OWQA 3WFLA 2VX4A 1K9EA 3G6MA 3W37A 4C7GA 3VGBA 2CIPA 5FL1A 2VR4A 1FA2A 1NARA 1OIMA 2BXYA 4AD4A 1JZ5A 4BQ5A 1HKJA 4RL3A 1FOBA 2VJXA 5D4YA 2J74A 2A3AA 4PTWA 1V0LA 1C8XA 1G5AA 1GW1A 1MXGA 1NOWA 2OSWA 2XSAA 7CGTA 3NSNA 5A8OA 3WH7A 2G4FA 3EDEA 4LQ1A 1E5JA 2CKRA 3OBAA 1GONA 1JF6A 1EH9A 3SURA 2QV4A 4M1RA 2B31A 1E0VA 2X05A 3OB8A 5A8PA 4J3TA 3MUZ1 2BHZA 1W3LA 3RMEA 1BGGA 2WVVB 3WIJA 3MO4A 1ZU8A 2IXUA 1H3GA 3AS0A 3CHFA 1BGAA 1JYNA 5A2BA 3SUWA 4DO4A 4X9YA 3I3DA 2D2OA 1HX0A 1E5NA 3T0DA 3VDBA 1GOOA 5A2CA 1Z32X 2WPGA 3L4TA 4HZ7A 1RPKA 4E4PA 1B3YA 3RJYA 3CUJA 1E6PA 4FNSA 4GXPA 4JL2A 4Z2KA 4AW7A 3AZSA 2VCCA 2VRKA 2J7GA 3SCNA 2UY5A 3LPPA 3WDPP 4WIWA 3VIIA 3TTOA 2PI6A 2VZUA 3FY1A 1HF6A 1BG9A 5D9NA 1MW1A 1HJQA 3VIOA 5IFPA 1W9VA 3AQUA 4RE2A 2G3IA 1G1YA 4M24A 4MJ2A 3QHMA 4YHEA 4H8UA 2CYGA 1YQ2A 3ALFA 2VRQA 1MW2A 3EMQA 4CN4A 1UWQA 4LGXA 1J0ZA 2XFFA 1CXKA 2GSJA 1E0XA 5I3DA 1ISZA 1GOKA 1A47A 4BQ3A 1CXIA 4DUVA 5ABHA 3BLKA 3KLKA 4WK9A 4D1IA 2ESCA 1BAGA 3S2CA 1DTUA 4W8AA 3HJEA 2XTKA 2XVNA 1CXFA 3D4ZA 3BLPX 2AMGA 4PMYA 4U3AA 4W7WA 4S3KA 2XVKA 4RE3A 1M03A 1UWUA 4Z2LA 2JIEA 2F7OA 2G3MA 4H8VA 3T2PA 2D23A 3OIHA 1C7SA 5D9PA 3VX1A 3WF3A 3ARWA 3TA9A 1ISXA 2EPLX 4W5ZA 1OD0A 4NX0A 1I1WA 3LPOA 3AS1A 1E4MM 1UKOA 1L0PA 2VZOA 1E6NA 3VIMA 2JFEX 5CZKA 3AISA 1TQVA 3PZUA 1RP9A 2WSKA 4P8VA 1PIGA 1CDGA 3WBAA 3PZOA 1JYVA 1PZ2A 4PSPA 3DC0A 4PUDA 4AD1A 1JIBA 1UR0A 4BQ2A 3TTQA 2DDXA 3WDQA 4OBRA 2WMIB 2ZUSA 1JZ8A 3VIFA 4HPHA 3WNMA 1C8QA 3BUBA 4NZJA 3U5UA 1OD8A 2GJXB 5CPSA 4FLSA 3GXPA 1JFXA 2ZX9A 1TMQA 5FD0A 4OJYA 3AROA 4PCSA 5GPRA 1CXEA 2J47A 2W91A 2MANA 3NJ3A 3PZNA 5M3WA 3L4YA 2WAGA 1GQKA 1HJXA 5DT5A 2J7CA 2WYSA 4F79A 1SR0A 2VC9A 3WDHA 4J3WA 1CLXA 1AQMA 1O6IA 2ZX5A 4AZIA 4FNTA 2PB1A 4MNJA 1E1FA 3VINA 4J27A 4UNIA 1NOFA 4CN6A 2WMKA 1KR1A 1B0IA 1IT0A 1J0IA 1V02A 1GQLA 2VOTA 1J12A 4AMCA 4OOUA 1SYTA 2W66A 4U5IA 3O6AA 2G3JA 2Y5EA 2CBJA 3BAJA 4PMOA 3EBVA 2QMKA 3CUIA 1D3CA 3DX4A 1ZBCA 3SCVA 4AYSA 1OINA 2FHCA 3I3BA 4GZEA 2YJQA 3HZ3A 3KEHA 3W4RA 3OZOA 3BAKA 4MNMA 3WENA 1UKPA 3M6DA 4M8UA 3VGGA 3EDFA 2GK1B 2OWXA 1E9LA 2CHOA 1XYZA 1UWTA 5CSYA 3PTMA 2E8YA 1H09A 3BAYA 1ISYA 1E6SM 1OSEA 1T0OA 2HISA 2ZX8A 1WZLA 2OSXA 1LL4A 5I6SA 3B9EA 4B16A 3BAWA 4ZXOA 3W29A 2QMJA 4W7VA 3WF0A 1ZB5A 4XZWA 1LL6A 1J18A 5E09A 2F61A 2E8ZA 1OGSA 2GFTA 3PZ9A 2BY2A 4DO6A 4M56A 3VIHA 3UG3A 5F7UA 3VMNA 4D1JA 4D6GA 3UEQA 2WB5A 2YOCA 2FH6A 3IJ9A 5BRQA 1MVYA 4WKAA 3CHDA 5A2AA 1TQWA 3WDJA 4H41A 4AWEA 2F1AA 1FH9A 5I79A 3PZMA 3NDZA 4AZCB 2A3BA 1AQHA 3M7SA 2DSVA 2FH8A 3K8LA 4HTYA 4J7RA 4JZ5A 2EBNA 5AY7A 1M7XA 3D3AA 3LX9A 2WM0A 3ARRA 5C70A 4MNKA 1EOMA 1UD6A 4F9DA 3FNDA 4BA0A 2XIIA 2YA0A 1E71M 3WN6A 1EHNA 2CHNA 3W38A 2BHYA 1WPCA 1CPUA 3MV01 5BXSA 5A6BA 2G41A 4WLCA 2XG9A 3OGSA 4BF7A 1E6RA 5I5RA 5AC4A 1XRVA 4Q22A 3VIJA 3LMYA 6CGTA 1L8NA 1UWSA 1BYCA 2V38A 1B3ZA 1FP8A 3CH9A 1E3XA 3CZSA 4PTVA 3RPMA 2XN1A 4AZBA 1SMAA 3CHCA 1KXVA 5ECUA 3DDFA 3K1DA 3VX0A 4MDOA 1R7AA 4UOQA 1JZ2A 2AOSA 2VCAA 2QHAA 4AEFA 3GZAA 2D3NA 3SCSA 1ECEA 4BZYA 1DWGM 4MNLA 1HNYA 4AC1X 4AMWA 2DIEA 2E9BA 2J77A 1U30A 4M81A 3T0BA 4AZ6A 5CPTA 1V3MA 4PTMA 1IZKA 1W3JA 3AICA 3D5HA 3WEZA 4QCFA 4HA3A 3DYPA 2OW7A 2DSUA 1JXJA 2J4GA 4JHOA 3WUEA 1QNRA 4CU6A 3CO4A 2EADA 1MFVA 1CGYA 1V3KA 1V6WA 1KGWA 3WELA 3MSGA 1GJWA 2EPOA 4KGLA 1YHTA 3CV5A 1XCWA 2YL9A 2C7FA 4FNRA 3VIKA 1EDTA 2YKKA 5E0CA 3DHPA 1V6XA 3AHTA 1E6QM 1H1NA 3PN8A 1B90A 3UR7A 1V08A 2O9RA 1CBGA 5E70A 4LYRA 3BVWA 1W3HA 2CNCA 2DH3A 4JFSA 4E8DA 2W61A 4OGZA 3W0KA 5HDRA 3MMWA 5IHRA 3GH4A 3THCA 3FXYA 3VD3A 3N1AA 1G0CA 1DWJM 1QBAA 4ATWA 2BV9A 1US3A 1RP8A 1VJZA 3NUKA 1OM0A 1J9YA 2J8FA 3VIPA 3W53A 5I78A 3GDBA 3T2OA 5C71A 5FIPA 3ARUA 3SUUA 1ODUA 4JFTA 3UG5A 4OBSA 1LL7A 4ZXLA 2BNJA 2JF7A 2WCSA 3ZQ9A 4LX4A 2XWDA 3CZJA 1UR1A 2YA1A 3S6TA 2DIJA 4D71A 1EQCA 1HL9A 4JAWA 4GI9A 2WC4A 1G9HA 1Y7VA 2WC7A 1BVZA 2WLZA 1HKKA 3THDA 5JBEA 1UHVA 3ZJ7A 3W24A 1W9XA 3ARPA 1W1PA 4PEEA 1V3LA 1O7AA 3QOMA 3FAXA 4FK9A 1W9PA 5ABEA 4MAZA 2UY3A 1JD9A 1LF1A 1PX8A 2VO5A 5KEZA 2OLHA 3WNNA 3LPFA 5CGTA 3HG5A 4MTVA 3IJ7A 1J0JA 1DP0A 2DSWA 1KGUA 1QNPA 4FNUA 1NWSA 2BY0A 4LPCA 1WCGA 3GNPA 4L4PA 3NCOA 3LPGA 1UUQA 1M04A 3AZTA 1HJVA 5A6AA 4UFLA 2V5DA 1TR1A 1JYWA 1GUVA 1KB3A 4P7RA 1V02E 4V28A 1SZNA 3M46A 1KGXA 7TAAA 4URIA 2J25A 4F9JA 3J7HA 1EQPA 4K68A 3MUAA 4CD5A 1V0KA 4UTFA 3O2LA 4HOWA 4AY1A 3BMVA 3AMLA 1E4NA 4GQRA 2DT2A 4AYGA 1QNQA 2E9MA 1BVNP 4JKKA 2BVDA 3WY1A 4Z2GA 4UZSA 2X0HA 3ARTA 4J28A 3UR8A 2F2HA 4AZ7A 3BLBA 1H41A 1WNOA 3VSUA 3VD7A 3WEOA 2XHYA 4B3KA 4X0VA 3HG4A 4UQEA 3AJ7A 3D52A 4UFIA 1TQSA 4X0NA 3N18A 1ZL1A 1ZBKA 5E6ZA 5JBDA 3ZT6A 5HPCA 1J0KA 4HMEA 4UOZA 4EK7A 3BUPA 3F5JA 3VDAA 1ZBVA 4W85A 3SCOA 1JNEA 2CBUA 1FFRA 4AIOA 1NWTA 1QNSA 1PJ9A 4UCFA 1D7FA 3EJSA 2VT0A 1LJYA 2FGZA 3UG4A 2CEQA 4F66A 1UD3A 4ACYA 1ZJAA 1TG7A 5BROA 1R7OA 4D6HA 2QF8A 4P7NA 3WQ4A 1VBRA 4TTGA 4ZENA 3T2QA 5A8QA 5E6YA 4KRUA 5A8NA 1BSIA 1OCQA 4S3JA 5AC5A 4AXNA 3AYSA 1BLIA 1Q6DA 2WBGA 4CCCA 3MKKA 1UA3A 1ITXA 2E3ZA 3AIEA 1B2YA 1XSIA 3BGAA 1KQZA 3GM8A 2FYVA 3HN3A 1NQ6A 1VENA 2IXVA 3WF2A 1CGXA 4P8WA 3PBGA 2XM2A 4H8HA 2D22A 9CGTA 3W25A 3KL0A 3KWXA 4OZOA 1X6NA 4JKLA 1UKQA 3CZKA 3FHQA 3VMPA 5BRPA 2XVPA 2ZICA 2V3FA 3T09A 5LYRA 1WZAA 3UERA 1DHKA 1JG9A 3CZEA 4J3SA 3AXHA 2W92A 3MUIA 1X6LA 2E0PA 3A24A 2YIHA 3OLEA 1MXDA 3FN9A 3BSHA 4IPNB 3IK2A 3CPUA 2YBUA 3ZIZA 1KWGA 1WB0A 2VX5A 4W7UA 3WD0A 3EJPA 1JZ3A 3DYOA 2WHLA 3OLIA 1B30A 3AHZA 1R75A 4Z2HA 4GIAA 3A21A 1C92A 4DUXA 4OKDA 3LRLA 4JFVA 3CUHA 4QAWA 3D50A 3MI6A 2VMFA 2FHBA 3WUBA 2XUCA 2PBGA 1FH7A 1H4PA 3AS3A 2WMHA 5IHSA 2EXOA 1KXQA 2XYLA 1VAHA 1QI2A 3F5KA 3RO8A 1LG1A 3WUGA 1VF8A 1MQRA 3G6LA 2WHJA 1LQ0A 2WZIA 1R8LA 1TZ7A 3N11A 3W26A 2ZUUA 3BCDA 3MV11 1KTCA 5A6KA 3AMDA 3ZT7A 3VD5A 2ZXQA 4AZHA 1JDCA 4AEEA 4FMVA 4HOZA 3VILA 4PUEA 2JE8A 4BCEA 2JEPA 1ESWA 3ARXA 1JAKA 3HMCA 4F8XA 3WNLA 1JD7A 1JI1A 5IDIA 1QPKA 2O9PA 1QI5A 4P7OA 3U7BA 3AHXA 4CU7A 5I24A 1J01A 2G8ZA 1GCYA 3MMUA 1HIZA 1QBBA 1EDGA 1QW8A 5A6BD 1C3FA 2CERA 3CZGA 2E40A 1QVBA 4DM1A 3IAQA 5I0DA 3M07A 4FLQA 2YL5A 1OGBA 3B9AA 3N17A 1R86A 3CIVA 2XIBA 3HG2A 1MWOA 2DGAA 4JCLA 2J7HA 4M29A 3WF1A 4E2OA 4U33A 3VM7A 1NP2A 1TUXA 3ZO9A 1JYXA 4J3XA 3CHEA 3PZVA 2TAAA 3WFZA 4ATLA 3S5ZA 3DX1A 1TA3B 3ARYA 4V2XA 2ZWYA 4D6CA 5C8BB 2Q8XA 3MUY1 1TQTA 2XWEA 1CIUA 2XSBA 5CQ1A 3SUSA 4C7FA 3EJRA 3WUFA 2OYKA 3ZJKA 1JDAA 2XVLA 3T08A 1W1VA 4HA4A 3VDCA 2QLYA 4UQDA 2EO7A 1KBBA 1BG4A 1EDQA 2NT1A 5LA0A 1WO2A 3TP4A 3TV8A 2CCRA 4ACZB 1C91A 2WC3A 5CGMA 2X09A 3QR3A 4HMCA 2WMGA 1VIWA 1DWHM 3ARQA 3I3EA 3RIKA 3VGEA 2F1BA 5FOOA 1E43A 3H54A 3CUFA 4GQQA 4P8XA 3WD2A 1I1XA 3N15A 4M80A 1X1NA 4NZFA 2EPMX 4PMNA 3WQ6A 2XFYA 2W67A 2J7EA 1UQYA 3IGUA 3WKZA 3VSVA 3ZJ8A 1JF5A 1UD8A 3ZOAA 2WHMA 4CVWA 1GVIA 1UQZA 1US2A 5JBFA 1HXKA 1WDRA 2CXGA 2J7FA 3WQ5A 1UD5A 4AD2A 4B3LA 3WH5A 4JHZA 3VKKA 1IV8A 4A3YA 3AHVA 3POCA 4U5KA 1HT6A 1SFSA 4AD3A 1B1YA 4YN5A 3CMGA 1CGUA 3BUQA 2YLAA 5I77A 2XVGA 4GZIA 1XC6A 4QLLA 2QPSA 1UR8A 2EACA 3WY4A 3MS8A 3ZR5A 1GOIA 2WCAA 2BXZA 1EGZA 4MB3A 1QNOA 1FFQA 3CZLA 2X2IA 2WSPA 4QP0A 3CUGA 4KWUA 4UQCA 5EB8A 1N82A 1WZKA 3MMDA 1G01A 4HA1A 4CD4A 5EFFA 2X2HA 1BYAA 1EIBA 1QI0A 3GXDA 3IAPA 2V5CA 5BYWA 3SCPA 3EDJA 1OIFA 1EA9C 2Y8VA 1J11A 1WKYA 3WD3A 4AISA 2VR5A 2YA2A 3GNRA 2WWCA 1H0GA 4IUGA 1E6ZA 1A3HA 3WH8A 1UA7A 2GJXA 1H0IA 1BPLB 2F7PA 5BXPA 1XD0A 2WVVA 4KMQA 2WVSA 3II1A 3ECQA 4MAVA 2FHFA 4WSKA 4PMXA 2PWFA 4WJXA 1VEOA 1E40A 1UG6A 4PYSA 4AIUA 2X0YA 2WZEA 3AXIA 2ZOXA 4D72A 4N0RA 2O9TA 2XM1A 1CXHA 3QHOA 4MB4A 4J3VA 3SCTA 1TE1A 1B3VA 5BXTA 4R5EA 3SUTA 1GOQA 3AS2A 1QI4A 3F5LA 2G3NA 4AZ5A 1H5VA 2Y24A 3OZPA 4HPGA 3VNZA 4XX6A 2D24A 5D9MA 1UH4A 1R33A 3A4AA 1UYQA 1C8YA 2GJPA 1F4AA 1VFMA 1K6AA 2JF6A 4LYPA 2VVNA 3VTRA 1MYRA 2Y4SA 4QLKA 4H2CA 1UR2A 1LLOA 1W3KA 4XB3A 1E15A 2PWGA 1NWRA 2DSZA 3KE0A 3VSTA 4V27A 1VJSA 5ABGA 1W2VA 2HVMA 1V3IA 2WKLA 5E1QA 4A3HA 3GXMA 1E4LA 1H49A 2D0FA 4U2ZA 3GXTA 3NYDA 4BS0A 1GQJA 2J79A 2XN2A 1D2KA 1H2JA 4XUYA 4PCTA 1TCMA 1XH2A 3A3HA 1KCLA 5A6LA 2VQTA 1B31A 2ZUNA 3WNKA 3T0AA 5DF0A 3APGA 3A22A 3W6LA 2E4TA 1XCXA 2YL8A 1PZ3A 3AMGA 4J3UA 4PRWA 5A95A 5LA1A 2VVSA 4NF7A 3U7VA 3IJ8A 1KTBA 3H55A 4GKLA 1V6VA 1HL8A 2VNCA 3GH7A 3U5YA 1B3WA 1WAWA 1AMYA 1QW9A 3OLDA 5CJ5A 2D0GA 1B3XA 3WMCA 4ZEPA 3PZGA 3K46A 1V03A 1QOXA 2WW5A 4U31A 4MB1A 3WL1A 1VEPA 3JUGA 1TVPA 1XSJA 4D6EA 3WY2A 1KXTA 4CU8A 4D6DA 1OBAA 1V3JA 2O92A 4CN1A 1FP9A 1GORA 4P7QA 1KFWA 1GJUA 3O9NA 2XPKA 4ZE5A 5E9AA 4AZGA 5A6MA 4AD5A 3N13A 1OB0A 1IZJA 3TTSA 3W28A 2ZE0A 3EJQA 1GQIA 2X2JA 4IM4A 2BFGA 1W2PA 3AMCA 3OA5A 2EAEA 3BH4A 2YLLA 4GINA 3DX2A 1ZBWA 2ZXBA 1KWKA 3VDHA 2FDMA 1CGTA 1Q6FA 3CLWA 3K4DA 5CXPA 3FW6A 1HXJA 4ML4A 3DYMA 1PX3A 4TXEA 8CGTA 1WZMA 1BHGA 1E72M 3PZTA 4CD8A 2OSYA 4DO5A 3N9KA 2VCBA 1JZ7A 3BMWA 2WZHA 1WDSA 5I23A 3SIMA 3GBDA 1KR0A 1ZS2A 3A6OA 5IXEA 1R34A 1Q6CA 2YL6A 2NSXA 1CYGA 2D20A 4B15A 5HXMA 1NH6A 4EE9A 1JNDA 4UQ9A 1XV8A 3WQWA 4KRTA 3PTKA 3HU7A 1PIFA 4HOXA 2GDUA 5D8ZA 5JUVA 1JGIA 3E1F1 1UASA 1AQ0A 5CLWA 4TVCA 4B9YA 1EHAA 3K8KA 1UH3A 3GH5A 5GNZA 2OYMA 3RM9A 3AIBA 3ARVA 1GOWA 3GYCA 2YDRA 2F8QA 3RJXA 5BXRA 2WVUA 2ZUVA 2NT0A 4W89A 1R46A 4JIEA 3K8MA 4WF7A 2F7QA 4NRRA 3CMJA 3HG3A 4GO8A 4IISA 4TX6A 2PWHA 2WNWA 1WDPA 3NSXA 1RD6A 3MSDA 2RGMA 4UR9A 3KL3A 3CBWA 4PSRA 2XJ7A 3ZSTA 4PMDA 1HP5A 4W5UA 3BSGA 2A3EA 1K9FA 3AI0A 4KGJA 1UD2A 5JIWA 5D8WA 5TD4A 4GPNA 2D3LA 2J62A 3VD9A 3OLGA 3ZR6A 2VZVA 3ZJ6A 4U3CA 2DT3A 3AYRA 4W8BA 1TVNA 3VMOA 3MANA 3MU7A 4UQBA 3FHAA 1QX1A 3WD1A 4NXKA 4DWSA 2CBVA 1CXLA 4FNPA 4D6JA 1TA3A 3FAWA 2WLYA 1B9ZA 3A23A 4MPKA 1AVAA 2J7BA 1CWYA 4PN2A 4RE4A 1XSKA 2BY3A 3B9DA 3SCQA 4Y7EA 1PPIA 3ARZA 1MFUA 1C90A 3AZRA 1GHSA 3QGVA 4HU0A 2XFRA 5EFDA 4HZ6A 2VRJA 5EMYA 3RM4A 1U2YA 4W88A 3GXNA 3N04A 1E73M 3W6MA 1QHZA 4FF5A 2O9OA 1E56A 1QI3A 3AIQA 3DX0A 4GI8A 1E1EA 3ZSSA 3LRKA 4JL1A 3L4XA 2DQXA 3GTNA 5HOSA 3RCNA 3RILA 1ITCA 4IPLA 2QPUA 3BVVA 5HPOA 2VI0A 4PMZA 1LWHA 2D73A 1VBUA 3N12A 1QWNA 1V3HA 4PMQA 5A8MA 3K4AA 1UWRA 2ZX7A 3AMKA 4Z2IA 5A6JA 2ZUTA 4WKHA 4TVUA 2YDQA 3ARSA 3WMSA 2IUZA 1Q4NX 1NP0A 1LG2A 5M5DA 1GOMA 4TTUA 3PZIA 4R27A 4UFKA 4KH2A 4NZCA 3WEMA 1E70M 4ATDA 1XH0A 1Q6EA 1TFVA 1J10A 1RH9A 2YFOA 4QFUA 5A94A 2W5FA 1V6YA
chains in the Genus database with same CATH superfamily
3FQ4A 2GK0A 5EZOL 1E4JA 4AQAB 1KCKA 3DO7A 5FECA 2ENQA 1IM3A 4NQDA 5DVKA 3GX9A 3VGDA 2CO7A 3DX7B 4NO2B 1J8HA 5I1IL 2PYEB 1W0YT 5FYJU 1O95A 3NYZA 3SCRA 4H04A 1CQYA 1E27A 2FT7A 3QC5X 4JO3L 4YSTA 3S36H 4CGTA 2C4FU 4F0SA 3WDRA 1IGIH 1UT9A 4OJFH 3ARGC 4GQ0A 4DF0A 3VD4A 4F9PC 4JHUA 5I1AA 1H51A 4OGYL 3VOFA 2HRWA 3U0TA 3HBLA 3BXWA 3HQPA 1F4XL 3CC1A 1XI3A 2WCPA 3SDXE 2CKBB 2XXFA 3L5WA 1GK8A 5L7XH 4LVNC 1A5LC 4X6CB 3FU7A 1MNSA 4KT2A 4A3HA 1TYRA 2B1AH 2BHFA 5IBUG 2WANA 1JL8A 4N1HB 4AYMC 5BU9A 2QKIB 4UTAA 1SW0A 9XIMA 5EZLB 1QFWM 4AQ1A 3LMJL 1HQRB 1NEZG 2IAMA 4ODUA 1BQHB 2JJTA 5INDA 4KKCD 2Y85A 1XCQB 1OAYL 2HVJA 3MNVA 4I89A 1IQDA 3EJUA 4LHJB 1A6UH 1AMKA 4MJIB 4NJKA 3WFDH 3WIHA 3G8EA 1NF7A 2YPLA 5CPLA 2EIMB 5H2BB 2A7BA 3H4HA 4DY1A 4EWND 3J07A 1JGVH 2C8NA 2NMSA 3KGSA 3ZZSA 2C71A 3DPDA 3EH4B 4C6FA 3MHFA 4KCTA 1OSZB 2EYSB 5GZOC 4KV5F 4KK9D 2LR4A 4OV5A 4O4YL 4AX3A 1KTKE 4JRFA 3ZWTA 3DV6B 4WFGD 4KK8C 5IMMA 4ERGA 4TNWK 5TF1H 5EF2A 3I7SA 1KPRA 4GHRA 2CGYA 3L3IA 1NCIA 4GVHA 5ECVA 3PWAA 4RSYA 1P4LA 1LWJA 2FO8A 4LF3B 5ACZA 4YHYC 1WDDA 1S1RA 4JTHA 1F3DJ 3QIWB 4EUPB 4JYEA 3UZXA 2M8XA 3ITLA 3PC0A 4QHKJ 3VA6A 3ARGA 3BWZA 5EU6D 3LOTA 1TPUA 3FJ6A 1U8OB 4WHYH 2CUMA 3OAZH 4TVPD 1BM3L 3EJTA 1BFNA 2CKSA 2OKOA 5C0EA 5CD5D 4LUTB 2E7MA 4GLRI 3KYNA 4WCYL 3NDYA 2HG5A 2Z4QB 4U6VH 3E2SA 3ML8A 1I8MA 2PDUA 2Q8AL 1PY0A 4FC3E 2HTKC 2J6XA 4M61B 1P4LB 1UA6L 4LF3A 4DQOL 3GVWA 3FQXB 2W4XA 1MEWA 3FB8A 1RULH 5LHEA 3W07A 2Q3RA 4AG4L 3TCLA 1KQYA 2GB2A 3SPGA 3ETBF 4EAMA 3G5ZA 1MOEA 4W93A 5AW4B 1YNLH 3LNDA 4QXUL 4GAFB 4I88A 3C6SB 4EZJA 5HYQB 5IB4B 5L2KA 5DCCA 4PJGB 1XH1A 2Z1KA 3MLZL 4LAZA 1EHLL 3HMWH 3UR5A 3GC3A 5JA8B 3G1DA 4DN4L 2ATAA 3Q6GH 3O6FC 1AGBA 3DTXB 1WDAA 3MLZH 4GC4A 1FHUA 3V2AR 4WK2B 3RY5A 4YSEA 5BJTB 1PX4A 2BSED 4Y4KD 5KSBF 3U4FA 5HBFA 2BNUB 2YMOA 1S46A 3OWRA 5FYLH 5CM1A 4FI7A 1DTNA 3UTTB 4ADSA 2W9LA 1K9TA 4UFMA 2XFGB 3GBLA 1HJSA 4PRTA 3X11A 2DW7A 4R4FH 1NAL1 1HL4A 5TE6H 1YY9C 1F2JA 1OX5A 1SMDA 1T20B 3V0HA 3ULVH 1UXSB 3TN0B 1WKDA 3Q8FA 4C5ZA 4PCNA 2EEXA 3EO9H 4WEVX 2JQMA 2WXQA 1KCZA 3A3XA 3UZVB 1WD8A 3ATBA 3FOLA 4CD6A 4U1IB 3G0XA 3I10A 4XN5A 1XCTB 1FL6A 1ZK9A 1UWXK 3BAXA 4HXBL 4M43H 3H2AA 5HHPB 2DWSA 3GSWB 5HWMA 3GNNA 4QCIB 5K9KB 2XBDA 2XV0A 1DVYA 1X5HA 3OAUH 5D71H 4KXDA 3QG6B 5JIPA 1JFHA 1HKIA 3M0JA 5J8LA 4GMTH 4TL4A 2J71A 3PG9A 3FQ1A 3L3OA 5D1ZD 4TX8A 1XLMA 4O2EA 3S1UA 3NCCB 3V4UH 1YEGH 4X5RA 4E9VA 3W2NA 1HH9B 2AS5M 3BPOC 4UF7C 2Y22A 3W2DH 3MLTB 1CE1L 3SKJH 2XFXB 2FX8L 1VRXA 3P4OA 3CXDL 3QORA 1LE5A 3E80A 1N3NB 4O9HL 5LN4A 3B7SA 2BOFX 1QRNE 1TZAA 5B38A 1P5VA 2EXWD 2MRYA 5F7BA 4LNYA 3K7UA 1Z5LA 2GYSA 4MASA 4UU9B 1HVQA 3CXDH 1Y18B 1YEFH 4LSVL 4RLDA 2X41A 4YGAB 5D30A 1R0AH 3ULUL 1FYTB 3BXNB 2NXYB 4AW4A 5T3XH 1FH8A 3BC9A 5IFTA 1E30A 4KERA 1KG0A 3T8QA 2DZAA 1EHXA 4M93B 2EABA 2XFXA 3WBWA 4PFMA 1RIUL 1UT1A 4Y16D 1FH2A 2JKLA 3QQNA 4PUKA 4HKZA 2ZE3A 2CO6A 1DQJA 3GSRB 4GLEA 1WA0X 1VB9A 4HBKA 2PBOA 4CLMA 2H2SD 3ISRA 4IRJB 1UR4A 3FU3A 1NL0L 1T0NB 2BZDA 4YDJA 4XAWH 1BYBA 4AEHH 3A6BH 1WP6A 4XPAH 3PY2A 1EXPA 2W9EH 5KS9A 1S7UB 3O6ML 2GT9B 2R2BA 4PS4L 3ALGA 4Y4HC 4OLZL 4OF6A 4JS7A 5GRUH 2VXQA 1BTCA 4EDXB 5JXQA 4TUOB 3E38A 4N6RB 2FWOB 5DQDL 1T22B 2EF9A 3DOIA 4HKZB 4XBKA 4FHKA 4DETA 1C7TA 5J3HC 4Z7VB 4DAGL 1JDDA 2DSKA 4ELME 3K2UH 4MX7B 1OC7A 4Z8FH 4POYA 4ML9A 3ARGD 4K23L 2OMYA 4N8CL 1E9PA 4C54A 1UR9A 5J5DA 2VDKB 4LFHG 5BZXA 4JFYB 1IAIH 4Z3FA 5LWYH 2NRDA 4JPKH 2DQGL 1OAUH 1I85C 4OCRH 1W1TA 4Z8FL 4JQXA 2BS9A 3MBFA 4LSPL 2DQTL 4L4TA 2BVPB 4J8RB 2ED9A 3O0RL 3ZYJA 2ISWA 1TQUA 4IRZL 4Q6IB 4UV7H 3MRJB 1ORQA 2X4PB 5IJCC 1FUYA 5E8PA 2YBTA 2DQEH 4MWFB 1OXYA 1F2XK 2JCCB 3KBEA 3E0LA 2YD9A 4PW9A 3EO1A 1A5FH 2KDYA 1ADQA 4X5QA 1FHDA 3VXUA 1IEAA 1SVBA 2ZNWA 3PV7A 3QIWD 1VFAB 1ISWA 1TE6A 4FL4B 4PV9A 4JFUA 3FRPG 4WSJA 5DT1L 3E12A 2V2XB 2R1WA 3UD6A 5EZIH 4YVNA 3IIVA 1PZ5B 4XTRC 3NIFB 5XIMA 3JTSA 1HHHB 1I7UB 2Z91B 4R7VA 5D2LE 2CK0H 5D1XE 3G5YA 3RPBA 5FYLD 3ZDZF 4CMHB 4O1FA 5DEZA 4M7JH 5GQBA 5DT1H 3G6JA 4EKJA 4DCQB 2X1UA 3E3HA 3ULUE 2IPKA 2WMFA 3BSZA 2X4SA 2XQ0A 4JCMA 3SY8A 2B7PA 2EPKX 5LAXA 1MQKL 1I8MB 3LCGA 3QXTA 4P46C 3MUGB 4YTQA 4MDIB 3VB9A 1NOUA 1YN6B 5IJBC 1N8FA 4L9YA 1A4MA 2PF0A 3D25B 1O68A 2XXCB 3CZ8A 4NUGL 4E0RB 1A0CA 4LSDA 5ABFA 1IMHC 3UA4A 1TCRA 3VXNA 2R56H 3QXDB 4PJBB 2GVGA 1N7ML 2X7LB 3UCQA 1NWUA 4IKIA 4UT9A 3T6WA 4LSTH 2WHKA 3N6QA 4M5ZH 3NG3A 1SQ7A 3O11B 4KFNA 3B9KA 4HBQA 5MHSE 1AH4A 4JICA 2LTQC 5BV7H 3H7LA 2RH0A 4LBEA 2QUUA 1FWIC 3LRMA 5GNYA 1TU2B 1JRCA 3RWIB 4BZ2A 3WQVA 4JTEA 1J8SA 3TLRA 2Y8KA 5A2FA 5D9SB 3UBXG 4XCNB 3WLMA 2BZCA 4ZXBB 2VN3A 3B9VA 5DO2C 2EUVA 2GC7C 2XM1A 4H8NA 3TONA 3QUMB 4B7LA 1N9PA 4QYAA 2V2HA 5C0AB 2JALA 4DAIA 5KG9A 4KJQC 4W9GC 4X3ZA 1QZNA 1FAIL 3LSCA 3PFMA 5AHLA 2WXNA 2HX8A 2ICWI 3FYOA 5KVGE 2O30A 3BDYH 4NJAH 3MJYA 3F12B 4K39A 5A3HA 3IU4L 5C9ZA 1SY6H 5IP4A 2AGTA 4CDGC 2M2DA 2FEDC 2CWRA 2EJ1A 3MV8D 4BXSV 2ZUMA 1T6MA 5DZJA 3C5JB 2NW0A 2OO6A 3QQ0A 1Q9WA 4ODBD 1EXBA 2CZ5A 5CUSH 4WGWB 4UOJA 2CAKA 1FG2B 3MZGB 1RJQA 4HEME 1AS8A 4FHBD 4QWWC 4WI4A 2X4TB 4JD4A 2YUZA 2PABA 5ICZA 2Z24A 3HFML 2FB2A 1GKPA 4FABH 1WCBA 3IANA 4QM1A 4W9KC 3VKAA 1MI5B 2FLBT 3IWUA 5SV4A 1F8MA 2I5QA 5U4NA 3BLLA 3QJFB 4ZTXA 3T3ME 4GT7A 4P2AA 4PUBL 4V1DE 4K7PL 1UCTA 2EZ0C 1L5GA 1UWIA 4U6HB 5ABAA 3H8NA 5IFHL 2HZHA 1LQSR 3VFWB 5IKCA 2E5CA 3M0KA 4N9DA 1OCWL 3HGJA 3LGDA 3H9SA 2H5UA 4M8RA 1L7IL 2FUTA 4DWSC 1F86A 3FH7A 5EZJA 5EO9B 3QHZL 5IB5A 1FZKA 3H42L 3NABH 4MA8H 1Q7MA 4IIQB 4LY4A 3DX9A 3QCUH 4FQQA 3KPRD 1UM5L 1EZSA 4Q6YA 5F1NA 5KN5B 2BZ7A 1SSDA 3NOYA 3OV6A 5HULA 5JIIA 3WN5A 3AU2A 3WFCH 4BFGA 5GRJH 5KZMA 1H8LA 4XPFH 3D8MA 5EUOA 2H3NB 1A4BA 3F4VA 5DO8A 4XNDA 1KFBA 1JGEB 2QDGA 3G0UA 1LO0L 3LZLA 2XZCH 5EIIG 5AQ0A 3V16A 3U46B 3PDGA 4PG9B 3UYRH 1HP4A 1MQPA 2YX0A 2ZXDA 5CHNB 1GW0A 3SSJA 2AFNA 4E8CA 2P49B 3MVIA 1AKJB 3QVAA 5K39A 1VLWA 5F1NB 5CPMA 2FBRA 4DERA 5EU3A 3H2FA 4KROD 2ARJB 5HPMA 3UTSD 3S5YA 1OP3K 1PB0A 2RA1A 1W9UA 3RVXC 2X1WL 2CJUH 1VZWA 4JX4A 3L7EA 3WL0A 1TTRA 1X39A 1X9QA 4R7WA 4UUIA 4WY0A 5HWNA 1G94A 2ICCA 5AAMA 1KV3A 4N8UA 5EBWB 4XPGL 4AIEA 4O11A 1SSGA 3TIEB 1OGGA 5D7HA 3F04A 4OKVB 4JO5A 4KKCC 4X0KB 3P0WA 2F19H 5K39B 3MJ9H 4L5FL 4P4RB 2JCCA 4HUKB 1MW0A 4WFEE 4IMAA 3D06A 3W87A 2W63A 2B1AL 3HMXA 2X89D 1OGAE 1HI6B 2PWEA 4ES9A 4KHTL 1CZ1A 3R11A 4FLRA 4UC5A 3P4NB 5L0QC 1S5IH 4L5FH 3GQYA 4D6IA 2WMJA 3QNZB 1RUPH 2NY2C 2J8TA 1KKRA 2ISSA 5F0PB 2QDWA 4HBCL 4IRJD 5HGGS 3QH2A 1PNDA 3FONB 4FYTA 4KHTH 3UXAA 2JK2A 5F6HI 3TWCL 1I3GH 4HU8A 4JB9H 5ICYB 4XVOA 3WCZA 2AK4A 3PGCA 1FX6A 5DMLA 3OQRA 5TPWL 4NHUA 3STZA 3P81A 4I90A 1MLBB 2GTWA 3CXFA 1PDZA 5JXAL 1I3GL 1A4JA 3IDMA 4JRLA 5DS8A 3RIFK 4JM2C 3WKML 3AREA 4P5UA 1W0WB 1LO4H 2ADIA 1GKEA 4JZJA 5CSUA 5ITFA 1CURA 3O9WA 3BUIA 5A1AA 3DO7B 1PZAA 3LD5A 1V0NA 2Y2TA 2ZDSA 4DP0X 4UMAA 1CK0L 2XKNA 4P8QA 3RWJB 4CILA 1J93A 5D1QE 3JUZA 3OXRB 1P6CA 2CG9X 2HNEA 3FCUB 3UETA 3ESNA 3W39B 3BDKA 4GT0A 5EB9A 4R26H 4HUWB 1KEGH 4JPIA 2AXWA 2F0CA 2W59A 3HA0A 1XGQB 4Y8DC 4YXHL 3A9BA 3OG2A 3QRBA 4JM0A 5J6GA 1W1A1 3PJTA 4ZQNA 2NUTB 3FO9A 5EU5A 3MYJB 4GCAA 1VPOL 4OZFG 1C5CL 2I69A 4M1CC 3V0WH 4DPBX 5FB8A 4LRTA 2VL4A 2GIXA 5LBSL 2DZUA 3TBCA 4ORGA 1BJ1J 2QF7A 1F42A 3O41B 3O2DH 4AJ0A 1GZGA 3HPSA 3MRMB 1CLOL 2C9SA 1WOAA 5KSVA 1KJVA 3SGKC 3VIGA 2OO0A 2AF2A 1FVCB 4CNIA 4J3OH 1V6UA 4IGSA 1ADDA 2R39A 2YC1B 1VLXA 4A7SA 3H6JA 2JIWA 3GUTB 4B9ZA 5C0AA 1L6XA 2NDFA 4WFFD 3TMQA 4ANXA 4EAYA 4ZS7H 5EO1B 3E6HA 1T04B 3OMZA 3BGMB 3TJHD 3TX9A 1ZY9A 2ZWZA 3I6KB 1RBOB 1E55A 1DE4B 4NXSA 4B41A 5FF7A 3TZNA 3QKEA 4GNVA 5EC2B 2FATH 4TQHA 5CCHE 3DFPA 3L3IB 3WFLA 3D34A 3GSOA 2AVFA 1Z5YD 5SWSA 3DHDA 2H8PB 3EZ4A 1FGNL 3PREA 4O0ZA 5HQLA 3NJHA 4M6MH 5FYJE 3VGBA 5I76A 4G7FA 3GS7A 2CIPA 2QCDA 4XIMA 5FL1A 4F58L 2GSIB 1TYGA 1EK3A 3M0MA 3R89A 4IGHA 4X6FB 3VRIA 1KJ2B 2OJZH 4L4JA 3HG1D 4Y5VA 1OIMA 3BE7A 2IKIA 4Y6GA 3EFOA 3IS1X 4H5SA 1CDHA 5MENA 3O4LE 1S5HB 3I85A 4MVBD 3BOXA 1HKJA 4ZAKA 1QD0A 5HYSB 1FTXA 5HHMD 1WD9A 4GRWE 5JMUA 2VJXA 1XL9A 2A3AA 2Q20A 3FYYA 3S4SG 3QH3B 4ZUUB 1V6TA 1G5AA 4WK0B 4LV9A 4JDTH 1GW1A 1MXGA 4PB4A 2K4WA 2OSWA 4NKQB 3LD8C 1QOQA 2VFHA 4RISL 4JFEA 3DXAB 1PCKA 2VL5B 2Q3ZA 4U0RB 4Y5VB 2G3XA 5ETUA 3NVDA 5AVNA 5AVSB 1ZTXL 4DTGL 4B97A 4P3CL 3FUHA 4WI3A 3GSXB 5JHMA 4K9EL 4S1RH 3N3EA 2FWUA 3B83A 1B4EA 1XG4A 3NO5A 4LPWA 4WFGE 3HPXA 2HT3D 2WCAA 4M1RA 3OYZA 1WBYB 3QI9B 4HIXH 1F6KA 4N2NA 5I1LB 3V5OA 2FWSA 2PO6D 3OB8A 3N4EA 2NWRA 3F6LA 3IARA 5HGAA 1BGGA 3RMEA 2WVVB 5CZJA 3P3BA 2I85A 5FUCC 1R3SA 4MZ1A 3QZNA 2F84A 1OCOB 5LNRA 1SN5A 2WZTA 1TZ8A 4B3VA 4AVFA 1JYNA 5A2BA 4PMFA 4JRXB 4TXVB 3SUWA 2YJLA 3KPRE 2QS8A 2ABAA 3ZE2F 3MODL 1A7PL 3BHBB 3F01A 3SYQA 3QFJB 1HX0A 4QRQB 1QTWA 3KBJA 2NQCA 5J1TC 1LO3L 1XLGA 3IGAA 4XBGA 4ILDA 4YHIB 1LGVA 2BNRE 2E86A 4LPYA 4HZ7A 4N6EA 4A66A 1B3YA 1EAPB 3CUJA 1E6PA 2BP3A 4GXPA 5HMSA 1SDAB 3ESUF 3MOBH 2WWMD 4JL2A 1EX0A 1CDCA 4H25B 4AV5A 2HG0A 2J7GA 3I75A 4QXGL 3HZKB 2V37A 1BXNA 1JCLA 2YEZB 1L7TL 2A79A 3OBEA 3VIIA 3HC4H 3ZRCC 1BG9A 4Y4FB 5DS1A 4DK6A 3MSRA 2X6VA 3FRPB 4QEGA 5CO1A 5E4IA 1W9VA 4ZMPA 2VWEC 1WGVA 5LWYL 1RVFL 4RE2A 2AL2B 3C2FA 3K6DA 1G1YA 4KCUA 3PHOA 2A2QT 4MJ2A 1X1OA 5J0BA 1ZK5A 5HNTA 5DQJA 1GKOA 4YHEA 3S42A 1U92B 3NH7H 3H0TA 2GC4C 5I71B 2OR8A 2CYGA 2F9BT 5BXFA 1NFBA 1I31A 2HLFD 3L2NA 3P4MA 1ZMYA 3O2DA 4ANWA 1EJWC 2VRQA 1IO4C 1XLAA 2WJZA 3EPOA 5IHHA 4Q4PA 5F96H 3OJVC 4PEKA 5IM51 3PWLB 5IIEA 2NV2A 4WJG3 1AD0B 4N2YA 2E7DA 4E38A 4XH2A 5IHUH 4AVHA 1F74A 2XFFA 3CPRA 1AY1L 4M1GL 3H7RA 1A47A 4RPPA 3QQXA 4BQ3A 1CXIA 4Z7UE 5E8OA 2QCLA 3QLLA 5DQPA 8XIAA 3RE0A 1REIA 3ZTDC 4WK9A 4D1IA 3P4MB 1DXIA 4ZS6C 4HK3N 2AMUA 3MPGA 4L80A 5ILTL 2Z29A 2CLVA 4NO2A 3FSAA 1AQ0A 2UV3A 3ETSA 2VGLM 3KG5A 1CXFA 1S7RA 2CR0A 3MCG1 4N2DA 2EXYD 2BLFA 4HAFA 2AMGA 4HJ0C 4QI3A 4V2BA 3UBXB 4NAQA 4U3AA 1XMWA 1A9VA 3MBEA 2ZCKL 3RYSA 2FJHA 4S3KA 1G7LA 3RFZA 3GEWB 3C2AH 3VI3F 5EIIA 3JW7A 4HCFA 3S2LA 4H8VA 2H8XA 5JHDA 1SM3L 1X96A 4QRUA 3KWTA 3WF3A 3QZMA 3HAEG 3HBGA 1QAPA 3ARWA 3RU8L 2VDRB 4RAUB 3PL6C 1ZEAH 5K33A 4LASL 3II2A 3WEAA 4AUYA 3BH8B 4YWIA 1I8LC 2VFDA 4PUUA 2BCKB 2FYYB 2JQZA 4JTAA 2A3LA 3PWPA 3D0LB 4MXWH 5AW2B 3ZTCC 2F1EA 4J6RL 1AOZA 1ZCCA 3GUFA 3G6AB 4HFUH 3GO1L 1ZEAL 3LKPA 5E2TL 1OEPA 3S2MA 5LNUA 3VFMB 3H2NA 1I8UA 3WIFB 1NDMA 4KTYA 1NANI 1ADSA 2VZOA 5KITA 4HFUL 3K72B 4IOIB 4ESKA 5IJKC 1OX4A 3H23A 1INQB 5IW1B 3CXHJ 3QDMB 3BH8A 2NQLA 3MRRA 2PO6A 4WK4B 4OM0L 3KBVA 4ELDA 5A7BA 3FKRA 3MFGB 5L8LB 4OECA 3R8BB 2BX7A 2YCIX 1XX1A 3KXFE 4G43A 1JNLL 2WYIA 4YDVA 2VDHA 3VFCA 4GSXA 5E00A 4RCAA 3AISA 3I7QA 4PW3A 4HUUA 4JGUA 1DVFA 4WHTA 1TQVA 4K3GA 4AVIA 1Q1JH 5CGBA 5DEJA 2QSTA 4RDYA 1A1OB 2VLKB 4X7FC 2WSKA 3I84A 4RWYL 2DL9A 2VUNA 1TCRB 1CDGA 3VXNB 5HY9B 3IGKA 3RGTA 1Z1WA 4O15A 3PZOA 1G7QB 1IQDB 3WO8A 4PUDA 3DC0A 2VC2H 5I5MA 3SPIA 1XLKA 1FVPA 4AD1A 3VA2C 3W75A 4JTRA 3OKKA 5M95B 4POUB 4F33A 4OBRA 3LCLA 2WMIB 3HA1A 4IPJA 2ZUSA 2ZYFA 1DIOA 1KPVA 4DF9A 1I2OA 3TC7A 3VIFA 2P47B 3WNMA 2N0KA 4KRLB 3CQHA 3WJLA 2WV3A 2WD0A 1V54B 4O50A 4AF0B 4I3GA 4RV8A 5KVFE 2ZKYA 2FL5B 3V10A 2XWXA 1HO4A 1PTZA 3MN8A 5JPNB 3LQLA 4LL9A 4GMTL 3QUMA 3B9KC 5IBLD 2C1OB 2ODHA 4N22A 5DJ0A 2DQWA 1Q90A 3B03A 3DFQA 2XIQA 4OGAD 3PIQB 4RZ6A 4C60A 5FD0A 3IFPA 4LLUA 4NO0B 2NLJA 5HNUA 2D7PA 3NPWA 1KXQE 4PCSA 2VP8A 1CR9L 5LGZA 5GPRA 5RUBA 4YC2C 1Q0YH 1CXEA 3LIZA 3Q6FB 4Z7UF 4HPYL 7FABL 2YPVA 4YAQA 2IMRA 3T3MF 5DMIL 1FBIH 2IC2A 3QK0A 3V6ZA 5M3WA 5T26A 2X6CA 1A14H 5FV1L 4XZ9A 1A3LL 3G6JF 4L4VA 2P8CA 3ABQA 1GQKA 3F00A 5IQMA 1WFJA 2J7CA 1JWMA 5K9XA 4K4KA 2QADB 4JLRA 1DUYB 1RU9H 4J3WA 1AR2A 1SY6A 4QG6A 1W16A 5EOCJ 2DI9A 2QAPA 4J1UA 4FL4C 2VWSA 2FZDA 2HJPA 4F24A 3W7EA 1E1FA 2WPBA 4UNIA 1UP2A 3FB7B 3VFRB 1NOFA 4N0YL 1H3VA 4HJIA 1OM3H 4BE5A 1G9ML 2PN5A 2WMKA 1B0IA 3EYVA 4KWVA 1IT0A 4POCA 3TZVB 3JV6B 4H7CA 3QQDB 4W9DC 1N5YH 3N4AA 4DHLA 2QNEA 4HMNA 1HH9A 1J8KA 4FQPA 1AQDB 2INEA 3NO1A 4ZQMA 4L1LA 3DUSA 1FWTA 2DBLH 3L7FB 4H40A 5D2LA 1W8SA 3GSRA 4DOHE 1XO8A 2C9AA 3WJMB 1DVQA 1MF2L 4NO0D 5BS0B 2CQVA 3R2GA 3HAEH 8FABA 2G3JA 2EIBA 3EX3A 4RRPM 2JI3A 2G5BA 3APNA 2CBJA 3LLDA 3GK8L 4PMOA 1RCYA 1LBFA 3D33A 3S5LA 3M41A 4NIRA 2Z3FA 3L5LA 3QPYA 4NENB 5AUMB 4S0TD 2HTMA 5LNSA 3SCVA 4EDXA 2CO3A 4PP1D 3GIVA 2PFHA 3SCMC 2YJQA 2DQGH 3Q8BA 1FN4A 1RIUH 3F7LA 2F5AH 3EHBB 3OZOA 3MJ7A 4MNMA 1R17A 4UANA 3FCSA 3T4AC 4A2DA 3WJMA 4LCWB 3IVUA 3U2ZA 9XIAA 3M6DA 1F02I 4M8UA 1F6AA 2VE6B 1EWDA 3ZGIA 3KXFD 4JTFA 1LO4L 2R0ZL 1NCWH 1E9LA 3KTXA 3UXFA 2F5AL 4OF7A 5JPMB 2K9UA 1O9VA 5EU3B 3LS5H 1XYZA 2AGJH 2HS6A 4NJJA 2HMID 2YQ3A 2R82A 3QJUB 4NWUH 3NO3A 1Y65A 1E6SM 2ED8A 4LCSA 5GRUL 5DFTA 2XZ9A 1OSEA 2B5IC 1TJGH 5DVLA 2ZX8A 4G7SB 4FEMA 4P57B 3V9EA 5CJNA 5A43C 4YDMA 2V7HA 5I6SA 3WQFA 1RK0B 1BJ1H 4FF9A 4S3DA 4WGKA 1NBCA 3WF0A 4G9DB 1D2PA 3K6SB 5CC6A 1S3HA 4FIQA 4R84A 2PD5A 2CMRL 3ZKSD 2DD8L 3EOSA 4X6DE 2F61A 2A77H 5FUOH 4YSQA 3GWJA 3LCWA 5CHNA 1FL5A 1WCQA 3UYCA 2HYMA 3SZKC 3BKYH 5D7IE 3R8RA 3MLXL 3BPLB 2YBRA 5ICYA 3HV9A 4G1EB 2GFTA 3PZ9A 3ILQD 4QGCA 5IK3B 4RNJA 2IV8A 4XP4L 1QNZH 2BC4B 1VKXB 4XP6H 4OZIE 4JTSA 3VIHA 4X8XA 4IJ3B 4F7CA 5BOJA 1BVKB 4J4PC 1MFCL 6XIAA 2YK1H 3UEQA 3LNEA 4XPBH 1H1ZA 2AKMA 4LCUA 5JHLA 2WB5A 4QUOA 4XP4H 4W4QA 3VC5A 3QJOA 5CAHA 2FH6A 2VDMB 3GHEL 1PL3A 3GRBA 3S4SB 4D9RD 1PS9A 3BD5A 4IJRA 4MKTA 1SW3A 2I1OA 3EYSL 2YXVA 1TQWA 4CRPA 4DEFA 1JRHL 2HPIA 1IC7L 4PWHA 3VXRE 3A4FA 3FJNA 1FH9A 4Q9RL 3BW3A 1IX2A 4X9IA 4LDOB 1MDTA 1FH5H 1D5IH 1FWXA 1HILB 1LROA 3PZMA 5HBBA 3U82B 5TQ2L 1WBHA 1TU2A 2FNBA 3RX7A 1Y6NR 4KJPD 1ZIBA 2VSCA 2FH8A 3C6SA 4LSSH 3ARED 5L2KB 4HAGA 5MEOA 3HLAB 3ZKMC 1GW9A 4JQIH 2DIKA 5DYFA 1AGDA 2QDDA 3D3AA 3WUBA 2WGXA 3FSZA 4B9IA 1E9OB 2WM0A 3OD3A 5C70A 4B5UA 3CN3A 1BKHA 3WSQH 5GJSH 1JCMP 4JGMA 4KTEH 1KFEA 5L9DH 2XIIA 4UTTA 1ET7A 2YA0A 4F9LC 2C6QA 4OZFB 2W95A 4X63A 1EHNA 2J2ZA 1W0WA 2CALA 1AG1O 2P3ZA 3N06B 4MG4A 1TV5A 2H8ZA 3JRKA 1Q0XL 1GQNA 5ACMA 1CPUA 3OC5A 3MV01 4XBMA 4G1MA 1IGML 2VR2A 1M68A 2G41A 4WLCA 1KLGB 1OM9A 1PKLA 3QFDA 3Q3GB 4LU0A 1L6SA 1E6RA 5I1HH 1O6SB 4A2EA 4IIFA 3W83A 5HR7A 5AC4A 5D09A 4GO6B 1XRVA 3P11H 1I1AB 3CZUB 3VRLF 1AYRA 1QO3B 4V1DB 3MO1B 4XBEL 1ND0B 2XTLA 1JGLL 5SWSB 3T2NH 6CGTA 5KG9B 1YPIA 1UWSA 4ZMYA 4CNOA 4MMZA 1O1HA 2UY6A 4L18A 1M05A 3RPMA 2LLEA 1S9XB 2D9CA 3CHCA 4WRHA 4ROQA 4WQ6A 3W1RA 1SLXA 2VDIA 3C52A 3HHSB 3THMH 2KUTA 4TL5A 3SCMA 4MDOA 4X7TB 3IYLW 1F56A 1R7AA 4TNWF 3WLBA 5K7JA 3M7OA 3NABL 4MA8L 4XGZA 4R7DA 1W15A 4DZAA 3PL6D 5ESAB 4CSPA 1HK6A 2QDEA 3P60A 1OAKH 3TZFA 2D3NA 4A8NA 3PAVA 2WNKA 4GYJA 4NSKA 4PGBA 1O9ZA 4BZYA 2V8LA 4GCXA 2WQ8A 2JELH 5KVDE 3VE7A 2BSBA 2ZZUT 3LS9A 1TNMA 1CD9B 5FJJA 2YO3A 3ECVA 3V8OA 4J2PA 2XVBA 1SZGA 3RTQD 3HNTL 3IJYB 2DIEA 1DZ0A 4BSWB 2EXYC 2NQDA 3F6IA 3NIDE 1OWRM 2XT1B 4Q32A 4R27A 1SFHA 5F2MA 3DC8A 3T2LA 4JRXE 2W65A 5K9JH 3QRLA 1T1WB 1RLWA 3MP3A 1SDYA 4JDBA 3U3HA 4KVNL 1XBDA 3RWDB 1EPXA 1OTTC 4ZPTA 2G60H 5CPTA 3HBPA 3NESA 2H3NA 4PTMA 5AB2A 2CZEA 4Q0XL 4DF2A 2P7TA 4WSHA 4K37A 4Y9AA 2BW4A 2NY7L 4GUPB 3CLEL 5EZOH 1T89C 2WXFA 3DYPA 2D7QA 1JXJA 1P9MA 2R69A 3MX0A 4PY8I 5DR5L 2DSUA 3EAUA 1QNRA 5E9XA 3C6LD 4E9XA 2QEZA 3H42H 4DP4X 1F6AB 2VE6A 4MJIE 1AW5A 1I45A 1CLZH 2VW6A 5JXED 5HHVH 1EXUB 1V3KA 1DVUA 2YWZA 2NY5C 3PK7A 1KGWA 1R2RA 1DJGA 4HWUA 3FT2A 3GMPA 3WELA 4DKFL 1GGOA 1KV5A 3RL1B 3M9YA 4LBRA 4L3ED 1XGEA 4PP1C 3TOYA 3QEHB 1MCSA 1G7JA 1SFTA 1SF3A 3MX0B 1T22A 4B9FA 5L7XL 1GJWA 4E3VA 5GRXG 4XBGB 1ONQB 3CV5A 4UT7H 4DKEL 2C7FA 3PPEA 3PQYA 3PWVA 4FNRA 5DJ8A 2NDGA 1E2VA 1MI5A 3IT8D 4OUUA 1T2QL 2GPZA 1EJ6A 2XWCA 3C8FA 4LEQA 1F90L 3O6KH 3UJIL 2YRBA 3EBIA 3DFOA 1H1NA 3D48R 4JFPB 1Z6JT 1ZTMA 2FB4L 2YGQA 3I75B 1OHLA 5GGUB 2H41A 4UWMA 2CO1A 2YSSA 1JPTL 3NCFB 1XGRA 2FD6L 4L4TB 4XHJC 2QQNL 3ZKNC 1W3HA 2OELA 5EGRA 2QFPA 4LCCB 5HGAB 2UBPC 4JFSA 3MBXL 3PWVB 3ZUCA 4CQ9A 1J8HE 5AL8A 2YOAA 2BSSB 1LEIA 1FWRA 2YD8A 2UZPA 1L4IA 5KN5A 1F5WA 1SXBA 3MRNA 3QDJA 1WBXA 1M3IA 3BHBA 3FQNA 2V2XA 3MOAH 2ITCA 1F3WA 3L3HA 5C0JB 1RP8A 3MYOA 1T1YA 5CZRA 2VLJB 3S98A 4O1DA 4RZ5A 5CEXA 1GH7A 4WI6A 5BU6A 4HHAA 3UTQB 2GG1A 3UNTA 3V35A 2EDKA 3W53A 2HJLB 4QRSA 1K8DB 3D2UA 5AEAA 3DRQA 5FOJA 4QRRE 3KPQA 2A6IB 1VBHA 3QN3A 1ZVSA 1UM4H 2O0TA 4PJFA 5CMAB 1LYQA 3RR1A 2YPIA 2VYRE 4APXB 5FUZH 3CVHL 3GMQA 3V6OE 4PGJA 3AREB 5CAYB 1KB5H 5CS7A 4Q2ZB 5K69A 1ILUA 1NSNL 1U1HA 5G4WA 3RNKA 2HKFL 4KPHL 3MC5A 3CZJA 3FO2B 4FXGC 2C4FT 3WU1A 2UZ9A 2YA1A 3LKOA 1EQCA 3MV7B 4JAWA 3MGAA 1ZGLP 2HJFB 1BEYL 2OTUB 5AZEL 5SX5K 3QIUA 4NN7B 4FEIA 4G6JH 4Y19A 4ACTA 5KSVB 1HKKA 1TPH1 1B0RB 3ARPA 4XNMB 1EHLH 3EOTH 4ZUSB 4Y89A 2OZ0A 3N44F 2Z31D 4PLJD 4PEEA 3VXRD 3QULB 1W9PA 4N28A 2DDQL 4RDWA 1MFDH 1CW2A 2AXFB 2DTSA 5DUBB 1A3WA 4R53A 1PZCA 2NY3B 5F88B 3BGMA 3MQIA 2EC8A 3ZKMD 2ZRWA 2VO5A 3ZW3A 2G5UA 5KEZA 4N4QA 4Z08A 3MY9A 2WV8A 3ITGA 5J13C 1I7ZB 1UWEH 4NGHL 5HI3C 4RAUA 1DE4A 4WCYH 1U8CA 4M62L 4IRZA 3VXQB 3S37H 4AYID 4W70A 2OMWA 1JN6A 1U42A 3AG3B 3FT4B 4WEEA 3K30A 3RLGA 2FEEL 4S3AA 1KF9B 1U8JA 1MVUB 2K6YA 3HG5A 4FCAA 5DS8B 3TBYB 4ADJA 2J6EA 5CD3A 3LKPB 4MTVA 5HQMA 1WA3A 3ARDA 1VFTA 4FNUA 4M3KB 4L0ZA 1W80A 3ZKXC 2P0IA 4KKAC 4ZS7L 2BY0A 2K78A 3LTVA 3CFBA 3GNPA 3TMLA 3GC2A 4HIIB 1F1AA 1MG2C 5ESVB 1OX4B 1HZYA 4HXBH 3F7VA 4HX1B 1NUGA 1UUQA 3HW7A 1DQLL 3MRRB 5L2JB 4MNGA 3DGCR 3QUMH 1IXPA 4FDWA 1XGQA 3C09B 5B1JC 5G55A 1UYWL 2VC7A 1HJVA 3FIGA 5A6AA 1I7TA 2V5DA 5C2CA 2O5NA 4XP9H 3R4DA 4DJEA 3ILPA 1FHVA 3RX8A 3P0GB 1RY8A 2JGQA 3NN8A 4M6ML 1V02E 4V28A 4JHBA 4IG2B 4ADTA 4G5AA 2IANE 3MYZA 3QO1B 5IBLC 3KAOA 2X5PA 4PJCB 3J7HA 1NCAL 5AW1B 3WKQA 1NKRA 5E5UB 3UWWA 3GIPA 3S3GA 2P80D 3LQAH 3WLIA 2DQIH 3SI9A 1CN4A 2WIMA 4CD5A 4P3DB 4TF4A 5KBDA 2DM3A 3QQ3B 1ZD6A 2A6JB 1NCAH 4O9HH 1W54A 3EBGA 4AY1A 3GC4A 4UTFA 1DVFC 4P4KB 4PJ5D 4RFNC 4BDVA 3I7RA 3BMVA 5IKCB 3QEUB 4Q8MA 5G2WA 4R9XA 4GKTA 4Z1CA 1A7RL 4GQRA 4NHCH 4FZEH 4BZ2H 3X14A 3IDGA 1MDAA 4HUCA 5D1ZC 4F4RA 3VFLA 3DI3B 3P77B 4GKZB 2E9MA 4ZO9A 1ITUA 1BVNP 1WA1X 1X5YA 4IMLA 3OM3B 1YO4A 4NHCL 4BZ2L 2BVDA 4BKNA 5AC7A 1R9ZA 5D71L 2EE3A 2C18A 5B39B 4HZLA 2WLIB 2X3CA 1KYUA 5H37G 3ULSA 3BRDA 2W60A 4GGBA 4KCWA 4QE1A 3VUAA 2F2HA 4O28A 4AZ7A 1AO7B 3OX8B 1CJYA 5IVXF 1JGEA 1KBGL 1H41A 2I07A 1CE1H 2Z7UA 4M7LH 1C9WA 1FZMB 4RW5A 4EPEC 1C1EL 3N40P 5C0DA 1TO3A 2QEJA 3PV6B 5FKPB 4DN3L 4R2GB 3S96B 1ONQA 4X0VA 5I09A 1BZ7B 1GZQA 4XVJL 4JGNA 2VO8A 2J7LA 2TSAA 4LBAA 3VTTA 1EEZB 2DV6A 3N18A 1LK2B 4XBSA 1FIEA 1XL4A 1KEML 4U28A 1J05A 4O2FB 4RKAA 1BIHA 3DMMD 1ZL1A 4XVJH 4NCC1 2VXUL 5A3IC 4QG9A 4HMEA 2OXGB 4HJJL 5FF4A 4EK7A 3SDAB 1SHMA 1NCWL 5C0DB 4HUXB 5IREA 1KFKA 1ZBVA 5FAJA 4B5EA 1J8RA 4XO9A 1JNEA 2R1YB 1EA0A 1NWTA 4E41D 1ESOA 5IVXA 3TJEL 3IAGC 4K94L 4UCFA 2WZ5A 3MOBL 3QRGL 2CNYA 2VT0A 4DGYL 3ARFC 1JNJA 4GC3A 4KMTH 3S9DB 2EDJA 1C08B 2VDKH 3NCXA 5ENLA 1WBYA 3VJ6A 2YGPA 3QQDA 1M7IA 3IN2A 3RB7A 4IJCA 3FCTA 2D4DA 1XLEA 4NQVA 1G9EA 3RX5A 3NGBC 4FQHB 1PWLA 4ACYA 4BI6A 4IH3A 1QVOB 3P30H 3HV8A 3LHWA 3BV7A 4PBDA 1YVLA 3NZ1A 4W81A 2GQHA 6ENLA 3DIVA 3JV0A 1K3UA 2X4UA 2EDMA 3ILDA 5D7IB 2CLRB 2OGYA 3GDRA 3MJ8A 4NRSA 4ZENA 5LZLA 1VESA 3WAJA 4OI7A 4HJ1A 3RJDA 2PTUA 1S5MA 3T6QC 3TV3L 3WNJA 3VD1A 3O2VH 1HUVA 2AJYL 3LYRA 1S3RA 3QEQD 1FGVH 4LMQE 1KTDA 3I6GB 5DEGA 2OZ4A 3T1WA 1J96A 1Q6DA 5AC5A 2V69A 5K1VA 1OFQA 1CMOA 3RI5F 3ESMA 3SQSA 1UZHA 1HHKB 1ITXA 1EZVX 2WQUA 3AU1A 3QDGE 3VE0A 1N6QH 3U25A 1AW2A 4A68A 3GM8A 1DANT 2FYVA 4E68A 2IAMB 3L0KA 3LNPA 2FDBP 1NQ6A 4HT3A 1KJ3H 2R0KH 1MCIA 5DY2A 5FCUH 5CC5A 1OGPA 3TZVA 3ILQC 3CVCA 3UIZA 3BRFA 2G2NA 4M5ZL 3UAJD 5DGRA 1ACZA 2ERJC 3WTVA 2NY4C 4JM2A 1KJ3L 2R0KL 1G6RB 2X9YA 3JWNE 3EFDH 4H8HA 1J2WA 2D22A 3KWXA 4OZOA 4UAOC 5IVZA 4XUGA 2EUZA 4Z7QB 4CQDA 1MVFA 4N90E 1JRBA 4L9ZA 5BRPA 3NXFA 4KKLD 3U9PL 3LDBB 2V3FA 4UIKH 5PAZA 3SKNB 2GJJA 2D2JA 3K2GA 3ZDXE 3QSTA 3DV4B 3UERA 5I0ZA 1C9SA 1XWYA 1VHCA 4O1AA 1DHKA 1OALA 3SQMA 3VUSA 4Z1YA 2ZA1A 3MUIA 1X6LA 4KMLB 4U6TA 1Q9KA 4UIKL 4DZHA 4O4YH 3BI9X 3FN9A 2O5ZH 3OLEA 4LNRA 4EUPA 3NCJL 1E5BA 5B1AB 3MRBB 3ZDXB 4IQJA 4A55A 5TDOB 1WIPA 4K3ZA 4N7QA 4S23A 4XPHH 1TWZA 3LHVA 3MWCA 2YMTA 2TPSA 2Z1WA 3V0EA 4LS2A 4WFFE 3NA8A 3CLFH 2HLFC 1N0LA 4Q8WA 2XWZA 2V5RA 1BD2D 1A7QH 2A9DA 2FQEA 1PG7W 3OAWA 4RZCA 5EU7C 3DU0A 1ZKAA 3QBTB 4Z2HA 1GOGA 3CHQA 1XF3B 1KIQB 3D69B 4OB5H 4YE4H 2XFWA 5T3ZD 1EAQA 3FQXA 3IGXA 1T5KA 4BEQA 3S2JA 3BLOA 4YGVA 1UZDA 4AQOA 3PUDA 5KJ7E 2V82A 4JFVA 5C08A 3QO1A 3PF3A 3IDJB 3USZA 5I3IA 4Q56A 4Y2DD 4IBUA 3OZ9H 5JXEC 1YN7B 3CL8A 4X6EB 3LKQA 1A49A 1MHPH 4KI5F 4Z7OB 2PBGA 2PPGA 4Z7NB 5FA3B 2XUCA 4BZ1L 4HA0A 4QLRA 4RMSA 5AKQA 4F3HA 3QH3A 4JZNA 1W72B 5DMMA 2AQ3A 4PJFE 3ARGB 4BYHA 2PTYA 3ULUD 5LHFA 4GVIA 1W5MA 2CD0A 3VWJC 4BSJA 3N6JA 1OPGH 4PJXE 5ID0B 2DQHH 1VAHA 5C0AE 1L7IH 1QI2A 3F5KA 5FESA 4MDJB 1O0VA 3MT1A 1LG1A 2MTPA 3UWYA 2N7SA 7FABH 2COQA 2VMCA 3S6DA 3O81A 1I1YA 3GDKA 4S3FA 1R8LA 2X28A 4DVBA 5IDZA 3THQA 1Q72H 4LCYB 3AMDA 4TX9A 3W7DA 2F53B 3FSUA 4HK6A 1CL7I 3S4SA 3BKMH 2DAVA 1P4IH 3QCTL 5FKAB 1F5ZA 1JDCA 4NAMA 3RUGA 4MJ5B 4BHUA 2I57A 4QCIA 4RGND 5K9KA 1AYOA 4E9QA 4BCEA 2NCMA 4EUPH 2KDGA 3KRBA 1YNKH 2IDUA 1JCKA 3RUGF 3GYEA 4BK5C 5JMRA 4AE0A 3KBHE 1WWCA 1C9DA 2C1PA 3MTRA 2IS7A 1EXGA 2J6WA 4RAVB 1N5YL 3P5YA 4E2DA 3G5WA 3EX6A 3GHPA 4GS7C 4O18A 2WXPA 2G8ZA 1BXXA 2XTJD 4IHBA 4P5TA 1OEZW 4DKFH 1HIZA 3LN5A 1FDLL 1Z0MA 2GTQA 3MZNA 2L04A 5I6PA 4JJOA 4YDIH 2Z0IA 3GTXA 4UNLA 5D2TA 5AHIA 1KRCC 2PTTA 4B2DD 4PFEA 2BSLA 4EXBA 2D03L 4LOUC 1IEVA 3FUJA 3GK8H 5I0DA 4AV0A 2ZAGA 3M07A 5B4MC 3NL2A 3EEGA 4F15B 3FU9A 3PWGA 1COBA 1L0YA 1OSPL 1S5IL 3B9AA 2XZCL 4X6CE 3CIVA 2W0KA 4IF2A 4CEUC 3GSWA 2SEBA 3HG2A 5CKGA 4ZNEE 4OUIA 2HB0A 4NOFA 1U21A 4N4YB 5DTFB 1OARL 2EILB 1GR7A 4U1JB 2NW3B 4L61A 4E8GA 2BJML 2PPFA 3MI2A 4M29A 3W5NA 3MQTA 1T1WA 3TEUA 1JK8A 3S34H 1NLBL 2R0ZH 3CAKA 1V77A 2B7OA 2HFEB 2CJUL 3ZO9A 1RJLB 4J3XA 1K5WA 2C79A 3BIKB 5E6IA 1RXLA 2G3ZA 3N0AA 1DJQA 3WFZA 4QLKA 1Q2RA 2LAAA 2RALA 3C5XA 3IE4A 3S5ZA 4ADIA 4NO5B 4H26A 1N3NA 5HGDA 4V2XA 1VR6A 2G2PA 2XTSA 4P5MA 1CYXA 3MUY1 2Q8XA 2BOGX 2Y06H 2XWEA 3MA9L 2KT6A 3X1GA 2HFEA 1ACYH 3D3VA 4P04A 5F7LB 3SUSA 3FN3A 1KENH 2GGIA 3WUFA 2NW2A 5FUCE 2E6FA 3X13B 1Z48A 4OHQA 4ADUA 4Y1AE 2EDBA 5F7MC 3MA9H 2EXWC 4AYBA 1DQJB 5D6DC 3T08A 1ACYL 4KZEL 3F58L 3OMIB 1T5AA 2IWGA 3GT6A 4UQDA 3CWOX 5G2HA 2AJXL 2EO7A 1BGXL 2HRLA 3W74A 2FJHB 5LA0A 1ZSXA 3MRFA 4K8RC 1WO2A 1JWUB 1QNZL 1Y18A 3QC6X 1N70A 4QAMB 3N3MA 3W1AA 3M1BB 3FLUA 4FA3A 1Q2SA 5KANI 1SO4A 5KTLA 3K3QA 4HCRH 3UTZA 3V6BR 3WMLA 5E94B 3G1HA 3ZVHB 3WG7B 4GP8B 1HXYA 5ESQB 3L9CA 1KJMA 1PY9A 6PCYA 4MY9A 3IBOA 4EN2A 3NYKA 3QR3A 3DKJA 3QR2A 5AW7B 1I8JA 1KGCE 2NY5H 1YEDA 2VDQH 2FEJA 4FS0A 2BS71 1NC2A 1BVKA 4NIKB 1D7KA 4TVPE 4AIZB 3VFMA 2YGYA 3FO1B 1QFOA 3HMXL 1MDLA 1OFAA 3OKNA 1H15A 3Q45A 5FOOA 2QTVA 4PS8A 1BQUA 5T3XE 2Z1PA 4NKIH 1E6OH 2JF1A 6REQA 3QDMA 1K4DA 1FL5B 1NC4D 2X1QA 4AKPA 1I1XA 1TPDA 3N15A 4KESA 3O2DL 1YMHA 2UWEB 4M5PA 1YY9D 1VGKB 3AB0B 5G4MA 3G08B 4X6EA 1X1NA 2WJFA 4I87A 3ZQWA 2JB6B 4PS7A 2X1SA 4GFSA 3S8HA 3QV6A 2AV1B 5B3NA 4MVAA 1VGAA 2J7EA 2PEVA 1UQYA 4H9XA 3LCHA 3IGSA 3P67A 4IRJC 4L29B 3UGUA 4PGCA 2V2DA 1NBQA 3QJSB 1IXOA 1NJJA 3ZOAA 1KO0A 2WHMA 5C92A 4F8PA 3QMRA 5G5IA 3W9DA 2PDNA 4QHNB 3GPEA 5EBLA 4YEEA 2CXGA 3ANYA 1UD5A 2K0RA 4IZGA 3HS9A 3CHPA 3LHPH 1T41A 4HJWA 3S1XA 3WH5A 3DK2A 2ACSA 4Q74A 1PVHA 4G5DA 3VKKA 4RUBA 1AO7E 2WYZA 1SFSA 2I9LB 5E95B 1B1YA 3M5VA 3VXSB 5DRCA 3SZ6A 3RF9A 4JJ5B 4KRNA 3KYNB 1A9BA 3NTYA 1KOAA 4I5BA 3W9DB 2BC4A 1VKXA 1YNTA 2XVGA 3F7YA 2Y7EA 1JN6B 4B5ZA 1C8PA 4GBDA 4GZIA 5CMAA 4KCVA 4OZ4A 3PG2A 4K15A 2WZPA 3P82A 1BFVH 3MUGA 4KOBA 2QPSA 4ILSA 2C3GA 3K91A 4G8EA 1N19A 4QHUA 4ZQKB 1VYPX 3LGGA 1QEXA 2HPTA 5GGQH 2IW0A 4ZS6D 4KFZC 3O05A 2B0SL 1FFQA 3B2UC 4N2HA 4PJGA 2X2IA 3MNWB 1TG8A 2J5LB 5IHLB 4QP0A 1IIKA 1IGMH 4JVPA 4Y1SA 4YWGL 5GRWA 1S7SB 3PY9A 1XXFC 3MYPA 1LDPL 4KTGA 5DK2B 4M5SA 3CAQA 1HKLH 4GQ9L 4EUPG 4YBLB 4JQVC 5I8OL 1KRAC 3MMDA 4S39A 1RLBA 3BFOA 2ZTKA 1TZIA 1G01A 1M9SA 2EVGA 3L54A 5EFFA 3ZPDA 2IMMA 3T65B 4EWJA 4DH2A 4IHOA 5B3JF 1K3IA 1MAJA 1EMTL 5LCVL 1IKNC 4Q0XH 5CJOL 2CC0A 3D3VD 4MD0B 5ABDE 3KBWA 4K73A 1TQCC 2I5GA 3KYOA 3R0DA 3EDJA 4MA1C 2WXJA 1J1OH 5I6XC 4KKBD 5LBGA 3EXLA 1EA9C 3SDCC 5B1JA 3WE1A 1WKYA 2VN5A 2Y8UA 3PDOA 4KTDL 3VD0A 4UTBH 2JELL 2VR5A 1X4ZA 4WUUB 3CFBB 4PJ5B 4AISA 4DJDD 4XXWC 3DUSB 2HFGH 3SJ3A 1EUNA 4G8FA 4UB9A 1ZP4A 1UM5H 3CJJA 3RGBA 3VCLB 1IGWA 1LD9A 1XEUA 4P23B 5GHWH 4IUGA 3DXAD 2NY6C 4IICA 1DBMH 4HWEL 3RVXD 1E6ZA 2G5BB 2HK1A 5E8NB 3AU6A 5K9JL 1FQ0A 2PCFA 3AALA 4XWOC 4G8GE 1I0BA 2JKRM 1ZLVH 4MUPA 3BYYA 1B6UA 5GHWL 1H0IA 4X61A 1WSST 1MEXH 5H4YA 3TXAA 3V5DA 2PP3A 1TZGL 3GDTA 3GKAA 4C5YA 4ZSOE 4PJ5A 4O51A 2LVCA 2NW2B 5AOZA 3I50L 2I07B 4HWBA 2A7NA 4YDNA 3ZLQC 3GI8L 4EI5C 4Z1PA 1NCCH 4Y19E 5I5IA 1I2NA 1SBBA 3QDGB 5D7JA 1CD8A 3II1A 5KSAD 3WGUB 3P3UA 1NEYA 2GAZA 3NSNA 4JQAA 3M44A 4JY9A 2WO5A 4WJXA 3GI8H 5F70A 3O3EB 4DGVH 1BZOA 2BOBA 4PYSA 4A21A 3IRPX 2NR6D 1PGRB 3QWRA 4LF1A 3GEFA 4AIUA 4IIDA 4UTWC 4BUGA 2TSYA 3PWUB 2WZEA 1AJ7L 4NNAA 1G7JB 2ZOXA 3IJYA 3GB7B 4D72A 1WGOA 2F5BH 4ORMA 2X4OB 2ZRYA 4XK2A 4N2BA 3F3HA 3AQYA 3LVTA 4KKZA 4AD2A 1FCUA 4LPTA 2OU4A 4HCGA 1Z3GL 2I26N 3QHOA 3PBUA 5C0ND 3L7RA 4KO7A 2IBGA 3MAWA 3RDTC 7REQA 4C6DA 3BE1L 5F0LB 4QROA 2HKAA 4L23A 1YEKH 4APQC 4MXWL 3KGTA 1PLAA 4WO0A 4OIIH 2G3NA 1KFCA 3ANVA 2FJGB 3F5LA 3RLHA 2QQKH 4TV6A 4ZQTA 3EH2A 2Y61A 2B4CH 1YC7A 4JFDD 3G6JE 4J8QA 4OQTA 2ICWB 3MBWA 1KULA 3CSYA 1JGVL 4EPDC 1MJJA 2WQXA 5FLUA 3WLWC 2JB6A 3U0WH 2ZCKH 3C6LC 1SRDA 2OLDA 3WE6B 5CJMA 3NPXA 4RMQA 1X4YA 3JWNH 4Z7IA 1G84A 2HT3C 3VB8A 1LL1A 2FO1A 4FTDA 2IO5A 2JF6A 4FQLH 3NK3A 4BFJA 1R3KB 1KT2B 3EX2A 3HPJB 4B0MB 1MYRA 1F6LL 4M19A 4PUJA 2Y4SA 4R4ND 2UWEE 2XQBH 3NPSB 5I82A 4BQCA 1RBAA 1UWAA 4JN1L 1KEGL 3GSMA 2KYIA 4ETYA 3GUGA 3I6EA 4M7LT 4OD2B 2OPJA 1GGUA 2QZ5A 4EVZA 2CWNA 1TX2A 3KZPA 4Y9NA 4ZUSA 1UR2A 4MMZC 4O0KA 2I9EA 1LLOA 4LLVA 4F37K 3LKRB 3GI9L 1NWRA 2DSZA 3KE0A 2G9HB 3QEQA 2VXNA 5F88A 4V27A 1IBYA 3OZMA 2D7MA 4XMWA 2WKLA 5E1QA 2NXZD 4PJEB 2V17L 3H3BC 5AOIA 3SDYH 2QGDA 3LNFA 1H49A 1U8PB 3JS3A 4H44C 5C07D 4HGKC 1KFAL 4I5BB 2OMWB 1SDDB 4RESB 3QUYC 1O5RA 1W37A 3TJLA 5I3FA 1IAMA 1CDUA 3EH1A 3QDJB 1TR9A 1LDSA 2JB5L 3GJFB 4E9TA 5AHNA 2EIZB 2GK2A 3GE7A 3ITCA 3UPWA 4JN6A 1RJYA 3NA9L 4LP4A 1KV8A 1MWAH 4OCYL 3A3HA 1J9RA 1KCLA 1DJHA 3TNOA 1WT5C 3ARBA 2VQTA 4YK4C 2BP8B 4ZOCA 5HK4A 1YKWA 2ZUNA 3WNKA 1AXTL 3KPNA 4UTTC 3DXAE 2QCDB 2O1AA 5INCB 3BQUC 3TR9A 2NY1B 2YZ8A 1PTDA 3APGA 1EEXA 1ZQ5A 3L45A 2FMNA 3TW7A 5JW4R 4JJHA 3RWCB 3U6XS 2VOMA 1FVCA 4KI5C 1FNEB 4CNIB 3O3BA 4LEXH 4PJHA 1XCXA 3RJOA 3UMTA 2VDLH 3TFKD 2DVTA 4E4UA 2UXTA 5FO7A 5C0RH 5JIQA 1KYAA 3E96A 3DDMA 4ORIA 4PRWA 4QNPE 3GW3A 5E1AA 5DELA 3QA3A 2PLKA 2VVSA 3U7VA 3IJ8A 4IOFC 4ENZA 3BPCB 1DQQB 2R29H 3VW3H 2DUXA 4FXRA 2IPUK 1HQRA 4ZFGH 4GKLA 4K07A