1AVEA

Crystal structure of hen egg-white apo-avidin in relation to its thermal stability properties
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
b'KCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIDIN
publication title Crystal structure of apo-avidin from hen egg-white.
pubmed rcsb
source organism Gallus gallus
molecule tags Biotin-binding protein
total genus 23
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1aveA00
4GJSA 2MF6A 1VWGB 1SWFA 3RDQA 4BX5A 2RTGB 1AVEA 3T2XA 1SRIA 1SLFB 2RTJA 4JO6A 1SWSA 2RTRB 2A5BA 2Y32A 1SWQA 1VWIB 3RDMA 2RTPB 1SWOA 2C1QA 1KL4A 1VWPB 2BC3A 1LCWA 2IZFB 1MOYA 1VWEB 1AVDA 4CPIA 1DF8A 1KL3A 3WZPA 2A5CA 4DNEA 2RTLA 1STRB 1VWDB 2IZKA 2RTMA 4GD9A 2CAMA 4Z2VA 2RTIB 4GJVA 1N4JA 4CPHB 2JGSA 1KFFA 3FDCA 4Z6JA 2OF8A 2A8GA 4CPFA 3SZJA 2RTBB 4BX6A 3T6FA 1I9HA 1HXZA 1RXHA 5K68A 3X00A 1RSUB 2OF9A 1SWUA 5L3YA 1N9YA 2F01A 2RTEB 4Z28A 1SWJA 3VHIA 4IRWA 1N9MA 1SLGB 1SWTA 2OFBA 2WPUA 3RY2A 1VWJB 3T6LA 3WZNA 4EKVA 2G5LA 2IZLB 1MK5A 1VWRB 3RY1A 2QCBA 2ZSCA 3VHMA 2RTCB 2RTQB 1SWBA 2Y3EA 1MM9A 4GDAA 4JNJA 3SZHA 2OFAA 1N7YA 5B5FA 3EW2A 2IZEB 3RE6A 1RXJA 1VWHB 4CPEA 3WYQA 1SWHA 2RTHB 1NBXA 1VWMB 1VWOB 4BX7B 5CSEA 2GH7A 1SWKA 3VGWA 3RDUA 1STPA 4OKAA 1SLDB 3WZOA 5JD2A 4Y5DA 1VWNB 5F2BA 2IZHB 1LCVA 3MM0A 1SRGA 4GGRA 4BCSA 1NQMA 4U46A 3T2WA 2RTNB 1RSTB 1SWRA 1SWPA 1Y52X 2Y3FA 1VWAB 3MG5A 4Z2PA 2RTAA 1STSB 3RDXA 4BX5B 2RTFB 3PK2A 1VYOA 1SWNA 4CPHA 2IZBA 4Z27A 1NDJA 1RAVA 4BJ8A 4GGZA 1LCZA 1SREA 1SRHA 5K67A 1VWBB 2C4IA 1SWCA 1NC9A 1PTSA 4Y59A 3WYPA 1HY2A 1VWFB 1LUQA 2RTDB 2FHLA 3EW1A 1VWCB 2UYWA 1SLEB 1VWQB 1VWKB 1SWLA 2FHNX 2UZ2A 3RDSA 3WZQA 5IRAA 1SWGA 1SWEA 2IZJA 1Y55X 2IZDB 1HXLA 1MEPA 2IZIA 1SWAA 2RTKA 5B5GA 4GGTA 3SZIA 5CHKA 2IZGB 4BX6B 1KL5A 1RXKA 2IZCB 5IRUA 1LDOA 5IRWA 3VHHA 4BX7A 1Y53X 2IZAA 2AVIA 1SRFA 3RE5A 1LDQA 2RTOB 1VWLB 1IJ8A 1SRJA 1LELA 1SWDA 3RDOA 4BBOA 4I60A 4JHQA 4YVBA 4Z2OA 1WBIA 1NQNA 2C1SA 1N43A 1HQQA
chains in the Genus database with same CATH superfamily
1TOUA 2KD2A 1GGLA 3BY0A 1VWGB 4IMNA 1SWFA 3BS2A 4CDCA 2WEWA 1PEEA 1AVEA 1OBQA 1EIIA 2AKQA 1BBPA 1SRIA 2CM9A 4O3YA 2AT8X 2Q2MA 1BJ7A 2RTRB 1FE3A 3CBSA 4NNTA 1SY1A 4EFGA 3ZW0B 3WXQA 4MIRA 3NQKA 1PM1X 4TKJA 2RTPB 1SWOA 5LJCA 4I3DA 3S5XA 2IZFB 3B2KA 1VWEB 1I78A 2X56A 4CDDA 3WZPA 1KT3A 3FELA 5HZ8A 2FGSA 2F73A 1GM6A 5KICA 3HOEA 1ERXA 5EEEA 1STRB 1KT4A 4Z2VA 1ACDA 4OMWA 4XMGA 1JV4A 1LICA 1SXYA 3STMX 4ARHA 4ZGFA 2Q9SA 3IFBA 1G7NA 4EDEA 2NP1A 3EMMA 2Q4NA 3D96A 3VE2A 4BVMA 1YWBA 2WQ9A 4BX6A 1PBOA 3FR2A 1HXZA 1RXHA 1D3SA 1TVQA 2A13A 3X00A 2JW1A 4XMHA 1GX9A 2OY8A 5HCEC 2WUTA 4OMXA 1SWJA 4CDEA 1CBQA 4AZMA 3B2JA 1A3YA 2JOZA 4EKVA 2F09A 1E2TA 4JGLA 1VWRB 2X55A 4MVIA 5AJBA 3ZWEA 2AT6X 3VHMA 1B4MA 2HLVA 3EBWA 2GTLO 2W2FA 2Y3EA 1MM9A 4AZPA 5B3MO 3PK2A 2KTDA 4JNJA 2OZQA 3SZHA 1B0OA 4GU8A 2IZEB 1RXJA 2QO4A 1OPBA 1ZRYA 2X4MA 4LZVA 2AT5X 5L8IA 5B2AO 3I17A 4ZCBA 3TGAA 2BS5A 4NNSA 1VWOB 4AZQA 4BX7B 4DQ3A 4NW4A 3C77X 3HWDA 1I05A 4IMOA 3VG5A 1STPA 5BVSA 5D4AA 1HMTA 1R0UA 4ORUA 1AQBA 2OYBO 2IZHB 1JYJA 4GGRA 4BCSA 2M4LA 1FJ1E 4Z2OA 4O49A 1GX8A 2GTLM 1SWPA 3PEDA 3ZZVA 1Y52X 2Y3FA 2FKGA 1VWAB 1X8PA 3VPJE 1KT7A 3OBLA 4QZTA 3RDXA 1QQSA 1LIEA 1VYOA 2A2GA 3S5VA 4GH7A 1GKAB 2CM4A 4O4OA 2X8TA 4INNA 1LIFA 3ZUOA 4CPHA 4GGZA 1LCZA 1NGLA 4ZHFA 1SREA 2CBSA 2HZRA 5IXGA 5LJHA 4TJZA 5FQ7E 1HBPA 2FWVA 2BHVA 1WUBA 2ZAGA 1U0XA 4C5PA 1QY0A 1HY2A 3FA9A 4TKBA 5HZ5A 1I06A 4YMYA 1CBSA 3D9WA 2ZAIA 1A18A 1QABE 3EBKA 4YDAA 3GE2A 5H9NA 3K3LA 2RCQA 5F6BA 3RZYA 4CSBA 2UZ2A 2W2BA 3PQSA 3WZQA 5IRAA 3VG3A 2R73A 1EPBA 3RKGA 2IZIA 2RTKA 1GT5A 1XCAA 1KT6A 4GGTA 5B5GA 3WJDA 5CHKA 3S26A 2IZGB 4ES7A 2JU3A 2R74A 1AB0A 1K24A 5H9LA 4IB6A 5EPQA 5IO6A 4WFUA 3HOLA 3UAQA 4KH8A 1LKEA 4GDZA 1CBIA 1SWDA 1NP4A 1HN2A 2LA7A 1X8UA 2L5PA 4I60A 4JHQA 4YKMA 4BQUA 2RD7C 3CR6A 4AZNA 4AZOA 5CYBA 4IB7A 1HQQA 3RDMA 3ZQ3A 3MVFA 1VYFA 4QNIA 4GJSA 4ORSA 4Y0SA 3OD9A 2RTGB 1ZNDA 5AQ6A 1DZMA 4ZFXA 5FENA 3VG7A 5B10O 4COTA 2VDFA 1SWSA 4YFQA 2A5BA 2RA6A 3B2HA 1SWQA 3FIDA 1KQXA 3ELXA 4RUUA 4YKOA 3TGBA 1AVGI 3JSQA 2P8GA 2BC3A 4GK9A 5JR8A 4QGXA 4YCHA 1KL3A 4FBOA 2YG2A 4WFVA 3WBGA 2A5CA 2OVDA 3PH6A 3MX7A 3ZW2A 1EUOA 2KT4B 3FW5A 4NLIA 4DNEA 2RTLA 3C76X 3WJGA 2IZKA 2RTMA 1ZNGA 4HWMA 4OELA 3PP6A 4QYNA 5KHPA 5LJKA 4ZHDA 1N4JA 4AYHA 2JGSA 4EEJA 2NNQA 1P6PA 4UU2A 1D2UA 1PBYA 2A8GA 4MVKA 1HBQA 4CPFA 1JMZA 3T6FA 1I9HA 1X71A 3NQ9A 1RSUB 2BT9A 3U03A 4ZHCA 5L3YA 1I04A 2G79A 2RTEB 3PECA 4Z28A 1BLRA 3FA6A 3VHIA 1E06A 4IRWA 1N9MA 1JYDA 2WPUA 3ZI8A 4EXZA 1L6MA 1VPRA 5FFHA 2POAA 1YP6A 2G5LA 4YGHA 2IZLB 1LIBA 1DZKA 3RY1A 3SAOA 2QCBA 3FEKA 3FYFA 3QKGA 4NLJA 4IAWA 1Y9TA 2RTQB 3BRNA 2BS6A 1MX7A 3MBTA 2G8CO 1N7YA 5B5FA 3RE6A 1IW2A 4MEEA 1G85A 2JU7A 2WWPA 2HMBA 1JMXA 3WYQA 2GTLN 3APVA 3EM0A 3F8AA 4Y0RA 1ML7A 5CSEA 4RUNA 3RDUA 3LHNA 2HKDA 2N93A 1A2DA 1VWNB 5F2BA 4ZH9A 1LF7A 1SRGA 3Q34A 1W4TA 2MJIA 4ODDA 1NQMA 1TW4A 4DQ4A 2RTNB 1SWRA 1JZUA 1XKIA 2FLJA 2OY1O 1O1VA 4FQBB 4BX5B 1I4UA 2AF5A 1GT4A 2L68A 3BX8A 2Q39A 3HWFA 3KFFA 3NQ3A 3EYCA 4YCEA 3V8UA 4ALOA 4Z27A 3JS1A 1RAVA 3STKA 3NR3A 1DF3A 4FBRA 1N0SA 3L4RA 2QOMA 3KQ0A 1FDQA 4YFRA 5K67A 1VWBB 2AT3X 1NC9A 3DSZA 4NV8A 4Y59A 5K06A 1OEKA 2PY1A 4U8UO 1VWFB 1LUQA 2RTDB 3NADA 1MUPA 3FLLA 3OJYC 4I95A 4CDFA 2FR2A 1OBUA 2ALLX 2QO6A 3EW1A 1BRPA 1LNMA 5D48A 3PDFA 1QY1A 4LKTA 3RDSA 4WHIA 2DJFA 4TLJA 4QGVA 2OL7A 5HCDC 3TZSA 3FR4A 2IZJA 2IZDB 4ID2A 4O3ZA 5D8JA 4OEMA 3APWA 1KL5A 1X8NA 4YGGA 1SY0A 2OL8O 3OE3A 1O8VA 5IRUA 3VHHA 1Y53X 4GETA 1VYGA 4BX7A 1KGLA 1S7DA 2XKLA 4U8UM 2DM5A 3P6CA 3RE5A 3FENA 1RBPA 3WVMA 4ON1A 4XMEA 5DG4A 3P6EA 2WR6A 1YWAA 1UYOX 4BGFA 2PI3O 2C1SA 2ACPX 4GKCA 4D6AA 4QAEA 2R56A 1MDCA 2GTFX 4ORRA 1ERBA 3B2IA 1AELA 3O19A 3RWXA 3P6FA 4TNNA 1PMPA 4U3QA 1U17A 1EPAA 5F1EA 2OL6O 4O4SA 1GKAA 1LFOA 5HBSA 4A60A 4A1YA 2G7BA 1HMSA 4HPBA 2Y32A 2NNDA 5HA0A 5HZ9A 1VWIB 3SLTA 3WJEA 1LIDA 4KCAA 4KIIA 4LZUA 4A8ZA 1HMRA 1JIWI 3H3IA 1LCWA 1G74A 1YIVA 1AVDA 3DTQA 4TQ2A 3LTWA 2A3FX 4LQZA 3HWEA 1KZWA 1SY3A 2AT0X 1IFCA 1UZ2X 4L1NA 4GD9A 4TKHA 3WOVA 2CAMA 4ALBA 3B2LA 2CZTA 2RTIB 3D95A 4GJVA 4YBUA 4O4UA 5LJDA 5BYPA 5HWZA 2O62A 3FDCA 4IBAA 1NP1A 1RLBE 2OF8A 5EDBA 3C78X 2RTBB 2CZUA 5IO5A 2X34A 4FGIB 1ZNLA 4O3XB 4WBKA 1KZXA 2JU8A 5H8TA 4I9SA 1ZNHA 2Z4HA 4K19A 3T6LA 1FELA 1SLGB 2OFBA 2X8FA 3P02A 3RY2A 3VU1A 2NNEA 4R0BA 2QMIA 4PJ2A 1MK5A 4YH0A 1SMPI 5B27A 5KIDA 4ORYA 4I3CA 3O22A 2ZSCA 4UU3A 4ZH6A 3SLOA 4ZHGA 1SWBA 3P6GA 3Q6LA 3ZW1B 1Y0GA 2MHDA 3EW2A 1KQWA 4HPCA 5F58A 5LJEA 1SWHA 2RTHB 3KVNA 2AH7X 1QG5A 1T8VA 2GH7A 1B8EA 1SY2A 1BEBA 1Y9LA 4GNYA 2QO5A 2MO5A 3FR5A 1SLDB 3WZOA 1CBRA 5JD2A 4Y5DA 1OBPA 3VG2A 5HZ6A 1S2PA 2JMBA 1LCVA 3MM0A 3AEHA 4GRJA 4MVEA 5LKEA 3NP1A 4YFPA 4YGZA 4U46A 4YDBA 5L8OA 1OEEA 3SOTA 1X89A 2L9CA 2X45A 3KFHA 3MG5A 2RTAA 1STSB 4Z2PA 2RTFB 2KTSA 1GT1A 1SWNA 3PPTA 3BU9A 2EU7X 2ACOA 3O2YA 4M7MA 4NP1A 3SLJA 4BJ8A 2K23A 1BRQA 3APXA 1DZPA 2MM3A 5D45A 3RSWA 4D6BA 2C4IA 2GC9A 1SWCA 2XSTA 1DV9A 5C0NA 3T1DA 2E4JA 2HZQA 1E5PA 1GT3A 2FHLA 1EI5A 1BSQA 2KW1A 3UEXA 2UYWA 4HPAA 3NBXX 1SLEB 3BSZE 1JQPA 3CWKA 3KFIA 5HZQA 1SWLA 2X32A 4U8UN 2FHNX 2WEXA 3ZW0A 2VFBA 1JJXA 4PSQA 2IFBA 2FKJA 1SWEA 1Y55X 2OVSA 1HXLA 2AMMX 4B55A 1SWAA 3FW4A 5L8NA 1MX8A 3SZIA 1OPAA 4Y0PA 2FTBA 1IIUA 1QFTA 3BX7A 4BX6B 1RXKA 2ASNX 3PQUA 4N7DA 1LDOA 5IRWA 3BLGA 5F7GA 3WJBA 1HQPA 2AVIA 2BLGA 3VG6A 1SRFA 2A2UA 2FS6A 3NPOA 1CRBA 3D4RA 3CKFA 1BM5A 1IJ8A 1SRJA 1LELA 3HPEA 5B11O 3RDOA 2VFCA 2X8SA 4BBOA 5CE4A 1WBIA 1NQNA 4QRLA 1ALBA 1ZNKA 1JJUA 2JN3A 3AUMO 4ORWA 4QGWA 5F6ZA 3VG4A 1G5WA 2FR3A 4XMCA 1E00A 4GDAA 2RTOB 3NX1A 1EALA 2AL0X 2MF6A 3LV4A 4KC7A 3RDQA 1SA8A 4BX5A 4O3WA 3TF6A 2Q2PA 3T2XA 1SLFB 1W5RA 2RTJA 1X8OA 4JO6A 1B56A 3U9PC 4EQAC 1EW3A 1ZNEA 1BWYA 4KT5A 4Y0QA 1QWDA 4YBPA 5AJCA 3ELZA 4ZJ0A 3G7XA 1YUPA 1IKJA 2C1QA 3AKMA 1KL4A 1YWCA 5EZ2A 1VWPB 1DC9A 4CPIA 1MOYA 4ZGUA 1E02A 5AEOA 1DF8A 3U0DA 2G78A 4MVLA 2RN4A 1DFVA 1VWDB 3TGCA 3P6DA 4NYQA 4OS0A 1KT5A 2OFRX 3BU1A 5BVQA 4CPHB 1W6FA 1KFFA 1MVGA 4I3BA 4I6SA 4Z6JA 2QM9A 3SZJA 3FIQA 3HTYA 3FEPA 3HWGA 1ADLA 5K68A 4IAXA 3FA7A 1ICMA 2OF9A 1SWUA 1FEMA 2FT9A 1N9YA 2F01A 2I5ZO 3UEWA 4LKPA 5FQ6E 5IO7A 3RBYA 3VE1A 1SWTA 2LBAA 3EC5A 3JQOA 4IB8A 1VWJB 3WZNA 4FBVA 1K3BA 2ANSA 4A1HA 4QQ1A 4QZUA 3E3CA 2WQAE 4O9SA 2RTCB 4GUZA 4NYRA 1SXUA 3F6ZB 1JJJA 1SXXA 2OY5O 1YP7A 2OFAA 3D97A 5LKFA 4ZHHA 3KZAA 2RQ0A 3FMZA 1VWHB 1KOIA 1EXSA 5EDCA 3UEVA 1BSOA 1EQDA 4CPEA 1NBXA 2BSZA 1TOWA 1VWMB 4MISA 3NX2A 1UREA 3GAQA 4ORXA 3CQNA 1SWKA 3VGWA 2A0AA 1GX3A 2DJGA 5B29A 1JBHA 4OKAA 3CQRA 1OEJA 4KC8A 2CBRA 2FRSA 2OFMX 3WJFA 1OSPO 1T68X 1IKEA 5BVTA 3T2WA 1FENA 2Z4IA 4GE1A 3STNA 1RSTB 5HTEA 3HK1A 2QOSC 3FA8A 3IA8A 4CK4A 4CV7A 2K62A 2WSJA 3CKGA 3PH5A 1CJ5A 1EIOA 4IB9A 5LJBA 3UEUA 2LFOA 2I5VO 2IZBA 2HYSA 2OVAA 1NDJA 2RCTA 1X8QA 1ICNA 2YMSA 3APUA 3F9DA 1SRHA 4AZRA 4IABA 3WYPA 1PTSA 2OVEA 5EEDA 4DCBA 1YWDA 4ML7B 2FS7A 5FQ8E 3S60A 5HA1A 4QYPA 2GJ5A 1VWCB 1VWQB 2LB6A 4N7CA 1VWKB 2OY7A 1UYNX 5DPQA 5HAEA 1BSYA 1S44A 1IFBA 1O1UA 4HFOA 5H9KA 4GZVA 1T0VA 4OS3A 1SWGA 2MWHA 4ZR2A 4BOEA 3P6HA 1FTPA 4O4XA 1GXAA 1MEPA 1QFVA 2LBVA 1SXWA 3ZW1A 3P24A 4NV7A 4GNWA 4U9CA 1LPJA 5D47A 5HTDA 4XMDA 1U18A 4XMFA 5LJGA 1QY2A 2IZCB 2LKKA 3QQ2A 2IZAA 2W2AA 3I0AA 5HCCC 3WJCA 4I9RA 1H91A 2X46A 1Z24A 3KFGA 3BDRA 1LDQA 1VWLB 2L67A 3AKNA 1TXLA 3CBCA 5FAZA 3N91A 2HNXA 1KXOA 4YVBA 4L3RA 4OS8A 3CMPA 4AW8A 3ZUIA 1A57A 4M6SA 1DZJA 5H9AA 1N43A 4HPDA
chains in the Genus database with same CATH topology
4GJSA 2MF6A 1VWGB 1SWFA 3RDQA 4BX5A 2RTGB 1AVEA 3T2XA 1SRIA 1SLFB 2RTJA 4JO6A 1SWSA 2RTRB 2A5BA 2Y32A 1SWQA 1VWIB 3RDMA 2RTPB 1SWOA 2C1QA 1KL4A 1VWPB 2BC3A 1LCWA 2IZFB 1MOYA 1VWEB 1AVDA 4CPIA 1DF8A 1KL3A 3WZPA 2A5CA 4DNEA 2RTLA 1STRB 1VWDB 2IZKA 2RTMA 4GD9A 2CAMA 4Z2VA 2RTIB 4GJVA 1N4JA 4CPHB 2JGSA 1KFFA 3FDCA 4Z6JA 2OF8A 2A8GA 4CPFA 3SZJA 2RTBB 4BX6A 3T6FA 1I9HA 1HXZA 1RXHA 5K68A 3X00A 1RSUB 2OF9A 1SWUA 5L3YA 1N9YA 2F01A 2RTEB 4Z28A 1SWJA 3VHIA 4IRWA 1N9MA 1SLGB 1SWTA 2OFBA 2WPUA 3RY2A 1VWJB 3T6LA 3WZNA 4EKVA 2G5LA 2IZLB 1MK5A 1VWRB 3RY1A 2QCBA 2ZSCA 3VHMA 2RTCB 2RTQB 1SWBA 2Y3EA 1MM9A 4GDAA 4JNJA 3SZHA 2OFAA 1N7YA 5B5FA 3EW2A 2IZEB 3RE6A 1RXJA 1VWHB 4CPEA 3WYQA 1SWHA 2RTHB 1NBXA 1VWMB 1VWOB 4BX7B 5CSEA 2GH7A 1SWKA 3VGWA 3RDUA 1STPA 4OKAA 1SLDB 3WZOA 5JD2A 4Y5DA 1VWNB 5F2BA 2IZHB 1LCVA 3MM0A 1SRGA 4GGRA 4BCSA 1NQMA 4U46A 3T2WA 2RTNB 1RSTB 1SWRA 1SWPA 1Y52X 2Y3FA 1VWAB 3MG5A 4Z2PA 2RTAA 1STSB 3RDXA 4BX5B 2RTFB 3PK2A 1VYOA 1SWNA 4CPHA 2IZBA 4Z27A 1NDJA 1RAVA 4BJ8A 4GGZA 1LCZA 1SREA 1SRHA 5K67A 1VWBB 2C4IA 1SWCA 1NC9A 1PTSA 4Y59A 3WYPA 1HY2A 1VWFB 1LUQA 2RTDB 2FHLA 3EW1A 1VWCB 2UYWA 1SLEB 1VWQB 1VWKB 1SWLA 2FHNX 2UZ2A 3RDSA 3WZQA 5IRAA 1SWGA 1SWEA 2IZJA 1Y55X 2IZDB 1HXLA 1MEPA 2IZIA 1SWAA 2RTKA 5B5GA 4GGTA 3SZIA 5CHKA 2IZGB 4BX6B 1KL5A 1RXKA 2IZCB 5IRUA 1LDOA 5IRWA 3VHHA 4BX7A 1Y53X 2IZAA 2AVIA 1SRFA 3RE5A 1LDQA 2RTOB 1VWLB 1IJ8A 1SRJA 1LELA 1SWDA 3RDOA 4BBOA 4I60A 4JHQA 4YVBA 4Z2OA 1WBIA 1NQNA 2C1SA 1N43A 1HQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GJS A;  2MF6 A;  1VWG B;  1SWF A;  3RDQ A;  4BX5 A;  2RTG B;  1AVE A;  3T2X A;  1SRI A;  1SLF B;  2RTJ A;  4JO6 A;  1SWS A;  2RTR B;  2A5B A;  2Y32 A;  1SWQ A;  1VWI B;  3RDM A;  2RTP B;  1SWO A;  2C1Q A;  1KL4 A;  1VWP B;  2BC3 A;  1LCW A;  2IZF B;  1MOY A;  1VWE B;  1AVD A;  4CPI A;  1DF8 A;  1KL3 A;  3WZP A;  2A5C A;  4DNE A;  2RTL A;  1STR B;  1VWD B;  2IZK A;  2RTM A;  4GD9 A;  2CAM A;  4Z2V A;  2RTI B;  4GJV A;  1N4J A;  4CPH B;  2JGS A;  1KFF A;  3FDC A;  4Z6J A;  2OF8 A;  2A8G A;  4CPF A;  3SZJ A;  2RTB B;  4BX6 A;  3T6F A;  1I9H A;  1HXZ A;  1RXH A;  5K68 A;  3X00 A;  1RSU B;  2OF9 A;  1SWU A;  5L3Y A;  1N9Y A;  2F01 A;  2RTE B;  4Z28 A;  1SWJ A;  3VHI A;  4IRW A;  1N9M A;  1SLG B;  1SWT A;  2OFB A;  2WPU A;  3RY2 A;  1VWJ B;  3T6L A;  3WZN A;  4EKV A;  2G5L A;  2IZL B;  1MK5 A;  1VWR B;  3RY1 A;  2QCB A;  2ZSC A;  3VHM A;  2RTC B;  2RTQ B;  1SWB A;  2Y3E A;  1MM9 A;  4GDA A;  4JNJ A;  3SZH A;  2OFA A;  1N7Y A;  5B5F A;  3EW2 A;  2IZE B;  3RE6 A;  1RXJ A;  1VWH B;  4CPE A;  3WYQ A;  1SWH A;  2RTH B;  1NBX A;  1VWM B;  1VWO B;  4BX7 B;  5CSE A;  2GH7 A;  1SWK A;  3VGW A;  3RDU A;  1STP A;  4OKA A;  1SLD B;  3WZO A;  5JD2 A;  4Y5D A;  1VWN B;  5F2B A;  2IZH B;  1LCV A;  3MM0 A;  1SRG A;  4GGR A;  4BCS A;  1NQM A;  4U46 A;  3T2W A;  2RTN B;  1RST B;  1SWR A;  1SWP A;  1Y52 X;  2Y3F A;  1VWA B;  3MG5 A;  4Z2P A;  2RTA A;  1STS B;  3RDX A;  4BX5 B;  2RTF B;  3PK2 A;  1VYO A;  1SWN A;  4CPH A;  2IZB A;  4Z27 A;  1NDJ A;  1RAV A;  4BJ8 A;  4GGZ A;  1LCZ A;  1SRE A;  1SRH A;  5K67 A;  1VWB B;  2C4I A;  1SWC A;  1NC9 A;  1PTS A;  4Y59 A;  3WYP A;  1HY2 A;  1VWF B;  1LUQ A;  2RTD B;  2FHL A;  3EW1 A;  1VWC B;  2UYW A;  1SLE B;  1VWQ B;  1VWK B;  1SWL A;  2FHN X;  2UZ2 A;  3RDS A;  3WZQ A;  5IRA A;  1SWG A;  1SWE A;  2IZJ A;  1Y55 X;  2IZD B;  1HXL A;  1MEP A;  2IZI A;  1SWA A;  2RTK A;  5B5G A;  4GGT A;  3SZI A;  5CHK A;  2IZG B;  4BX6 B;  1KL5 A;  1RXK A;  2IZC B;  5IRU A;  1LDO A;  5IRW A;  3VHH A;  4BX7 A;  1Y53 X;  2IZA A;  2AVI A;  1SRF A;  3RE5 A;  1LDQ A;  2RTO B;  1VWL B;  1IJ8 A;  1SRJ A;  1LEL A;  1SWD A;  3RDO A;  4BBO A;  4I60 A;  4JHQ A;  4YVB A;  4Z2O A;  1WBI A;  1NQN A;  2C1S A;  1N43 A;  1HQQ A; 
#chains in the Genus database with same CATH topology
 1TOU A;  2KD2 A;  1GGL A;  3BY0 A;  1VWG B;  4IMN A;  1SWF A;  3BS2 A;  4CDC A;  2WEW A;  1PEE A;  1AVE A;  1OBQ A;  1EII A;  2AKQ A;  1BBP A;  1SRI A;  2CM9 A;  4O3Y A;  2AT8 X;  2Q2M A;  1BJ7 A;  2RTR B;  1FE3 A;  3CBS A;  4NNT A;  1SY1 A;  4EFG A;  3ZW0 B;  3WXQ A;  4MIR A;  3NQK A;  1PM1 X;  4TKJ A;  2RTP B;  1SWO A;  5LJC A;  4I3D A;  3S5X A;  2IZF B;  3B2K A;  1VWE B;  1I78 A;  2X56 A;  4CDD A;  3WZP A;  1KT3 A;  3FEL A;  5HZ8 A;  2FGS A;  2F73 A;  1GM6 A;  5KIC A;  3HOE A;  1ERX A;  5EEE A;  1STR B;  1KT4 A;  4Z2V A;  1ACD A;  4OMW A;  4XMG A;  1JV4 A;  1LIC A;  1SXY A;  3STM X;  4ARH A;  4ZGF A;  2Q9S A;  3IFB A;  1G7N A;  4EDE A;  2NP1 A;  3EMM A;  2Q4N A;  3D96 A;  3VE2 A;  4BVM A;  1YWB A;  2WQ9 A;  4BX6 A;  1PBO A;  3FR2 A;  1HXZ A;  1RXH A;  1D3S A;  1TVQ A;  2A13 A;  3X00 A;  2JW1 A;  4XMH A;  1GX9 A;  2OY8 A;  5HCE C;  2WUT A;  4OMX A;  1SWJ A;  4CDE A;  1CBQ A;  4AZM A;  3B2J A;  1A3Y A;  2JOZ A;  4EKV A;  2F09 A;  1E2T A;  4JGL A;  1VWR B;  2X55 A;  4MVI A;  5AJB A;  3ZWE A;  2AT6 X;  3VHM A;  1B4M A;  2HLV A;  3EBW A;  2GTL O;  2W2F A;  2Y3E A;  1MM9 A;  4AZP A;  5B3M O;  3PK2 A;  2KTD A;  4JNJ A;  2OZQ A;  3SZH A;  1B0O A;  4GU8 A;  2IZE B;  1RXJ A;  2QO4 A;  1OPB A;  1ZRY A;  2X4M A;  4LZV A;  2AT5 X;  5L8I A;  5B2A O;  3I17 A;  4ZCB A;  3TGA A;  2BS5 A;  4NNS A;  1VWO B;  4AZQ A;  4BX7 B;  4DQ3 A;  4NW4 A;  3C77 X;  3HWD A;  1I05 A;  4IMO A;  3VG5 A;  1STP A;  5BVS A;  5D4A A;  1HMT A;  1R0U A;  4ORU A;  1AQB A;  2OYB O;  2IZH B;  1JYJ A;  4GGR A;  4BCS A;  2M4L A;  1FJ1 E;  4Z2O A;  4O49 A;  1GX8 A;  2GTL M;  1SWP A;  3PED A;  3ZZV A;  1Y52 X;  2Y3F A;  2FKG A;  1VWA B;  1X8P A;  3VPJ E;  1KT7 A;  3OBL A;  4QZT A;  3RDX A;  1QQS A;  1LIE A;  1VYO A;  2A2G A;  3S5V A;  4GH7 A;  1GKA B;  2CM4 A;  4O4O A;  2X8T A;  4INN A;  1LIF A;  3ZUO A;  4CPH A;  4GGZ A;  1LCZ A;  1NGL A;  4ZHF A;  1SRE A;  2CBS A;  2HZR A;  5IXG A;  5LJH A;  4TJZ A;  5FQ7 E;  1HBP A;  2FWV A;  2BHV A;  1WUB A;  2ZAG A;  1U0X A;  4C5P A;  1QY0 A;  1HY2 A;  3FA9 A;  4TKB A;  5HZ5 A;  1I06 A;  4YMY A;  1CBS A;  3D9W A;  2ZAI A;  1A18 A;  1QAB E;  3EBK A;  4YDA A;  3GE2 A;  5H9N A;  3K3L A;  2RCQ A;  5F6B A;  3RZY A;  4CSB A;  2UZ2 A;  2W2B A;  3PQS A;  3WZQ A;  5IRA A;  3VG3 A;  2R73 A;  1EPB A;  3RKG A;  2IZI A;  2RTK A;  1GT5 A;  1XCA A;  1KT6 A;  4GGT A;  5B5G A;  3WJD A;  5CHK A;  3S26 A;  2IZG B;  4ES7 A;  2JU3 A;  2R74 A;  1AB0 A;  1K24 A;  5H9L A;  4IB6 A;  5EPQ A;  5IO6 A;  4WFU A;  3HOL A;  3UAQ A;  4KH8 A;  1LKE A;  4GDZ A;  1CBI A;  1SWD A;  1NP4 A;  1HN2 A;  2LA7 A;  1X8U A;  2L5P A;  4I60 A;  4JHQ A;  4YKM A;  4BQU A;  2RD7 C;  3CR6 A;  4AZN A;  4AZO A;  5CYB A;  4IB7 A;  1HQQ A;  3RDM A;  3ZQ3 A;  3MVF A;  1VYF A;  4QNI A;  4GJS A;  4ORS A;  4Y0S A;  3OD9 A;  2RTG B;  1ZND A;  5AQ6 A;  1DZM A;  4ZFX A;  5FEN A;  3VG7 A;  5B10 O;  4COT A;  2VDF A;  1SWS A;  4YFQ A;  2A5B A;  2RA6 A;  3B2H A;  1SWQ A;  3FID A;  1KQX A;  3ELX A;  4RUU A;  4YKO A;  3TGB A;  1AVG I;  3JSQ A;  2P8G A;  2BC3 A;  4GK9 A;  5JR8 A;  4QGX A;  4YCH A;  1KL3 A;  4FBO A;  2YG2 A;  4WFV A;  3WBG A;  2A5C A;  2OVD A;  3PH6 A;  3MX7 A;  3ZW2 A;  1EUO A;  2KT4 B;  3FW5 A;  4NLI A;  4DNE A;  2RTL A;  3C76 X;  3WJG A;  2IZK A;  2RTM A;  1ZNG A;  4HWM A;  4OEL A;  3PP6 A;  4QYN A;  5KHP A;  5LJK A;  4ZHD A;  1N4J A;  4AYH A;  2JGS A;  4EEJ A;  2NNQ A;  1P6P A;  4UU2 A;  1D2U A;  1PBY A;  2A8G A;  4MVK A;  1HBQ A;  4CPF A;  1JMZ A;  3T6F A;  1I9H A;  1X71 A;  3NQ9 A;  1RSU B;  2BT9 A;  3U03 A;  4ZHC A;  5L3Y A;  1I04 A;  2G79 A;  2RTE B;  3PEC A;  4Z28 A;  1BLR A;  3FA6 A;  3VHI A;  1E06 A;  4IRW A;  1N9M A;  1JYD A;  2WPU A;  3ZI8 A;  4EXZ A;  1L6M A;  1VPR A;  5FFH A;  2POA A;  1YP6 A;  2G5L A;  4YGH A;  2IZL B;  1LIB A;  1DZK A;  3RY1 A;  3SAO A;  2QCB A;  3FEK A;  3FYF A;  3QKG A;  4NLJ A;  4IAW A;  1Y9T A;  2RTQ B;  3BRN A;  2BS6 A;  1MX7 A;  3MBT A;  2G8C O;  1N7Y A;  5B5F A;  3RE6 A;  1IW2 A;  4MEE A;  1G85 A;  2JU7 A;  2WWP A;  2HMB A;  1JMX A;  3WYQ A;  2GTL N;  3APV A;  3EM0 A;  3F8A A;  4Y0R A;  1ML7 A;  5CSE A;  4RUN A;  3RDU A;  3LHN A;  2HKD A;  2N93 A;  1A2D A;  1VWN B;  5F2B A;  4ZH9 A;  1LF7 A;  1SRG A;  3Q34 A;  1W4T A;  2MJI A;  4ODD A;  1NQM A;  1TW4 A;  4DQ4 A;  2RTN B;  1SWR A;  1JZU A;  1XKI A;  2FLJ A;  2OY1 O;  1O1V A;  4FQB B;  4BX5 B;  1I4U A;  2AF5 A;  1GT4 A;  2L68 A;  3BX8 A;  2Q39 A;  3HWF A;  3KFF A;  3NQ3 A;  3EYC A;  4YCE A;  3V8U A;  4ALO A;  4Z27 A;  3JS1 A;  1RAV A;  3STK A;  3NR3 A;  1DF3 A;  4FBR A;  1N0S A;  3L4R A;  2QOM A;  3KQ0 A;  1FDQ A;  4YFR A;  5K67 A;  1VWB B;  2AT3 X;  1NC9 A;  3DSZ A;  4NV8 A;  4Y59 A;  5K06 A;  1OEK A;  2PY1 A;  4U8U O;  1VWF B;  1LUQ A;  2RTD B;  3NAD A;  1MUP A;  3FLL A;  3OJY C;  4I95 A;  4CDF A;  2FR2 A;  1OBU A;  2ALL X;  2QO6 A;  3EW1 A;  1BRP A;  1LNM A;  5D48 A;  3PDF A;  1QY1 A;  4LKT A;  3RDS A;  4WHI A;  2DJF A;  4TLJ A;  4QGV A;  2OL7 A;  5HCD C;  3TZS A;  3FR4 A;  2IZJ A;  2IZD B;  4ID2 A;  4O3Z A;  5D8J A;  4OEM A;  3APW A;  1KL5 A;  1X8N A;  4YGG A;  1SY0 A;  2OL8 O;  3OE3 A;  1O8V A;  5IRU A;  3VHH A;  1Y53 X;  4GET A;  1VYG A;  4BX7 A;  1KGL A;  1S7D A;  2XKL A;  4U8U M;  2DM5 A;  3P6C A;  3RE5 A;  3FEN A;  1RBP A;  3WVM A;  4ON1 A;  4XME A;  5DG4 A;  3P6E A;  2WR6 A;  1YWA A;  1UYO X;  4BGF A;  2PI3 O;  2C1S A;  2ACP X;  4GKC A;  4D6A A;  4QAE A;  2R56 A;  1MDC A;  2GTF X;  4ORR A;  1ERB A;  3B2I A;  1AEL A;  3O19 A;  3RWX A;  3P6F A;  4TNN A;  1PMP A;  4U3Q A;  1U17 A;  1EPA A;  5F1E A;  2OL6 O;  4O4S A;  1GKA A;  1LFO A;  5HBS A;  4A60 A;  4A1Y A;  2G7B A;  1HMS A;  4HPB A;  2Y32 A;  2NND A;  5HA0 A;  5HZ9 A;  1VWI B;  3SLT A;  3WJE A;  1LID A;  4KCA A;  4KII A;  4LZU A;  4A8Z A;  1HMR A;  1JIW I;  3H3I A;  1LCW A;  1G74 A;  1YIV A;  1AVD A;  3DTQ A;  4TQ2 A;  3LTW A;  2A3F X;  4LQZ A;  3HWE A;  1KZW A;  1SY3 A;  2AT0 X;  1IFC A;  1UZ2 X;  4L1N A;  4GD9 A;  4TKH A;  3WOV A;  2CAM A;  4ALB A;  3B2L A;  2CZT A;  2RTI B;  3D95 A;  4GJV A;  4YBU A;  4O4U A;  5LJD A;  5BYP A;  5HWZ A;  2O62 A;  3FDC A;  4IBA A;  1NP1 A;  1RLB E;  2OF8 A;  5EDB A;  3C78 X;  2RTB B;  2CZU A;  5IO5 A;  2X34 A;  4FGI B;  1ZNL A;  4O3X B;  4WBK A;  1KZX A;  2JU8 A;  5H8T A;  4I9S A;  1ZNH A;  2Z4H A;  4K19 A;  3T6L A;  1FEL A;  1SLG B;  2OFB A;  2X8F A;  3P02 A;  3RY2 A;  3VU1 A;  2NNE A;  4R0B A;  2QMI A;  4PJ2 A;  1MK5 A;  4YH0 A;  1SMP I;  5B27 A;  5KID A;  4ORY A;  4I3C A;  3O22 A;  2ZSC A;  4UU3 A;  4ZH6 A;  3SLO A;  4ZHG A;  1SWB A;  3P6G A;  3Q6L A;  3ZW1 B;  1Y0G A;  2MHD A;  3EW2 A;  1KQW A;  4HPC A;  5F58 A;  5LJE A;  1SWH A;  2RTH B;  3KVN A;  2AH7 X;  1QG5 A;  1T8V A;  2GH7 A;  1B8E A;  1SY2 A;  1BEB A;  1Y9L A;  4GNY A;  2QO5 A;  2MO5 A;  3FR5 A;  1SLD B;  3WZO A;  1CBR A;  5JD2 A;  4Y5D A;  1OBP A;  3VG2 A;  5HZ6 A;  1S2P A;  2JMB A;  1LCV A;  3MM0 A;  3AEH A;  4GRJ A;  4MVE A;  5LKE A;  3NP1 A;  4YFP A;  4YGZ A;  4U46 A;  4YDB A;  5L8O A;  1OEE A;  3SOT A;  1X89 A;  2L9C A;  2X45 A;  3KFH A;  3MG5 A;  2RTA A;  1STS B;  4Z2P A;  2RTF B;  2KTS A;  1GT1 A;  1SWN A;  3PPT A;  3BU9 A;  2EU7 X;  2ACO A;  3O2Y A;  4M7M A;  4NP1 A;  3SLJ A;  4BJ8 A;  2K23 A;  1BRQ A;  3APX A;  1DZP A;  2MM3 A;  5D45 A;  3RSW A;  4D6B A;  2C4I A;  2GC9 A;  1SWC A;  2XST A;  1DV9 A;  5C0N A;  3T1D A;  2E4J A;  2HZQ A;  1E5P A;  1GT3 A;  2FHL A;  1EI5 A;  1BSQ A;  2KW1 A;  3UEX A;  2UYW A;  4HPA A;  3NBX X;  1SLE B;  3BSZ E;  1JQP A;  3CWK A;  3KFI A;  5HZQ A;  1SWL A;  2X32 A;  4U8U N;  2FHN X;  2WEX A;  3ZW0 A;  2VFB A;  1JJX A;  4PSQ A;  2IFB A;  2FKJ A;  1SWE A;  1Y55 X;  2OVS A;  1HXL A;  2AMM X;  4B55 A;  1SWA A;  3FW4 A;  5L8N A;  1MX8 A;  3SZI A;  1OPA A;  4Y0P A;  2FTB A;  1IIU A;  1QFT A;  3BX7 A;  4BX6 B;  1RXK A;  2ASN X;  3PQU A;  4N7D A;  1LDO A;  5IRW A;  3BLG A;  5F7G A;  3WJB A;  1HQP A;  2AVI A;  2BLG A;  3VG6 A;  1SRF A;  2A2U A;  2FS6 A;  3NPO A;  1CRB A;  3D4R A;  3CKF A;  1BM5 A;  1IJ8 A;  1SRJ A;  1LEL A;  3HPE A;  5B11 O;  3RDO A;  2VFC A;  2X8S A;  4BBO A;  5CE4 A;  1WBI A;  1NQN A;  4QRL A;  1ALB A;  1ZNK A;  1JJU A;  2JN3 A;  3AUM O;  4ORW A;  4QGW A;  5F6Z A;  3VG4 A;  1G5W A;  2FR3 A;  4XMC A;  1E00 A;  4GDA A;  2RTO B;  3NX1 A;  1EAL A;  2AL0 X;  2MF6 A;  3LV4 A;  4KC7 A;  3RDQ A;  1SA8 A;  4BX5 A;  4O3W A;  3TF6 A;  2Q2P A;  3T2X A;  1SLF B;  1W5R A;  2RTJ A;  1X8O A;  4JO6 A;  1B56 A;  3U9P C;  4EQA C;  1EW3 A;  1ZNE A;  1BWY A;  4KT5 A;  4Y0Q A;  1QWD A;  4YBP A;  5AJC A;  3ELZ A;  4ZJ0 A;  3G7X A;  1YUP A;  1IKJ A;  2C1Q A;  3AKM A;  1KL4 A;  1YWC A;  5EZ2 A;  1VWP B;  1DC9 A;  4CPI A;  1MOY A;  4ZGU A;  1E02 A;  5AEO A;  1DF8 A;  3U0D A;  2G78 A;  4MVL A;  2RN4 A;  1DFV A;  1VWD B;  3TGC A;  3P6D A;  4NYQ A;  4OS0 A;  1KT5 A;  2OFR X;  3BU1 A;  5BVQ A;  4CPH B;  1W6F A;  1KFF A;  1MVG A;  4I3B A;  4I6S A;  4Z6J A;  2QM9 A;  3SZJ A;  3FIQ A;  3HTY A;  3FEP A;  3HWG A;  1ADL A;  5K68 A;  4IAX A;  3FA7 A;  1ICM A;  2OF9 A;  1SWU A;  1FEM A;  2FT9 A;  1N9Y A;  2F01 A;  2I5Z O;  3UEW A;  4LKP A;  5FQ6 E;  5IO7 A;  3RBY A;  3VE1 A;  1SWT A;  2LBA A;  3EC5 A;  3JQO A;  4IB8 A;  1VWJ B;  3WZN A;  4FBV A;  1K3B A;  2ANS A;  4A1H A;  4QQ1 A;  4QZU A;  3E3C A;  2WQA E;  4O9S A;  2RTC B;  4GUZ A;  4NYR A;  1SXU A;  3F6Z B;  1JJJ A;  1SXX A;  2OY5 O;  1YP7 A;  2OFA A;  3D97 A;  5LKF A;  4ZHH A;  3KZA A;  2RQ0 A;  3FMZ A;  1VWH B;  1KOI A;  1EXS A;  5EDC A;  3UEV A;  1BSO A;  1EQD A;  4CPE A;  1NBX A;  2BSZ A;  1TOW A;  1VWM B;  4MIS A;  3NX2 A;  1URE A;  3GAQ A;  4ORX A;  3CQN A;  1SWK A;  3VGW A;  2A0A A;  1GX3 A;  2DJG A;  5B29 A;  1JBH A;  4OKA A;  3CQR A;  1OEJ A;  4KC8 A;  2CBR A;  2FRS A;  2OFM X;  3WJF A;  1OSP O;  1T68 X;  1IKE A;  5BVT A;  3T2W A;  1FEN A;  2Z4I A;  4GE1 A;  3STN A;  1RST B;  5HTE A;  3HK1 A;  2QOS C;  3FA8 A;  3IA8 A;  4CK4 A;  4CV7 A;  2K62 A;  2WSJ A;  3CKG A;  3PH5 A;  1CJ5 A;  1EIO A;  4IB9 A;  5LJB A;  3UEU A;  2LFO A;  2I5V O;  2IZB A;  2HYS A;  2OVA A;  1NDJ A;  2RCT A;  1X8Q A;  1ICN A;  2YMS A;  3APU A;  3F9D A;  1SRH A;  4AZR A;  4IAB A;  3WYP A;  1PTS A;  2OVE A;  5EED A;  4DCB A;  1YWD A;  4ML7 B;  2FS7 A;  5FQ8 E;  3S60 A;  5HA1 A;  4QYP A;  2GJ5 A;  1VWC B;  1VWQ B;  2LB6 A;  4N7C A;  1VWK B;  2OY7 A;  1UYN X;  5DPQ A;  5HAE A;  1BSY A;  1S44 A;  1IFB A;  1O1U A;  4HFO A;  5H9K A;  4GZV A;  1T0V A;  4OS3 A;  1SWG A;  2MWH A;  4ZR2 A;  4BOE A;  3P6H A;  1FTP A;  4O4X A;  1GXA A;  1MEP A;  1QFV A;  2LBV A;  1SXW A;  3ZW1 A;  3P24 A;  4NV7 A;  4GNW A;  4U9C A;  1LPJ A;  5D47 A;  5HTD A;  4XMD A;  1U18 A;  4XMF A;  5LJG A;  1QY2 A;  2IZC B;  2LKK A;  3QQ2 A;  2IZA A;  2W2A A;  3I0A A;  5HCC C;  3WJC A;  4I9R A;  1H91 A;  2X46 A;  1Z24 A;  3KFG A;  3BDR A;  1LDQ A;  1VWL B;  2L67 A;  3AKN A;  1TXL A;  3CBC A;  5FAZ A;  3N91 A;  2HNX A;  1KXO A;  4YVB A;  4L3R A;  4OS8 A;  3CMP A;  4AW8 A;  3ZUI A;  1A57 A;  4M6S A;  1DZJ A;  5H9A A;  1N43 A;  4HPD A; 
#chains in the Genus database with same CATH homology
 4GJS A;  2MF6 A;  1VWG B;  1SWF A;  3RDQ A;  4BX5 A;  2RTG B;  1AVE A;  3T2X A;  1SRI A;  1SLF B;  2RTJ A;  4JO6 A;  1SWS A;  2RTR B;  2A5B A;  2Y32 A;  1SWQ A;  1VWI B;  3RDM A;  2RTP B;  1SWO A;  2C1Q A;  1KL4 A;  1VWP B;  2BC3 A;  1LCW A;  2IZF B;  1MOY A;  1VWE B;  1AVD A;  4CPI A;  1DF8 A;  1KL3 A;  3WZP A;  2A5C A;  4DNE A;  2RTL A;  1STR B;  1VWD B;  2IZK A;  2RTM A;  4GD9 A;  2CAM A;  4Z2V A;  2RTI B;  4GJV A;  1N4J A;  4CPH B;  2JGS A;  1KFF A;  3FDC A;  4Z6J A;  2OF8 A;  2A8G A;  4CPF A;  3SZJ A;  2RTB B;  4BX6 A;  3T6F A;  1I9H A;  1HXZ A;  1RXH A;  5K68 A;  3X00 A;  1RSU B;  2OF9 A;  1SWU A;  5L3Y A;  1N9Y A;  2F01 A;  2RTE B;  4Z28 A;  1SWJ A;  3VHI A;  4IRW A;  1N9M A;  1SLG B;  1SWT A;  2OFB A;  2WPU A;  3RY2 A;  1VWJ B;  3T6L A;  3WZN A;  4EKV A;  2G5L A;  2IZL B;  1MK5 A;  1VWR B;  3RY1 A;  2QCB A;  2ZSC A;  3VHM A;  2RTC B;  2RTQ B;  1SWB A;  2Y3E A;  1MM9 A;  4GDA A;  4JNJ A;  3SZH A;  2OFA A;  1N7Y A;  5B5F A;  3EW2 A;  2IZE B;  3RE6 A;  1RXJ A;  1VWH B;  4CPE A;  3WYQ A;  1SWH A;  2RTH B;  1NBX A;  1VWM B;  1VWO B;  4BX7 B;  5CSE A;  2GH7 A;  1SWK A;  3VGW A;  3RDU A;  1STP A;  4OKA A;  1SLD B;  3WZO A;  5JD2 A;  4Y5D A;  1VWN B;  5F2B A;  2IZH B;  1LCV A;  3MM0 A;  1SRG A;  4GGR A;  4BCS A;  1NQM A;  4U46 A;  3T2W A;  2RTN B;  1RST B;  1SWR A;  1SWP A;  1Y52 X;  2Y3F A;  1VWA B;  3MG5 A;  4Z2P A;  2RTA A;  1STS B;  3RDX A;  4BX5 B;  2RTF B;  3PK2 A;  1VYO A;  1SWN A;  4CPH A;  2IZB A;  4Z27 A;  1NDJ A;  1RAV A;  4BJ8 A;  4GGZ A;  1LCZ A;  1SRE A;  1SRH A;  5K67 A;  1VWB B;  2C4I A;  1SWC A;  1NC9 A;  1PTS A;  4Y59 A;  3WYP A;  1HY2 A;  1VWF B;  1LUQ A;  2RTD B;  2FHL A;  3EW1 A;  1VWC B;  2UYW A;  1SLE B;  1VWQ B;  1VWK B;  1SWL A;  2FHN X;  2UZ2 A;  3RDS A;  3WZQ A;  5IRA A;  1SWG A;  1SWE A;  2IZJ A;  1Y55 X;  2IZD B;  1HXL A;  1MEP A;  2IZI A;  1SWA A;  2RTK A;  5B5G A;  4GGT A;  3SZI A;  5CHK A;  2IZG B;  4BX6 B;  1KL5 A;  1RXK A;  2IZC B;  5IRU A;  1LDO A;  5IRW A;  3VHH A;  4BX7 A;  1Y53 X;  2IZA A;  2AVI A;  1SRF A;  3RE5 A;  1LDQ A;  2RTO B;  1VWL B;  1IJ8 A;  1SRJ A;  1LEL A;  1SWD A;  3RDO A;  4BBO A;  4I60 A;  4JHQ A;  4YVB A;  4Z2O A;  1WBI A;  1NQN A;  2C1S A;  1N43 A;  1HQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...