1AVOB

Proteasome activator reg(alpha)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
140
structure length
140
Chain Sequence
b'AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11S REGULATOR
publication title Structure of the proteasome activator REGalpha (PA28alpha).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteasome activator
total genus 57
structure length 140
sequence length 140
chains with identical sequence D, F, H, J, L, N
ec nomenclature
pdb deposition date 1997-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1avoB00
1Z7Qc 1YARO 1YAUO 3JTLO 3JSEO 3JRMO 3IPMO 1YA7O 1AVOB 1FNTc
chains in the Genus database with same CATH superfamily
2UUHA 2IM8A 2LFDA 3RW0A 4P6IC 3PCVA 5B3SC 3TK0A 2R7TA 2EILC 2V26A 2P1AA 3Q6NA 4JTAB 5A69A 2D5RB 4MVQA 1FAPB 1NU9C 3B9QA 3KPHA 3KH2A 1JRAA 4IJJA 2A68F 3UMIA 3HJCA 4QI2A 3L0IA 3O10A 3DZAA 4EBKA 2WB7A 5DVWA 4CSAA 3IQ6A 2NSFA 2Q00A 3N24A 1RKEB 3C18A 3DM5A 5KYWB 5DQZA 1LPEA 2H7VC 3GEIA 1WTYA 1C17M 2A1DD 2B0JA 4O6YA 4YL1A 1TWCA 3ZG1A 3FOOA 4JTDB 1BDJB 2BC5A 1Z23A 3EFOB 2WZLA 4IAOA 1NBBA 1BR1A 1QKRA 1V55C 3LAYA 3ZIBA 1OW8A 1VTMP 4WABA 1OQCA 3QZCA 2MHRA 1A7DA 2QTVA 4CX9A 2R05A 5CI9A 1AEPA 4G0HA 2HV6A 5L0JA 3GM2A 2M64A 3KYIA 1LI5A 3RKOF 5CIVA 3QW0A 5TJ5E 2YLGA 5E33A 4Q5SF 1M6TA 3AOUA 1NFNA 3DXJF 1SF8A 3JSEO 3LS1A 1ZZPA 1QQ3A 2XLMA 4GQHA 1YLMA 4ZLCA 3NMKA 1UG7A 3EQLF 3HNLA 2KW3C 5L0HA 2YLIA 4E7ZA 2BL2A 2Y39A 1Z63A 2O9XA 1A41A 2HS5A 3DE8A 3JCUQ 1GQAA 4FWVA 1Z3IX 4JEBA 3NG1A 5DQTA 3PDMP 1NLXA 1WATA 1XWJA 2ICWG 4KBLA 4LDQA 3OA1A 4U5GA 4BJTA 4DVZA 4BJ6C 3U3FA 4JJGA 1TKNA 2Q9AA 3S9OA 4FAPB 2Y69C 2CCYA 3WG7C 2CW0F 4OINF 2XL8A 4I1MA 5AC4A 2I15A 3NYJA 3CSKA 4AE4B 1VLSA 2X0CA 1OKKD 2OEVA 2Q4FA 4MVOA 2OG2A 4CDYA 3DJUB 4XTKA 3PHF2 1V4AA 3EGDB 3EGXB 3B0PA 4JTCB 3TOMA 1H9TA 1Z7Qc 4FX5A 1YARO 4LERA 3I5PA 3SZRA 1YAUO 2VC9A 2YL3A 2Y3BA 3C8GD 1APCA 2J9VA 1M2OA 2HFIA 2AVKA 4G7OF 4HFFB 1T01A 3N0TA 5F5HA 5FCLA 2R7OA 2QY9A 3QW1A 4N6HA 3K1HA 1F1MA 3AG3C 1MMGA 3RYLA 3W2VA 2QLAA 1HE9A 1BBHA 1L7CA 2IYLD 4MQ9F 4E18A 3EH1A 2GAQA 1N1CA 2R9RB 1CPQA 3Q7LA 1V74B 3UMHA 4CS8A 1ZVZA 2IXPA 3ABLC 2X51A 1OCZC 3HNJA 4DRJB 3O39A 2OQMA 1OW7A 4YT5A 2XLEA 3M4BA 1A0BA 3PMRA 1K05A 2Y3GA 3FMSA 3K1IC 3U8VA 5DLJA 2H8AA 5BQGA 4KNWA 1JPNA 4DXWA 2H7BA 2PNOA 2G3VA 4DBRA 1HY5A 4EBBA 3Q7GA 3IQ5A 2ZD9A 4CDVA 1E84A 4CSAC 2IOQA 1LVKA 3N2ZB 3O55A 5DS6A 1J8YF 3LEVA 1MMDA 2RD9A 1DOWA 2YL7A 3KKBA 5BQHA 3JSZA 4KI2A 2CNWD 2RSEB 3KMIA 1RCPA 3S27A 2F22A 2HMQA 1VLTA 1RKCA 1IW7F 1ZU4A 2CYDA 2ETSA 2A6EF 4A4AA 2Q9BA 1VK5A 1ZU5A 2XM0A 1A7EA 3BEHA 4G78A 1AVOB 3FAPB 2A0BA 4JCZA 3TOLA 2MYSA 2CGEA 2XXAA 5JRAA 1O5HA 3H2VA 3JT1A 4L6RA 4YK5A 1SZIA 2DI3A 1JR8A 1LE2A 2J0WA 2ZPAA 1SYQA 3R2PA 1RKEA 3W8HA 2PBEA 4AX2A 3SXKA 5DS4A 1SR2A 2J7PA 2NUTB 5KYWA 4OIQF 2Z15A 3AG4C 2A6HF 3AGUA 1VYIA 1D1BA 2UUIA 3FVYA 3NMJA 4LDKA 1TQGA 4RDAA 4NTBA 2YWAA 3K33A 2YLDA 2ZXOA 3ITFA 4WJ0A 1LIHA 2R7SA 1I5NA 1HE1A 1U89A 4CIHA 3M1CB 4PK4A 2AU5A 4PJNA 1T6UA 4YT2A 4W8PA 4H4KC 3T6GB 3M79A 2OOCA 4BJ5C 3MX3A 5BQIA 3W8IA 3U9MA 3C63A 1BR4A 1Y4CA 2EPKX 4OIRF 3ZQVA 1TFOB 4NC3A 3SYNA 5L0IA 2G62A 4PACA 3VM6A 1K40A 4AL0A 4MW8A 3ZC4A 5AGFA 3HKKA 4PR9A 2YKZA 1K04A 3AGTA 3F47A 3CAXA 3TQOA 4MW3A 1MNDA 3HNIA 3DI5A 2G3KA 5L3QA 3DM9B 1WWPA 2QUPA 3EPVA 2B0HA 4RD9A 4PJLA 5EK0A 3U0CA 2PX3A 3U2MA 3IQTA 4E7SA 4U5DE 3L1MA 1RJ9B 2L6GA 3WHNA 2KSFA 1VMAA 3G50A 4XPWA 4YWQA 3FDQA 1R5ID 3Q6MA 3AG2C 3DE9A 2WVOA 1ZHTA 3RVZA 2Y3HA 3S29A 3DJNB 4P9FA 1JAFA 4O6NA 4JCHA 3G4ZA 2DB4A 1Q0DA 1OXKA 1D0YA 4ULVA 4AE4A 2P6VA 3DWWA 2XM4A 3TJ5A 4AK9A 3OWTA 3EGDA 2ZXWC 4YL3A 1PCXA 4PFPA 3UGOA 2XLWA 1M2VB 5E2QA 4I3MA 1ZHYA 4CS9C 3GM1A 2EPOA 5JSLA 3U5SA 4EIYA 1OR2A 4EHPA 2VCCA 1YDIA 1Q0GA 2NG1A 3L34A 4EKWA 4LLCA 4IGGA 2KQ9A 3ATPA 2PFDA 3LNRA 1MMAA 2L6FA 3CQZA 1LS4A 5JLIA 3OEOA 2YEVA 1Q0FA 4MTGA 1NSGB 2L6HA 3LLKA 3DAFA 5FZTA 2HUJA 2L81A 2XSEA 1QSPA 2FFHA 3EG9A 2YZSA 2EIMC 2IBFA 4WGYA 4BJ6A 3V5ZA 4XLPF 1HMDA 3AG1C 2J9BA 2P61A 3LESA 2WL8A 3K7DA 1OCRC 2LQGA 1HMOA 2LIGA 3R7CA 1DOVA 1G4WR 3V7OA 4C3EA 4U5HA 4Q4ZF 1YA9A 5COMA 2DYRC 4JRZA 5T1DB 4XQ1A 2WVNA 4U5CE 3RQEA 3QVYA 4PFOA 4JJFA 5EGYA 3U2LA 1FR0A 1OW6A 3ZWIA 3DD7A 1QLEC 3V5YA 4O6MA 4BEJA 5B3IA 3NRHA 2OJED 3ABKC 4K7BA 2J8WA 3NYLA 2FAPB 3CEXA 4CIPA 4RBNA 4BJ1A 5KYXB 1FTSA 2XS8A 3SXZA 5DS5A 1YYJA 5COFA 4MS2A 2R7RA 5HV9A 5KYYB 1FFTC 1LE4A 4NQFA 5JT4A 1S05A 1OCCC 4FESA 2ZXPA 3HNKA 4Z9IA 256BA 5B1AC 2R02A 3K1IA 3RQFA 1RMVA 3S90A 2Q9CA 2XXAB 5L0CA 2HMZA 2YHSA 4MVMA 4XEKA 3GWLA 3LNMB 1AUEA 3RIPA 2AP3A 1NZEA 2IXOA 1ST6A 3MBGA 4XWJA 1YA7O 1OXBA 1ZYRF 2L7AA 2R25A 1PD0A 5A6BA 4R32A 1T6QA 4CBEA 1H9GA 4GYTA 4MTFA 2XLHA 2M4EA 2AWCA 2EIJC 2J0XA 4IRUA 5A6JA 3AQBA 3FHDA 1E2XA 2J7PD 2NUPA 4ER9A 1WOLA 1QPUA 1TWHA 4JC7A 2VCBA 2E87A 3LEOA 2C04A 2DYSC 2GWWA 3NYMA 4GEHA 4Z9JA 4N06A 3HLZA 1EQ1A 4UDVA 4HE8D 2KJGA 1FNTc 2J9UA 4G7HF 2EINC 1EA8A 3IEEA 2P7VA 3W4YA 2R7XA 4U9DA 3T9OA 4KC9A 2L9JA 4MTOA 1ZHXA 2GA0A 2YVKA 3NMIA 3IQCA 3MYFA 3WODF 3EH2A 1EI7A 4O79A 1E85A 4MVUA 3SNHA 2PP4A 1H7IA 2BE5F 1ZHZA 3B29A 1E86A 4C3DA 2Q3TA 1T9KA 3GANA 3ZTMA 1Y6DA 4IWBA 2DGJA 2WVQA 3M15A 4YL0A 4OIPF 1Q0KA 3X2QC 1RJ9A 1KU2A 2R7WA 3DAGA 4XPXA 1ORYA 2VASA 3K6BA 5AC5A 3FOPA 1G4US 1VOMA 3B71A 3QTHA 4QDLA 3EFOA 3I5QA 4D4NA 4AL1A 5BUOA 4JIOA 4DBQA 3K66A 1S7ZA 4HFKB 3H2UA 1O87A 1LKXA 3T6JA 4J7YA 5L3VA 2Q7RA 4P9TA 2XRHA 3EJNA 1C03A 1L3PA 1M2VA 3TJ6A 3HTKC 4E0IA 2YRFA 4CJOA 2HKVA 1CGNA 2CDQA 2XLOA 5E3CA 3C8GB 4J32B 3UNGC 5IY5C 2W4MA 3MYIA 1G5ZA 1V54C 2A0UA 2GFHA 1MQVA 2OJQA 3I4UA 1JOGA 1YZAA 2GDCA 4X0RA 3VYWA 2Y3DA 2XS1A 3MLGA 4MVSA 1LS1A 4O7GA 3C7JA 2IXMA 5KYUB 3S84A 4C7OB 2KNHA 2XL4A 2P0NA 3DKAA 3LJBA 4E17A 2I8BA 5A6KA 1OR3A 2VCAA 1YZCA 1FFHA 1FMVA 1CGOA 3S0XA 4YN0B 3GWNA 3GM3A 1YVIA 2OKUA 4NY3A 4DOZA 4Q7CA 2HJ3A 3BRJA 3UMKA 3IPMO 5E3AA 3X1OA 1Q0MA 3CZ6A 4XLNF 1U0BB 2HZ8A 4CS9A 4YJWA 3A11A 5GPGB 3SEOA 3W2WA 3RH3A 3US6A 2PF4E 4A2NB 5K0IA 4G7ZF 3ASOC 4JVSA 1NU7D 3EGXA 1WGWA 2NSGA 3LLIA 3SXYA 2JX0A 5JUAA 3UR3C 1NFOA 1C02A 1Z6AA 2EPLX 3MFNA 3QMKA 4XEVA 4BG0A 4I1OB 1ZHWA 1MNEA 4MVRA 3EHMA 5KYXA 1VB5A 1U6HA 2VH3A 4JZAA 5KYYA 1CPRA 4Z9HA 4YT4A 1H6GA 1FMWA 1XZQA 4ANJA 3AQCA 3FAJA 2WZGA 2WZFA 4KNVA 5F28E 3ECSA 3NKDA 3L8IA 3M4CA 2A69F 1I4ZA 2H7OA 5B1BC 4N6CA 3U3BA 4U5EE 1Z5ZA 2D4UA 2KYHA 3AJMA 4CJGA 4NCQA 4E0HA 5CI8A 3GEHA 3L8JA 3O6XA 1D0XA 4J30B 4DJ9A 4U5BE 1XZPA 2QNLA 1UFBA 3F46A 3JRMO 4IB4A 5T3TA 4D4XA 5L0FA 1HW1A 3E70C 3G4XA 2YL1A 3ZSUA 1OCOC 3GEEA 2EPNA 4H54A 3GORA 1LM3B 2LFFA 4IAQA 2FGYA 3H65A 2XL6A 3JYHA 4LACB 5EHHA 4ULWA 2HSQA 2MWQA 5A6BD 1KNYA 1M57C 4PJMA 4NTAA 3U8PA 3C8ZA 5JS5A 1ZW2A 3SXMA 5L0GA 2ASRA 5COGA 1T6IA 3S28A 4EUKB 3POVA 3B0UX 1MMNA 3GODA 2IXNA 3V5XA 2EPMX 1GS9A 1ORSC 3IHUA 1D1AA 3RVYA 3QVZA 4EWCA 2KC3A 3VF0A 4NTFA 1GM5A 4ONSA 3VRCA 1B68A 4K1OA 4BPMA 3J06A 2V3CC 1W2WA 2NUTA 5L0DA 1VYKA 3DMDA 1TWAA 2EIKC 1KTMA 1TR2A 3VAYA 3LUTB 2OEXA 3C62A 4B6IA 1I4YA 3TD7A 4C3BA 1GGQA 3T6BA 1JMWA 2AWYA 4DRHB 1TFKB 4PJJA 4DVYP 4ZLDA 2HSBA 4LDRA 1ZW3A 4MVZA 4DRIB 1QZXA 1PD1A 2ZXRA 4U5FE 1G8XA 3EG9B 1SMYF 2HJMA 2J45A 2KGOA 2W9YA 3FXHA 1LI7A 1BR2A 4HEAJ 1OKKA 3ASNC 5D91A 1YJGA 3SP1A 3ZDLA 4EBJA 5KYNA 2TMVP 2R7VA 4MNDA 2XLVA 3RQGA 2W4BA 4CS8C 1YYXA 3JTLO 3EHNA 3C8GA 1O3UA 3NDBB 3KL4A 4XEFA 2YQYA 4M63A 5D92A 2LCHA 1R4TA 3WAQA 3RFYA 3LS0A 1D1CA 4YT8A 1ORJA 3EZIA 5KYUA 4C7OA 4JW1A 2J9WA 4QI0A 1WN0A 1J8MF 1T5OA 2VB6A 1M56C 3KYJA 3NKEA 5HSWA 1JPJA 1QVXA 3T4RA 5JP7A 4BJ5A 4OD5A 1IZMA 3RF3A 3ZVRA 3JYYA 4IARA 4W8KA 4OIOF 2JD3A 2LP4A 1E83A 2YL0A 4J7TA 5A6AA 2LD6A 2OU6A 2R7UA 1BZ4A 3A9CA 3EZHA 4LLEA 4WGZA 4I44A 4BEMJ 2NPUA 1TWGA 4CS7A 2C03A 3E9VA 4XPYA 2JPUA 3JRTA 4N4WA 5F5FA 3ABMC 2HV7A 2J46A 4OD4A 2KK1A 1D0ZA 4JE9A 3ZTZA 4JEAA 4F4BA 4U9EA 3UGPA 4JURI 3U9JA 3TULA 1NG1A 1WASA 2LK4A 5T3WA 3B0VC 2PX0A 1CGME 1EKYA 2CNWA 1PV3A 5JVEA 1HW2A 2NUPB 2R7QA 2OCCC 2R03A 2LSEA 4JKVA 2W45A 1A7VA 4CDAA 3ZQYA 3JZ0A 2QE9A 1RXQA 2XLDA 4K0DA
chains in the Genus database with same CATH topology
1Z7Qc 1YARO 1YAUO 3JTLO 3JSEO 3JRMO 3IPMO 1YA7O 1AVOB 1FNTc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7Q c;  1YAR O;  1YAU O;  3JTL O;  3JSE O;  3JRM O;  3IPM O;  1YA7 O;  1AVO B;  1FNT c; 
#chains in the Genus database with same CATH topology
 2UUH A;  2IM8 A;  2LFD A;  3RW0 A;  4P6I C;  3PCV A;  5B3S C;  3TK0 A;  2R7T A;  2EIL C;  2V26 A;  2P1A A;  3Q6N A;  4JTA B;  5A69 A;  2D5R B;  4MVQ A;  1FAP B;  1NU9 C;  3B9Q A;  3KPH A;  3KH2 A;  1JRA A;  4IJJ A;  2A68 F;  3UMI A;  3HJC A;  4QI2 A;  3L0I A;  3O10 A;  3DZA A;  4EBK A;  2WB7 A;  5DVW A;  4CSA A;  3IQ6 A;  2NSF A;  2Q00 A;  3N24 A;  1RKE B;  3C18 A;  3DM5 A;  5KYW B;  5DQZ A;  1LPE A;  2H7V C;  3GEI A;  1WTY A;  1C17 M;  2A1D D;  2B0J A;  4O6Y A;  4YL1 A;  1TWC A;  3ZG1 A;  3FOO A;  4JTD B;  1BDJ B;  2BC5 A;  1Z23 A;  3EFO B;  2WZL A;  4IAO A;  1NBB A;  1BR1 A;  1QKR A;  1V55 C;  3LAY A;  3ZIB A;  1OW8 A;  1VTM P;  4WAB A;  1OQC A;  3QZC A;  2MHR A;  1A7D A;  2QTV A;  4CX9 A;  2R05 A;  5CI9 A;  1AEP A;  4G0H A;  2HV6 A;  5L0J A;  3GM2 A;  2M64 A;  3KYI A;  1LI5 A;  3RKO F;  5CIV A;  3QW0 A;  5TJ5 E;  2YLG A;  5E33 A;  4Q5S F;  1M6T A;  3AOU A;  1NFN A;  3DXJ F;  1SF8 A;  3JSE O;  3LS1 A;  1ZZP A;  1QQ3 A;  2XLM A;  4GQH A;  1YLM A;  4ZLC A;  3NMK A;  1UG7 A;  3EQL F;  3HNL A;  2KW3 C;  5L0H A;  2YLI A;  4E7Z A;  2BL2 A;  2Y39 A;  1Z63 A;  2O9X A;  1A41 A;  2HS5 A;  3DE8 A;  3JCU Q;  1GQA A;  4FWV A;  1Z3I X;  4JEB A;  3NG1 A;  5DQT A;  3PDM P;  1NLX A;  1WAT A;  1XWJ A;  2ICW G;  4KBL A;  4LDQ A;  3OA1 A;  4U5G A;  4BJT A;  4DVZ A;  4BJ6 C;  3U3F A;  4JJG A;  1TKN A;  2Q9A A;  3S9O A;  4FAP B;  2Y69 C;  2CCY A;  3WG7 C;  2CW0 F;  4OIN F;  2XL8 A;  4I1M A;  5AC4 A;  2I15 A;  3NYJ A;  3CSK A;  4AE4 B;  1VLS A;  2X0C A;  1OKK D;  2OEV A;  2Q4F A;  4MVO A;  2OG2 A;  4CDY A;  3DJU B;  4XTK A;  3PHF 2;  1V4A A;  3EGD B;  3EGX B;  3B0P A;  4JTC B;  3TOM A;  1H9T A;  1Z7Q c;  4FX5 A;  1YAR O;  4LER A;  3I5P A;  3SZR A;  1YAU O;  2VC9 A;  2YL3 A;  2Y3B A;  3C8G D;  1APC A;  2J9V A;  1M2O A;  2HFI A;  2AVK A;  4G7O F;  4HFF B;  1T01 A;  3N0T A;  5F5H A;  5FCL A;  2R7O A;  2QY9 A;  3QW1 A;  4N6H A;  3K1H A;  1F1M A;  3AG3 C;  1MMG A;  3RYL A;  3W2V A;  2QLA A;  1HE9 A;  1BBH A;  1L7C A;  2IYL D;  4MQ9 F;  4E18 A;  3EH1 A;  2GAQ A;  1N1C A;  2R9R B;  1CPQ A;  3Q7L A;  1V74 B;  3UMH A;  4CS8 A;  1ZVZ A;  2IXP A;  3ABL C;  2X51 A;  1OCZ C;  3HNJ A;  4DRJ B;  3O39 A;  2OQM A;  1OW7 A;  4YT5 A;  2XLE A;  3M4B A;  1A0B A;  3PMR A;  1K05 A;  2Y3G A;  3FMS A;  3K1I C;  3U8V A;  5DLJ A;  2H8A A;  5BQG A;  4KNW A;  1JPN A;  4DXW A;  2H7B A;  2PNO A;  2G3V A;  4DBR A;  1HY5 A;  4EBB A;  3Q7G A;  3IQ5 A;  2ZD9 A;  4CDV A;  1E84 A;  4CSA C;  2IOQ A;  1LVK A;  3N2Z B;  3O55 A;  5DS6 A;  1J8Y F;  3LEV A;  1MMD A;  2RD9 A;  1DOW A;  2YL7 A;  3KKB A;  5BQH A;  3JSZ A;  4KI2 A;  2CNW D;  2RSE B;  3KMI A;  1RCP A;  3S27 A;  2F22 A;  2HMQ A;  1VLT A;  1RKC A;  1IW7 F;  1ZU4 A;  2CYD A;  2ETS A;  2A6E F;  4A4A A;  2Q9B A;  1VK5 A;  1ZU5 A;  2XM0 A;  1A7E A;  3BEH A;  4G78 A;  1AVO B;  3FAP B;  2A0B A;  4JCZ A;  3TOL A;  2MYS A;  2CGE A;  2XXA A;  5JRA A;  1O5H A;  3H2V A;  3JT1 A;  4L6R A;  4YK5 A;  1SZI A;  2DI3 A;  1JR8 A;  1LE2 A;  2J0W A;  2ZPA A;  1SYQ A;  3R2P A;  1RKE A;  3W8H A;  2PBE A;  4AX2 A;  3SXK A;  5DS4 A;  1SR2 A;  2J7P A;  2NUT B;  5KYW A;  4OIQ F;  2Z15 A;  3AG4 C;  2A6H F;  3AGU A;  1VYI A;  1D1B A;  2UUI A;  3FVY A;  3NMJ A;  4LDK A;  1TQG A;  4RDA A;  4NTB A;  2YWA A;  3K33 A;  2YLD A;  2ZXO A;  3ITF A;  4WJ0 A;  1LIH A;  2R7S A;  1I5N A;  1HE1 A;  1U89 A;  4CIH A;  3M1C B;  4PK4 A;  2AU5 A;  4PJN A;  1T6U A;  4YT2 A;  4W8P A;  4H4K C;  3T6G B;  3M79 A;  2OOC A;  4BJ5 C;  3MX3 A;  5BQI A;  3W8I A;  3U9M A;  3C63 A;  1BR4 A;  1Y4C A;  2EPK X;  4OIR F;  3ZQV A;  1TFO B;  4NC3 A;  3SYN A;  5L0I A;  2G62 A;  4PAC A;  3VM6 A;  1K40 A;  4AL0 A;  4MW8 A;  3ZC4 A;  5AGF A;  3HKK A;  4PR9 A;  2YKZ A;  1K04 A;  3AGT A;  3F47 A;  3CAX A;  3TQO A;  4MW3 A;  1MND A;  3HNI A;  3DI5 A;  2G3K A;  5L3Q A;  3DM9 B;  1WWP A;  2QUP A;  3EPV A;  2B0H A;  4RD9 A;  4PJL A;  5EK0 A;  3U0C A;  2PX3 A;  3U2M A;  3IQT A;  4E7S A;  4U5D E;  3L1M A;  1RJ9 B;  2L6G A;  3WHN A;  2KSF A;  1VMA A;  3G50 A;  4XPW A;  4YWQ A;  3FDQ A;  1R5I D;  3Q6M A;  3AG2 C;  3DE9 A;  2WVO A;  1ZHT A;  3RVZ A;  2Y3H A;  3S29 A;  3DJN B;  4P9F A;  1JAF A;  4O6N A;  4JCH A;  3G4Z A;  2DB4 A;  1Q0D A;  1OXK A;  1D0Y A;  4ULV A;  4AE4 A;  2P6V A;  3DWW A;  2XM4 A;  3TJ5 A;  4AK9 A;  3OWT A;  3EGD A;  2ZXW C;  4YL3 A;  1PCX A;  4PFP A;  3UGO A;  2XLW A;  1M2V B;  5E2Q A;  4I3M A;  1ZHY A;  4CS9 C;  3GM1 A;  2EPO A;  5JSL A;  3U5S A;  4EIY A;  1OR2 A;  4EHP A;  2VCC A;  1YDI A;  1Q0G A;  2NG1 A;  3L34 A;  4EKW A;  4LLC A;  4IGG A;  2KQ9 A;  3ATP A;  2PFD A;  3LNR A;  1MMA A;  2L6F A;  3CQZ A;  1LS4 A;  5JLI A;  3OEO A;  2YEV A;  1Q0F A;  4MTG A;  1NSG B;  2L6H A;  3LLK A;  3DAF A;  5FZT A;  2HUJ A;  2L81 A;  2XSE A;  1QSP A;  2FFH A;  3EG9 A;  2YZS A;  2EIM C;  2IBF A;  4WGY A;  4BJ6 A;  3V5Z A;  4XLP F;  1HMD A;  3AG1 C;  2J9B A;  2P61 A;  3LES A;  2WL8 A;  3K7D A;  1OCR C;  2LQG A;  1HMO A;  2LIG A;  3R7C A;  1DOV A;  1G4W R;  3V7O A;  4C3E A;  4U5H A;  4Q4Z F;  1YA9 A;  5COM A;  2DYR C;  4JRZ A;  5T1D B;  4XQ1 A;  2WVN A;  4U5C E;  3RQE A;  3QVY A;  4PFO A;  4JJF A;  5EGY A;  3U2L A;  1FR0 A;  1OW6 A;  3ZWI A;  3DD7 A;  1QLE C;  3V5Y A;  4O6M A;  4BEJ A;  5B3I A;  3NRH A;  2OJE D;  3ABK C;  4K7B A;  2J8W A;  3NYL A;  2FAP B;  3CEX A;  4CIP A;  4RBN A;  4BJ1 A;  5KYX B;  1FTS A;  2XS8 A;  3SXZ A;  5DS5 A;  1YYJ A;  5COF A;  4MS2 A;  2R7R A;  5HV9 A;  5KYY B;  1FFT C;  1LE4 A;  4NQF A;  5JT4 A;  1S05 A;  1OCC C;  4FES A;  2ZXP A;  3HNK A;  4Z9I A;  256B A;  5B1A C;  2R02 A;  3K1I A;  3RQF A;  1RMV A;  3S90 A;  2Q9C A;  2XXA B;  5L0C A;  2HMZ A;  2YHS A;  4MVM A;  4XEK A;  3GWL A;  3LNM B;  1AUE A;  3RIP A;  2AP3 A;  1NZE A;  2IXO A;  1ST6 A;  3MBG A;  4XWJ A;  1YA7 O;  1OXB A;  1ZYR F;  2L7A A;  2R25 A;  1PD0 A;  5A6B A;  4R32 A;  1T6Q A;  4CBE A;  1H9G A;  4GYT A;  4MTF A;  2XLH A;  2M4E A;  2AWC A;  2EIJ C;  2J0X A;  4IRU A;  5A6J A;  3AQB A;  3FHD A;  1E2X A;  2J7P D;  2NUP A;  4ER9 A;  1WOL A;  1QPU A;  1TWH A;  4JC7 A;  2VCB A;  2E87 A;  3LEO A;  2C04 A;  2DYS C;  2GWW A;  3NYM A;  4GEH A;  4Z9J A;  4N06 A;  3HLZ A;  1EQ1 A;  4UDV A;  4HE8 D;  2KJG A;  1FNT c;  2J9U A;  4G7H F;  2EIN C;  1EA8 A;  3IEE A;  2P7V A;  3W4Y A;  2R7X A;  4U9D A;  3T9O A;  4KC9 A;  2L9J A;  4MTO A;  1ZHX A;  2GA0 A;  2YVK A;  3NMI A;  3IQC A;  3MYF A;  3WOD F;  3EH2 A;  1EI7 A;  4O79 A;  1E85 A;  4MVU A;  3SNH A;  2PP4 A;  1H7I A;  2BE5 F;  1ZHZ A;  3B29 A;  1E86 A;  4C3D A;  2Q3T A;  1T9K A;  3GAN A;  3ZTM A;  1Y6D A;  4IWB A;  2DGJ A;  2WVQ A;  3M15 A;  4YL0 A;  4OIP F;  1Q0K A;  3X2Q C;  1RJ9 A;  1KU2 A;  2R7W A;  3DAG A;  4XPX A;  1ORY A;  2VAS A;  3K6B A;  5AC5 A;  3FOP A;  1G4U S;  1VOM A;  3B71 A;  3QTH A;  4QDL A;  3EFO A;  3I5Q A;  4D4N A;  4AL1 A;  5BUO A;  4JIO A;  4DBQ A;  3K66 A;  1S7Z A;  4HFK B;  3H2U A;  1O87 A;  1LKX A;  3T6J A;  4J7Y A;  5L3V A;  2Q7R A;  4P9T A;  2XRH A;  3EJN A;  1C03 A;  1L3P A;  1M2V A;  3TJ6 A;  3HTK C;  4E0I A;  2YRF A;  4CJO A;  2HKV A;  1CGN A;  2CDQ A;  2XLO A;  5E3C A;  3C8G B;  4J32 B;  3UNG C;  5IY5 C;  2W4M A;  3MYI A;  1G5Z A;  1V54 C;  2A0U A;  2GFH A;  1MQV A;  2OJQ A;  3I4U A;  1JOG A;  1YZA A;  2GDC A;  4X0R A;  3VYW A;  2Y3D A;  2XS1 A;  3MLG A;  4MVS A;  1LS1 A;  4O7G A;  3C7J A;  2IXM A;  5KYU B;  3S84 A;  4C7O B;  2KNH A;  2XL4 A;  2P0N A;  3DKA A;  3LJB A;  4E17 A;  2I8B A;  5A6K A;  1OR3 A;  2VCA A;  1YZC A;  1FFH A;  1FMV A;  1CGO A;  3S0X A;  4YN0 B;  3GWN A;  3GM3 A;  1YVI A;  2OKU A;  4NY3 A;  4DOZ A;  4Q7C A;  2HJ3 A;  3BRJ A;  3UMK A;  3IPM O;  5E3A A;  3X1O A;  1Q0M A;  3CZ6 A;  4XLN F;  1U0B B;  2HZ8 A;  4CS9 A;  4YJW A;  3A11 A;  5GPG B;  3SEO A;  3W2W A;  3RH3 A;  3US6 A;  2PF4 E;  4A2N B;  5K0I A;  4G7Z F;  3ASO C;  4JVS A;  1NU7 D;  3EGX A;  1WGW A;  2NSG A;  3LLI A;  3SXY A;  2JX0 A;  5JUA A;  3UR3 C;  1NFO A;  1C02 A;  1Z6A A;  2EPL X;  3MFN A;  3QMK A;  4XEV A;  4BG0 A;  4I1O B;  1ZHW A;  1MNE A;  4MVR A;  3EHM A;  5KYX A;  1VB5 A;  1U6H A;  2VH3 A;  4JZA A;  5KYY A;  1CPR A;  4Z9H A;  4YT4 A;  1H6G A;  1FMW A;  1XZQ A;  4ANJ A;  3AQC A;  3FAJ A;  2WZG A;  2WZF A;  4KNV A;  5F28 E;  3ECS A;  3NKD A;  3L8I A;  3M4C A;  2A69 F;  1I4Z A;  2H7O A;  5B1B C;  4N6C A;  3U3B A;  4U5E E;  1Z5Z A;  2D4U A;  2KYH A;  3AJM A;  4CJG A;  4NCQ A;  4E0H A;  5CI8 A;  3GEH A;  3L8J A;  3O6X A;  1D0X A;  4J30 B;  4DJ9 A;  4U5B E;  1XZP A;  2QNL A;  1UFB A;  3F46 A;  3JRM O;  4IB4 A;  5T3T A;  4D4X A;  5L0F A;  1HW1 A;  3E70 C;  3G4X A;  2YL1 A;  3ZSU A;  1OCO C;  3GEE A;  2EPN A;  4H54 A;  3GOR A;  1LM3 B;  2LFF A;  4IAQ A;  2FGY A;  3H65 A;  2XL6 A;  3JYH A;  4LAC B;  5EHH A;  4ULW A;  2HSQ A;  2MWQ A;  5A6B D;  1KNY A;  1M57 C;  4PJM A;  4NTA A;  3U8P A;  3C8Z A;  5JS5 A;  1ZW2 A;  3SXM A;  5L0G A;  2ASR A;  5COG A;  1T6I A;  3S28 A;  4EUK B;  3POV A;  3B0U X;  1MMN A;  3GOD A;  2IXN A;  3V5X A;  2EPM X;  1GS9 A;  1ORS C;  3IHU A;  1D1A A;  3RVY A;  3QVZ A;  4EWC A;  2KC3 A;  3VF0 A;  4NTF A;  1GM5 A;  4ONS A;  3VRC A;  1B68 A;  4K1O A;  4BPM A;  3J06 A;  2V3C C;  1W2W A;  2NUT A;  5L0D A;  1VYK A;  3DMD A;  1TWA A;  2EIK C;  1KTM A;  1TR2 A;  3VAY A;  3LUT B;  2OEX A;  3C62 A;  4B6I A;  1I4Y A;  3TD7 A;  4C3B A;  1GGQ A;  3T6B A;  1JMW A;  2AWY A;  4DRH B;  1TFK B;  4PJJ A;  4DVY P;  4ZLD A;  2HSB A;  4LDR A;  1ZW3 A;  4MVZ A;  4DRI B;  1QZX A;  1PD1 A;  2ZXR A;  4U5F E;  1G8X A;  3EG9 B;  1SMY F;  2HJM A;  2J45 A;  2KGO A;  2W9Y A;  3FXH A;  1LI7 A;  1BR2 A;  4HEA J;  1OKK A;  3ASN C;  5D91 A;  1YJG A;  3SP1 A;  3ZDL A;  4EBJ A;  5KYN A;  2TMV P;  2R7V A;  4MND A;  2XLV A;  3RQG A;  2W4B A;  4CS8 C;  1YYX A;  3JTL O;  3EHN A;  3C8G A;  1O3U A;  3NDB B;  3KL4 A;  4XEF A;  2YQY A;  4M63 A;  5D92 A;  2LCH A;  1R4T A;  3WAQ A;  3RFY A;  3LS0 A;  1D1C A;  4YT8 A;  1ORJ A;  3EZI A;  5KYU A;  4C7O A;  4JW1 A;  2J9W A;  4QI0 A;  1WN0 A;  1J8M F;  1T5O A;  2VB6 A;  1M56 C;  3KYJ A;  3NKE A;  5HSW A;  1JPJ A;  1QVX A;  3T4R A;  5JP7 A;  4BJ5 A;  4OD5 A;  1IZM A;  3RF3 A;  3ZVR A;  3JYY A;  4IAR A;  4W8K A;  4OIO F;  2JD3 A;  2LP4 A;  1E83 A;  2YL0 A;  4J7T A;  5A6A A;  2LD6 A;  2OU6 A;  2R7U A;  1BZ4 A;  3A9C A;  3EZH A;  4LLE A;  4WGZ A;  4I44 A;  4BEM J;  2NPU A;  1TWG A;  4CS7 A;  2C03 A;  3E9V A;  4XPY A;  2JPU A;  3JRT A;  4N4W A;  5F5F A;  3ABM C;  2HV7 A;  2J46 A;  4OD4 A;  2KK1 A;  1D0Z A;  4JE9 A;  3ZTZ A;  4JEA A;  4F4B A;  4U9E A;  3UGP A;  4JUR I;  3U9J A;  3TUL A;  1NG1 A;  1WAS A;  2LK4 A;  5T3W A;  3B0V C;  2PX0 A;  1CGM E;  1EKY A;  2CNW A;  1PV3 A;  5JVE A;  1HW2 A;  2NUP B;  2R7Q A;  2OCC C;  2R03 A;  2LSE A;  4JKV A;  2W45 A;  1A7V A;  4CDA A;  3ZQY A;  3JZ0 A;  2QE9 A;  1RXQ A;  2XLD A;  4K0D A; 
#chains in the Genus database with same CATH homology
 1Z7Q c;  1YAR O;  1YAU O;  3JTL O;  3JSE O;  3JRM O;  3IPM O;  1YA7 O;  1AVO B;  1FNT c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...