1AVOB

Proteasome activator reg(alpha)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
140
structure length
140
Chain Sequence
AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the proteasome activator REGalpha (PA28alpha).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteasome activator
molecule keywords 11S REGULATOR
total genus 57
structure length 140
sequence length 140
chains with identical sequence D, F, H, J, L, N
ec nomenclature
pdb deposition date 1997-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1avoB00
1YA7O 1YARO 1YAUO 1AVOB 3JTLO 3JSEO 3JRMO 3IPMO 1Z7Qc 1FNTc
chains in the Genus database with same CATH superfamily
3WAQA 3B9QA 3Q7GA 2G3VA 4XEKA 4YL3A 5KYXA 2W4BA 4C7OA 1YA9A 1NFNA 4J30B 4MVUA 4WGYA 4Z9JA 2EPKX 2VH3A 3DXJF 1YVIA 4J32B 4KI2A 3B29A 2LSEA 1WN0A 4BJ6C 2W9YA 2G62A 1VYIA 2P6VA 4Z9HA 1PD1A 2NSGA 2XL4A 1EI7A 1LVKA 1RKEA 2A0UA 2QTVA 3L0IA 5KYWB 2FFHA 2NUTA 5FCLA 2Q9AA 1YZCA 2BE5F 1ZHZA 1TQGA 2C03A 2GDCA 3N2ZB 4N6CA 3V7OA 5DLJA 4DVZA 5T3WA 3EHMA 2L7AA 1E83A 3RVZA 1ORJA 1V4AA 2EIMC 2H7OA 1Q0DA 2DB4A 4OIQF 1VLTA 1F1MA 1U89A 2XLWA 2XLEA 1FTSA 2WZGA 5BQHA 3VRCA 4ULWA 3H65A 1HE1A 2VCAA 2R7UA 2CNWA 3VF0A 1HMDA 4XPWA 1OCCC 3DZAA 1V55C 5A6AA 1ORSC 1OW8A 2B0HA 4YJWA 1Q0GA 4C3DA 5KYYB 3OA1A 1K05A 4XLNF 4A4AA 2PF4E 3LNMB 2ZXOA 1UFBA 3QW0A 2VASA 1D1BA 3A11A 4MW8A 3HNJA 2CDQA 1Q0KA 3QW1A 3T6BA 2IXNA 4G7HF 1WGWA 1VK5A 2PBEA 4LDKA 2J7PA 3A9CA 3ZTZA 1B68A 1U0BB 2MYSA 4O6MA 1G4US 5TJ5E 3LUTB 1L7CA 2A68F 3U0CA 1H7IA 1FR0A 2KW3C 4MVMA 3C62A 3EG9A 3LJBA 3NKEA 3PCVA 3SXZA 2Q9BA 1HY5A 3TQOA 4FWVA 2OJQA 2J0XA 1G5ZA 2NUTB 4N06A 2GA0A 4OD5A 3HJCA 3E70C 3QMKA 1BR4A 1Z63A 2NSFA 2OU6A 4HE8D 2OQMA 2WVNA 3EJNA 1S05A 2R7OA 3NKDA 4RBNA 3TJ5A 5AC4A 4P6IC 4YK5A 5A6JA 5JT4A 1RCPA 2VCBA 3IQCA 4NTAA 2ICWG 3ABLC 1NU9C 3Q7LA 2QLAA 2WZFA 1JMWA 3W2WA 2IM8A 5KYXB 2IXPA 1TFKB 2DI3A 3U8PA 3V5ZA 3AGUA 3K33A 1SF8A 2A6HF 1VLSA 2Y3DA 5L0FA 2UUHA 3ZDLA 2CW0F 3AG1C 3DJUB 4I1OB 4DJ9A 3RFYA 2OG2A 2CYDA 3JRMO 4U5EE 2Y3HA 3ZVRA 1MMDA 2GWWA 4E0IA 3NYLA 1FNTc 4JJGA 2NG1A 3GODA 1OXKA 1G4WR 1JPJA 4B6IA 2J9BA 1NU7D 1OCZC 3DD7A 3FXHA 3HLZA 4JZAA 3U9MA 3ZSUA 3CZ6A 4CBEA 1T6IA 2ASRA 4E0HA 5BUOA 4DRJB 2H7BA 4D4XA 4X0RA 2YEVA 4DRHB 4DRIB 2EPMX 2J0WA 3I4UA 3LEVA 2JX0A 3MLGA 2I8BA 3QVZA 4KNWA 2EPOA 1M57C 2PP4A 5A69A 1PCXA 1AVOB 4U5BE 4YN0B 2YWAA 1RKCA 3S27A 2XXAB 4DOZA 1JAFA 4UDVA 2LQGA 3DJNB 1NZEA 3WG7C 3W4YA 4JCHA 3OEOA 4IARA 5L0DA 2R7RA 2WZLA 2KQ9A 4N4WA 3AOUA 2KYHA 4YL1A 1YYJA 2QY9A 1FFTC 1QVXA 4U5DE 3KL4A 3FDQA 2NPUA 3I5QA 4G0HA 2HZ8A 2KNHA 4YT5A 3W8IA 3W8HA 4MVZA 4W8PA 1T5OA 2OKUA 4JW1A 1OW6A 2YVKA 4JEBA 4WGZA 2IXOA 2LK4A 4BJ5A 3PHF2 4YT2A 1KNYA 5A6BA 4AL1A 4OIPF 1LS4A 5GPGB 3M4BA 3H2UA 3UMIA 4MQ9F 1KTMA 2DGJA 3AQBA 3EFOA 1HW2A 4OD4A 4IB4A 4BG0A 1T6UA 4XWJA 1R5ID 5DS5A 4BJTA 2PFDA 2WVQA 1H6GA 1SMYF 2L9JA 1I5NA 3FVYA 3JZ0A 4YWQA 5EHHA 4LACB 3UGPA 3HNIA 1NLXA 5L3VA 3MBGA 2HKVA 3IHUA 3IEEA 4RDAA 4PJMA 5B3SC 4P9FA 1LPEA 3LESA 4JTCB 2MHRA 3MYFA 3ZWIA 2P1AA 3LAYA 4JJFA 3R7CA 1W2WA 3EH1A 4DXWA 3RQGA 4G7OF 2M64A 3K1HA 3U3BA 1RKEB 2C04A 3C63A 1ZYRF 5CI9A 1Y6DA 1TKNA 2ETSA 3AQCA 3L8JA 4MTGA 1C17M 2EPLX 4A2NB 1IZMA 2YL7A 3M4CA 3ZTMA 4G78A 3CQZA 5B1AC 4E17A 4GQHA 1CGME 2UUIA 3EHNA 3HNLA 4Z9IA 2R7WA 5DVWA 1NBBA 3H2VA 1MMGA 2HFIA 2GFHA 3C7JA 2YLIA 3DI5A 2I15A 3ECSA 3LS0A 4JTDB 1SYQA 4DBQA 3VYWA 2AVKA 4PR9A 2J46A 3EZHA 4EWCA 1UG7A 2LCHA 3C8GD 3ITFA 3M1CB 4NTFA 4XEFA 4PFOA 2OEVA 2AWYA 5E3AA 3DM5A 3UMHA 4PACA 1GGQA 2W4MA 5COGA 3SP1A 2NUPB 2VB6A 3ZG1A 2X51A 3ASNC 3TJ6A 1BR1A 1BZ4A 2E87A 5FZTA 3NMIA 1A7VA 1D0XA 2EIJC 3JTLO 2YLDA 1WWPA 2WVOA 2Y39A 3CEXA 3Q6MA 3EG9B 4MVOA 1OCOC 4LERA 1A7DA 1DOVA 2RD9A 2XLHA 4CX9A 2Q4FA 4BPMA 5COFA 3FHDA 2JPUA 3S90A 1OR2A 1MMAA 2ZD9A 3T4RA 1K40A 4XTKA 1NG1A 3FOPA 4AE4B 1E2XA 2LFFA 3MFNA 4EUKB 1NFOA 1RXQA 2Q3TA 4OIRF 2BC5A 256BA 2R02A 2HJMA 2IBFA 3EGDA 3LLKA 2IOQA 3PMRA 1QQ3A 5B1BC 5JS5A 3DAFA 4LLCA 4O7GA 2AP3A 4XEVA 3QVYA 3GWNA 5D91A 5L0JA 3NMJA 2XXAA 4MS2A 1VMAA 1R4TA 4E7SA 5DQZA 3DMDA 5K0IA 1O87A 3BRJA 4ONSA 2VC9A 3C8GB 3JCUQ 3S28A 2ZPAA 1JR8A 3AG4C 5AC5A 4G7ZF 1I4ZA 4WJ0A 5JLIA 4CDYA 3DAGA 2A0BA 5BQGA 3FOOA 4NCQA 4I3MA 1CGNA 4KNVA 1YZAA 1EA8A 3QTHA 4FX5A 2R7SA 4L6RA 2GAQA 4JE9A 5L0CA 1MQVA 4DBRA 4JVSA 1XZPA 1ZHYA 3W2VA 3EH2A 1LKXA 1WATA 2F22A 2QNLA 3HKKA 3JT1A 1Y4CA 4MTOA 1FMWA 5EGYA 2HSQA 4CIPA 1M2VB 3ATPA 3QZCA 1PV3A 4ZLDA 2LP4A 3B0PA 3LS1A 4M63A 2WL8A 3FMSA 4PJNA 4GYTA 2ZXWC 1OQCA 4F4BA 4NQFA 2Z15A 1JOGA 2DYSC 3DE8A 4RD9A 5EK0A 5CIVA 1BDJB 2L6GA 1CPQA 2Y3GA 2J9UA 1LE2A 3M79A 3M15A 3US6A 3SXYA 1QZXA 2HJ3A 3S29A 4AL0A 3G50A 4JTAB 2BL2A 4J7TA 3RQFA 2OJED 2HSBA 3SEOA 2R7VA 4BJ5C 3U2LA 2XLVA 3X2QC 1BBHA 4XLPF 4XQ1A 3TK0A 1MNDA 3RVYA 4EKWA 1M56C 3F47A 3L8IA 3ABMC 3O55A 3POVA 1D0ZA 2OCCC 4JKVA 3RKOF 3EGXA 4LDRA 2P7VA 4ANJA 1LIHA 4PFPA 1ORYA 2XM4A 4MTFA 1FFHA 3FAPB 3J06A 3G4XA 1TWHA 4ZLCA 1APCA 4WABA 1JRAA 2MWQA 2G3KA 3DWWA 5F28E 3TOMA 4MVQA 4NC3A 2A6EF 3CSKA 3N0TA 3NG1A 1VB5A 4FESA 4AE4A 5DS4A 1GM5A 3NDBB 4NY3A 2DYRC 3DE9A 2HS5A 4CDAA 1TWAA 2VCCA 4BEMJ 2KSFA 4YL0A 1GQAA 3L34A 3T6JA 4CS7A 3WHNA 4ER9A 1ZW2A 1FMVA 3GEEA 3B0UX 3DKAA 4CJOA 4O6YA 2Q00A 3BEHA 1MNEA 1TR2A 2H7VC 1L3PA 2EILC 4JRZA 4XPYA 1QPUA 3EQLF 3RH3A 2V3CC 3RYLA 1BR2A 3NMKA 3O10A 5T3TA 2L81A 2W45A 4PJLA 2KK1A 1PD0A 3AJMA 1Q0FA 1YDIA 1Q0MA 3FAJA 4I1MA 4KC9A 1XZQA 3AGTA 4U5GA 2Q9CA 1FAPB 1T9KA 1VYKA 1DOWA 2R7QA 4IGGA 5DQTA 2XL8A 3U2MA 5T1DB 1O5HA 1J8MF 4AK9A 3N24A 5E33A 2LFDA 5KYWA 1Z6AA 3GM3A 1C02A 1LM3B 4JC7A 2D5RB 4MNDA 4Q7CA 3VM6A 1IW7F 1WASA 3LEOA 3LNRA 3O39A 4J7YA 1OKKA 4QI2A 3KKBA 2EIKC 3MX3A 5COMA 3ZQYA 5L0IA 1C03A 2XS1A 4JIOA 3ASOC 1LS1A 1WOLA 1Z23A 3V5YA 1ZU4A 3PDMP 1J8YF 3EZIA 2AWCA 4MVSA 3S9OA 3C8GA 4CS8C 2XLDA 2QUPA 1M2VA 1Z3IX 3IQ6A 3VAYA 4QDLA 1OXBA 4JCZA 1LI7A 1Z5ZA 3C18A 4U9DA 1RJ9A 4H54A 3K66A 4CS9A 1Z7Qc 1U6HA 2J45A 4P9TA 1JPNA 1YA7O 2XRHA 4EHPA 3K6BA 2J9VA 1WTYA 3KH2A 2O9XA 2EINC 2R9RB 3UMKA 2OOCA 1M6TA 5L0GA 3E9VA 3EFOB 3SXKA 4CDVA 4E18A 5JRAA 1A41A 2KGOA 4D4NA 2CCYA 2XLOA 1A7EA 1ZW3A 4HFFB 2YLGA 3X1OA 4N6HA 3B0VC 1TWGA 5A6KA 4LLEA 1YJGA 4HFKB 1CGOA 3CAXA 2X0CA 2EPNA 3O6XA 4IWBA 1N1CA 1SR2A 2LIGA 1D0YA 4QI0A 3GORA 2HMQA 2HV6A 3U9JA 2XL6A 3GEHA 1RMVA 2Y3BA 2YZSA 3K7DA 4BJ6A 5B3IA 1XWJA 4H4KC 1H9GA 4PJJA 3SNHA 2R7XA 1T6QA 3DM9B 2LD6A 2XS8A 2YL0A 3EPVA 2NUPA 5KYUB 3UR3C 1ST6A 3TD7A 3U8VA 4CS9C 1HE9A 1AUEA 1YARO 2ZXRA 1KU2A 3ZC4A 2KJGA 3JSEO 4LDQA 3ZQVA 3JYYA 2R03A 1H9TA 1EKYA 3EGXB 4JEAA 4CJGA 5JUAA 4CSAA 3RF3A 1M2OA 1E86A 4EBBA 3GM1A 4OINF 1YYXA 4BEJA 1AEPA 5DS6A 3KYIA 2B0JA 3G4ZA 2R05A 1D1CA 4O79A 3OWTA 2FAPB 4GEHA 4E7ZA 3GEIA 4Q5SF 3K1IC 2HMZA 4CIHA 2PX0A 2PNOA 2R25A 2R7TA 2P0NA 4O6NA 5BQIA 2OEXA 2D4UA 4MW3A 5F5FA 2XLMA 4C7OB 5IY5C 2J9WA 1D1AA 4ULVA 1NSGB 2H8AA 1OR3A 2IXMA 2AU5A 2J8WA 3S84A 4C3EA 5F5HA 1ZZPA 3NYMA 3ZIBA 1E84A 4IAQA 3HNKA 4PK4A 4CS8A 4EBJA 2YL3A 1I4YA 1O3UA 1SZIA 2A69F 2KC3A 3NRHA 1MMNA 5KYUA 2Q7RA 1LE4A 2WB7A 4YT8A 1YLMA 1HW1A 2YL1A 4NTBA 4R32A 1V74B 2IYLD 5JP7A 4EBKA 2M4EA 4KBLA 2CGEA 5HV9A 4IAOA 4K1OA 1QKRA 4IRUA 3RIPA 1EQ1A 2YQYA 2YHSA 2A1DD 3S0XA 2HUJA 1HMOA 2PX3A 2YKZA 3L1MA 3U5SA 4BJ1A 1ZHXA 3WODF 1VOMA 3NYJA 5KYNA 5L3QA 5HSWA 1A0BA 1LI5A 1OW7A 1S7ZA 3RW0A 3UNGC 3V5XA 4U5FE 4OIOF 2TMVP 1V54C 1TWCA 3IPMO 4U9EA 1T01A 3SZRA 3U3FA 3F46A 3EGDB 4I44A 4W8KA 1YAUO 4U5CE 4MVRA 4EIYA 5KYYA 2XSEA 3TULA 3AG3C 4JURI 2L6FA 2HV7A 3UGOA 4HEAJ 3GM2A 3JYHA 5JSLA 3SXMA 3GWLA 3SYNA 3MYIA 1QLEC 1VTMP 1OCRC 5L0HA 3Q6NA 1RJ9B 1GS9A 1ZHWA 5JVEA 2L6HA 1G8XA 3JSZA 2Y69C 3T6GB 3TOLA 4C3BA 5CI8A 2JD3A 3JRTA 4FAPB 2P61A 3C8ZA 2QE9A 3KPHA 3HTKC 1OKKD 3GANA 3LLIA 3K1IA 3AG2C 3ABKC 1E85A 4U5HA 2CNWD 2XM0A 5E3CA 2FGYA 1ZVZA 1K04A 2RSEB 3R2PA 5AGFA 1ZU5A 4K0DA 5E2QA 4DVYP 5A6BD 4K7BA 4IJJA 3IQTA 4XPXA 3RQEA 4Q4ZF 3KYJA 5D92A 1CPRA 2YRFA 3B71A 4CSAC 3T9OA 2ZXPA 3IQ5A 2V26A 4AX2A 1ZHTA 1QSPA 3I5PA 3KMIA 4YT4A 1TFOB 2J7PD
chains in the Genus database with same CATH topology
1YA7O 1YARO 1YAUO 1AVOB 3JTLO 3JSEO 3JRMO 3IPMO 1Z7Qc 1FNTc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA7 O;  1YAR O;  1YAU O;  1AVO B;  3JTL O;  3JSE O;  3JRM O;  3IPM O;  1Z7Q c;  1FNT c; 
#chains in the Genus database with same CATH topology
 3WAQ A;  3B9Q A;  3Q7G A;  2G3V A;  4XEK A;  4YL3 A;  5KYX A;  2W4B A;  4C7O A;  1YA9 A;  1NFN A;  4J30 B;  4MVU A;  4WGY A;  4Z9J A;  2EPK X;  2VH3 A;  3DXJ F;  1YVI A;  4J32 B;  4KI2 A;  3B29 A;  2LSE A;  1WN0 A;  4BJ6 C;  2W9Y A;  2G62 A;  1VYI A;  2P6V A;  4Z9H A;  1PD1 A;  2NSG A;  2XL4 A;  1EI7 A;  1LVK A;  1RKE A;  2A0U A;  2QTV A;  3L0I A;  5KYW B;  2FFH A;  2NUT A;  5FCL A;  2Q9A A;  1YZC A;  2BE5 F;  1ZHZ A;  1TQG A;  2C03 A;  2GDC A;  3N2Z B;  4N6C A;  3V7O A;  5DLJ A;  4DVZ A;  5T3W A;  3EHM A;  2L7A A;  1E83 A;  3RVZ A;  1ORJ A;  1V4A A;  2EIM C;  2H7O A;  1Q0D A;  2DB4 A;  4OIQ F;  1VLT A;  1F1M A;  1U89 A;  2XLW A;  2XLE A;  1FTS A;  2WZG A;  5BQH A;  3VRC A;  4ULW A;  3H65 A;  1HE1 A;  2VCA A;  2R7U A;  2CNW A;  3VF0 A;  1HMD A;  4XPW A;  1OCC C;  3DZA A;  1V55 C;  5A6A A;  1ORS C;  1OW8 A;  2B0H A;  4YJW A;  1Q0G A;  4C3D A;  5KYY B;  3OA1 A;  1K05 A;  4XLN F;  4A4A A;  2PF4 E;  3LNM B;  2ZXO A;  1UFB A;  3QW0 A;  2VAS A;  1D1B A;  3A11 A;  4MW8 A;  3HNJ A;  2CDQ A;  1Q0K A;  3QW1 A;  3T6B A;  2IXN A;  4G7H F;  1WGW A;  1VK5 A;  2PBE A;  4LDK A;  2J7P A;  3A9C A;  3ZTZ A;  1B68 A;  1U0B B;  2MYS A;  4O6M A;  1G4U S;  5TJ5 E;  3LUT B;  1L7C A;  2A68 F;  3U0C A;  1H7I A;  1FR0 A;  2KW3 C;  4MVM A;  3C62 A;  3EG9 A;  3LJB A;  3NKE A;  3PCV A;  3SXZ A;  2Q9B A;  1HY5 A;  3TQO A;  4FWV A;  2OJQ A;  2J0X A;  1G5Z A;  2NUT B;  4N06 A;  2GA0 A;  4OD5 A;  3HJC A;  3E70 C;  3QMK A;  1BR4 A;  1Z63 A;  2NSF A;  2OU6 A;  4HE8 D;  2OQM A;  2WVN A;  3EJN A;  1S05 A;  2R7O A;  3NKD A;  4RBN A;  3TJ5 A;  5AC4 A;  4P6I C;  4YK5 A;  5A6J A;  5JT4 A;  1RCP A;  2VCB A;  3IQC A;  4NTA A;  2ICW G;  3ABL C;  1NU9 C;  3Q7L A;  2QLA A;  2WZF A;  1JMW A;  3W2W A;  2IM8 A;  5KYX B;  2IXP A;  1TFK B;  2DI3 A;  3U8P A;  3V5Z A;  3AGU A;  3K33 A;  1SF8 A;  2A6H F;  1VLS A;  2Y3D A;  5L0F A;  2UUH A;  3ZDL A;  2CW0 F;  3AG1 C;  3DJU B;  4I1O B;  4DJ9 A;  3RFY A;  2OG2 A;  2CYD A;  3JRM O;  4U5E E;  2Y3H A;  3ZVR A;  1MMD A;  2GWW A;  4E0I A;  3NYL A;  1FNT c;  4JJG A;  2NG1 A;  3GOD A;  1OXK A;  1G4W R;  1JPJ A;  4B6I A;  2J9B A;  1NU7 D;  1OCZ C;  3DD7 A;  3FXH A;  3HLZ A;  4JZA A;  3U9M A;  3ZSU A;  3CZ6 A;  4CBE A;  1T6I A;  2ASR A;  4E0H A;  5BUO A;  4DRJ B;  2H7B A;  4D4X A;  4X0R A;  2YEV A;  4DRH B;  4DRI B;  2EPM X;  2J0W A;  3I4U A;  3LEV A;  2JX0 A;  3MLG A;  2I8B A;  3QVZ A;  4KNW A;  2EPO A;  1M57 C;  2PP4 A;  5A69 A;  1PCX A;  1AVO B;  4U5B E;  4YN0 B;  2YWA A;  1RKC A;  3S27 A;  2XXA B;  4DOZ A;  1JAF A;  4UDV A;  2LQG A;  3DJN B;  1NZE A;  3WG7 C;  3W4Y A;  4JCH A;  3OEO A;  4IAR A;  5L0D A;  2R7R A;  2WZL A;  2KQ9 A;  4N4W A;  3AOU A;  2KYH A;  4YL1 A;  1YYJ A;  2QY9 A;  1FFT C;  1QVX A;  4U5D E;  3KL4 A;  3FDQ A;  2NPU A;  3I5Q A;  4G0H A;  2HZ8 A;  2KNH A;  4YT5 A;  3W8I A;  3W8H A;  4MVZ A;  4W8P A;  1T5O A;  2OKU A;  4JW1 A;  1OW6 A;  2YVK A;  4JEB A;  4WGZ A;  2IXO A;  2LK4 A;  4BJ5 A;  3PHF 2;  4YT2 A;  1KNY A;  5A6B A;  4AL1 A;  4OIP F;  1LS4 A;  5GPG B;  3M4B A;  3H2U A;  3UMI A;  4MQ9 F;  1KTM A;  2DGJ A;  3AQB A;  3EFO A;  1HW2 A;  4OD4 A;  4IB4 A;  4BG0 A;  1T6U A;  4XWJ A;  1R5I D;  5DS5 A;  4BJT A;  2PFD A;  2WVQ A;  1H6G A;  1SMY F;  2L9J A;  1I5N A;  3FVY A;  3JZ0 A;  4YWQ A;  5EHH A;  4LAC B;  3UGP A;  3HNI A;  1NLX A;  5L3V A;  3MBG A;  2HKV A;  3IHU A;  3IEE A;  4RDA A;  4PJM A;  5B3S C;  4P9F A;  1LPE A;  3LES A;  4JTC B;  2MHR A;  3MYF A;  3ZWI A;  2P1A A;  3LAY A;  4JJF A;  3R7C A;  1W2W A;  3EH1 A;  4DXW A;  3RQG A;  4G7O F;  2M64 A;  3K1H A;  3U3B A;  1RKE B;  2C04 A;  3C63 A;  1ZYR F;  5CI9 A;  1Y6D A;  1TKN A;  2ETS A;  3AQC A;  3L8J A;  4MTG A;  1C17 M;  2EPL X;  4A2N B;  1IZM A;  2YL7 A;  3M4C A;  3ZTM A;  4G78 A;  3CQZ A;  5B1A C;  4E17 A;  4GQH A;  1CGM E;  2UUI A;  3EHN A;  3HNL A;  4Z9I A;  2R7W A;  5DVW A;  1NBB A;  3H2V A;  1MMG A;  2HFI A;  2GFH A;  3C7J A;  2YLI A;  3DI5 A;  2I15 A;  3ECS A;  3LS0 A;  4JTD B;  1SYQ A;  4DBQ A;  3VYW A;  2AVK A;  4PR9 A;  2J46 A;  3EZH A;  4EWC A;  1UG7 A;  2LCH A;  3C8G D;  3ITF A;  3M1C B;  4NTF A;  4XEF A;  4PFO A;  2OEV A;  2AWY A;  5E3A A;  3DM5 A;  3UMH A;  4PAC A;  1GGQ A;  2W4M A;  5COG A;  3SP1 A;  2NUP B;  2VB6 A;  3ZG1 A;  2X51 A;  3ASN C;  3TJ6 A;  1BR1 A;  1BZ4 A;  2E87 A;  5FZT A;  3NMI A;  1A7V A;  1D0X A;  2EIJ C;  3JTL O;  2YLD A;  1WWP A;  2WVO A;  2Y39 A;  3CEX A;  3Q6M A;  3EG9 B;  4MVO A;  1OCO C;  4LER A;  1A7D A;  1DOV A;  2RD9 A;  2XLH A;  4CX9 A;  2Q4F A;  4BPM A;  5COF A;  3FHD A;  2JPU A;  3S90 A;  1OR2 A;  1MMA A;  2ZD9 A;  3T4R A;  1K40 A;  4XTK A;  1NG1 A;  3FOP A;  4AE4 B;  1E2X A;  2LFF A;  3MFN A;  4EUK B;  1NFO A;  1RXQ A;  2Q3T A;  4OIR F;  2BC5 A;  256B A;  2R02 A;  2HJM A;  2IBF A;  3EGD A;  3LLK A;  2IOQ A;  3PMR A;  1QQ3 A;  5B1B C;  5JS5 A;  3DAF A;  4LLC A;  4O7G A;  2AP3 A;  4XEV A;  3QVY A;  3GWN A;  5D91 A;  5L0J A;  3NMJ A;  2XXA A;  4MS2 A;  1VMA A;  1R4T A;  4E7S A;  5DQZ A;  3DMD A;  5K0I A;  1O87 A;  3BRJ A;  4ONS A;  2VC9 A;  3C8G B;  3JCU Q;  3S28 A;  2ZPA A;  1JR8 A;  3AG4 C;  5AC5 A;  4G7Z F;  1I4Z A;  4WJ0 A;  5JLI A;  4CDY A;  3DAG A;  2A0B A;  5BQG A;  3FOO A;  4NCQ A;  4I3M A;  1CGN A;  4KNV A;  1YZA A;  1EA8 A;  3QTH A;  4FX5 A;  2R7S A;  4L6R A;  2GAQ A;  4JE9 A;  5L0C A;  1MQV A;  4DBR A;  4JVS A;  1XZP A;  1ZHY A;  3W2V A;  3EH2 A;  1LKX A;  1WAT A;  2F22 A;  2QNL A;  3HKK A;  3JT1 A;  1Y4C A;  4MTO A;  1FMW A;  5EGY A;  2HSQ A;  4CIP A;  1M2V B;  3ATP A;  3QZC A;  1PV3 A;  4ZLD A;  2LP4 A;  3B0P A;  3LS1 A;  4M63 A;  2WL8 A;  3FMS A;  4PJN A;  4GYT A;  2ZXW C;  1OQC A;  4F4B A;  4NQF A;  2Z15 A;  1JOG A;  2DYS C;  3DE8 A;  4RD9 A;  5EK0 A;  5CIV A;  1BDJ B;  2L6G A;  1CPQ A;  2Y3G A;  2J9U A;  1LE2 A;  3M79 A;  3M15 A;  3US6 A;  3SXY A;  1QZX A;  2HJ3 A;  3S29 A;  4AL0 A;  3G50 A;  4JTA B;  2BL2 A;  4J7T A;  3RQF A;  2OJE D;  2HSB A;  3SEO A;  2R7V A;  4BJ5 C;  3U2L A;  2XLV A;  3X2Q C;  1BBH A;  4XLP F;  4XQ1 A;  3TK0 A;  1MND A;  3RVY A;  4EKW A;  1M56 C;  3F47 A;  3L8I A;  3ABM C;  3O55 A;  3POV A;  1D0Z A;  2OCC C;  4JKV A;  3RKO F;  3EGX A;  4LDR A;  2P7V A;  4ANJ A;  1LIH A;  4PFP A;  1ORY A;  2XM4 A;  4MTF A;  1FFH A;  3FAP B;  3J06 A;  3G4X A;  1TWH A;  4ZLC A;  1APC A;  4WAB A;  1JRA A;  2MWQ A;  2G3K A;  3DWW A;  5F28 E;  3TOM A;  4MVQ A;  4NC3 A;  2A6E F;  3CSK A;  3N0T A;  3NG1 A;  1VB5 A;  4FES A;  4AE4 A;  5DS4 A;  1GM5 A;  3NDB B;  4NY3 A;  2DYR C;  3DE9 A;  2HS5 A;  4CDA A;  1TWA A;  2VCC A;  4BEM J;  2KSF A;  4YL0 A;  1GQA A;  3L34 A;  3T6J A;  4CS7 A;  3WHN A;  4ER9 A;  1ZW2 A;  1FMV A;  3GEE A;  3B0U X;  3DKA A;  4CJO A;  4O6Y A;  2Q00 A;  3BEH A;  1MNE A;  1TR2 A;  2H7V C;  1L3P A;  2EIL C;  4JRZ A;  4XPY A;  1QPU A;  3EQL F;  3RH3 A;  2V3C C;  3RYL A;  1BR2 A;  3NMK A;  3O10 A;  5T3T A;  2L81 A;  2W45 A;  4PJL A;  2KK1 A;  1PD0 A;  3AJM A;  1Q0F A;  1YDI A;  1Q0M A;  3FAJ A;  4I1M A;  4KC9 A;  1XZQ A;  3AGT A;  4U5G A;  2Q9C A;  1FAP B;  1T9K A;  1VYK A;  1DOW A;  2R7Q A;  4IGG A;  5DQT A;  2XL8 A;  3U2M A;  5T1D B;  1O5H A;  1J8M F;  4AK9 A;  3N24 A;  5E33 A;  2LFD A;  5KYW A;  1Z6A A;  3GM3 A;  1C02 A;  1LM3 B;  4JC7 A;  2D5R B;  4MND A;  4Q7C A;  3VM6 A;  1IW7 F;  1WAS A;  3LEO A;  3LNR A;  3O39 A;  4J7Y A;  1OKK A;  4QI2 A;  3KKB A;  2EIK C;  3MX3 A;  5COM A;  3ZQY A;  5L0I A;  1C03 A;  2XS1 A;  4JIO A;  3ASO C;  1LS1 A;  1WOL A;  1Z23 A;  3V5Y A;  1ZU4 A;  3PDM P;  1J8Y F;  3EZI A;  2AWC A;  4MVS A;  3S9O A;  3C8G A;  4CS8 C;  2XLD A;  2QUP A;  1M2V A;  1Z3I X;  3IQ6 A;  3VAY A;  4QDL A;  1OXB A;  4JCZ A;  1LI7 A;  1Z5Z A;  3C18 A;  4U9D A;  1RJ9 A;  4H54 A;  3K66 A;  4CS9 A;  1Z7Q c;  1U6H A;  2J45 A;  4P9T A;  1JPN A;  1YA7 O;  2XRH A;  4EHP A;  3K6B A;  2J9V A;  1WTY A;  3KH2 A;  2O9X A;  2EIN C;  2R9R B;  3UMK A;  2OOC A;  1M6T A;  5L0G A;  3E9V A;  3EFO B;  3SXK A;  4CDV A;  4E18 A;  5JRA A;  1A41 A;  2KGO A;  4D4N A;  2CCY A;  2XLO A;  1A7E A;  1ZW3 A;  4HFF B;  2YLG A;  3X1O A;  4N6H A;  3B0V C;  1TWG A;  5A6K A;  4LLE A;  1YJG A;  4HFK B;  1CGO A;  3CAX A;  2X0C A;  2EPN A;  3O6X A;  4IWB A;  1N1C A;  1SR2 A;  2LIG A;  1D0Y A;  4QI0 A;  3GOR A;  2HMQ A;  2HV6 A;  3U9J A;  2XL6 A;  3GEH A;  1RMV A;  2Y3B A;  2YZS A;  3K7D A;  4BJ6 A;  5B3I A;  1XWJ A;  4H4K C;  1H9G A;  4PJJ A;  3SNH A;  2R7X A;  1T6Q A;  3DM9 B;  2LD6 A;  2XS8 A;  2YL0 A;  3EPV A;  2NUP A;  5KYU B;  3UR3 C;  1ST6 A;  3TD7 A;  3U8V A;  4CS9 C;  1HE9 A;  1AUE A;  1YAR O;  2ZXR A;  1KU2 A;  3ZC4 A;  2KJG A;  3JSE O;  4LDQ A;  3ZQV A;  3JYY A;  2R03 A;  1H9T A;  1EKY A;  3EGX B;  4JEA A;  4CJG A;  5JUA A;  4CSA A;  3RF3 A;  1M2O A;  1E86 A;  4EBB A;  3GM1 A;  4OIN F;  1YYX A;  4BEJ A;  1AEP A;  5DS6 A;  3KYI A;  2B0J A;  3G4Z A;  2R05 A;  1D1C A;  4O79 A;  3OWT A;  2FAP B;  4GEH A;  4E7Z A;  3GEI A;  4Q5S F;  3K1I C;  2HMZ A;  4CIH A;  2PX0 A;  2PNO A;  2R25 A;  2R7T A;  2P0N A;  4O6N A;  5BQI A;  2OEX A;  2D4U A;  4MW3 A;  5F5F A;  2XLM A;  4C7O B;  5IY5 C;  2J9W A;  1D1A A;  4ULV A;  1NSG B;  2H8A A;  1OR3 A;  2IXM A;  2AU5 A;  2J8W A;  3S84 A;  4C3E A;  5F5H A;  1ZZP A;  3NYM A;  3ZIB A;  1E84 A;  4IAQ A;  3HNK A;  4PK4 A;  4CS8 A;  4EBJ A;  2YL3 A;  1I4Y A;  1O3U A;  1SZI A;  2A69 F;  2KC3 A;  3NRH A;  1MMN A;  5KYU A;  2Q7R A;  1LE4 A;  2WB7 A;  4YT8 A;  1YLM A;  1HW1 A;  2YL1 A;  4NTB A;  4R32 A;  1V74 B;  2IYL D;  5JP7 A;  4EBK A;  2M4E A;  4KBL A;  2CGE A;  5HV9 A;  4IAO A;  4K1O A;  1QKR A;  4IRU A;  3RIP A;  1EQ1 A;  2YQY A;  2YHS A;  2A1D D;  3S0X A;  2HUJ A;  1HMO A;  2PX3 A;  2YKZ A;  3L1M A;  3U5S A;  4BJ1 A;  1ZHX A;  3WOD F;  1VOM A;  3NYJ A;  5KYN A;  5L3Q A;  5HSW A;  1A0B A;  1LI5 A;  1OW7 A;  1S7Z A;  3RW0 A;  3UNG C;  3V5X A;  4U5F E;  4OIO F;  2TMV P;  1V54 C;  1TWC A;  3IPM O;  4U9E A;  1T01 A;  3SZR A;  3U3F A;  3F46 A;  3EGD B;  4I44 A;  4W8K A;  1YAU O;  4U5C E;  4MVR A;  4EIY A;  5KYY A;  2XSE A;  3TUL A;  3AG3 C;  4JUR I;  2L6F A;  2HV7 A;  3UGO A;  4HEA J;  3GM2 A;  3JYH A;  5JSL A;  3SXM A;  3GWL A;  3SYN A;  3MYI A;  1QLE C;  1VTM P;  1OCR C;  5L0H A;  3Q6N A;  1RJ9 B;  1GS9 A;  1ZHW A;  5JVE A;  2L6H A;  1G8X A;  3JSZ A;  2Y69 C;  3T6G B;  3TOL A;  4C3B A;  5CI8 A;  2JD3 A;  3JRT A;  4FAP B;  2P61 A;  3C8Z A;  2QE9 A;  3KPH A;  3HTK C;  1OKK D;  3GAN A;  3LLI A;  3K1I A;  3AG2 C;  3ABK C;  1E85 A;  4U5H A;  2CNW D;  2XM0 A;  5E3C A;  2FGY A;  1ZVZ A;  1K04 A;  2RSE B;  3R2P A;  5AGF A;  1ZU5 A;  4K0D A;  5E2Q A;  4DVY P;  5A6B D;  4K7B A;  4IJJ A;  3IQT A;  4XPX A;  3RQE A;  4Q4Z F;  3KYJ A;  5D92 A;  1CPR A;  2YRF A;  3B71 A;  4CSA C;  3T9O A;  2ZXP A;  3IQ5 A;  2V26 A;  4AX2 A;  1ZHT A;  1QSP A;  3I5P A;  3KMI A;  4YT4 A;  1TFO B;  2J7P D; 
#chains in the Genus database with same CATH homology
 1YA7 O;  1YAR O;  1YAU O;  1AVO B;  3JTL O;  3JSE O;  3JRM O;  3IPM O;  1Z7Q c;  1FNT c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...