1AVOB

Proteasome activator reg(alpha)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
140
structure length
140
Chain Sequence
b'AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11S REGULATOR
publication title Structure of the proteasome activator REGalpha (PA28alpha).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteasome activator
total genus 57
structure length 140
sequence length 140
chains with identical sequence D, F, H, J, L, N
ec nomenclature
pdb deposition date 1997-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1avoB00
3JRMO 1YA7O 1YARO 1FNTc 3IPMO 3JTLO 1YAUO 1Z7Qc 1AVOB 3JSEO
chains in the Genus database with same CATH superfamily
3U2LA 2LSEA 2KGOA 2OJED 4XEVA 3SZRA 4U5EE 2O9XA 5KYWA 4XTKA 5BQIA 2YEVA 1OCZC 1OCRC 3DXJF 5BQGA 2C04A 3IHUA 4CIHA 1ZHYA 3U0CA 4BPMA 2Q7RA 3EG9B 1TWAA 4WJ0A 4A2NB 1MNDA 3WODF 2KC3A 3NYLA 4PFOA 1OKKD 2EIJC 5EGYA 1T6QA 3OWTA 2NUTA 2JPUA 3NMIA 3CQZA 3ZSUA 3POVA 3LEVA 3B9QA 3QVYA 1QVXA 5CI8A 2J9VA 2L6GA 1WGWA 4JCZA 5D91A 1QPUA 1EA8A 1LM3B 1HMOA 4NTAA 2EILC 2EIKC 4JTAB 3FAPB 4MTFA 3TULA 1LE2A 3K1IA 1MNEA 2OKUA 3AOUA 3U2MA 4AL0A 5A6BD 3JRMO 2LCHA 3TOMA 3K1HA 4BJ5A 2KJGA 3ZVRA 3F46A 1NG1A 1JRAA 2HKVA 2IBFA 2IXPA 5CIVA 1G4WR 5A69A 1T01A 2Q4FA 4PFPA 1LI5A 2VCAA 2Y3GA 3EFOB 2A0UA 1LS1A 4ULVA 5D92A 3SYNA 3JSZA 1UG7A 3M4BA 5KYNA 4G78A 3MLGA 1JMWA 1RJ9B 1VK5A 2C03A 2LFDA 4DVYP 4OD5A 3S0XA 2EPLX 2EPNA 5A6KA 3C8GB 2FAPB 3W8HA 1FFTC 3GM3A 4QI0A 1I4ZA 1OXKA 4KC9A 2HSQA 2OU6A 3JRTA 2PX3A 3O55A 3EH1A 4JCHA 3NDBB 3PHF2 2ICWG 2XS8A 4PR9A 4EUKB 1G8XA 1W2WA 4U5DE 1BBHA 2H7VC 4Q5SF 3CSKA 1EKYA 4G7HF 5HSWA 1D0YA 2WZGA 2MWQA 1TWGA 4O6YA 2GA0A 4PJNA 4ZLDA 3A11A 2XSEA 1B68A 2PBEA 2FGYA 3I5QA 3OA1A 4G0HA 4O7GA 4X0RA 4YN0B 3RIPA 4IWBA 3X2QC 2I15A 4BJ1A 5COGA 4Z9IA 1BR2A 1OCCC 1HE1A 2QTVA 4MNDA 3PDMP 3LUTB 5GPGB 4OINF 3EGDB 2GDCA 5AC5A 2BE5F 2JD3A 3K1IC 1SF8A 4KNVA 4YJWA 5T3WA 3ZWIA 5KYWB 1XZPA 3L8JA 3EGXB 4BJ5C 2Y39A 3Q6NA 2VCCA 4H54A 3RF3A 3VAYA 1ORSC 4PJLA 2P7VA 3DM9B 3NG1A 1H7IA 1FFHA 2PP4A 4U5HA 4GEHA 4DRJB 1C02A 2VCBA 2E87A 4DRHB 3L0IA 3RQGA 4LLCA 2NUTB 5KYYB 2R9RB 4OD4A 5KYUA 3W8IA 2L6FA 4EWCA 3R2PA 3S9OA 2J9BA 3UR3C 5E33A 1IW7F 2Q9CA 3I4UA 3HTKC 4A4AA 3U9MA 3ZDLA 1PV3A 3HJCA 3M79A 4JTDB 3K6BA 3KL4A 5F28E 3W2VA 4Q4ZF 1Z3IX 2YL3A 1APCA 4E17A 2YL7A 5L0GA 2KNHA 4CS9A 4CBEA 3H65A 4HEAJ 4J7TA 1Q0DA 2QUPA 2DB4A 3C62A 4PACA 2R7RA 1WTYA 2A6EF 1VB5A 1Y6DA 3K33A 1QLEC 3L8IA 3RH3A 4U5CE 2YLDA 3J06A 1M2OA 2G62A 3GWLA 1EQ1A 1YZAA 1YYXA 1AUEA 3CAXA 3DWWA 3RKOF 3GANA 4U5GA 1PD0A 4WGYA 3FVYA 3HLZA 1NZEA 5COMA 1CGOA 1D1BA 5E3CA 1VTMP 1I4YA 2CW0F 2MHRA 3DKAA 2L9JA 5JP7A 4CIPA 4U5FE 5JS5A 2PNOA 1D0XA 1TWCA 2JX0A 3EHMA 1LVKA 1ZW3A 2W45A 4E0HA 2CNWD 2XS1A 4JW1A 4MVOA 1E84A 3AQBA 3LEOA 3S28A 2R02A 3BRJA 2XLEA 1C03A 3JZ0A 1H9TA 2H7OA 4JURI 3B0UX 3MX3A 2D4UA 5DQZA 1TKNA 5JT4A 3QMKA 4DXWA 4MS2A 3GEIA 1YARO 1K40A 1J8YF 1YAUO 3LNMB 5L3VA 5BQHA 2XLOA 5B1BC 1HW1A 3FHDA 3SXKA 3GEHA 1U6HA 4XEFA 4LDRA 1VLTA 1M57C 4N06A 1LE4A 2IOQA 2YHSA 1LI7A 4IB4A 2DGJA 4JEAA 3DJUB 2QLAA 4CS9C 2YLGA 3SEOA 5FZTA 2I8BA 1L7CA 3UMHA 2ZPAA 1WOLA 2HV6A 2R7XA 4UDVA 4G7OF 3EJNA 4K0DA 1UFBA 1TQGA 2VH3A 2Y3BA 3B71A 3PCVA 1NFNA 2H7BA 1LPEA 3C18A 3IQ6A 5K0IA 1XZQA 2WL8A 3O39A 4AE4B 5L3QA 3ASOC 1OW8A 4ZLCA 4AL1A 4XPXA 3RVZA 1ZZPA 1OCOC 4DVZA 2EINC 3DE8A 4J7YA 1JPNA 4MVMA 3RW0A 5KYUB 1MMGA 1Q0MA 2HJMA 2GFHA 2LQGA 2R05A 1T6IA 3EPVA 1OR3A 2NSGA 2XLHA 4I3MA 4O6MA 2EPKX 1BDJB 4XQ1A 1V54C 5A6JA 1E83A 1A41A 2NPUA 2YL0A 3JT1A 2Q9BA 1FMVA 2WB7A 5CI9A 1F1MA 3NMKA 4E18A 2RSEB 2IYLD 3FDQA 3EHNA 4CSAA 1ZHTA 2HUJA 2YLIA 2HV7A 3U5SA 3G50A 3U8VA 1FNTc 3K7DA 2V3CC 3SXYA 1D1CA 2EPMX 5EHHA 3AG4C 5L0HA 1OXBA 3GEEA 2G3VA 4IJJA 4C3EA 5L0DA 3KPHA 4PJJA 4CJOA 5L0CA 4JTCB 3IPMO 3GWNA 5JUAA 4C3BA 2WZLA 2J7PD 4JVSA 5AC4A 4E0IA 3JSEO 2P6VA 4DOZA 3DD7A 1MMAA 2BL2A 5DQTA 3IQTA 4P9TA 4E7ZA 4YT4A 1O87A 4C7OA 1JAFA 1V74B 3JYHA 3LLKA 3UNGC 2WVNA 3U9JA 1ST6A 5EK0A 5JRAA 2R7SA 3U3BA 3LS1A 1GM5A 3ZQYA 4I1MA 1U0BB 1SYQA 2A1DD 3EGDA 1VLSA 2ETSA 1XWJA 3C8GD 2HFIA 2XM0A 2J46A 2KSFA 4YK5A 5E2QA 1U89A 1Z5ZA 1PD1A 3GODA 1T6UA 3HNIA 1E86A 3ZG1A 4OIPF 5F5HA 2KW3C 3RYLA 2ASRA 2XLWA 4BJTA 1K05A 3OEOA 2NUPA 4YT5A 2VC9A 4ER9A 1Z6AA 5FCLA 3RQEA 2XLMA 3MBGA 4D4XA 4YT8A 5KYXA 4K7BA 3TK0A 3S29A 3ZTZA 4QDLA 1I5NA 4JC7A 4KBLA 1NLXA 3EQLF 4N4WA 4G7ZF 4CSAC 1LKXA 3T4RA 1G5ZA 3E70C 4XPWA 3UGOA 2DYRC 2AVKA 3NRHA 4KNWA 3GORA 2KK1A 3HNLA 3T9OA 3U8PA 3LNRA 4O79A 3CZ6A 3WHNA 4BEJA 2OEXA 4XLPF 3C8ZA 1QQ3A 1SR2A 4Z9JA 5A6AA 1V55C 2XM4A 2A6HF 3ZQVA 4O6NA 3FOOA 2HZ8A 1HW2A 1OKKA 3DE9A 2R25A 1YA9A 4J32B 4YT2A 1N1CA 1SMYF 1Q0KA 1QZXA 2XXAB 4CDYA 2Q3TA 3QW0A 3V5YA 3O10A 1GQAA 2XLDA 3EG9A 4LERA 4AK9A 3RFYA 1CPQA 4E7SA 4OIOF 5COFA 3NKEA 3SNHA 4JKVA 2W4BA 5A6BA 1OW6A 1KU2A 3VYWA 1OQCA 4FX5A 3VRCA 1DOWA 2IXNA 3HKKA 3V7OA 1YA7O 2VB6A 1FAPB 3GM2A 5DVWA 3VM6A 1QKRA 3US6A 2OG2A 1HY5A 1RKCA 3K66A 5DLJA 1A7EA 4EIYA 1O5HA 2P61A 1LS4A 4CDAA 2EIMC 3EH2A 4J30B 4JJFA 3FOPA 1M2VA 2GAQA 2NSFA 4M63A 3ATPA 4C7OB 3AGTA 3KKBA 3WAQA 3RQFA 2IXMA 5DS6A 3NMJA 3C63A 1GGQA 4JZAA 2YRFA 3B0PA 4XPYA 2Q9AA 3ZIBA 3M1CB 3N0TA 2P1AA 3BEHA 1A7DA 1ZHWA 1Z7Qc 2YQYA 3IQ5A 4MTGA 2Y3DA 3ITFA 2M64A 3AQCA 4YWQA 3L1MA 2YZSA 3B0VC 1ZHZA 3SXMA 1WWPA 2MYSA 2OEVA 3Q7LA 1NFOA 1YLMA 1M56C 2CYDA 1RXQA 2G3KA 2HS5A 2IM8A 3JTLO 4JRZA 1QSPA 4NC3A 4F4BA 4JE9A 2NUPB 4FAPB 2A0BA 3Q6MA 4MVZA 5DS5A 256BA 3KYJA 2OJQA 4U9EA 5JLIA 1S05A 1WATA 4IAQA 2QY9A 1H9GA 3DI5A 1ZU4A 2EPOA 3SP1A 2J0XA 2CCYA 1HE9A 1MMNA 2Y69C 4L6RA 1WASA 4ANJA 2DYSC 3W2WA 2LFFA 3JYYA 4MVUA 5JVEA 2R7WA 1G4US 1ZYRF 1CGME 2AWYA 3UMIA 3TJ6A 5T1DB 4GYTA 1LIHA 2CGEA 3UGPA 1D1AA 1FR0A 4P6IC 3AG3C 3DM5A 5L0IA 3EGXA 5BUOA 2QNLA 1ORJA 2R7TA 3N2ZB 3O6XA 2J9WA 4MQ9F 3NYJA 3DMDA 3VF0A 1Z63A 2L6HA 3EZIA 3RVYA 3ZC4A 2WVOA 3FAJA 2PF4E 2OCCC 2OOCA 3G4XA 3N24A 1OR2A 2VASA 1BZ4A 3B29A 4W8KA 4BG0A 5KYYA 1ZU5A 4OIRF 3TD7A 3FXHA 3UMKA 5DS4A 3KYIA 1V4AA 2NG1A 2ZXOA 4N6CA 3CEXA 4DBQA 2CDQA 2Q00A 1YDIA 2X51A 4FWVA 2YVKA 4YL3A 1CPRA 4U5BE 3KH2A 1OW7A 1L3PA 4GQHA 4MW8A 3V5ZA 4JEBA 3WG7C 3X1OA 2F22A 1M2VB 2A68F 1CGNA 1TFOB 2W4MA 3M15A 4I1OB 1GS9A 3FMSA 4RDAA 1JR8A 4C3DA 4EBKA 1VOMA 1YVIA 3ABLC 2PX0A 2R03A 1ZVZA 4YL0A 2XXAA 4IAOA 2R7VA 2D5RB 1BR1A 4W8PA 1KTMA 1VYIA 2CNWA 2XL6A 4RD9A 3QW1A 3ABMC 3ASNC 2KQ9A 1TFKB 3AG1C 3LAYA 2AP3A 2J9UA 1TR2A 2LP4A 1NBBA 2R7QA 4U9DA 1FMWA 1D0ZA 3H2VA 3JCUQ 4XWJA 3TOLA 5F5FA 1A0BA 1Q0GA 1SZIA 2J45A 3PMRA 2AWCA 4HFKB 4FESA 3A9CA 5T3TA 5IY5C 1T5OA 1Z23A 5L0FA 1WN0A 1TWHA 4PK4A 2HMQA 1ORYA 1Y4CA 1VYKA 2YL1A 2ZD9A 2ZXWC 4EBBA 4DBRA 4RBNA 3F47A 3DZAA 1J8MF 1M6TA 1RKEA 1A7VA 2LK4A 4LDKA 4WABA 5HV9A 1T9KA 2XLVA 1R4TA 3DAFA 3MFNA 4AX2A 1AEPA 4P9FA 2YKZA 2B0JA 3HNKA 3C7JA 4MVRA 4R32A 2X0CA 1E85A 4OIQF 2R7OA 2HSBA 3AG2C 3GM1A 4NY3A 4BJ6A 1Q0FA 4HFFB 4LLEA 4DRIB 3EZHA 3TQOA 4MVSA 3W4YA 2HMZA 2M4EA 1EI7A 4CS8A 3M4CA 4WGZA 2DI3A 2J0WA 3V5XA 1NSGB 4D4NA 1MMDA 2H8AA 4NTBA 4H4KC 1YJGA 3ZTMA 5E3AA 3DAGA 5L0JA 2XRHA 3LESA 2XL8A 4IARA 4AE4A 1YYJA 3S84A 4N6HA 3R7CA 2HJ3A 2R7UA 5B1AC 3E9VA 1H6GA 2XL4A 2GWWA 4BEMJ 5JSLA 2YWAA 2J8WA 1ZW2A 2FFHA 1VMAA 3HNJA 4CJGA 3H2UA 4YL1A 2LIGA 4ULWA 4DJ9A 2LD6A 2UUHA 3IQCA 4EBJA 2W9YA 2ZXRA 3NKDA 4CDVA 4BJ6C 3TJ5A 1ZHXA 3T6BA 2UUIA 2J7PA 1IZMA 2PFDA 2BC5A 3G4ZA 4PJMA 4NTFA 4Z9HA 4CS7A 1R5ID 1BR4A 1JOGA 3EFOA 4NQFA 1HMDA 3LJBA 3KMIA 3T6JA 1JPJA 1PCXA 3SXZA 3MYIA 4K1OA 1RJ9A 3QZCA 4QI2A 4ONSA 2IXOA 2KYHA 5AGFA 3S90A 2OQMA 2L81A 4XLNF 2QE9A 3LLIA 3MYFA 3C8GA 4LDQA 2P0NA 3IEEA 4JIOA 4MW3A 4Q7CA 4XEKA 4EKWA 1K04A 2B0HA 1RMVA 1KNYA 4CS8C 5KYXB 4MVQA 3U3FA 1NU7D 5B3IA 3T6GB 3DJNB 4IGGA 1AVOB 2TMVP 1RCPA 4B6IA 4KI2A 4MTOA 2ZXPA 5B3SC 4LACB 3QVZA 4HE8D 1O3UA 5TJ5E 3ECSA 3ABKC 1YZCA 3QTHA 1MQVA 3Q7GA 1S7ZA 2RD9A 3AGUA 3I5PA 1C17M 2L7AA 4I44A 4NCQA 1RKEB 2A69F 4IRUA 4EHPA 1E2XA 2WVQA 2Z15A 2V26A 3NYMA 4CX9A 1NU9C 4JJGA 1DOVA 3L34A 2Y3HA 3AJMA 1FTSA 2AU5A 3LS0A 2WZFA 3S27A
chains in the Genus database with same CATH topology
3JRMO 1YA7O 1YARO 1FNTc 3IPMO 3JTLO 1YAUO 1Z7Qc 1AVOB 3JSEO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRM O;  1YA7 O;  1YAR O;  1FNT c;  3IPM O;  3JTL O;  1YAU O;  1Z7Q c;  1AVO B;  3JSE O; 
#chains in the Genus database with same CATH topology
 3U2L A;  2LSE A;  2KGO A;  2OJE D;  4XEV A;  3SZR A;  4U5E E;  2O9X A;  5KYW A;  4XTK A;  5BQI A;  2YEV A;  1OCZ C;  1OCR C;  3DXJ F;  5BQG A;  2C04 A;  3IHU A;  4CIH A;  1ZHY A;  3U0C A;  4BPM A;  2Q7R A;  3EG9 B;  1TWA A;  4WJ0 A;  4A2N B;  1MND A;  3WOD F;  2KC3 A;  3NYL A;  4PFO A;  1OKK D;  2EIJ C;  5EGY A;  1T6Q A;  3OWT A;  2NUT A;  2JPU A;  3NMI A;  3CQZ A;  3ZSU A;  3POV A;  3LEV A;  3B9Q A;  3QVY A;  1QVX A;  5CI8 A;  2J9V A;  2L6G A;  1WGW A;  4JCZ A;  5D91 A;  1QPU A;  1EA8 A;  1LM3 B;  1HMO A;  4NTA A;  2EIL C;  2EIK C;  4JTA B;  3FAP B;  4MTF A;  3TUL A;  1LE2 A;  3K1I A;  1MNE A;  2OKU A;  3AOU A;  3U2M A;  4AL0 A;  5A6B D;  3JRM O;  2LCH A;  3TOM A;  3K1H A;  4BJ5 A;  2KJG A;  3ZVR A;  3F46 A;  1NG1 A;  1JRA A;  2HKV A;  2IBF A;  2IXP A;  5CIV A;  1G4W R;  5A69 A;  1T01 A;  2Q4F A;  4PFP A;  1LI5 A;  2VCA A;  2Y3G A;  3EFO B;  2A0U A;  1LS1 A;  4ULV A;  5D92 A;  3SYN A;  3JSZ A;  1UG7 A;  3M4B A;  5KYN A;  4G78 A;  3MLG A;  1JMW A;  1RJ9 B;  1VK5 A;  2C03 A;  2LFD A;  4DVY P;  4OD5 A;  3S0X A;  2EPL X;  2EPN A;  5A6K A;  3C8G B;  2FAP B;  3W8H A;  1FFT C;  3GM3 A;  4QI0 A;  1I4Z A;  1OXK A;  4KC9 A;  2HSQ A;  2OU6 A;  3JRT A;  2PX3 A;  3O55 A;  3EH1 A;  4JCH A;  3NDB B;  3PHF 2;  2ICW G;  2XS8 A;  4PR9 A;  4EUK B;  1G8X A;  1W2W A;  4U5D E;  1BBH A;  2H7V C;  4Q5S F;  3CSK A;  1EKY A;  4G7H F;  5HSW A;  1D0Y A;  2WZG A;  2MWQ A;  1TWG A;  4O6Y A;  2GA0 A;  4PJN A;  4ZLD A;  3A11 A;  2XSE A;  1B68 A;  2PBE A;  2FGY A;  3I5Q A;  3OA1 A;  4G0H A;  4O7G A;  4X0R A;  4YN0 B;  3RIP A;  4IWB A;  3X2Q C;  2I15 A;  4BJ1 A;  5COG A;  4Z9I A;  1BR2 A;  1OCC C;  1HE1 A;  2QTV A;  4MND A;  3PDM P;  3LUT B;  5GPG B;  4OIN F;  3EGD B;  2GDC A;  5AC5 A;  2BE5 F;  2JD3 A;  3K1I C;  1SF8 A;  4KNV A;  4YJW A;  5T3W A;  3ZWI A;  5KYW B;  1XZP A;  3L8J A;  3EGX B;  4BJ5 C;  2Y39 A;  3Q6N A;  2VCC A;  4H54 A;  3RF3 A;  3VAY A;  1ORS C;  4PJL A;  2P7V A;  3DM9 B;  3NG1 A;  1H7I A;  1FFH A;  2PP4 A;  4U5H A;  4GEH A;  4DRJ B;  1C02 A;  2VCB A;  2E87 A;  4DRH B;  3L0I A;  3RQG A;  4LLC A;  2NUT B;  5KYY B;  2R9R B;  4OD4 A;  5KYU A;  3W8I A;  2L6F A;  4EWC A;  3R2P A;  3S9O A;  2J9B A;  3UR3 C;  5E33 A;  1IW7 F;  2Q9C A;  3I4U A;  3HTK C;  4A4A A;  3U9M A;  3ZDL A;  1PV3 A;  3HJC A;  3M79 A;  4JTD B;  3K6B A;  3KL4 A;  5F28 E;  3W2V A;  4Q4Z F;  1Z3I X;  2YL3 A;  1APC A;  4E17 A;  2YL7 A;  5L0G A;  2KNH A;  4CS9 A;  4CBE A;  3H65 A;  4HEA J;  4J7T A;  1Q0D A;  2QUP A;  2DB4 A;  3C62 A;  4PAC A;  2R7R A;  1WTY A;  2A6E F;  1VB5 A;  1Y6D A;  3K33 A;  1QLE C;  3L8I A;  3RH3 A;  4U5C E;  2YLD A;  3J06 A;  1M2O A;  2G62 A;  3GWL A;  1EQ1 A;  1YZA A;  1YYX A;  1AUE A;  3CAX A;  3DWW A;  3RKO F;  3GAN A;  4U5G A;  1PD0 A;  4WGY A;  3FVY A;  3HLZ A;  1NZE A;  5COM A;  1CGO A;  1D1B A;  5E3C A;  1VTM P;  1I4Y A;  2CW0 F;  2MHR A;  3DKA A;  2L9J A;  5JP7 A;  4CIP A;  4U5F E;  5JS5 A;  2PNO A;  1D0X A;  1TWC A;  2JX0 A;  3EHM A;  1LVK A;  1ZW3 A;  2W45 A;  4E0H A;  2CNW D;  2XS1 A;  4JW1 A;  4MVO A;  1E84 A;  3AQB A;  3LEO A;  3S28 A;  2R02 A;  3BRJ A;  2XLE A;  1C03 A;  3JZ0 A;  1H9T A;  2H7O A;  4JUR I;  3B0U X;  3MX3 A;  2D4U A;  5DQZ A;  1TKN A;  5JT4 A;  3QMK A;  4DXW A;  4MS2 A;  3GEI A;  1YAR O;  1K40 A;  1J8Y F;  1YAU O;  3LNM B;  5L3V A;  5BQH A;  2XLO A;  5B1B C;  1HW1 A;  3FHD A;  3SXK A;  3GEH A;  1U6H A;  4XEF A;  4LDR A;  1VLT A;  1M57 C;  4N06 A;  1LE4 A;  2IOQ A;  2YHS A;  1LI7 A;  4IB4 A;  2DGJ A;  4JEA A;  3DJU B;  2QLA A;  4CS9 C;  2YLG A;  3SEO A;  5FZT A;  2I8B A;  1L7C A;  3UMH A;  2ZPA A;  1WOL A;  2HV6 A;  2R7X A;  4UDV A;  4G7O F;  3EJN A;  4K0D A;  1UFB A;  1TQG A;  2VH3 A;  2Y3B A;  3B71 A;  3PCV A;  1NFN A;  2H7B A;  1LPE A;  3C18 A;  3IQ6 A;  5K0I A;  1XZQ A;  2WL8 A;  3O39 A;  4AE4 B;  5L3Q A;  3ASO C;  1OW8 A;  4ZLC A;  4AL1 A;  4XPX A;  3RVZ A;  1ZZP A;  1OCO C;  4DVZ A;  2EIN C;  3DE8 A;  4J7Y A;  1JPN A;  4MVM A;  3RW0 A;  5KYU B;  1MMG A;  1Q0M A;  2HJM A;  2GFH A;  2LQG A;  2R05 A;  1T6I A;  3EPV A;  1OR3 A;  2NSG A;  2XLH A;  4I3M A;  4O6M A;  2EPK X;  1BDJ B;  4XQ1 A;  1V54 C;  5A6J A;  1E83 A;  1A41 A;  2NPU A;  2YL0 A;  3JT1 A;  2Q9B A;  1FMV A;  2WB7 A;  5CI9 A;  1F1M A;  3NMK A;  4E18 A;  2RSE B;  2IYL D;  3FDQ A;  3EHN A;  4CSA A;  1ZHT A;  2HUJ A;  2YLI A;  2HV7 A;  3U5S A;  3G50 A;  3U8V A;  1FNT c;  3K7D A;  2V3C C;  3SXY A;  1D1C A;  2EPM X;  5EHH A;  3AG4 C;  5L0H A;  1OXB A;  3GEE A;  2G3V A;  4IJJ A;  4C3E A;  5L0D A;  3KPH A;  4PJJ A;  4CJO A;  5L0C A;  4JTC B;  3IPM O;  3GWN A;  5JUA A;  4C3B A;  2WZL A;  2J7P D;  4JVS A;  5AC4 A;  4E0I A;  3JSE O;  2P6V A;  4DOZ A;  3DD7 A;  1MMA A;  2BL2 A;  5DQT A;  3IQT A;  4P9T A;  4E7Z A;  4YT4 A;  1O87 A;  4C7O A;  1JAF A;  1V74 B;  3JYH A;  3LLK A;  3UNG C;  2WVN A;  3U9J A;  1ST6 A;  5EK0 A;  5JRA A;  2R7S A;  3U3B A;  3LS1 A;  1GM5 A;  3ZQY A;  4I1M A;  1U0B B;  1SYQ A;  2A1D D;  3EGD A;  1VLS A;  2ETS A;  1XWJ A;  3C8G D;  2HFI A;  2XM0 A;  2J46 A;  2KSF A;  4YK5 A;  5E2Q A;  1U89 A;  1Z5Z A;  1PD1 A;  3GOD A;  1T6U A;  3HNI A;  1E86 A;  3ZG1 A;  4OIP F;  5F5H A;  2KW3 C;  3RYL A;  2ASR A;  2XLW A;  4BJT A;  1K05 A;  3OEO A;  2NUP A;  4YT5 A;  2VC9 A;  4ER9 A;  1Z6A A;  5FCL A;  3RQE A;  2XLM A;  3MBG A;  4D4X A;  4YT8 A;  5KYX A;  4K7B A;  3TK0 A;  3S29 A;  3ZTZ A;  4QDL A;  1I5N A;  4JC7 A;  4KBL A;  1NLX A;  3EQL F;  4N4W A;  4G7Z F;  4CSA C;  1LKX A;  3T4R A;  1G5Z A;  3E70 C;  4XPW A;  3UGO A;  2DYR C;  2AVK A;  3NRH A;  4KNW A;  3GOR A;  2KK1 A;  3HNL A;  3T9O A;  3U8P A;  3LNR A;  4O79 A;  3CZ6 A;  3WHN A;  4BEJ A;  2OEX A;  4XLP F;  3C8Z A;  1QQ3 A;  1SR2 A;  4Z9J A;  5A6A A;  1V55 C;  2XM4 A;  2A6H F;  3ZQV A;  4O6N A;  3FOO A;  2HZ8 A;  1HW2 A;  1OKK A;  3DE9 A;  2R25 A;  1YA9 A;  4J32 B;  4YT2 A;  1N1C A;  1SMY F;  1Q0K A;  1QZX A;  2XXA B;  4CDY A;  2Q3T A;  3QW0 A;  3V5Y A;  3O10 A;  1GQA A;  2XLD A;  3EG9 A;  4LER A;  4AK9 A;  3RFY A;  1CPQ A;  4E7S A;  4OIO F;  5COF A;  3NKE A;  3SNH A;  4JKV A;  2W4B A;  5A6B A;  1OW6 A;  1KU2 A;  3VYW A;  1OQC A;  4FX5 A;  3VRC A;  1DOW A;  2IXN A;  3HKK A;  3V7O A;  1YA7 O;  2VB6 A;  1FAP B;  3GM2 A;  5DVW A;  3VM6 A;  1QKR A;  3US6 A;  2OG2 A;  1HY5 A;  1RKC A;  3K66 A;  5DLJ A;  1A7E A;  4EIY A;  1O5H A;  2P61 A;  1LS4 A;  4CDA A;  2EIM C;  3EH2 A;  4J30 B;  4JJF A;  3FOP A;  1M2V A;  2GAQ A;  2NSF A;  4M63 A;  3ATP A;  4C7O B;  3AGT A;  3KKB A;  3WAQ A;  3RQF A;  2IXM A;  5DS6 A;  3NMJ A;  3C63 A;  1GGQ A;  4JZA A;  2YRF A;  3B0P A;  4XPY A;  2Q9A A;  3ZIB A;  3M1C B;  3N0T A;  2P1A A;  3BEH A;  1A7D A;  1ZHW A;  1Z7Q c;  2YQY A;  3IQ5 A;  4MTG A;  2Y3D A;  3ITF A;  2M64 A;  3AQC A;  4YWQ A;  3L1M A;  2YZS A;  3B0V C;  1ZHZ A;  3SXM A;  1WWP A;  2MYS A;  2OEV A;  3Q7L A;  1NFO A;  1YLM A;  1M56 C;  2CYD A;  1RXQ A;  2G3K A;  2HS5 A;  2IM8 A;  3JTL O;  4JRZ A;  1QSP A;  4NC3 A;  4F4B A;  4JE9 A;  2NUP B;  4FAP B;  2A0B A;  3Q6M A;  4MVZ A;  5DS5 A;  256B A;  3KYJ A;  2OJQ A;  4U9E A;  5JLI A;  1S05 A;  1WAT A;  4IAQ A;  2QY9 A;  1H9G A;  3DI5 A;  1ZU4 A;  2EPO A;  3SP1 A;  2J0X A;  2CCY A;  1HE9 A;  1MMN A;  2Y69 C;  4L6R A;  1WAS A;  4ANJ A;  2DYS C;  3W2W A;  2LFF A;  3JYY A;  4MVU A;  5JVE A;  2R7W A;  1G4U S;  1ZYR F;  1CGM E;  2AWY A;  3UMI A;  3TJ6 A;  5T1D B;  4GYT A;  1LIH A;  2CGE A;  3UGP A;  1D1A A;  1FR0 A;  4P6I C;  3AG3 C;  3DM5 A;  5L0I A;  3EGX A;  5BUO A;  2QNL A;  1ORJ A;  2R7T A;  3N2Z B;  3O6X A;  2J9W A;  4MQ9 F;  3NYJ A;  3DMD A;  3VF0 A;  1Z63 A;  2L6H A;  3EZI A;  3RVY A;  3ZC4 A;  2WVO A;  3FAJ A;  2PF4 E;  2OCC C;  2OOC A;  3G4X A;  3N24 A;  1OR2 A;  2VAS A;  1BZ4 A;  3B29 A;  4W8K A;  4BG0 A;  5KYY A;  1ZU5 A;  4OIR F;  3TD7 A;  3FXH A;  3UMK A;  5DS4 A;  3KYI A;  1V4A A;  2NG1 A;  2ZXO A;  4N6C A;  3CEX A;  4DBQ A;  2CDQ A;  2Q00 A;  1YDI A;  2X51 A;  4FWV A;  2YVK A;  4YL3 A;  1CPR A;  4U5B E;  3KH2 A;  1OW7 A;  1L3P A;  4GQH A;  4MW8 A;  3V5Z A;  4JEB A;  3WG7 C;  3X1O A;  2F22 A;  1M2V B;  2A68 F;  1CGN A;  1TFO B;  2W4M A;  3M15 A;  4I1O B;  1GS9 A;  3FMS A;  4RDA A;  1JR8 A;  4C3D A;  4EBK A;  1VOM A;  1YVI A;  3ABL C;  2PX0 A;  2R03 A;  1ZVZ A;  4YL0 A;  2XXA A;  4IAO A;  2R7V A;  2D5R B;  1BR1 A;  4W8P A;  1KTM A;  1VYI A;  2CNW A;  2XL6 A;  4RD9 A;  3QW1 A;  3ABM C;  3ASN C;  2KQ9 A;  1TFK B;  3AG1 C;  3LAY A;  2AP3 A;  2J9U A;  1TR2 A;  2LP4 A;  1NBB A;  2R7Q A;  4U9D A;  1FMW A;  1D0Z A;  3H2V A;  3JCU Q;  4XWJ A;  3TOL A;  5F5F A;  1A0B A;  1Q0G A;  1SZI A;  2J45 A;  3PMR A;  2AWC A;  4HFK B;  4FES A;  3A9C A;  5T3T A;  5IY5 C;  1T5O A;  1Z23 A;  5L0F A;  1WN0 A;  1TWH A;  4PK4 A;  2HMQ A;  1ORY A;  1Y4C A;  1VYK A;  2YL1 A;  2ZD9 A;  2ZXW C;  4EBB A;  4DBR A;  4RBN A;  3F47 A;  3DZA A;  1J8M F;  1M6T A;  1RKE A;  1A7V A;  2LK4 A;  4LDK A;  4WAB A;  5HV9 A;  1T9K A;  2XLV A;  1R4T A;  3DAF A;  3MFN A;  4AX2 A;  1AEP A;  4P9F A;  2YKZ A;  2B0J A;  3HNK A;  3C7J A;  4MVR A;  4R32 A;  2X0C A;  1E85 A;  4OIQ F;  2R7O A;  2HSB A;  3AG2 C;  3GM1 A;  4NY3 A;  4BJ6 A;  1Q0F A;  4HFF B;  4LLE A;  4DRI B;  3EZH A;  3TQO A;  4MVS A;  3W4Y A;  2HMZ A;  2M4E A;  1EI7 A;  4CS8 A;  3M4C A;  4WGZ A;  2DI3 A;  2J0W A;  3V5X A;  1NSG B;  4D4N A;  1MMD A;  2H8A A;  4NTB A;  4H4K C;  1YJG A;  3ZTM A;  5E3A A;  3DAG A;  5L0J A;  2XRH A;  3LES A;  2XL8 A;  4IAR A;  4AE4 A;  1YYJ A;  3S84 A;  4N6H A;  3R7C A;  2HJ3 A;  2R7U A;  5B1A C;  3E9V A;  1H6G A;  2XL4 A;  2GWW A;  4BEM J;  5JSL A;  2YWA A;  2J8W A;  1ZW2 A;  2FFH A;  1VMA A;  3HNJ A;  4CJG A;  3H2U A;  4YL1 A;  2LIG A;  4ULW A;  4DJ9 A;  2LD6 A;  2UUH A;  3IQC A;  4EBJ A;  2W9Y A;  2ZXR A;  3NKD A;  4CDV A;  4BJ6 C;  3TJ5 A;  1ZHX A;  3T6B A;  2UUI A;  2J7P A;  1IZM A;  2PFD A;  2BC5 A;  3G4Z A;  4PJM A;  4NTF A;  4Z9H A;  4CS7 A;  1R5I D;  1BR4 A;  1JOG A;  3EFO A;  4NQF A;  1HMD A;  3LJB A;  3KMI A;  3T6J A;  1JPJ A;  1PCX A;  3SXZ A;  3MYI A;  4K1O A;  1RJ9 A;  3QZC A;  4QI2 A;  4ONS A;  2IXO A;  2KYH A;  5AGF A;  3S90 A;  2OQM A;  2L81 A;  4XLN F;  2QE9 A;  3LLI A;  3MYF A;  3C8G A;  4LDQ A;  2P0N A;  3IEE A;  4JIO A;  4MW3 A;  4Q7C A;  4XEK A;  4EKW A;  1K04 A;  2B0H A;  1RMV A;  1KNY A;  4CS8 C;  5KYX B;  4MVQ A;  3U3F A;  1NU7 D;  5B3I A;  3T6G B;  3DJN B;  4IGG A;  1AVO B;  2TMV P;  1RCP A;  4B6I A;  4KI2 A;  4MTO A;  2ZXP A;  5B3S C;  4LAC B;  3QVZ A;  4HE8 D;  1O3U A;  5TJ5 E;  3ECS A;  3ABK C;  1YZC A;  3QTH A;  1MQV A;  3Q7G A;  1S7Z A;  2RD9 A;  3AGU A;  3I5P A;  1C17 M;  2L7A A;  4I44 A;  4NCQ A;  1RKE B;  2A69 F;  4IRU A;  4EHP A;  1E2X A;  2WVQ A;  2Z15 A;  2V26 A;  3NYM A;  4CX9 A;  1NU9 C;  4JJG A;  1DOV A;  3L34 A;  2Y3H A;  3AJM A;  1FTS A;  2AU5 A;  3LS0 A;  2WZF A;  3S27 A; 
#chains in the Genus database with same CATH homology
 3JRM O;  1YA7 O;  1YAR O;  1FNT c;  3IPM O;  3JTL O;  1YAU O;  1Z7Q c;  1AVO B;  3JSE O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...