1AVOB

Proteasome activator reg(alpha)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
140
structure length
140
Chain Sequence
AVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11S REGULATOR
publication title Structure of the proteasome activator REGalpha (PA28alpha).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteasome activator
total genus 57
structure length 140
sequence length 140
chains with identical sequence D, F, H, J, L, N
ec nomenclature
pdb deposition date 1997-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1avoB00
3JTLO 1FNTc 1Z7Qc 3JSEO 1AVOB 1YARO 1YA7O 3JRMO 3IPMO 1YAUO
chains in the Genus database with same CATH superfamily
2OJQA 1NG1A 2VCBA 4D4XA 4WGZA 1VLTA 5T3WA 3RQGA 4CS7A 1AUEA 2A6HF 2NPUA 2KK1A 3ZSUA 1TFOB 2L9JA 1EQ1A 1FTSA 3FAPB 2J0XA 2C04A 3C62A 2YHSA 2IM8A 3C18A 3K66A 3ZTZA 2ICWG 2XM0A 2KC3A 3V7OA 4E18A 4MNDA 2YLGA 4JRZA 1VMAA 4HFKB 3QZCA 4I1OB 2IXPA 1Z3IX 2PF4E 3LJBA 2XLOA 3T6JA 5E33A 4CSAA 5BQIA 2YKZA 5DLJA 2ZXWC 3B71A 1VYIA 3SXKA 3L0IA 2CYDA 3EZHA 4IRUA 4G7ZF 4PFPA 3GEHA 4JCHA 3NDBB 2YL1A 4C7OA 3IHUA 3RYLA 3EGXA 1WTYA 3RIPA 4XWJA 4CIHA 4XEFA 2X0CA 5JT4A 4UDVA 2HUJA 3Q7GA 1GQAA 5L0JA 2D5RB 5D91A 3G50A 1E83A 1ZW3A 4C3DA 1R5ID 3W2WA 4NTBA 1OR3A 4PJNA 4YT4A 1T01A 2EIKC 5A6JA 3K1HA 2LSEA 4U9EA 1V55C 1ZU5A 3DAFA 2R7QA 1I4YA 2IXMA 4O6YA 2H7BA 3RW0A 3LS0A 2KJGA 2NG1A 1CGNA 3B0PA 2VC9A 5EK0A 2QY9A 1JAFA 2XXAB 1LS1A 3DM9B 3VYWA 4DRJB 2HS5A 2DGJA 1ORYA 1Q0GA 3KH2A 4U5HA 3L1MA 4DXWA 4MQ9F 5KYYB 3BRJA 5KYWB 3POVA 3Q6MA 2EPLX 3PMRA 2Y3BA 2XS8A 3FHDA 3LEOA 2YZSA 2P1AA 4PK4A 2EIMC 4NCQA 1J8MF 2NSFA 2XLWA 4EKWA 3HKKA 4X0RA 4EIYA 4CSAC 1OCCC 4KNVA 1H7IA 2I15A 2J9WA 3A9CA 1HE1A 4JJFA 4MW8A 4N6CA 5K0IA 1E84A 1ORJA 1TWAA 2YL0A 3CSKA 4JIOA 4GQHA 2IXNA 4ER9A 3HNLA 5HV9A 3R7CA 1APCA 4DBRA 4K7BA 1Q0KA 1G5ZA 1RKCA 4DBQA 2MYSA 4CS9A 2LK4A 1BR1A 1LS4A 2NUPA 1LPEA 3LEVA 4XTKA 2KGOA 3AG4C 3IQTA 4J32B 4LLEA 2PNOA 1LKXA 4ANJA 3GEIA 3GM2A 1H6GA 5KYNA 3MX3A 1RCPA 2F22A 1BR4A 4YL0A 5DS4A 3AOUA 1RKEA 3C8ZA 3GM1A 3NYJA 3IEEA 4C7OB 2R7UA 3EGXB 1M2OA 4HFFB 4Z9HA 3ZQVA 1QSPA 4G78A 2XLEA 4CIPA 2KQ9A 3OEOA 4JZAA 3S28A 2LFFA 3Q6NA 4JC7A 4P6IC 4MTOA 1CPRA 3SNHA 2XL6A 2HV6A 4WABA 2GAQA 4AL0A 1YJGA 3EFOA 4WJ0A 1NZEA 4YT2A 3KYJA 2HZ8A 4DJ9A 4XEVA 2CNWA 1UFBA 2G62A 2Q9AA 2HJMA 1PV3A 1OR2A 3GEEA 3AQCA 3KYIA 3SZRA 2EPKX 3F47A 1BZ4A 3FXHA 1LM3B 2ZD9A 5COMA 1D0YA 2Q4FA 2XSEA 3DXJF 2HFIA 1FMWA 2CNWD 1XZPA 2IYLD 2YLDA 3M1CB 3RF3A 3T4RA 4JEBA 4NY3A 3UMHA 4OIOF 3JSEO 4J7YA 3TOMA 1FR0A 3ZTMA 3ZWIA 3TK0A 2J9VA 2PP4A 3C7JA 5L0HA 3UGPA 2KSFA 3FAJA 3JCUQ 1MQVA 4CS9C 3T9OA 3V5ZA 5L0GA 3J06A 4CJOA 1NFOA 2ZXRA 3DE9A 2LQGA 3U2LA 1VTMP 1LIHA 2ETSA 4NC3A 4F4BA 5KYYA 1OKKA 2OQMA 4FWVA 4AE4A 2J9BA 1NLXA 2QUPA 4LDKA 3C8GA 3HJCA 4JVSA 1OCOC 4FAPB 1OKKD 2B0JA 2FAPB 2WVQA 3G4ZA 2WVNA 2VCAA 2OCCC 3L8JA 4LERA 3W4YA 4C3EA 3KMIA 2W4BA 2YL7A 2A0BA 2E87A 1J8YF 2MHRA 4CS8C 1A0BA 3G4XA 2L81A 3FMSA 4DVZA 2DI3A 2R7SA 3AG2C 1EKYA 2R7TA 5KYXB 3O39A 4O6NA 1SF8A 2J0WA 3NMIA 4IB4A 4O79A 4YT5A 4CJGA 2NUPB 1QPUA 5A69A 2OU6A 3W2VA 4P9TA 3H65A 1OQCA 3IQCA 3FDQA 2PFDA 1JRAA 4OINF 3UMIA 1Z6AA 2XL8A 4M63A 2G3VA 1RKEB 3K1IA 5AC4A 5E3AA 4EWCA 3DKAA 3U5SA 1Z23A 4A2NB 1BBHA 4L6RA 3GORA 3ASNC 4XPWA 2HJ3A 1OCZC 1VK5A 1KU2A 2Q7RA 3EH1A 4Q5SF 2J7PA 1E2XA 2QE9A 4NTAA 3T6GB 4QI2A 4N6HA 1V4AA 2Z15A 3UNGC 3EFOB 3DM5A 2PX3A 1FFHA 1GS9A 1WN0A 1A41A 2G3KA 2R05A 3CAXA 4JE9A 4BJ6A 1IW7F 4PJMA 2EPNA 1VB5A 3LUTB 3CQZA 2XLMA 3N2ZB 5KYUB 3JSZA 4G0HA 2OG2A 1TWHA 1KTMA 1RJ9B 1Q0FA 1M56C 1SR2A 3ZDLA 2EIJC 4EBBA 4YT8A 4IWBA 4CX9A 4MVRA 4MVUA 4P9FA 1ORSC 3SXYA 2BL2A 2UUHA 4BJ5A 3PHF2 5L0DA 5TJ5E 2HMQA 2XRHA 3LS1A 3W8HA 2J8WA 3I5PA 1D1AA 2R7VA 4CDVA 1CGME 4Q7CA 2CCYA 5JVEA 2FGYA 4CDYA 3KL4A 5DS6A 5DQTA 4GEHA 4H4KC 4BPMA 3EHMA 4IAOA 3QTHA 1KNYA 3R2PA 2DYRC 2VB6A 3DMDA 3E70C 1HY5A 4U5EE 3K7DA 3ABLC 4AE4B 2L7AA 3C8GB 1UG7A 5JLIA 1QQ3A 4U5BE 1YYXA 3RH3A 1S05A 3S9OA 1RMVA 1O87A 1B68A 1Z63A 2A1DD 4K1OA 4PR9A 3ZIBA 3RKOF 1VOMA 4XLNF 2C03A 2DYSC 3WAQA 3AQBA 3C63A 3QVZA 5CIVA 1H9TA 1C03A 2IBFA 3DZAA 4AL1A 4JEAA 2GWWA 4PFOA 5DQZA 1YARO 3RQEA 2NUTB 3LAYA 5B1AC 3JZ0A 3SXZA 5A6AA 5KYXA 4XPXA 3NMJA 3DD7A 1MMNA 3M15A 4NTFA 4OIPF 1L3PA 4FESA 3U9MA 1H9GA 3M79A 1ZHYA 2IXOA 3NYLA 4EBJA 2YQYA 1S7ZA 4JJGA 1Z7Qc 1HW1A 2XLDA 3ASOC 2X51A 3M4CA 1IZMA 2J46A 3LNRA 2JPUA 1YAUO 5D92A 1E85A 3KPHA 5F28E 3EZIA 2R25A 2L6HA 4D4NA 1TFKB 1YYJA 2HSQA 2WZFA 3EQLF 3RFYA 2LD6A 3UMKA 3QW0A 1XZQA 4JKVA 3O10A 4Z9IA 2VH3A 1K04A 3PCVA 3EJNA 3LNMB 1WASA 4J7TA 5BUOA 3IQ6A 2YWAA 2H8AA 3X2QC 2AU5A 5KYUA 4CDAA 3DE8A 1LVKA 3ABMC 3N0TA 1MNEA 1T6IA 2HMZA 2P61A 1RJ9A 3T6BA 2Y69C 4MTGA 1ZHXA 4BG0A 5JP7A 4OD5A 1O5HA 2KW3C 4R32A 2WL8A 4I1MA 1Z5ZA 5EHHA 3H2VA 1TWCA 2XM4A 4CBEA 4ZLCA 1QLEC 4KI2A 2YEVA 3LESA 4PACA 3QMKA 4IJJA 5E2QA 1WGWA 1NU7D 5T1DB 3U8PA 4JTDB 2R7WA 1JR8A 2WB7A 3NRHA 1ZHZA 4ONSA 5BQGA 3SXMA 3U0CA 3EG9A 3PDMP 2AVKA 4B6IA 1OCRC 1BR2A 1ST6A 2J45A 2YLIA 3NKDA 2M64A 5DS5A 3DJNB 1FFTC 4U5GA 4DRHB 3V5YA 3TULA 4BEMJ 3AGUA 5L0CA 1SMYF 2CW0F 2FFHA 4LACB 4IAQA 4HEAJ 4YN0B 3GANA 3NG1A 4HE8D 3TQOA 4MTFA 4YJWA 2OKUA 3MLGA 3B9QA 2YVKA 4PJLA 2Y3HA 4I3MA 3C8GD 5GPGB 3GWNA 2P6VA 1M57C 1LE2A 1ZYRF 2R9RB 3GWLA 1QVXA 3NKEA 3S84A 1D0XA 3S90A 4OIQF 3SEOA 2NUTA 3HLZA 3WHNA 3B29A 2LFDA 2RD9A 4GYTA 2HKVA 3MYIA 2XLHA 4YK5A 3TD7A 4BJ6C 4MW3A 4BEJA 2QLAA 3HNIA 4XQ1A 1E86A 3LLKA 1MMDA 1ZW2A 1L7CA 1MMAA 3RVYA 1QZXA 5IY5C 5CI8A 2ASRA 2QNLA 1C17M 1LI7A 2L6FA 2Q00A 2XLVA 3K33A 3NYMA 2HV7A 1D1BA 2WVOA 3US6A 3ZQYA 2TMVP 3SYNA 1K40A 4N4WA 3I5QA 4BJTA 3JYHA 3VRCA 1FAPB 2IOQA 1G4WR 1XWJA 4Q4ZF 4QI0A 1Q0DA 4W8PA 2GDCA 1YVIA 3MYFA 1AVOB 2BE5F 2R03A 2J9UA 3KKBA 2AWCA 3EPVA 1D0ZA 3FOOA 2J7PD 3MFNA 1YA9A 2ZPAA 3DJUB 3UR3C 4DVYP 4E7ZA 2WZGA 3JRMO 4AX2A 1WOLA 2JX0A 3AJMA 3H2UA 3LLIA 2W4MA 1T6QA 1EI7A 2LCHA 2NSGA 3ECSA 3ABKC 3VF0A 3ZG1A 1WWPA 4JURI 4KC9A 3GODA 4QDLA 1OW8A 2LIGA 4U5FE 1ZZPA 3OWTA 3EHNA 3HNJA 5JS5A 4EUKB 3AG1C 1TKNA 5L3VA 5COFA 3TJ6A 4XEKA 3IQ5A 4WGYA 2YL3A 2VCCA 3EG9B 5T3TA 2V26A 3O55A 1YA7O 4MS2A 2ZXPA 5JRAA 4MVMA 4I44A 1R4TA 4KNWA 3B0VC 2V3CC 3JTLO 3ITFA 1A7DA 2H7VC 5B1BC 5JUAA 1FNTc 4AK9A 3QW1A 3B0UX 3DAGA 1OXKA 256BA 3K1IC 3QVYA 2I8BA 1TR2A 2DB4A 5L0IA 4MVSA 5AC5A 4U9DA 1YDIA 2A6EF 1HMOA 3F46A 3FVYA 2OEXA 1CGOA 2LP4A 3EGDB 2A68F 3TJ5A 1HMDA 1T6UA 3NMKA 5AGFA 2R7XA 4C3BA 4E0IA 4LDQA 1C02A 2M4EA 3L8IA 5E3CA 1JPJA 4MVQA 3GM3A 1T5OA 1M6TA 4PJJA 3M4BA 3S29A 3TOLA 2EILC 2QTVA 4RD9A 1MNDA 1PCXA 1CPQA 4JCZA 1T9KA 2Y3GA 5A6BA 4MVZA 2GFHA 3U9JA 1WATA 2CDQA 4BJ5C 2KNHA 3OA1A 4JTCB 5CI9A 3ZVRA 3SP1A 2O9XA 3X1OA 2YRFA 2XS1A 4YL1A 4E17A 4XLPF 5A6BD 5COGA 4BJ1A 1YZAA 5L0FA 4G7OF 2HSBA 3EH2A 2PX0A 3E9VA 3W8IA 1NU9C 1GGQA 4ZLDA 1A7VA 1BDJB 1I4ZA 1M2VA 1VLSA 1VYKA 2A0UA 3VM6A 4XPYA 1NFNA 2R7RA 4OIRF 5A6KA 2Y39A 4DOZA 3MBGA 4JW1A 4K0DA 2UUIA 5JSLA 1I5NA 4J30B 4O6MA 1W2WA 3V5XA 4EBKA 1U0BB 2W45A 1U6HA 5HSWA 5F5HA 4KBLA 4E0HA 1Y6DA 1O3UA 3DI5A 1HW2A 1JPNA 2L6GA 1SYQA 2CGEA 2W9YA 1ZHWA 2OOCA 3U3BA 3VAYA 1JMWA 4MVOA 1ZHTA 1K05A 2XL4A 4ULWA 4ULVA 1LI5A 2OEVA 1FMVA 4OD4A 3RQFA 1NSGB 1RXQA 1G4US 3ZC4A 1OW6A 4DRIB 4W8KA 2ZXOA 5L3QA 2WZLA 1MMGA 4EHPA 1V74B 2VASA 3HTKC 2BC5A 4Z9JA 1HE9A 2B0HA 2Q9BA 2GA0A 1JOGA 3N24A 4CS8A 4YWQA 4RBNA 3CZ6A 3IPMO 5FZTA 4G7HF 2AP3A 1EA8A 2Y3DA 1Q0MA 1YLMA 2P7VA 1GM5A 4IGGA 3JRTA 3U8VA 4N06A 1AEPA 3L34A 5F5FA 1OXBA 1PD1A 3RVZA 4E7SA 1ZVZA 2R7OA 3UGOA 3Q7LA 3U3FA 4U5DE 3WG7C 3S0XA 4U5CE 1ZU4A 1SZIA 5B3SC 1A7EA 2P0NA 1G8XA 2Q3TA 3AG3C 4LLCA 3DWWA 1DOVA 2H7OA 3HNKA 3ATPA 4O7GA 2EPMX 2EPOA 2Q9CA 2EINC 2D4UA 2RSEB 3EGDA 4YL3A 4IARA 1OW7A 4LDRA 1DOWA 3I4UA 4A4AA 1D1CA 3AGTA 4FX5A 4H54A 2OJED 4RDAA 5DVWA 3WODF 2MWQA 1V54C 3JT1A 5B3IA 5EGYA 2XXAA 1LE4A 4JTAB 2AWYA 1PD0A 2PBEA 5KYWA 3JYYA 1YZCA 3A11A 3CEXA 1Y4CA 3K6BA 3S27A 1TWGA 3BEHA 1U89A 2JD3A 2KYHA 5BQHA 1M2VB 3U2MA 2A69F 1F1MA 3FOPA 1QKRA 4NQFA 1TQGA 1NBBA 1N1CA 2R02A 5FCLA 3O6XA
chains in the Genus database with same CATH topology
3JTLO 1FNTc 1Z7Qc 3JSEO 1AVOB 1YARO 1YA7O 3JRMO 3IPMO 1YAUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTL O;  1FNT c;  1Z7Q c;  3JSE O;  1AVO B;  1YAR O;  1YA7 O;  3JRM O;  3IPM O;  1YAU O; 
#chains in the Genus database with same CATH topology
 2OJQ A;  1NG1 A;  2VCB A;  4D4X A;  4WGZ A;  1VLT A;  5T3W A;  3RQG A;  4CS7 A;  1AUE A;  2A6H F;  2NPU A;  2KK1 A;  3ZSU A;  1TFO B;  2L9J A;  1EQ1 A;  1FTS A;  3FAP B;  2J0X A;  2C04 A;  3C62 A;  2YHS A;  2IM8 A;  3C18 A;  3K66 A;  3ZTZ A;  2ICW G;  2XM0 A;  2KC3 A;  3V7O A;  4E18 A;  4MND A;  2YLG A;  4JRZ A;  1VMA A;  4HFK B;  3QZC A;  4I1O B;  2IXP A;  1Z3I X;  2PF4 E;  3LJB A;  2XLO A;  3T6J A;  5E33 A;  4CSA A;  5BQI A;  2YKZ A;  5DLJ A;  2ZXW C;  3B71 A;  1VYI A;  3SXK A;  3L0I A;  2CYD A;  3EZH A;  4IRU A;  4G7Z F;  4PFP A;  3GEH A;  4JCH A;  3NDB B;  2YL1 A;  4C7O A;  3IHU A;  3RYL A;  3EGX A;  1WTY A;  3RIP A;  4XWJ A;  4CIH A;  4XEF A;  2X0C A;  5JT4 A;  4UDV A;  2HUJ A;  3Q7G A;  1GQA A;  5L0J A;  2D5R B;  5D91 A;  3G50 A;  1E83 A;  1ZW3 A;  4C3D A;  1R5I D;  3W2W A;  4NTB A;  1OR3 A;  4PJN A;  4YT4 A;  1T01 A;  2EIK C;  5A6J A;  3K1H A;  2LSE A;  4U9E A;  1V55 C;  1ZU5 A;  3DAF A;  2R7Q A;  1I4Y A;  2IXM A;  4O6Y A;  2H7B A;  3RW0 A;  3LS0 A;  2KJG A;  2NG1 A;  1CGN A;  3B0P A;  2VC9 A;  5EK0 A;  2QY9 A;  1JAF A;  2XXA B;  1LS1 A;  3DM9 B;  3VYW A;  4DRJ B;  2HS5 A;  2DGJ A;  1ORY A;  1Q0G A;  3KH2 A;  4U5H A;  3L1M A;  4DXW A;  4MQ9 F;  5KYY B;  3BRJ A;  5KYW B;  3POV A;  3Q6M A;  2EPL X;  3PMR A;  2Y3B A;  2XS8 A;  3FHD A;  3LEO A;  2YZS A;  2P1A A;  4PK4 A;  2EIM C;  4NCQ A;  1J8M F;  2NSF A;  2XLW A;  4EKW A;  3HKK A;  4X0R A;  4EIY A;  4CSA C;  1OCC C;  4KNV A;  1H7I A;  2I15 A;  2J9W A;  3A9C A;  1HE1 A;  4JJF A;  4MW8 A;  4N6C A;  5K0I A;  1E84 A;  1ORJ A;  1TWA A;  2YL0 A;  3CSK A;  4JIO A;  4GQH A;  2IXN A;  4ER9 A;  3HNL A;  5HV9 A;  3R7C A;  1APC A;  4DBR A;  4K7B A;  1Q0K A;  1G5Z A;  1RKC A;  4DBQ A;  2MYS A;  4CS9 A;  2LK4 A;  1BR1 A;  1LS4 A;  2NUP A;  1LPE A;  3LEV A;  4XTK A;  2KGO A;  3AG4 C;  3IQT A;  4J32 B;  4LLE A;  2PNO A;  1LKX A;  4ANJ A;  3GEI A;  3GM2 A;  1H6G A;  5KYN A;  3MX3 A;  1RCP A;  2F22 A;  1BR4 A;  4YL0 A;  5DS4 A;  3AOU A;  1RKE A;  3C8Z A;  3GM1 A;  3NYJ A;  3IEE A;  4C7O B;  2R7U A;  3EGX B;  1M2O A;  4HFF B;  4Z9H A;  3ZQV A;  1QSP A;  4G78 A;  2XLE A;  4CIP A;  2KQ9 A;  3OEO A;  4JZA A;  3S28 A;  2LFF A;  3Q6N A;  4JC7 A;  4P6I C;  4MTO A;  1CPR A;  3SNH A;  2XL6 A;  2HV6 A;  4WAB A;  2GAQ A;  4AL0 A;  1YJG A;  3EFO A;  4WJ0 A;  1NZE A;  4YT2 A;  3KYJ A;  2HZ8 A;  4DJ9 A;  4XEV A;  2CNW A;  1UFB A;  2G62 A;  2Q9A A;  2HJM A;  1PV3 A;  1OR2 A;  3GEE A;  3AQC A;  3KYI A;  3SZR A;  2EPK X;  3F47 A;  1BZ4 A;  3FXH A;  1LM3 B;  2ZD9 A;  5COM A;  1D0Y A;  2Q4F A;  2XSE A;  3DXJ F;  2HFI A;  1FMW A;  2CNW D;  1XZP A;  2IYL D;  2YLD A;  3M1C B;  3RF3 A;  3T4R A;  4JEB A;  4NY3 A;  3UMH A;  4OIO F;  3JSE O;  4J7Y A;  3TOM A;  1FR0 A;  3ZTM A;  3ZWI A;  3TK0 A;  2J9V A;  2PP4 A;  3C7J A;  5L0H A;  3UGP A;  2KSF A;  3FAJ A;  3JCU Q;  1MQV A;  4CS9 C;  3T9O A;  3V5Z A;  5L0G A;  3J06 A;  4CJO A;  1NFO A;  2ZXR A;  3DE9 A;  2LQG A;  3U2L A;  1VTM P;  1LIH A;  2ETS A;  4NC3 A;  4F4B A;  5KYY A;  1OKK A;  2OQM A;  4FWV A;  4AE4 A;  2J9B A;  1NLX A;  2QUP A;  4LDK A;  3C8G A;  3HJC A;  4JVS A;  1OCO C;  4FAP B;  1OKK D;  2B0J A;  2FAP B;  2WVQ A;  3G4Z A;  2WVN A;  2VCA A;  2OCC C;  3L8J A;  4LER A;  3W4Y A;  4C3E A;  3KMI A;  2W4B A;  2YL7 A;  2A0B A;  2E87 A;  1J8Y F;  2MHR A;  4CS8 C;  1A0B A;  3G4X A;  2L81 A;  3FMS A;  4DVZ A;  2DI3 A;  2R7S A;  3AG2 C;  1EKY A;  2R7T A;  5KYX B;  3O39 A;  4O6N A;  1SF8 A;  2J0W A;  3NMI A;  4IB4 A;  4O79 A;  4YT5 A;  4CJG A;  2NUP B;  1QPU A;  5A69 A;  2OU6 A;  3W2V A;  4P9T A;  3H65 A;  1OQC A;  3IQC A;  3FDQ A;  2PFD A;  1JRA A;  4OIN F;  3UMI A;  1Z6A A;  2XL8 A;  4M63 A;  2G3V A;  1RKE B;  3K1I A;  5AC4 A;  5E3A A;  4EWC A;  3DKA A;  3U5S A;  1Z23 A;  4A2N B;  1BBH A;  4L6R A;  3GOR A;  3ASN C;  4XPW A;  2HJ3 A;  1OCZ C;  1VK5 A;  1KU2 A;  2Q7R A;  3EH1 A;  4Q5S F;  2J7P A;  1E2X A;  2QE9 A;  4NTA A;  3T6G B;  4QI2 A;  4N6H A;  1V4A A;  2Z15 A;  3UNG C;  3EFO B;  3DM5 A;  2PX3 A;  1FFH A;  1GS9 A;  1WN0 A;  1A41 A;  2G3K A;  2R05 A;  3CAX A;  4JE9 A;  4BJ6 A;  1IW7 F;  4PJM A;  2EPN A;  1VB5 A;  3LUT B;  3CQZ A;  2XLM A;  3N2Z B;  5KYU B;  3JSZ A;  4G0H A;  2OG2 A;  1TWH A;  1KTM A;  1RJ9 B;  1Q0F A;  1M56 C;  1SR2 A;  3ZDL A;  2EIJ C;  4EBB A;  4YT8 A;  4IWB A;  4CX9 A;  4MVR A;  4MVU A;  4P9F A;  1ORS C;  3SXY A;  2BL2 A;  2UUH A;  4BJ5 A;  3PHF 2;  5L0D A;  5TJ5 E;  2HMQ A;  2XRH A;  3LS1 A;  3W8H A;  2J8W A;  3I5P A;  1D1A A;  2R7V A;  4CDV A;  1CGM E;  4Q7C A;  2CCY A;  5JVE A;  2FGY A;  4CDY A;  3KL4 A;  5DS6 A;  5DQT A;  4GEH A;  4H4K C;  4BPM A;  3EHM A;  4IAO A;  3QTH A;  1KNY A;  3R2P A;  2DYR C;  2VB6 A;  3DMD A;  3E70 C;  1HY5 A;  4U5E E;  3K7D A;  3ABL C;  4AE4 B;  2L7A A;  3C8G B;  1UG7 A;  5JLI A;  1QQ3 A;  4U5B E;  1YYX A;  3RH3 A;  1S05 A;  3S9O A;  1RMV A;  1O87 A;  1B68 A;  1Z63 A;  2A1D D;  4K1O A;  4PR9 A;  3ZIB A;  3RKO F;  1VOM A;  4XLN F;  2C03 A;  2DYS C;  3WAQ A;  3AQB A;  3C63 A;  3QVZ A;  5CIV A;  1H9T A;  1C03 A;  2IBF A;  3DZA A;  4AL1 A;  4JEA A;  2GWW A;  4PFO A;  5DQZ A;  1YAR O;  3RQE A;  2NUT B;  3LAY A;  5B1A C;  3JZ0 A;  3SXZ A;  5A6A A;  5KYX A;  4XPX A;  3NMJ A;  3DD7 A;  1MMN A;  3M15 A;  4NTF A;  4OIP F;  1L3P A;  4FES A;  3U9M A;  1H9G A;  3M79 A;  1ZHY A;  2IXO A;  3NYL A;  4EBJ A;  2YQY A;  1S7Z A;  4JJG A;  1Z7Q c;  1HW1 A;  2XLD A;  3ASO C;  2X51 A;  3M4C A;  1IZM A;  2J46 A;  3LNR A;  2JPU A;  1YAU O;  5D92 A;  1E85 A;  3KPH A;  5F28 E;  3EZI A;  2R25 A;  2L6H A;  4D4N A;  1TFK B;  1YYJ A;  2HSQ A;  2WZF A;  3EQL F;  3RFY A;  2LD6 A;  3UMK A;  3QW0 A;  1XZQ A;  4JKV A;  3O10 A;  4Z9I A;  2VH3 A;  1K04 A;  3PCV A;  3EJN A;  3LNM B;  1WAS A;  4J7T A;  5BUO A;  3IQ6 A;  2YWA A;  2H8A A;  3X2Q C;  2AU5 A;  5KYU A;  4CDA A;  3DE8 A;  1LVK A;  3ABM C;  3N0T A;  1MNE A;  1T6I A;  2HMZ A;  2P61 A;  1RJ9 A;  3T6B A;  2Y69 C;  4MTG A;  1ZHX A;  4BG0 A;  5JP7 A;  4OD5 A;  1O5H A;  2KW3 C;  4R32 A;  2WL8 A;  4I1M A;  1Z5Z A;  5EHH A;  3H2V A;  1TWC A;  2XM4 A;  4CBE A;  4ZLC A;  1QLE C;  4KI2 A;  2YEV A;  3LES A;  4PAC A;  3QMK A;  4IJJ A;  5E2Q A;  1WGW A;  1NU7 D;  5T1D B;  3U8P A;  4JTD B;  2R7W A;  1JR8 A;  2WB7 A;  3NRH A;  1ZHZ A;  4ONS A;  5BQG A;  3SXM A;  3U0C A;  3EG9 A;  3PDM P;  2AVK A;  4B6I A;  1OCR C;  1BR2 A;  1ST6 A;  2J45 A;  2YLI A;  3NKD A;  2M64 A;  5DS5 A;  3DJN B;  1FFT C;  4U5G A;  4DRH B;  3V5Y A;  3TUL A;  4BEM J;  3AGU A;  5L0C A;  1SMY F;  2CW0 F;  2FFH A;  4LAC B;  4IAQ A;  4HEA J;  4YN0 B;  3GAN A;  3NG1 A;  4HE8 D;  3TQO A;  4MTF A;  4YJW A;  2OKU A;  3MLG A;  3B9Q A;  2YVK A;  4PJL A;  2Y3H A;  4I3M A;  3C8G D;  5GPG B;  3GWN A;  2P6V A;  1M57 C;  1LE2 A;  1ZYR F;  2R9R B;  3GWL A;  1QVX A;  3NKE A;  3S84 A;  1D0X A;  3S90 A;  4OIQ F;  3SEO A;  2NUT A;  3HLZ A;  3WHN A;  3B29 A;  2LFD A;  2RD9 A;  4GYT A;  2HKV A;  3MYI A;  2XLH A;  4YK5 A;  3TD7 A;  4BJ6 C;  4MW3 A;  4BEJ A;  2QLA A;  3HNI A;  4XQ1 A;  1E86 A;  3LLK A;  1MMD A;  1ZW2 A;  1L7C A;  1MMA A;  3RVY A;  1QZX A;  5IY5 C;  5CI8 A;  2ASR A;  2QNL A;  1C17 M;  1LI7 A;  2L6F A;  2Q00 A;  2XLV A;  3K33 A;  3NYM A;  2HV7 A;  1D1B A;  2WVO A;  3US6 A;  3ZQY A;  2TMV P;  3SYN A;  1K40 A;  4N4W A;  3I5Q A;  4BJT A;  3JYH A;  3VRC A;  1FAP B;  2IOQ A;  1G4W R;  1XWJ A;  4Q4Z F;  4QI0 A;  1Q0D A;  4W8P A;  2GDC A;  1YVI A;  3MYF A;  1AVO B;  2BE5 F;  2R03 A;  2J9U A;  3KKB A;  2AWC A;  3EPV A;  1D0Z A;  3FOO A;  2J7P D;  3MFN A;  1YA9 A;  2ZPA A;  3DJU B;  3UR3 C;  4DVY P;  4E7Z A;  2WZG A;  3JRM O;  4AX2 A;  1WOL A;  2JX0 A;  3AJM A;  3H2U A;  3LLI A;  2W4M A;  1T6Q A;  1EI7 A;  2LCH A;  2NSG A;  3ECS A;  3ABK C;  3VF0 A;  3ZG1 A;  1WWP A;  4JUR I;  4KC9 A;  3GOD A;  4QDL A;  1OW8 A;  2LIG A;  4U5F E;  1ZZP A;  3OWT A;  3EHN A;  3HNJ A;  5JS5 A;  4EUK B;  3AG1 C;  1TKN A;  5L3V A;  5COF A;  3TJ6 A;  4XEK A;  3IQ5 A;  4WGY A;  2YL3 A;  2VCC A;  3EG9 B;  5T3T A;  2V26 A;  3O55 A;  1YA7 O;  4MS2 A;  2ZXP A;  5JRA A;  4MVM A;  4I44 A;  1R4T A;  4KNW A;  3B0V C;  2V3C C;  3JTL O;  3ITF A;  1A7D A;  2H7V C;  5B1B C;  5JUA A;  1FNT c;  4AK9 A;  3QW1 A;  3B0U X;  3DAG A;  1OXK A;  256B A;  3K1I C;  3QVY A;  2I8B A;  1TR2 A;  2DB4 A;  5L0I A;  4MVS A;  5AC5 A;  4U9D A;  1YDI A;  2A6E F;  1HMO A;  3F46 A;  3FVY A;  2OEX A;  1CGO A;  2LP4 A;  3EGD B;  2A68 F;  3TJ5 A;  1HMD A;  1T6U A;  3NMK A;  5AGF A;  2R7X A;  4C3B A;  4E0I A;  4LDQ A;  1C02 A;  2M4E A;  3L8I A;  5E3C A;  1JPJ A;  4MVQ A;  3GM3 A;  1T5O A;  1M6T A;  4PJJ A;  3M4B A;  3S29 A;  3TOL A;  2EIL C;  2QTV A;  4RD9 A;  1MND A;  1PCX A;  1CPQ A;  4JCZ A;  1T9K A;  2Y3G A;  5A6B A;  4MVZ A;  2GFH A;  3U9J A;  1WAT A;  2CDQ A;  4BJ5 C;  2KNH A;  3OA1 A;  4JTC B;  5CI9 A;  3ZVR A;  3SP1 A;  2O9X A;  3X1O A;  2YRF A;  2XS1 A;  4YL1 A;  4E17 A;  4XLP F;  5A6B D;  5COG A;  4BJ1 A;  1YZA A;  5L0F A;  4G7O F;  2HSB A;  3EH2 A;  2PX0 A;  3E9V A;  3W8I A;  1NU9 C;  1GGQ A;  4ZLD A;  1A7V A;  1BDJ B;  1I4Z A;  1M2V A;  1VLS A;  1VYK A;  2A0U A;  3VM6 A;  4XPY A;  1NFN A;  2R7R A;  4OIR F;  5A6K A;  2Y39 A;  4DOZ A;  3MBG A;  4JW1 A;  4K0D A;  2UUI A;  5JSL A;  1I5N A;  4J30 B;  4O6M A;  1W2W A;  3V5X A;  4EBK A;  1U0B B;  2W45 A;  1U6H A;  5HSW A;  5F5H A;  4KBL A;  4E0H A;  1Y6D A;  1O3U A;  3DI5 A;  1HW2 A;  1JPN A;  2L6G A;  1SYQ A;  2CGE A;  2W9Y A;  1ZHW A;  2OOC A;  3U3B A;  3VAY A;  1JMW A;  4MVO A;  1ZHT A;  1K05 A;  2XL4 A;  4ULW A;  4ULV A;  1LI5 A;  2OEV A;  1FMV A;  4OD4 A;  3RQF A;  1NSG B;  1RXQ A;  1G4U S;  3ZC4 A;  1OW6 A;  4DRI B;  4W8K A;  2ZXO A;  5L3Q A;  2WZL A;  1MMG A;  4EHP A;  1V74 B;  2VAS A;  3HTK C;  2BC5 A;  4Z9J A;  1HE9 A;  2B0H A;  2Q9B A;  2GA0 A;  1JOG A;  3N24 A;  4CS8 A;  4YWQ A;  4RBN A;  3CZ6 A;  3IPM O;  5FZT A;  4G7H F;  2AP3 A;  1EA8 A;  2Y3D A;  1Q0M A;  1YLM A;  2P7V A;  1GM5 A;  4IGG A;  3JRT A;  3U8V A;  4N06 A;  1AEP A;  3L34 A;  5F5F A;  1OXB A;  1PD1 A;  3RVZ A;  4E7S A;  1ZVZ A;  2R7O A;  3UGO A;  3Q7L A;  3U3F A;  4U5D E;  3WG7 C;  3S0X A;  4U5C E;  1ZU4 A;  1SZI A;  5B3S C;  1A7E A;  2P0N A;  1G8X A;  2Q3T A;  3AG3 C;  4LLC A;  3DWW A;  1DOV A;  2H7O A;  3HNK A;  3ATP A;  4O7G A;  2EPM X;  2EPO A;  2Q9C A;  2EIN C;  2D4U A;  2RSE B;  3EGD A;  4YL3 A;  4IAR A;  1OW7 A;  4LDR A;  1DOW A;  3I4U A;  4A4A A;  1D1C A;  3AGT A;  4FX5 A;  4H54 A;  2OJE D;  4RDA A;  5DVW A;  3WOD F;  2MWQ A;  1V54 C;  3JT1 A;  5B3I A;  5EGY A;  2XXA A;  1LE4 A;  4JTA B;  2AWY A;  1PD0 A;  2PBE A;  5KYW A;  3JYY A;  1YZC A;  3A11 A;  3CEX A;  1Y4C A;  3K6B A;  3S27 A;  1TWG A;  3BEH A;  1U89 A;  2JD3 A;  2KYH A;  5BQH A;  1M2V B;  3U2M A;  2A69 F;  1F1M A;  3FOP A;  1QKR A;  4NQF A;  1TQG A;  1NBB A;  1N1C A;  2R02 A;  5FCL A;  3O6X A; 
#chains in the Genus database with same CATH homology
 3JTL O;  1FNT c;  1Z7Q c;  3JSE O;  1AVO B;  1YAR O;  1YA7 O;  3JRM O;  3IPM O;  1YAU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...