1AVYA

Fibritin deletion mutant m (bacteriophage t4)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
TNKIKAIETDIASVRQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVLLSTFLSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of bacteriophage T4 fibritin M: a troublesome packing arrangement.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Coiled coil
molecule keywords FIBRITIN
total genus 19
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1avyA00
2ZYGA 1AA0A 2IZ1A 2ZYAA 2W8ZA 1PGJA 1AVYA 1PGQA 2IYOA 2IYPA 2JKVA 2PGDA 3FWNA 2W90A 2ZYDA 2IZ0A 1PGOA 1PGPA 1OX3A 1NAYA
chains in the Genus database with same CATH superfamily
1URQB 2E5TA 1KB9D 1N7SD 1QL2A 2BASA 4PJ0H 2A06E 1GTWA 3MIWA 2XV5A 1KYOI 2WSSH 4L73A 1RF0A 4R4MA 1YJ9P 3SWYA 3TDKA 2Y9ZA 1BGYD 2QE7H 2WSFJ 4D6TG 3H32B 3V2NA 3M0AA 1PPJG 4LC1A 1OVRA 1MKMA 1SQXG 4HJGH 1FJKA 3CCEP 4PD4E 4WY4C 1M90Q 2O01J 2ITAA 3FGAD 3L71D 3A7OA 5KAFE 3AE5C 5AVXB 1BCCE 1OW7A 3I55P 3M9BA 2FYNC 1KORA 1K04A 3HUSB 4HB1A 3Q1MA 1LTBC 2WSEJ 4AQRD 4BXLA 4ZMDA 3RK3D 2BEZF 2HG5D 5AVVB 1NTKD 4I7ZC 1KILC 1HVVA 1IJDB 3V5BA 1JY3O 1QGKB 2FYUE 5EFWB 2KZIA 3AEEC 3GMAA 4YXWH 2A45I 5APWA 3A0HE 4H0LD 1KC8Q 1JTHB 2YKPA 2N1TD 3C8VA 1VQKP 1URQD 4OGQD 2POHA 3AE4C 2K9JA 2YIUB 2D2CD 1LT9A 3B71A 2O01H 3H1IG 4R4LA 3WU2E 3H32A 3HD7D 3OA7A 4GKGA 1VQPP 4D6TD 4HYTB 5AW1B 1RF0C 3HE5B 2O1JA 1SQQK 4PJ0E 1ZLLA 2YMKA 2ZFCA 1RY3A 1NOHA 5AVQB 1JY2P 4DJGA 2FFDA 3HD7A 2BCCG 1SQPE 3H1LG 4A7PA 1HF9A 3G3ZA 3CXHH 3GHGA 5CMZA 1KB9H 2OYIC 2H7HA 1ZOYC 2K9YA 2KUBA 3FWNA 4RKUJ 2OTLP 3MUDA 1KYOD 1NU1D 5AW6B 1S9KE 3H25A 1LTJB 1SQQE 1JY3N 2LXBA 4GOFA 4U3FD 3USSA 1YBKA 1J1EC 1NTKG 2D2CB 2SPZA 1K05A 2ZXXA 3HTKB 4WWIA 3VOPA 5CCGD 1PGPA 3HTKA 5CCHA 2WT7A 1DX7A 2HODB 1J1DB 2Q5UA 1SFCD 3H6PA 1NTZD 2M8RA 3L74J 1NO4A 1OFCX 3O8ZA 4RO0A 1CSBA 3A2AA 2Q3IA 5C39A 2M5AB 2H88C 3RK3B 1FZFA 3TGUD 3V4WA 3MHVA 4AYCA 2XU6A 2L91A 2UWJE 3D70A 2WSCH 3CXHD 1LJ2A 2OYIA 1Q86Q 5KLVJ 5AVSB 3OW2O 3HE5A 1L4AD 1OIPA 1PPJE 2K88A 5AW9B 1LTSC 3EFFK 1L2PA 2L5GB 1NTKK 2A45H 5CJ0A 5AVTB 1LT9B 4LGDE 1SQVE 1H8AA 2QJPB 4NPFX 1IFPA 1GK6A 1T6AA 3C1LA 3KDPB 1L0LE 2AEFA 3AE8C 3L36A 4GIFA 2BEQD 4U3FJ 2Z4EA 2H89C 2BCCJ 1SS1A 3B5NC 3H1LJ 4IOIH 3A5TA 1WT6A 1FOSE 3Q5RA 3IFMA 3M0DA 4N6JA 4H44B 3RK2B 2IBZI 2QRXA 3GHGB 1NWQA 1H0TB 2V7QJ 3L70D 3Q5SA 2FYUG 3KQGA 1RF1C 3HUSA 4H0LC 1L0LK 1BE3G 1KZUB 1TU3F 2QA4P 2QM8A 1P84H 3GLMA 1L4AA 3T97B 1KILE 5GTHH 3H1JD 4I2LC 2O1KA 1PV3A 3H1IE 2GUVA 1FE6A 2WPRA 1PGOA 2J59M 2KNCB 5CHXA 1VQLP 1KYOH 2MKVA 5H2FH 1MZ9A 2V7QH 3F5HA 5CCHD 2BCCE 3H1LE 3TGUG 1KTMA 2YMYA 2WPSA 5AVWB 1KB9E 2C0WA 3CWBD 1SFCA 5APUA 3S1KA 3S4RA 1GW3A 1NTZK 2A06D 2QJKC 3R4YA 1NGMB 1JUNA 5AW8B 2OGUA 2C9NY 1NH4A 3VP8A 3CC2P 1KN7A 3L71J 3ITKA 1BGYE 2ZXEB 5CCGC 2RN0A 1JM0A 3SWFA 2AEJA 1RQVA 4Y28J 2W6JH 1GL2A 3CCMP 4TLFA 3CI9A 2N1TC 3L37A 1D7MA 3H1KJ 1GU5A 1NYHA 1JO5A 5APQA 2C0XA 2KOGA 3H1JG 3LW5H 2K3RA 4H44D 1GDTA 2MJZA 1ZXGA 1J1DC 1FJPA 1E79H 3L75G 2Y0DA 1NTMK 1Y9BA 3BATA 2GM4A 1VQ6P 1IK7A 1AA0A 1SLQA 3KPEA 3L70G 4L74A 5E79E 5CCHC 1VQ8P 4RESB 5APSA 4PV1C 4IFFA 3CCVP 3MD0A 1ZMEC 1N73C 5KJ7C 2ZT9D 3LW5J 1YITP 3V4QA 1PGJA 5CCGA 1KFNA 1BDDA 2NPSB 1LWUB 2E74C 2ZJSE 3TK1A 1GZLA 3KYQA 3PH0A 1M57D 2JP3A 1EDJA 2QJYB 4PD4I 1H88A 1AJYA 1ZN5A 1QX8A 2GA1A 2KS1B 4DCKA 1SFCC 1VQMP 2PAJA 2RMZA 3CMEP 2KZJA 1DD3A 4DOJA 2Q1KA 1NTMD 3IAOA 2JJLA 3CX5E 2R5DA 1IZNB 1M8OB 2IZ1A 3JC22 4OWFA 5APVA 2Q3EA 5AW3B 1KQSO 2E76D 1NTZJ 3L74D 1FZGA 4BRYA 2OYHC 2G8YA 1KYOE 5TISH 1CI6A 3A0HH 3M06A 1OVVA 1AV1A 1KILA 2KYVA 2PFXA 1N73B 2IBZE 4YTPC 2IX7C 3AEBC 1CZQA 1KD1Q 3CC4P 5APYA 3PHLA 5B5EH 2B88A 3RL0g 1GL2D 4KT0J 5KKZB 3D71A 1S3JA 1QEXA 2YO3A 3AE3C 3H1HD 1K9MQ 2QG4A 2M5AA 3LIDA 2OYOA 3I56P 3CC7P 1U7MA 4YXDC 1R5SA 4N78E 1EC5A 2KS1A 3MTUE 1KQLA 1NTMJ 1RE4A 1SQBD 2QJKB 3L4FA 2KSEA 2ZAEB 3M9HA 4ASVA 1G1JA 3BASA 1NAYA 4H13D 2IDBA 1YHQP 4JPZB 1SQVD 5BU5A 4EI2A 2IYPA 1FS0E 3L73D 4N3YB 2FYUK 2B89A 1EZVE 2OQQA 2QJPC 4XA4A 1RE4C 2LKMA 4IFMA 1LT9C 1LTTC 1X0TA 2H8PD 3L35A 3L75E 3NFQA 3HD7B 1Y8AA 4W7ZA 4C7NB 3CCJP 2XKMA 1VQ4P 2QIWA 5DJTB 4IFDK 5KJ7D 2WSCJ 3L72J 1MFZA 4NPEA 3U59A 5KLIC 3E1RA 2FXPA 3MP7B 1KQGB 5GTHE 3P8MC 1J2JB 1QL1A 1KILD 3L75J 2NZ2A 5KKZC 1NTKE 4CPGA 3L70J 2LR2A 3CWBJ 3G4SP 2WQYC 1S2EA 3AEAC 3B8EB 4H13B 4UB8H 2FYUD 3TNUA 1U57A 4EYYQ 1S5LE 2IFNA 2WTYA 1YJWP 2E75C 1FZCA 1EXJA 2I1JA 1YI2P 1BCCJ 1VDFA 1ZRTE 1OWAA 2D2CC 2FXMA 3GHGC 3I5CA 4I6MC 3HD7C 2KI7B 4IL6H 3VMYA 3D6ZA 5L8RJ 3UIAA 5KAIH 3CWBE 5GTIH 2B87A 3KZIE 1YYCA 5M1BA 3RGUA 2FFDB 1HBWA 3P8CE 1W5CE 1S4XA 4JYBA 4GOEA 4WVZA 1QVGO 4UB6E 5CJ4A 4IL6E 1U7JA 2R44A 3AE9C 3CCUP 3NTNA 1SQQJ 3PLNA 5KAIE 3RK3C 1KILB 1N73A 1ZW0A 3P7KA 5KTBA 1L0LG 1NU1E 2JWAA 3AE1C 2HPCB 1FZBA 5H2FE 4C7RA 1HWTC 1QVFO 2E75B 4BRYB 1GMJA 1PP9J 1LTIC 2E76B 3BCCD 2FYZA 1M1JC 1SQVK 1NU1J 1T3JA 1KMIZ 3BRVB 3RL0B 1SQPK 3AEGC 1S72P 3HRNA 3VMAA 1LP1B 1NTZE 1RHZB 2NPSD 3QH9A 1S1CX 1SQXD 4WY4A 5KAFH 2KSJA 1BE3E 1JY2O 1PP9D 2WSEH 3CX5I 3KXDA 2YKOA 3NMDA 4W7YA 1T2KD 2W6AA 2KNCA 2QSIA 1SQBK 5KLVK 1HH0A 2WZ7A 4WB4A 1IFNA 1JTHA 1S5LX 3TGUJ 3AE6C 3M91A 1H89A 1DH3A 3H1IJ 1EZVG 2Z5HA 2ZVNB 1WMKA 2J5UA 3ABVC 4O9BA 4PV1D 1K73Q 3V2QA 4C46A 1LTAC 3N4XA 2M3BA 3TYYA 3WUVA 2M3EA 1DD4A 1EQ7A 2W83C 4KHXA 1Y47A 4UB6H 1FZEA 1VPCA 2OYIB 1M56D 2WWWA 4WBAA 1A02F 5AW5B 1SFCB 1L0LD 1NTME 3AEFC 3CX5D 2W90A 3EWKA 3O6QB 1BSNA 4BWNA 4DT0A 1Q81Q 1FBMA 1BDCA 1R5LA 1FDIA 4K3AA 5KJ7A 2HPCA 2CK3H 1LNQA 3L73J 1S5LH 1LWUC 2E74B 2Z5IA 1KB9I 2V4HA 2ZVOB 2HODA 1URQC 1YQ3C 2I1KA 3A0BH 3H1KG 3L72E 3PRJA 5AVYB 1L0LJ 1JB0J 4OGQC 1JNMA 3CXHI 3AECC 3WUTA 1PP9G 4NPDA 3F89A 3L74G 2YXRB 4U7JA 4WY4B 5BVZA 1A02J 2ZT9B 3H1JE 1FAVA 1P84D 3H1ID 3CWBG 1JCDA 3S9OA 1CI6B 1IFDA 1RF1B 1AFOA 3JSVC 2YO2A 4HKZH 1AVOA 3M0DC 2BCCD 3H1LD 2N1TB 1AQ5A 3CPWO 3RBZA 1SQBE 2JR8A 2Q6QA 2H43A 1SVFA 1OW8A 2E74D 3H1HG 3V2PA 5KLVG 1SQXK 3VMZA 3BVHA 5BU8B 1OZHA 4GT1A 1IO4A 2XDJA 1XTCC 5GTIE 1FDOA 1SQBJ 1EZVD 2PGDA 2R3CA 1EZVI 5AVZB 3O6QA 4C7NA 2NPSC 2P7JA 3L75D 4IL6X 1NTZG 1VF5B 1YTZI 2YIUC 1ZR4A 1Q82Q 3RK2D 2C9LY 3L73G 3R2PA 2E76C 2KXPB 2HR3A 1SQPJ 4PD4D 4EIJA 3G6EP 1L4AC 1NU1K 5DJUB 1FZCC 1JMMA 2ZYGA 3BRTB 2CPSA 3KHUA 3H1KD 3L71E 4ZNCA 1BCCD 2YXQB 3OAKA 1M1JB 2WMMA 3GF7A 3II6A 2KLVA 2O3JA 2VRSA 4PD4H 2IBZG 3G71P 1W2EA 3Q2YA 5TISE 3B5ND 4JF7A 2N1TA 1PGQA 1UIXA 2N9YB 3CCQP 1NAFA 1R8EA 1LTJC 3RL0D 2B87B 1ZRTD 2A06G 1RF1A 1NTMG 1USEA 4YPCA 1FOSF 4RJTA 2OYHB 3D6YA 1NKNA 5CBNA 2I8DA 3U1AA 2E75D 4EDFA 5APXA 3CMAP 1EXIA 3VP9A 4D6TE 3K5BA 1OX3A 2WPVB 2FFDC 2WSFH 3PTZA 4D6TJ 2OTJP 1RE3A 4H13C 1G1IA 1OW6A 3BCCJ 3WU2H 1SQPD 1X9VA 3JCUH 1T2KC 1Q7YQ 1KQFB 4TT3H 1PFIA 3L74E 1P84I 3GF3A 3IN6A 1LTJA 1AVYA 1PZQA 4B86A 1S9KD 1IK9A 1BE3J 5B5EE 1N2DC 1SQQD 1LP1A 2P2UA 2PP6A 2RH0A 3BCCE 2ZT9C 3IR9A 4U3FE 3VYIA 2CPBA 1EDKA 3E1IA 4Z1MH 2FKWB 2W6BA 4OGQB 3RL0C 1USDA 5K5GB 3CLQA 1PIXA 4H0LB 3B5NB 1VQ9P 5AW4B 1BE3D 1MFTA 1VF5C 3A0BE 1N7LA 3MUDC 3V6IA 5B66H 2Q7CA 3HE4B 4Y99C 3H1HE 5KLVE 1VQNP 3HE4A 2IYOA 3PJSK 1IFJA 1X22A 1JMBA 2IPPA 1KFMA 5AVUB 2JWDA 1LTGC 2K9JB 3B5NA 2IZ0A 2HFED 2W27A 2XNXA 3C9IA 1Z56A 3W68A 5KLIB 1VQOP 3B4SA 1JOCA 1VL2A 2XZRA 4L75A 4XE5B 1L0ND 2R5BA 3P8CD 2KIKA 3SSUA 1LGHB 1SQVJ 4AUWA 1M7LA 2LXCB 1W2BO 1YIJP 1VQ7P 3CD6P 1RE3C 2HLOA 1BSHA 3L73E 4I1LA 3KZIH 5TJHA 3CCLP 1JY3P 3L71G 3CL3D 1HJBA 1JCCA 1SQQG 1IC2A 4Y99B 2IFMA 3SFDC 2JEEA 4GDOA 1K8AQ 1FZAA 3L72D 3T97A 2FY8A 3U1CA 1NTKJ 1X79B 4W80A 1JY2N 1VF5D 2YNYA 1Q90D 1G2CB 3H1JJ 1NU1G 4M3LA 1KV4A 1OVUA 3VMXA 2FXOA 2GUSA 2WPQA 4ZKPA 3EFGA 3OJAB 3CCRP 1P84E 3RK3E 3VN0A 1DIPA 1NJIQ 2KP8A 1GD2E 4JBZA 3SWKA 2M0BA 2P67A 1T8ZA 4MN4C 1NVOA 2YKQA 1URQA 2AXTH 4H44C 2R32A 3RK2C 3ZDMA 2P58A 3AE2C 2FBWC 1DEEG 3G9RA 3FXDA 2Y0EA 3JCUE 3TNUB 1SQVG 2NPSA 5AVRB 1GK4A 4XFJA 4OH8B 1ZR2A 1PL5A 1EDLA 2K1AA 4GODA 2K37A 1ZV8A 3GG2A 2QJYC 3QWOC 3TSIA 1FDMA 1NHLA 4U3FG 3BCCG 4HH2A 3TF5A 1AQTA 1IFIA 1L0NG 1RQUA 4LLHA 2QVAA 3LIEA 2OARA 5AW2B 1XTGB 1N7SC 4UB8E 3A3YB 3AE7C 2FYUJ 1Q2NA 1J1EB 3Q3DA 1G2CA 4EOTA 1GW4A 5B66E 2WT7B 2WITA 3H1KE 1E5WA 4JQ0D 1FZCB 2HYNA 2N9BA 4I7ZB 3L72G 2O01N 3WMM0 1SQXE 2E42A 1HGVA 3E7KA 5AW0B 2FYNB 3GW6A 1PP9E 3HUSC 3NXSA 1DEBA 1ZP0C 1GU4A 3TGUE 4WY4D 2ZYAA 2OYHA 1BCCG 3SFEC 4L76A 2B9BA 2XNDH 1L0NK 2Y9YA 2A45G 3MZWB 3CXHE 4ZKUA 1N7SA 1QLED 2JDIH 3PP5A 1N7SB 1RH5B 2KB7P 2Q9IA 2KK7A 2RKLA 1BGYG 1PPJD 3FWLA 2E5YA 2E43A 4JYCA 3WUUA 2ZYDA 1YJNP 3FXEA 1CW5A 1SQBG 4ASWA 3H1HJ 1GL2B 1YQ4C 1UIIA 2OTKE 1L0NJ 3VTPC 1MUUA 1FC2C 1M1KQ 1OMIA 3RBXA 1LT1A 3EQ2A 3M9QA 1HUCA 1SQXJ 1N86A 1NKZB 2P1JA 2Y0CA 2AXTE 5APTA 1HGZA 2AXCA 3V2RA 1T3UA 2R3SA 3IF4A 4PV1B 1H0TA 1OXZA 1YTZT 2JKVA 1IFMA 1SQPG 1X8YA 2KLUA 2PRRA 1HTLC 3L70E 4KJMA 4QMAA 2DW3A 5E79H 1SP4A 2IBZD 2QM7A 5AW7B 3MGNA 3W67A 1VQ5P 2QEXP 2W8ZA 1HJ0A 3N7NA 1MV8A 1JEKA 2WVRA 4OVNF 1WRGA 1M1JA 2P10A 5KLVD 2AEMA 1LWUA 1N8RQ 1FU1A 1GL2C 3CCSP 1L4AB 2JO1A 2NRGA 3AEDC 3CX5H 4DZOA 5CBOA 3P32A 3Q5PA 4N78D 4K35A 2J58A 2G3AA 1BGYJ 3FX0A 1EDIA 1L0NE
chains in the Genus database with same CATH topology
2ZYGA 1AA0A 2IZ1A 2ZYAA 2W8ZA 1PGJA 1AVYA 1PGQA 2IYOA 2IYPA 2JKVA 2PGDA 3FWNA 2W90A 2ZYDA 2IZ0A 1PGOA 1PGPA 1OX3A 1NAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZYG A;  1AA0 A;  2IZ1 A;  2ZYA A;  2W8Z A;  1PGJ A;  1AVY A;  1PGQ A;  2IYO A;  2IYP A;  2JKV A;  2PGD A;  3FWN A;  2W90 A;  2ZYD A;  2IZ0 A;  1PGO A;  1PGP A;  1OX3 A;  1NAY A; 
#chains in the Genus database with same CATH topology
 1URQ B;  2E5T A;  1KB9 D;  1N7S D;  1QL2 A;  2BAS A;  4PJ0 H;  2A06 E;  1GTW A;  3MIW A;  2XV5 A;  1KYO I;  2WSS H;  4L73 A;  1RF0 A;  4R4M A;  1YJ9 P;  3SWY A;  3TDK A;  2Y9Z A;  1BGY D;  2QE7 H;  2WSF J;  4D6T G;  3H32 B;  3V2N A;  3M0A A;  1PPJ G;  4LC1 A;  1OVR A;  1MKM A;  1SQX G;  4HJG H;  1FJK A;  3CCE P;  4PD4 E;  4WY4 C;  1M90 Q;  2O01 J;  2ITA A;  3FGA D;  3L71 D;  3A7O A;  5KAF E;  3AE5 C;  5AVX B;  1BCC E;  1OW7 A;  3I55 P;  3M9B A;  2FYN C;  1KOR A;  1K04 A;  3HUS B;  4HB1 A;  3Q1M A;  1LTB C;  2WSE J;  4AQR D;  4BXL A;  4ZMD A;  3RK3 D;  2BEZ F;  2HG5 D;  5AVV B;  1NTK D;  4I7Z C;  1KIL C;  1HVV A;  1IJD B;  3V5B A;  1JY3 O;  1QGK B;  2FYU E;  5EFW B;  2KZI A;  3AEE C;  3GMA A;  4YXW H;  2A45 I;  5APW A;  3A0H E;  4H0L D;  1KC8 Q;  1JTH B;  2YKP A;  2N1T D;  3C8V A;  1VQK P;  1URQ D;  4OGQ D;  2POH A;  3AE4 C;  2K9J A;  2YIU B;  2D2C D;  1LT9 A;  3B71 A;  2O01 H;  3H1I G;  4R4L A;  3WU2 E;  3H32 A;  3HD7 D;  3OA7 A;  4GKG A;  1VQP P;  4D6T D;  4HYT B;  5AW1 B;  1RF0 C;  3HE5 B;  2O1J A;  1SQQ K;  4PJ0 E;  1ZLL A;  2YMK A;  2ZFC A;  1RY3 A;  1NOH A;  5AVQ B;  1JY2 P;  4DJG A;  2FFD A;  3HD7 A;  2BCC G;  1SQP E;  3H1L G;  4A7P A;  1HF9 A;  3G3Z A;  3CXH H;  3GHG A;  5CMZ A;  1KB9 H;  2OYI C;  2H7H A;  1ZOY C;  2K9Y A;  2KUB A;  3FWN A;  4RKU J;  2OTL P;  3MUD A;  1KYO D;  1NU1 D;  5AW6 B;  1S9K E;  3H25 A;  1LTJ B;  1SQQ E;  1JY3 N;  2LXB A;  4GOF A;  4U3F D;  3USS A;  1YBK A;  1J1E C;  1NTK G;  2D2C B;  2SPZ A;  1K05 A;  2ZXX A;  3HTK B;  4WWI A;  3VOP A;  5CCG D;  1PGP A;  3HTK A;  5CCH A;  2WT7 A;  1DX7 A;  2HOD B;  1J1D B;  2Q5U A;  1SFC D;  3H6P A;  1NTZ D;  2M8R A;  3L74 J;  1NO4 A;  1OFC X;  3O8Z A;  4RO0 A;  1CSB A;  3A2A A;  2Q3I A;  5C39 A;  2M5A B;  2H88 C;  3RK3 B;  1FZF A;  3TGU D;  3V4W A;  3MHV A;  4AYC A;  2XU6 A;  2L91 A;  2UWJ E;  3D70 A;  2WSC H;  3CXH D;  1LJ2 A;  2OYI A;  1Q86 Q;  5KLV J;  5AVS B;  3OW2 O;  3HE5 A;  1L4A D;  1OIP A;  1PPJ E;  2K88 A;  5AW9 B;  1LTS C;  3EFF K;  1L2P A;  2L5G B;  1NTK K;  2A45 H;  5CJ0 A;  5AVT B;  1LT9 B;  4LGD E;  1SQV E;  1H8A A;  2QJP B;  4NPF X;  1IFP A;  1GK6 A;  1T6A A;  3C1L A;  3KDP B;  1L0L E;  2AEF A;  3AE8 C;  3L36 A;  4GIF A;  2BEQ D;  4U3F J;  2Z4E A;  2H89 C;  2BCC J;  1SS1 A;  3B5N C;  3H1L J;  4IOI H;  3A5T A;  1WT6 A;  1FOS E;  3Q5R A;  3IFM A;  3M0D A;  4N6J A;  4H44 B;  3RK2 B;  2IBZ I;  2QRX A;  3GHG B;  1NWQ A;  1H0T B;  2V7Q J;  3L70 D;  3Q5S A;  2FYU G;  3KQG A;  1RF1 C;  3HUS A;  4H0L C;  1L0L K;  1BE3 G;  1KZU B;  1TU3 F;  2QA4 P;  2QM8 A;  1P84 H;  3GLM A;  1L4A A;  3T97 B;  1KIL E;  5GTH H;  3H1J D;  4I2L C;  2O1K A;  1PV3 A;  3H1I E;  2GUV A;  1FE6 A;  2WPR A;  1PGO A;  2J59 M;  2KNC B;  5CHX A;  1VQL P;  1KYO H;  2MKV A;  5H2F H;  1MZ9 A;  2V7Q H;  3F5H A;  5CCH D;  2BCC E;  3H1L E;  3TGU G;  1KTM A;  2YMY A;  2WPS A;  5AVW B;  1KB9 E;  2C0W A;  3CWB D;  1SFC A;  5APU A;  3S1K A;  3S4R A;  1GW3 A;  1NTZ K;  2A06 D;  2QJK C;  3R4Y A;  1NGM B;  1JUN A;  5AW8 B;  2OGU A;  2C9N Y;  1NH4 A;  3VP8 A;  3CC2 P;  1KN7 A;  3L71 J;  3ITK A;  1BGY E;  2ZXE B;  5CCG C;  2RN0 A;  1JM0 A;  3SWF A;  2AEJ A;  1RQV A;  4Y28 J;  2W6J H;  1GL2 A;  3CCM P;  4TLF A;  3CI9 A;  2N1T C;  3L37 A;  1D7M A;  3H1K J;  1GU5 A;  1NYH A;  1JO5 A;  5APQ A;  2C0X A;  2KOG A;  3H1J G;  3LW5 H;  2K3R A;  4H44 D;  1GDT A;  2MJZ A;  1ZXG A;  1J1D C;  1FJP A;  1E79 H;  3L75 G;  2Y0D A;  1NTM K;  1Y9B A;  3BAT A;  2GM4 A;  1VQ6 P;  1IK7 A;  1AA0 A;  1SLQ A;  3KPE A;  3L70 G;  4L74 A;  5E79 E;  5CCH C;  1VQ8 P;  4RES B;  5APS A;  4PV1 C;  4IFF A;  3CCV P;  3MD0 A;  1ZME C;  1N73 C;  5KJ7 C;  2ZT9 D;  3LW5 J;  1YIT P;  3V4Q A;  1PGJ A;  5CCG A;  1KFN A;  1BDD A;  2NPS B;  1LWU B;  2E74 C;  2ZJS E;  3TK1 A;  1GZL A;  3KYQ A;  3PH0 A;  1M57 D;  2JP3 A;  1EDJ A;  2QJY B;  4PD4 I;  1H88 A;  1AJY A;  1ZN5 A;  1QX8 A;  2GA1 A;  2KS1 B;  4DCK A;  1SFC C;  1VQM P;  2PAJ A;  2RMZ A;  3CME P;  2KZJ A;  1DD3 A;  4DOJ A;  2Q1K A;  1NTM D;  3IAO A;  2JJL A;  3CX5 E;  2R5D A;  1IZN B;  1M8O B;  2IZ1 A;  3JC2 2;  4OWF A;  5APV A;  2Q3E A;  5AW3 B;  1KQS O;  2E76 D;  1NTZ J;  3L74 D;  1FZG A;  4BRY A;  2OYH C;  2G8Y A;  1KYO E;  5TIS H;  1CI6 A;  3A0H H;  3M06 A;  1OVV A;  1AV1 A;  1KIL A;  2KYV A;  2PFX A;  1N73 B;  2IBZ E;  4YTP C;  2IX7 C;  3AEB C;  1CZQ A;  1KD1 Q;  3CC4 P;  5APY A;  3PHL A;  5B5E H;  2B88 A;  3RL0 g;  1GL2 D;  4KT0 J;  5KKZ B;  3D71 A;  1S3J A;  1QEX A;  2YO3 A;  3AE3 C;  3H1H D;  1K9M Q;  2QG4 A;  2M5A A;  3LID A;  2OYO A;  3I56 P;  3CC7 P;  1U7M A;  4YXD C;  1R5S A;  4N78 E;  1EC5 A;  2KS1 A;  3MTU E;  1KQL A;  1NTM J;  1RE4 A;  1SQB D;  2QJK B;  3L4F A;  2KSE A;  2ZAE B;  3M9H A;  4ASV A;  1G1J A;  3BAS A;  1NAY A;  4H13 D;  2IDB A;  1YHQ P;  4JPZ B;  1SQV D;  5BU5 A;  4EI2 A;  2IYP A;  1FS0 E;  3L73 D;  4N3Y B;  2FYU K;  2B89 A;  1EZV E;  2OQQ A;  2QJP C;  4XA4 A;  1RE4 C;  2LKM A;  4IFM A;  1LT9 C;  1LTT C;  1X0T A;  2H8P D;  3L35 A;  3L75 E;  3NFQ A;  3HD7 B;  1Y8A A;  4W7Z A;  4C7N B;  3CCJ P;  2XKM A;  1VQ4 P;  2QIW A;  5DJT B;  4IFD K;  5KJ7 D;  2WSC J;  3L72 J;  1MFZ A;  4NPE A;  3U59 A;  5KLI C;  3E1R A;  2FXP A;  3MP7 B;  1KQG B;  5GTH E;  3P8M C;  1J2J B;  1QL1 A;  1KIL D;  3L75 J;  2NZ2 A;  5KKZ C;  1NTK E;  4CPG A;  3L70 J;  2LR2 A;  3CWB J;  3G4S P;  2WQY C;  1S2E A;  3AEA C;  3B8E B;  4H13 B;  4UB8 H;  2FYU D;  3TNU A;  1U57 A;  4EYY Q;  1S5L E;  2IFN A;  2WTY A;  1YJW P;  2E75 C;  1FZC A;  1EXJ A;  2I1J A;  1YI2 P;  1BCC J;  1VDF A;  1ZRT E;  1OWA A;  2D2C C;  2FXM A;  3GHG C;  3I5C A;  4I6M C;  3HD7 C;  2KI7 B;  4IL6 H;  3VMY A;  3D6Z A;  5L8R J;  3UIA A;  5KAI H;  3CWB E;  5GTI H;  2B87 A;  3KZI E;  1YYC A;  5M1B A;  3RGU A;  2FFD B;  1HBW A;  3P8C E;  1W5C E;  1S4X A;  4JYB A;  4GOE A;  4WVZ A;  1QVG O;  4UB6 E;  5CJ4 A;  4IL6 E;  1U7J A;  2R44 A;  3AE9 C;  3CCU P;  3NTN A;  1SQQ J;  3PLN A;  5KAI E;  3RK3 C;  1KIL B;  1N73 A;  1ZW0 A;  3P7K A;  5KTB A;  1L0L G;  1NU1 E;  2JWA A;  3AE1 C;  2HPC B;  1FZB A;  5H2F E;  4C7R A;  1HWT C;  1QVF O;  2E75 B;  4BRY B;  1GMJ A;  1PP9 J;  1LTI C;  2E76 B;  3BCC D;  2FYZ A;  1M1J C;  1SQV K;  1NU1 J;  1T3J A;  1KMI Z;  3BRV B;  3RL0 B;  1SQP K;  3AEG C;  1S72 P;  3HRN A;  3VMA A;  1LP1 B;  1NTZ E;  1RHZ B;  2NPS D;  3QH9 A;  1S1C X;  1SQX D;  4WY4 A;  5KAF H;  2KSJ A;  1BE3 E;  1JY2 O;  1PP9 D;  2WSE H;  3CX5 I;  3KXD A;  2YKO A;  3NMD A;  4W7Y A;  1T2K D;  2W6A A;  2KNC A;  2QSI A;  1SQB K;  5KLV K;  1HH0 A;  2WZ7 A;  4WB4 A;  1IFN A;  1JTH A;  1S5L X;  3TGU J;  3AE6 C;  3M91 A;  1H89 A;  1DH3 A;  3H1I J;  1EZV G;  2Z5H A;  2ZVN B;  1WMK A;  2J5U A;  3ABV C;  4O9B A;  4PV1 D;  1K73 Q;  3V2Q A;  4C46 A;  1LTA C;  3N4X A;  2M3B A;  3TYY A;  3WUV A;  2M3E A;  1DD4 A;  1EQ7 A;  2W83 C;  4KHX A;  1Y47 A;  4UB6 H;  1FZE A;  1VPC A;  2OYI B;  1M56 D;  2WWW A;  4WBA A;  1A02 F;  5AW5 B;  1SFC B;  1L0L D;  1NTM E;  3AEF C;  3CX5 D;  2W90 A;  3EWK A;  3O6Q B;  1BSN A;  4BWN A;  4DT0 A;  1Q81 Q;  1FBM A;  1BDC A;  1R5L A;  1FDI A;  4K3A A;  5KJ7 A;  2HPC A;  2CK3 H;  1LNQ A;  3L73 J;  1S5L H;  1LWU C;  2E74 B;  2Z5I A;  1KB9 I;  2V4H A;  2ZVO B;  2HOD A;  1URQ C;  1YQ3 C;  2I1K A;  3A0B H;  3H1K G;  3L72 E;  3PRJ A;  5AVY B;  1L0L J;  1JB0 J;  4OGQ C;  1JNM A;  3CXH I;  3AEC C;  3WUT A;  1PP9 G;  4NPD A;  3F89 A;  3L74 G;  2YXR B;  4U7J A;  4WY4 B;  5BVZ A;  1A02 J;  2ZT9 B;  3H1J E;  1FAV A;  1P84 D;  3H1I D;  3CWB G;  1JCD A;  3S9O A;  1CI6 B;  1IFD A;  1RF1 B;  1AFO A;  3JSV C;  2YO2 A;  4HKZ H;  1AVO A;  3M0D C;  2BCC D;  3H1L D;  2N1T B;  1AQ5 A;  3CPW O;  3RBZ A;  1SQB E;  2JR8 A;  2Q6Q A;  2H43 A;  1SVF A;  1OW8 A;  2E74 D;  3H1H G;  3V2P A;  5KLV G;  1SQX K;  3VMZ A;  3BVH A;  5BU8 B;  1OZH A;  4GT1 A;  1IO4 A;  2XDJ A;  1XTC C;  5GTI E;  1FDO A;  1SQB J;  1EZV D;  2PGD A;  2R3C A;  1EZV I;  5AVZ B;  3O6Q A;  4C7N A;  2NPS C;  2P7J A;  3L75 D;  4IL6 X;  1NTZ G;  1VF5 B;  1YTZ I;  2YIU C;  1ZR4 A;  1Q82 Q;  3RK2 D;  2C9L Y;  3L73 G;  3R2P A;  2E76 C;  2KXP B;  2HR3 A;  1SQP J;  4PD4 D;  4EIJ A;  3G6E P;  1L4A C;  1NU1 K;  5DJU B;  1FZC C;  1JMM A;  2ZYG A;  3BRT B;  2CPS A;  3KHU A;  3H1K D;  3L71 E;  4ZNC A;  1BCC D;  2YXQ B;  3OAK A;  1M1J B;  2WMM A;  3GF7 A;  3II6 A;  2KLV A;  2O3J A;  2VRS A;  4PD4 H;  2IBZ G;  3G71 P;  1W2E A;  3Q2Y A;  5TIS E;  3B5N D;  4JF7 A;  2N1T A;  1PGQ A;  1UIX A;  2N9Y B;  3CCQ P;  1NAF A;  1R8E A;  1LTJ C;  3RL0 D;  2B87 B;  1ZRT D;  2A06 G;  1RF1 A;  1NTM G;  1USE A;  4YPC A;  1FOS F;  4RJT A;  2OYH B;  3D6Y A;  1NKN A;  5CBN A;  2I8D A;  3U1A A;  2E75 D;  4EDF A;  5APX A;  3CMA P;  1EXI A;  3VP9 A;  4D6T E;  3K5B A;  1OX3 A;  2WPV B;  2FFD C;  2WSF H;  3PTZ A;  4D6T J;  2OTJ P;  1RE3 A;  4H13 C;  1G1I A;  1OW6 A;  3BCC J;  3WU2 H;  1SQP D;  1X9V A;  3JCU H;  1T2K C;  1Q7Y Q;  1KQF B;  4TT3 H;  1PFI A;  3L74 E;  1P84 I;  3GF3 A;  3IN6 A;  1LTJ A;  1AVY A;  1PZQ A;  4B86 A;  1S9K D;  1IK9 A;  1BE3 J;  5B5E E;  1N2D C;  1SQQ D;  1LP1 A;  2P2U A;  2PP6 A;  2RH0 A;  3BCC E;  2ZT9 C;  3IR9 A;  4U3F E;  3VYI A;  2CPB A;  1EDK A;  3E1I A;  4Z1M H;  2FKW B;  2W6B A;  4OGQ B;  3RL0 C;  1USD A;  5K5G B;  3CLQ A;  1PIX A;  4H0L B;  3B5N B;  1VQ9 P;  5AW4 B;  1BE3 D;  1MFT A;  1VF5 C;  3A0B E;  1N7L A;  3MUD C;  3V6I A;  5B66 H;  2Q7C A;  3HE4 B;  4Y99 C;  3H1H E;  5KLV E;  1VQN P;  3HE4 A;  2IYO A;  3PJS K;  1IFJ A;  1X22 A;  1JMB A;  2IPP A;  1KFM A;  5AVU B;  2JWD A;  1LTG C;  2K9J B;  3B5N A;  2IZ0 A;  2HFE D;  2W27 A;  2XNX A;  3C9I A;  1Z56 A;  3W68 A;  5KLI B;  1VQO P;  3B4S A;  1JOC A;  1VL2 A;  2XZR A;  4L75 A;  4XE5 B;  1L0N D;  2R5B A;  3P8C D;  2KIK A;  3SSU A;  1LGH B;  1SQV J;  4AUW A;  1M7L A;  2LXC B;  1W2B O;  1YIJ P;  1VQ7 P;  3CD6 P;  1RE3 C;  2HLO A;  1BSH A;  3L73 E;  4I1L A;  3KZI H;  5TJH A;  3CCL P;  1JY3 P;  3L71 G;  3CL3 D;  1HJB A;  1JCC A;  1SQQ G;  1IC2 A;  4Y99 B;  2IFM A;  3SFD C;  2JEE A;  4GDO A;  1K8A Q;  1FZA A;  3L72 D;  3T97 A;  2FY8 A;  3U1C A;  1NTK J;  1X79 B;  4W80 A;  1JY2 N;  1VF5 D;  2YNY A;  1Q90 D;  1G2C B;  3H1J J;  1NU1 G;  4M3L A;  1KV4 A;  1OVU A;  3VMX A;  2FXO A;  2GUS A;  2WPQ A;  4ZKP A;  3EFG A;  3OJA B;  3CCR P;  1P84 E;  3RK3 E;  3VN0 A;  1DIP A;  1NJI Q;  2KP8 A;  1GD2 E;  4JBZ A;  3SWK A;  2M0B A;  2P67 A;  1T8Z A;  4MN4 C;  1NVO A;  2YKQ A;  1URQ A;  2AXT H;  4H44 C;  2R32 A;  3RK2 C;  3ZDM A;  2P58 A;  3AE2 C;  2FBW C;  1DEE G;  3G9R A;  3FXD A;  2Y0E A;  3JCU E;  3TNU B;  1SQV G;  2NPS A;  5AVR B;  1GK4 A;  4XFJ A;  4OH8 B;  1ZR2 A;  1PL5 A;  1EDL A;  2K1A A;  4GOD A;  2K37 A;  1ZV8 A;  3GG2 A;  2QJY C;  3QWO C;  3TSI A;  1FDM A;  1NHL A;  4U3F G;  3BCC G;  4HH2 A;  3TF5 A;  1AQT A;  1IFI A;  1L0N G;  1RQU A;  4LLH A;  2QVA A;  3LIE A;  2OAR A;  5AW2 B;  1XTG B;  1N7S C;  4UB8 E;  3A3Y B;  3AE7 C;  2FYU J;  1Q2N A;  1J1E B;  3Q3D A;  1G2C A;  4EOT A;  1GW4 A;  5B66 E;  2WT7 B;  2WIT A;  3H1K E;  1E5W A;  4JQ0 D;  1FZC B;  2HYN A;  2N9B A;  4I7Z B;  3L72 G;  2O01 N;  3WMM 0;  1SQX E;  2E42 A;  1HGV A;  3E7K A;  5AW0 B;  2FYN B;  3GW6 A;  1PP9 E;  3HUS C;  3NXS A;  1DEB A;  1ZP0 C;  1GU4 A;  3TGU E;  4WY4 D;  2ZYA A;  2OYH A;  1BCC G;  3SFE C;  4L76 A;  2B9B A;  2XND H;  1L0N K;  2Y9Y A;  2A45 G;  3MZW B;  3CXH E;  4ZKU A;  1N7S A;  1QLE D;  2JDI H;  3PP5 A;  1N7S B;  1RH5 B;  2KB7 P;  2Q9I A;  2KK7 A;  2RKL A;  1BGY G;  1PPJ D;  3FWL A;  2E5Y A;  2E43 A;  4JYC A;  3WUU A;  2ZYD A;  1YJN P;  3FXE A;  1CW5 A;  1SQB G;  4ASW A;  3H1H J;  1GL2 B;  1YQ4 C;  1UII A;  2OTK E;  1L0N J;  3VTP C;  1MUU A;  1FC2 C;  1M1K Q;  1OMI A;  3RBX A;  1LT1 A;  3EQ2 A;  3M9Q A;  1HUC A;  1SQX J;  1N86 A;  1NKZ B;  2P1J A;  2Y0C A;  2AXT E;  5APT A;  1HGZ A;  2AXC A;  3V2R A;  1T3U A;  2R3S A;  3IF4 A;  4PV1 B;  1H0T A;  1OXZ A;  1YTZ T;  2JKV A;  1IFM A;  1SQP G;  1X8Y A;  2KLU A;  2PRR A;  1HTL C;  3L70 E;  4KJM A;  4QMA A;  2DW3 A;  5E79 H;  1SP4 A;  2IBZ D;  2QM7 A;  5AW7 B;  3MGN A;  3W67 A;  1VQ5 P;  2QEX P;  2W8Z A;  1HJ0 A;  3N7N A;  1MV8 A;  1JEK A;  2WVR A;  4OVN F;  1WRG A;  1M1J A;  2P10 A;  5KLV D;  2AEM A;  1LWU A;  1N8R Q;  1FU1 A;  1GL2 C;  3CCS P;  1L4A B;  2JO1 A;  2NRG A;  3AED C;  3CX5 H;  4DZO A;  5CBO A;  3P32 A;  3Q5P A;  4N78 D;  4K35 A;  2J58 A;  2G3A A;  1BGY J;  3FX0 A;  1EDI A;  1L0N E; 
#chains in the Genus database with same CATH homology
 2ZYG A;  1AA0 A;  2IZ1 A;  2ZYA A;  2W8Z A;  1PGJ A;  1AVY A;  1PGQ A;  2IYO A;  2IYP A;  2JKV A;  2PGD A;  3FWN A;  2W90 A;  2ZYD A;  2IZ0 A;  1PGO A;  1PGP A;  1OX3 A;  1NAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...