1AVYA

Fibritin deletion mutant m (bacteriophage t4)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
TNKIKAIETDIASVRQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVLLSTFLSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of bacteriophage T4 fibritin M: a troublesome packing arrangement.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Coiled coil
molecule keywords FIBRITIN
total genus 19
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1avyA00
2IZ1A 1OX3A 2ZYAA 2IZ0A 1AVYA 2ZYGA 3FWNA 1NAYA 1PGJA 2IYOA 1PGQA 2JKVA 1PGPA 1PGOA 2PGDA 2W90A 1AA0A 2W8ZA 2ZYDA 2IYPA
chains in the Genus database with same CATH superfamily
3CI9A 2M3EA 3B4SA 3B71A 1FOSF 1R5LA 1J1DB 3E7KA 4ASVA 2N1TC 2GM4A 1LTTC 1NKZB 2YNYA 1EQ7A 3HTKA 3TNUA 3V4QA 5B66H 1SQXJ 1GW3A 1YQ3C 2FBWC 3M91A 2ZT9B 4W7YA 1FZFA 4WWIA 4D6TD 1NOHA 3M9QA 2OQQA 1BE3D 2Z5HA 2A45I 1VQMP 3AE2C 4BRYA 1OFCX 1VQ9P 4IFDK 2E76B 3L4FA 3P32A 1OWAA 2FYNB 3GMAA 3B5NA 2O1JA 1G1IA 1BDDA 1YQ4C 1M56D 1YJWP 1SQVK 1ZR2A 3CMAP 1OVRA 3FWLA 4N78D 2AEMA 3L72E 2QE7H 4PJ0H 3CLQA 4OGQD 3L37A 1W2EA 3KXDA 1KQGB 4C7NA 5KAFE 1R8EA 1L0LD 1KB9D 1JO5A 2IPPA 4W7ZA 3CX5I 3L72G 4L73A 2WT7A 1GD2E 5M1BA 4M3LA 1VQ6P 1K04A 1L4AC 5KAFH 2KB7P 3AEGC 3PP5A 1GTWA 1RF1A 1KQLA 2I8DA 3P8MC 1RQVA 2Q3IA 2J5UA 4RJTA 3CXHH 3IFMA 2HPCB 2W6AA 1RE3C 1AA0A 4PV1C 4YTPC 1SQQK 5KLVD 4DOJA 1L0LG 3S4RA 2KLVA 2OYIC 3U1CA 1HF9A 3KHUA 5KLVJ 4BWNA 5L8RJ 4C46A 4H0LC 5TJHA 3CXHE 1HH0A 2C0XA 4GT1A 3L74E 4WVZA 1KQFB 1M8OB 3CCVP 4Y99C 3HUSA 3IAOA 3M0DC 1FE6A 2Y0CA 1ZRTE 5APXA 1EDJA 3RK2D 1AQTA 1KB9E 1Y9BA 2B88A 1JY2O 1G1JA 1DEBA 2JWDA 1T3JA 2QRXA 2WSSH 1LP1B 1LJ2A 2YO2A 1BGYJ 2KXPB 3HD7B 3L73E 1PPJE 3H1KG 2W6JH 3T97A 1L0LJ 3H32B 4U3FG 2RH0A 1M57D 1L4AA 2RKLA 3NXSA 3G6EP 1IFIA 3MD0A 4AUWA 3AE5C 3RBXA 4GODA 1SP4A 5KLIB 3G71P 2QJKB 4ZKUA 2IZ1A 2VRSA 3KYQA 1KILC 1URQA 3S1KA 2HODB 1J1EC 1LNQA 4Y99B 1SQVD 2E75B 3AE8C 2Q9IA 1EDKA 5AW1B 1GL2D 3M9BA 2OYOA 2W8ZA 3HE4B 3H1LG 2HG5D 1A02F 5EFWB 3IF4A 3V6IA 3VN0A 2YMKA 2E5TA 2JJLA 1OMIA 5CMZA 5APVA 2OYIA 1NTKG 4WY4B 1ZV8A 3O6QB 1SQVE 1PP9D 3BCCD 3WUUA 1QVFO 5CCGC 4C7RA 2QSIA 3L36A 1SQVG 4H13C 1KILB 5KJ7C 1KFNA 3ABVC 2I1JA 4I1LA 1S5LH 4HH2A 1WMKA 3H1LD 1Q82Q 4NPEA 1J1DC 4NPDA 1N7SB 4GOFA 3TGUG 3WU2H 2H43A 1GL2A 2KOGA 5AVVB 1IO4A 2WZ7A 1ZN5A 3H1JD 3M9HA 1JUNA 1Q7YQ 1SVFA 3TDKA 1NTKJ 1JY3N 1NAYA 2OGUA 2DW3A 2R5DA 2ZAEB 5DJTB 3CCMP 1ZOYC 5AW8B 1JB0J 1GDTA 2E74C 1LTAC 1P84D 4K3AA 2HR3A 2QM8A 1QL2A 1OW8A 4DCKA 1MUUA 4UB8H 5AW7B 1LTJA 1Q2NA 1LTJC 3FXDA 3L72J 2K9JB 3AECC 5GTHE 2R32A 1MV8A 3TGUJ 1QVGO 1L2PA 3H1JG 5AW0B 3VMZA 1H0TB 3CCSP 2O01J 4TT3H 5GTHH 1SQQE 1NTMG 1U7JA 1LT1A 3L72D 3LIEA 2FYNC 3FWNA 3GW6A 1KYOD 4K35A 3WUTA 2K9YA 3WUVA 1S2EA 1HJ0A 1L0NJ 1VF5C 2D2CB 2ZYGA 1L4AD 3PLNA 5AW5B 3RL0C 5CJ4A 2OTLP 3H1KJ 1RHZB 1IFPA 2CPSA 3BATA 3H1LE 2FXMA 3L75D 2N1TB 3L74D 3VP9A 1UIXA 3CCRP 3L70J 2C0WA 1S5LX 1MKMA 1PIXA 1RF0A 3BASA 3R2PA 3D70A 1QGKB 1LWUC 1SQQD 3FX0A 4WY4D 3KDPB 3CXHI 5CCHA 1QL1A 3CD6P 3AEFC 1KYOE 1FZGA 1LTBC 1Z56A 2FYUK 5AVZB 3RK3E 2M8RA 4OWFA 2WTYA 1NU1J 1GU4A 3AE3C 2BCCE 2WSCH 4U3FE 1SFCA 3V5BA 1VL2A 3CCJP 1FJKA 3L73G 2WT7B 3H6PA 2NZ2A 2K3RA 2ZYAA 3VMYA 1WT6A 2IBZI 1GMJA 3H1HE 1SQBK 3A2AA 3CC7P 3NMDA 1AFOA 3N4XA 2IYPA 1ZLLA 5KAIE 4W80A 1K9MQ 1DD4A 2E76C 2FYUJ 1BSNA 4U3FD 2P67A 3EFFK 3II6A 1VQOP 5APWA 1PFIA 3Q2YA 5CBNA 2QVAA 1JY2P 1Q86Q 1NTMK 1KMIZ 3CMEP 1QLED 3P8CD 1KZUB 2Y0DA 2H7HA 4GKGA 1FOSE 1CZQA 1T3UA 1ZW0A 3TF5A 1HWTC 1M1JC 3L73D 5BU5A 2R3SA 1NH4A 3RK3B 1NJIQ 5K5GB 1H89A 2Q3EA 5AVWB 4AQRD 1RQUA 1SFCB 2JP3A 2YKPA 1FC2C 3CWBD 5DJUB 2QJPB 2W6BA 3CXHD 2SPZA 4D6TE 2Z4EA 1BE3E 3CCLP 1W5CE 4UB6H 2RMZA 1BDCA 2IFNA 4WBAA 2E75D 2XKMA 1T2KD 1KV4A 1CW5A 2KIKA 3NFQA 4EOTA 3AEDC 3RK3D 1SQBJ 2N1TA 1PPJD 4H13D 3AE1C 3A0HE 2MKVA 4IFFA 2IDBA 3PHLA 1N2DC 1SQXG 2ZT9D 4IOIH 4JQ0D 5KJ7D 3FGAD 1VF5B 1FAVA 1PP9E 3BCCE 2KI7B 1P84H 1PZQA 3P8CE 3TK1A 1NAFA 2B9BA 1H0TA 2FY8A 4H44C 2OYHC 1GW4A 3MGNA 2K9JA 3OA7A 1BCCE 2RN0A 1LTJB 3UIAA 3B5NC 1MFTA 1YJ9P 2WSCJ 4ZKPA 1YIJP 1VPCA 3JC22 1KB9I 2IFMA 4MN4C 3G4SP 3JSVC 4HKZH 1Q90D 2E74B 1Y47A 2JDIH 3CC2P 1ZXGA 1EZVE 3VMAA 1S3JA 1N7LA 1BE3G 1A02J 1KTMA 2CPBA 1VQ4P 1BCCG 1YHQP 1VQ5P 2IYOA 4R4LA 1ZMEC 1GK6A 1X0TA 5TISE 2L5GB 1KD1Q 3RGUA 1SLQA 2GUVA 1GL2B 1JCDA 5CHXA 1KORA 1N7SA 2BCCJ 1PV3A 3S9OA 1H8AA 1VF5D 3B8EB 2Y9YA 3CWBJ 4JYBA 1RE3A 1XTGB 2A45G 2ZVNB 1KILA 1URQC 3L74G 1VQKP 1FBMA 3PH0A 4XA4A 2IX7C 1PGJA 3RL0B 1M7LA 1YBKA 2P7JA 3H1HD 3O6QA 4WY4C 1GU5A 3L70E 2V7QJ 4WY4A 3G9RA 3H25A 1L0LK 2R3CA 4RKUJ 3MZWB 1NHLA 2OYIB 2PP6A 3A0HH 1RE4A 2KZJA 1HTLC 4KT0J 1YI2P 3KPEA 1HGVA 3HUSC 2FYUD 1JCCA 2W90A 3HE4A 1NWQA 1HVVA 1OX3A 1QEXA 1BGYG 1S4XA 2A06G 1N8RQ 1W2BO 3D6YA 5CBOA 3MIWA 4A7PA 2HODA 4DZOA 1DIPA 1URQB 1L0NK 4IL6X 2JO1A 3BRVB 3H1HG 1PL5A 2QJKC 1NTME 1EC5A 1T6AA 2QG4A 2YIUC 3AE9C 4GOEA 4LLHA 2H8PD 4JBZA 4N3YB 1L4AB 2QEXP 1NTZJ 3QH9A 3H32A 3CWBE 3VYIA 3D71A 4PJ0E 3A0BH 3T97B 4OVNF 4H0LD 1LP1A 2O1KA 3HD7A 1NTKE 3CCUP 1VQNP 3CPWO 1EXIA 2YIUB 1SS1A 1D7MA 2LR2A 2XNDH 3R4YA 3W68A 1SQXK 1SQPE 1M1KQ 3HUSB 3L70D 1X9VA 2GUSA 1SQQG 2NPSD 2NRGA 3LW5H 4L75A 4RESB 3TYYA 3V2PA 3V4WA 3H1KD 2UWJE 1VDFA 1NTZE 2E5YA 3L75J 1VQLP 2POHA 1M90Q 1L0ND 3H1ID 3FXEA 1FZBA 1IFDA 5KLIC 1AQ5A 3WMM0 4JYCA 1ZRTD 1LGHB 2H89C 1AV1A 1SQPG 1DH3A 1YJNP 3H1IJ 4PV1B 1IC2A 2KZIA 5AW4B 5KJ7A 2Q7CA 3EWKA 3A3YB 1LT9C 3HD7D 2O01N 1PPJG 2YKQA 3H1KE 4UB8E 2AEFA 2HPCA 2P10A 4IL6H 1RF1B 1IJDB 2H88C 2YO3A 3USSA 4NPFX 1KYOH 1EXJA 1RH5B 1EZVD 2Q6QA 2IZ0A 1DEEG 1ZP0C 2ZXXA 3L71E 4LGDE 3U59A 2Z5IA 3VTPC 3NTNA 1NTKD 3ITKA 4HYTB 3OAKA 5H2FE 3A0BE 5H2FH 1FZCB 5APQA 5KLVK 2AXTE 1DX7A 2QM7A 1P84I 1GK4A 4C7NB 3IN6A 2CK3H 1N86A 2IBZE 2I1KA 4EI2A 3MHVA 5CCGD 1S9KE 1S5LE 1L0LE 2M3BA 3L75E 2QIWA 3TSIA 2R44A 1IFNA 5AW6B 2HYNA 2FYZA 2XDJA 1KB9H 1Y8AA 2Q5UA 3M06A 3B5NB 1RF1C 3O8ZA 4H0LB 1BCCD 1TU3F 1PP9J 3BCCJ 2C9NY 3PJSK 1KYOI 1NTZG 4PD4E 3HRNA 4BRYB 3Q5PA 3K5BA 2WPVB 1IK9A 2OTKE 1NVOA 2XV5A 4EDFA 4JPZB 1RF0C 4JF7A 1URQD 3HTKB 3TNUB 2BASA 3L35A 2P1JA 1QX8A 3RK2B 1H88A 2Q1KA 3HE5A 5AVXB 3MUDC 1YTZT 3MUDA 1LWUA 2N9BA 3EFGA 1MFZA 1JEKA 4PV1D 3WU2E 5GTIE 1NTMD 1NTZD 3SSUA 3AEAC 5APYA 3OW2O 2IBZD 1PGQA 3C9IA 4U7JA 5AW3B 5APUA 3M0AA 1JNMA 1IFJA 1JY3O 3GHGB 4GIFA 3L75G 3RL0D 5B5EE 1AVYA 1BGYD 1JTHB 2KYVA 2E42A 1HBWA 5AW9B 2KK7A 2WSEJ 2PAJA 2LXCB 4CPGA 2YKOA 4N6JA 3AE4C 4OH8B 2K37A 2N9YB 2OYHB 2WITA 2GA1A 3CX5E 2J58A 3LW5J 4BXLA 2Y0EA 1NU1K 1IFMA 2IBZG 1FZCA 3V2RA 1L0NE 3Q5RA 2ZJSE 1FZCC 3KZIE 1OIPA 3H1HJ 1EDLA 3KZIH 1N73A 1N73C 5CCGA 3SFDC 3TGUE 1GZLA 3AEBC 1T8ZA 3G3ZA 2P58A 2O3JA 1KILD 2QJYC 2WPRA 3C1LA 3L70G 3SWYA 1S9KD 1AJYA 5CCHC 2BCCD 3C8VA 3F89A 2WVRA 4OGQB 5AVRB 3VP8A 4B86A 1S72P 1SQPJ 2FFDC 5KLVE 2FFDA 2WSFJ 3H1IG 5TISH 3L71J 4LC1A 1MZ9A 2E43A 3L71D 1Q81Q 2FYUG 4UB6E 1SQPD 2ZFCA 4DJGA 1N7SC 3IR9A 2NPSB 2A06D 3SWKA 2YXRB 1OW6A 1NU1E 2WMMA 3U1AA 3HD7C 1M1JB 5KKZC 2KUBA 1SQBG 2K88A 2BEQD 1JM0A 3CX5D 3H1IE 1HGZA 2KS1A 2YXQB 2KP8A 4H13B 2BCCG 2QA4P 3CC4P 1KC8Q 1JY2N 3CWBG 4I7ZC 1SQBE 1EZVG 3V2QA 2D2CC 5KTBA 2WWWA 1ZR4A 5APTA 3JCUE 4R4MA 4N78E 2XU6A 1U57A 1RY3A 3L71G 4HJGH 1P84E 2M5AA 5AVYB 2LXBA 1CI6A 1G2CA 2ITAA 2M0BA 3KQGA 1T2KC 2B87B 1NTZK 4H44B 1FDOA 1X79B 4PD4D 4RO0A 1HJBA 1BE3J 1LTGC 1SFCD 3CL3D 2G8YA 4I7ZB 5KAIH 4D6TJ 5APSA 3Q1MA 1USEA 1SQPK 1LTIC 2JR8A 2KNCA 1SQBD 2N1TD 3AE7C 3I5CA 2WPSA 1SQXD 2E74D 3N7NA 3M0DA 3W67A 2O01H 1FZAA 2WSFH 4I2LC 3ZDMA 1IK7A 1LT9A 3VMXA 5B5EH 2MJZA 2A45H 3LIDA 5E79H 3GF7A 3P7KA 3BVHA 3D6ZA 5KKZB 4YXWH 4D6TG 5AVTB 2G3AA 4I6MC 1NTMJ 1HUCA 1OVVA 1K05A 4EIJA 1NU1D 5GTIH 2P2UA 5KLVG 3EQ2A 2WPQA 3MTUE 1LTSC 1YYCA 3B5ND 1R5SA 1FJPA 3RBZA 2WQYC 2QJPC 2XNXA 1LT9B 1AVOA 1YTZI 2QJYB 2FKWB 2PGDA 3L73J 2PFXA 1KQSO 1FDMA 4OGQC 2ZXEB 2KNCB 3I55P 2OARA 3A7OA 2KSJA 1FS0E 1WRGA 4IFMA 3RL0g 3F5HA 4PD4H 1XTCC 2B87A 2PRRA 3BRTB 3CX5H 4U3FJ 1NU1G 1FU1A 1G2CB 1CI6B 1BCCJ 2M5AB 5B66E 4XE5B 5BU8B 2LKMA 1USDA 2ZVOB 3QWOC 1KFMA 1S1CX 4KJMA 4KHXA 5BVZA 3SWFA 1DD3A 2A06E 4QMAA 1UIIA 3CCQP 2KS1B 3MP7B 1EDIA 1J1EB 2V7QH 4YXDC 1JY3P 1M1JA 1E5WA 3GF3A 1KILE 2KLUA 2C9LY 2AXTH 2HLOA 1PGOA 5AW2B 2NPSA 2W83C 2JWAA 3GLMA 2L91A 2FXOA 1OW7A 2E76D 2WSEH 1OVUA 1VQ7P 4HB1A 1SQQJ 1LWUB 4PD4I 2ZYDA 1PGPA 3AE6C 5C39A 4ASWA 1E79H 1J2JB 1K8AQ 2FFDB 3V2NA 4DT0A 1FDIA 4IL6E 3L74J 4Y28J 2J59M 1PP9G 2R5BA 2K1AA 1JOCA 3BCCG 5AVSB 3RK3C 3PTZA 3RK2C 1SQXE 5E79E 1X22A 5CCHD 2FYUE 1N73B 4Z1MH 4ZNCA 5CJ0A 5AVQB 2OTJP 3A5TA 3GG2A 3SFEC 1BGYE 1NTKK 1RE4C 2YMYA 4XFJA 3TGUD 3Q5SA 1FZEA 4YPCA 4AYCA 1OXZA 1OZHA 4EYYQ 1CSBA 3E1RA 2JEEA 2V4HA 3CCEP 2Y9ZA 1KN7A 1NKNA 1N7SD 2BEZF 2E75C 4TLFA 5AVUB 1NO4A 3VOPA 2OYHA 1YITP 1JMBA 3H1JE 2W27A 1IZNB 4O9BA 1U7MA 1EZVI 3JCUH 3PRJA 2NPSC 1SQVJ 3I56P 2HFED 1K73Q 1VQ8P 1X8YA 2B89A 1GL2C 2KSEA 3AEEC 1L0NG 2FXPA 1JTHA 4L74A 2JKVA 2ZT9C 2D2CD 3GHGC 3GHGA 4WB4A 2AEJA 3Q3DA 1NGMB 3H1JJ 4GDOA 4L76A 1BSHA 2AXCA 4ZMDA 3H1LJ 4H44D 1NYHA 3OJAB 2XZRA 3E1IA 1SFCC 1JMMA 1VQPP 3HE5B
chains in the Genus database with same CATH topology
2IZ1A 1OX3A 2ZYAA 2IZ0A 1AVYA 2ZYGA 3FWNA 1NAYA 1PGJA 2IYOA 1PGQA 2JKVA 1PGPA 1PGOA 2PGDA 2W90A 1AA0A 2W8ZA 2ZYDA 2IYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZ1 A;  1OX3 A;  2ZYA A;  2IZ0 A;  1AVY A;  2ZYG A;  3FWN A;  1NAY A;  1PGJ A;  2IYO A;  1PGQ A;  2JKV A;  1PGP A;  1PGO A;  2PGD A;  2W90 A;  1AA0 A;  2W8Z A;  2ZYD A;  2IYP A; 
#chains in the Genus database with same CATH topology
 3CI9 A;  2M3E A;  3B4S A;  3B71 A;  1FOS F;  1R5L A;  1J1D B;  3E7K A;  4ASV A;  2N1T C;  2GM4 A;  1LTT C;  1NKZ B;  2YNY A;  1EQ7 A;  3HTK A;  3TNU A;  3V4Q A;  5B66 H;  1SQX J;  1GW3 A;  1YQ3 C;  2FBW C;  3M91 A;  2ZT9 B;  4W7Y A;  1FZF A;  4WWI A;  4D6T D;  1NOH A;  3M9Q A;  2OQQ A;  1BE3 D;  2Z5H A;  2A45 I;  1VQM P;  3AE2 C;  4BRY A;  1OFC X;  1VQ9 P;  4IFD K;  2E76 B;  3L4F A;  3P32 A;  1OWA A;  2FYN B;  3GMA A;  3B5N A;  2O1J A;  1G1I A;  1BDD A;  1YQ4 C;  1M56 D;  1YJW P;  1SQV K;  1ZR2 A;  3CMA P;  1OVR A;  3FWL A;  4N78 D;  2AEM A;  3L72 E;  2QE7 H;  4PJ0 H;  3CLQ A;  4OGQ D;  3L37 A;  1W2E A;  3KXD A;  1KQG B;  4C7N A;  5KAF E;  1R8E A;  1L0L D;  1KB9 D;  1JO5 A;  2IPP A;  4W7Z A;  3CX5 I;  3L72 G;  4L73 A;  2WT7 A;  1GD2 E;  5M1B A;  4M3L A;  1VQ6 P;  1K04 A;  1L4A C;  5KAF H;  2KB7 P;  3AEG C;  3PP5 A;  1GTW A;  1RF1 A;  1KQL A;  2I8D A;  3P8M C;  1RQV A;  2Q3I A;  2J5U A;  4RJT A;  3CXH H;  3IFM A;  2HPC B;  2W6A A;  1RE3 C;  1AA0 A;  4PV1 C;  4YTP C;  1SQQ K;  5KLV D;  4DOJ A;  1L0L G;  3S4R A;  2KLV A;  2OYI C;  3U1C A;  1HF9 A;  3KHU A;  5KLV J;  4BWN A;  5L8R J;  4C46 A;  4H0L C;  5TJH A;  3CXH E;  1HH0 A;  2C0X A;  4GT1 A;  3L74 E;  4WVZ A;  1KQF B;  1M8O B;  3CCV P;  4Y99 C;  3HUS A;  3IAO A;  3M0D C;  1FE6 A;  2Y0C A;  1ZRT E;  5APX A;  1EDJ A;  3RK2 D;  1AQT A;  1KB9 E;  1Y9B A;  2B88 A;  1JY2 O;  1G1J A;  1DEB A;  2JWD A;  1T3J A;  2QRX A;  2WSS H;  1LP1 B;  1LJ2 A;  2YO2 A;  1BGY J;  2KXP B;  3HD7 B;  3L73 E;  1PPJ E;  3H1K G;  2W6J H;  3T97 A;  1L0L J;  3H32 B;  4U3F G;  2RH0 A;  1M57 D;  1L4A A;  2RKL A;  3NXS A;  3G6E P;  1IFI A;  3MD0 A;  4AUW A;  3AE5 C;  3RBX A;  4GOD A;  1SP4 A;  5KLI B;  3G71 P;  2QJK B;  4ZKU A;  2IZ1 A;  2VRS A;  3KYQ A;  1KIL C;  1URQ A;  3S1K A;  2HOD B;  1J1E C;  1LNQ A;  4Y99 B;  1SQV D;  2E75 B;  3AE8 C;  2Q9I A;  1EDK A;  5AW1 B;  1GL2 D;  3M9B A;  2OYO A;  2W8Z A;  3HE4 B;  3H1L G;  2HG5 D;  1A02 F;  5EFW B;  3IF4 A;  3V6I A;  3VN0 A;  2YMK A;  2E5T A;  2JJL A;  1OMI A;  5CMZ A;  5APV A;  2OYI A;  1NTK G;  4WY4 B;  1ZV8 A;  3O6Q B;  1SQV E;  1PP9 D;  3BCC D;  3WUU A;  1QVF O;  5CCG C;  4C7R A;  2QSI A;  3L36 A;  1SQV G;  4H13 C;  1KIL B;  5KJ7 C;  1KFN A;  3ABV C;  2I1J A;  4I1L A;  1S5L H;  4HH2 A;  1WMK A;  3H1L D;  1Q82 Q;  4NPE A;  1J1D C;  4NPD A;  1N7S B;  4GOF A;  3TGU G;  3WU2 H;  2H43 A;  1GL2 A;  2KOG A;  5AVV B;  1IO4 A;  2WZ7 A;  1ZN5 A;  3H1J D;  3M9H A;  1JUN A;  1Q7Y Q;  1SVF A;  3TDK A;  1NTK J;  1JY3 N;  1NAY A;  2OGU A;  2DW3 A;  2R5D A;  2ZAE B;  5DJT B;  3CCM P;  1ZOY C;  5AW8 B;  1JB0 J;  1GDT A;  2E74 C;  1LTA C;  1P84 D;  4K3A A;  2HR3 A;  2QM8 A;  1QL2 A;  1OW8 A;  4DCK A;  1MUU A;  4UB8 H;  5AW7 B;  1LTJ A;  1Q2N A;  1LTJ C;  3FXD A;  3L72 J;  2K9J B;  3AEC C;  5GTH E;  2R32 A;  1MV8 A;  3TGU J;  1QVG O;  1L2P A;  3H1J G;  5AW0 B;  3VMZ A;  1H0T B;  3CCS P;  2O01 J;  4TT3 H;  5GTH H;  1SQQ E;  1NTM G;  1U7J A;  1LT1 A;  3L72 D;  3LIE A;  2FYN C;  3FWN A;  3GW6 A;  1KYO D;  4K35 A;  3WUT A;  2K9Y A;  3WUV A;  1S2E A;  1HJ0 A;  1L0N J;  1VF5 C;  2D2C B;  2ZYG A;  1L4A D;  3PLN A;  5AW5 B;  3RL0 C;  5CJ4 A;  2OTL P;  3H1K J;  1RHZ B;  1IFP A;  2CPS A;  3BAT A;  3H1L E;  2FXM A;  3L75 D;  2N1T B;  3L74 D;  3VP9 A;  1UIX A;  3CCR P;  3L70 J;  2C0W A;  1S5L X;  1MKM A;  1PIX A;  1RF0 A;  3BAS A;  3R2P A;  3D70 A;  1QGK B;  1LWU C;  1SQQ D;  3FX0 A;  4WY4 D;  3KDP B;  3CXH I;  5CCH A;  1QL1 A;  3CD6 P;  3AEF C;  1KYO E;  1FZG A;  1LTB C;  1Z56 A;  2FYU K;  5AVZ B;  3RK3 E;  2M8R A;  4OWF A;  2WTY A;  1NU1 J;  1GU4 A;  3AE3 C;  2BCC E;  2WSC H;  4U3F E;  1SFC A;  3V5B A;  1VL2 A;  3CCJ P;  1FJK A;  3L73 G;  2WT7 B;  3H6P A;  2NZ2 A;  2K3R A;  2ZYA A;  3VMY A;  1WT6 A;  2IBZ I;  1GMJ A;  3H1H E;  1SQB K;  3A2A A;  3CC7 P;  3NMD A;  1AFO A;  3N4X A;  2IYP A;  1ZLL A;  5KAI E;  4W80 A;  1K9M Q;  1DD4 A;  2E76 C;  2FYU J;  1BSN A;  4U3F D;  2P67 A;  3EFF K;  3II6 A;  1VQO P;  5APW A;  1PFI A;  3Q2Y A;  5CBN A;  2QVA A;  1JY2 P;  1Q86 Q;  1NTM K;  1KMI Z;  3CME P;  1QLE D;  3P8C D;  1KZU B;  2Y0D A;  2H7H A;  4GKG A;  1FOS E;  1CZQ A;  1T3U A;  1ZW0 A;  3TF5 A;  1HWT C;  1M1J C;  3L73 D;  5BU5 A;  2R3S A;  1NH4 A;  3RK3 B;  1NJI Q;  5K5G B;  1H89 A;  2Q3E A;  5AVW B;  4AQR D;  1RQU A;  1SFC B;  2JP3 A;  2YKP A;  1FC2 C;  3CWB D;  5DJU B;  2QJP B;  2W6B A;  3CXH D;  2SPZ A;  4D6T E;  2Z4E A;  1BE3 E;  3CCL P;  1W5C E;  4UB6 H;  2RMZ A;  1BDC A;  2IFN A;  4WBA A;  2E75 D;  2XKM A;  1T2K D;  1KV4 A;  1CW5 A;  2KIK A;  3NFQ A;  4EOT A;  3AED C;  3RK3 D;  1SQB J;  2N1T A;  1PPJ D;  4H13 D;  3AE1 C;  3A0H E;  2MKV A;  4IFF A;  2IDB A;  3PHL A;  1N2D C;  1SQX G;  2ZT9 D;  4IOI H;  4JQ0 D;  5KJ7 D;  3FGA D;  1VF5 B;  1FAV A;  1PP9 E;  3BCC E;  2KI7 B;  1P84 H;  1PZQ A;  3P8C E;  3TK1 A;  1NAF A;  2B9B A;  1H0T A;  2FY8 A;  4H44 C;  2OYH C;  1GW4 A;  3MGN A;  2K9J A;  3OA7 A;  1BCC E;  2RN0 A;  1LTJ B;  3UIA A;  3B5N C;  1MFT A;  1YJ9 P;  2WSC J;  4ZKP A;  1YIJ P;  1VPC A;  3JC2 2;  1KB9 I;  2IFM A;  4MN4 C;  3G4S P;  3JSV C;  4HKZ H;  1Q90 D;  2E74 B;  1Y47 A;  2JDI H;  3CC2 P;  1ZXG A;  1EZV E;  3VMA A;  1S3J A;  1N7L A;  1BE3 G;  1A02 J;  1KTM A;  2CPB A;  1VQ4 P;  1BCC G;  1YHQ P;  1VQ5 P;  2IYO A;  4R4L A;  1ZME C;  1GK6 A;  1X0T A;  5TIS E;  2L5G B;  1KD1 Q;  3RGU A;  1SLQ A;  2GUV A;  1GL2 B;  1JCD A;  5CHX A;  1KOR A;  1N7S A;  2BCC J;  1PV3 A;  3S9O A;  1H8A A;  1VF5 D;  3B8E B;  2Y9Y A;  3CWB J;  4JYB A;  1RE3 A;  1XTG B;  2A45 G;  2ZVN B;  1KIL A;  1URQ C;  3L74 G;  1VQK P;  1FBM A;  3PH0 A;  4XA4 A;  2IX7 C;  1PGJ A;  3RL0 B;  1M7L A;  1YBK A;  2P7J A;  3H1H D;  3O6Q A;  4WY4 C;  1GU5 A;  3L70 E;  2V7Q J;  4WY4 A;  3G9R A;  3H25 A;  1L0L K;  2R3C A;  4RKU J;  3MZW B;  1NHL A;  2OYI B;  2PP6 A;  3A0H H;  1RE4 A;  2KZJ A;  1HTL C;  4KT0 J;  1YI2 P;  3KPE A;  1HGV A;  3HUS C;  2FYU D;  1JCC A;  2W90 A;  3HE4 A;  1NWQ A;  1HVV A;  1OX3 A;  1QEX A;  1BGY G;  1S4X A;  2A06 G;  1N8R Q;  1W2B O;  3D6Y A;  5CBO A;  3MIW A;  4A7P A;  2HOD A;  4DZO A;  1DIP A;  1URQ B;  1L0N K;  4IL6 X;  2JO1 A;  3BRV B;  3H1H G;  1PL5 A;  2QJK C;  1NTM E;  1EC5 A;  1T6A A;  2QG4 A;  2YIU C;  3AE9 C;  4GOE A;  4LLH A;  2H8P D;  4JBZ A;  4N3Y B;  1L4A B;  2QEX P;  1NTZ J;  3QH9 A;  3H32 A;  3CWB E;  3VYI A;  3D71 A;  4PJ0 E;  3A0B H;  3T97 B;  4OVN F;  4H0L D;  1LP1 A;  2O1K A;  3HD7 A;  1NTK E;  3CCU P;  1VQN P;  3CPW O;  1EXI A;  2YIU B;  1SS1 A;  1D7M A;  2LR2 A;  2XND H;  3R4Y A;  3W68 A;  1SQX K;  1SQP E;  1M1K Q;  3HUS B;  3L70 D;  1X9V A;  2GUS A;  1SQQ G;  2NPS D;  2NRG A;  3LW5 H;  4L75 A;  4RES B;  3TYY A;  3V2P A;  3V4W A;  3H1K D;  2UWJ E;  1VDF A;  1NTZ E;  2E5Y A;  3L75 J;  1VQL P;  2POH A;  1M90 Q;  1L0N D;  3H1I D;  3FXE A;  1FZB A;  1IFD A;  5KLI C;  1AQ5 A;  3WMM 0;  4JYC A;  1ZRT D;  1LGH B;  2H89 C;  1AV1 A;  1SQP G;  1DH3 A;  1YJN P;  3H1I J;  4PV1 B;  1IC2 A;  2KZI A;  5AW4 B;  5KJ7 A;  2Q7C A;  3EWK A;  3A3Y B;  1LT9 C;  3HD7 D;  2O01 N;  1PPJ G;  2YKQ A;  3H1K E;  4UB8 E;  2AEF A;  2HPC A;  2P10 A;  4IL6 H;  1RF1 B;  1IJD B;  2H88 C;  2YO3 A;  3USS A;  4NPF X;  1KYO H;  1EXJ A;  1RH5 B;  1EZV D;  2Q6Q A;  2IZ0 A;  1DEE G;  1ZP0 C;  2ZXX A;  3L71 E;  4LGD E;  3U59 A;  2Z5I A;  3VTP C;  3NTN A;  1NTK D;  3ITK A;  4HYT B;  3OAK A;  5H2F E;  3A0B E;  5H2F H;  1FZC B;  5APQ A;  5KLV K;  2AXT E;  1DX7 A;  2QM7 A;  1P84 I;  1GK4 A;  4C7N B;  3IN6 A;  2CK3 H;  1N86 A;  2IBZ E;  2I1K A;  4EI2 A;  3MHV A;  5CCG D;  1S9K E;  1S5L E;  1L0L E;  2M3B A;  3L75 E;  2QIW A;  3TSI A;  2R44 A;  1IFN A;  5AW6 B;  2HYN A;  2FYZ A;  2XDJ A;  1KB9 H;  1Y8A A;  2Q5U A;  3M06 A;  3B5N B;  1RF1 C;  3O8Z A;  4H0L B;  1BCC D;  1TU3 F;  1PP9 J;  3BCC J;  2C9N Y;  3PJS K;  1KYO I;  1NTZ G;  4PD4 E;  3HRN A;  4BRY B;  3Q5P A;  3K5B A;  2WPV B;  1IK9 A;  2OTK E;  1NVO A;  2XV5 A;  4EDF A;  4JPZ B;  1RF0 C;  4JF7 A;  1URQ D;  3HTK B;  3TNU B;  2BAS A;  3L35 A;  2P1J A;  1QX8 A;  3RK2 B;  1H88 A;  2Q1K A;  3HE5 A;  5AVX B;  3MUD C;  1YTZ T;  3MUD A;  1LWU A;  2N9B A;  3EFG A;  1MFZ A;  1JEK A;  4PV1 D;  3WU2 E;  5GTI E;  1NTM D;  1NTZ D;  3SSU A;  3AEA C;  5APY A;  3OW2 O;  2IBZ D;  1PGQ A;  3C9I A;  4U7J A;  5AW3 B;  5APU A;  3M0A A;  1JNM A;  1IFJ A;  1JY3 O;  3GHG B;  4GIF A;  3L75 G;  3RL0 D;  5B5E E;  1AVY A;  1BGY D;  1JTH B;  2KYV A;  2E42 A;  1HBW A;  5AW9 B;  2KK7 A;  2WSE J;  2PAJ A;  2LXC B;  4CPG A;  2YKO A;  4N6J A;  3AE4 C;  4OH8 B;  2K37 A;  2N9Y B;  2OYH B;  2WIT A;  2GA1 A;  3CX5 E;  2J58 A;  3LW5 J;  4BXL A;  2Y0E A;  1NU1 K;  1IFM A;  2IBZ G;  1FZC A;  3V2R A;  1L0N E;  3Q5R A;  2ZJS E;  1FZC C;  3KZI E;  1OIP A;  3H1H J;  1EDL A;  3KZI H;  1N73 A;  1N73 C;  5CCG A;  3SFD C;  3TGU E;  1GZL A;  3AEB C;  1T8Z A;  3G3Z A;  2P58 A;  2O3J A;  1KIL D;  2QJY C;  2WPR A;  3C1L A;  3L70 G;  3SWY A;  1S9K D;  1AJY A;  5CCH C;  2BCC D;  3C8V A;  3F89 A;  2WVR A;  4OGQ B;  5AVR B;  3VP8 A;  4B86 A;  1S72 P;  1SQP J;  2FFD C;  5KLV E;  2FFD A;  2WSF J;  3H1I G;  5TIS H;  3L71 J;  4LC1 A;  1MZ9 A;  2E43 A;  3L71 D;  1Q81 Q;  2FYU G;  4UB6 E;  1SQP D;  2ZFC A;  4DJG A;  1N7S C;  3IR9 A;  2NPS B;  2A06 D;  3SWK A;  2YXR B;  1OW6 A;  1NU1 E;  2WMM A;  3U1A A;  3HD7 C;  1M1J B;  5KKZ C;  2KUB A;  1SQB G;  2K88 A;  2BEQ D;  1JM0 A;  3CX5 D;  3H1I E;  1HGZ A;  2KS1 A;  2YXQ B;  2KP8 A;  4H13 B;  2BCC G;  2QA4 P;  3CC4 P;  1KC8 Q;  1JY2 N;  3CWB G;  4I7Z C;  1SQB E;  1EZV G;  3V2Q A;  2D2C C;  5KTB A;  2WWW A;  1ZR4 A;  5APT A;  3JCU E;  4R4M A;  4N78 E;  2XU6 A;  1U57 A;  1RY3 A;  3L71 G;  4HJG H;  1P84 E;  2M5A A;  5AVY B;  2LXB A;  1CI6 A;  1G2C A;  2ITA A;  2M0B A;  3KQG A;  1T2K C;  2B87 B;  1NTZ K;  4H44 B;  1FDO A;  1X79 B;  4PD4 D;  4RO0 A;  1HJB A;  1BE3 J;  1LTG C;  1SFC D;  3CL3 D;  2G8Y A;  4I7Z B;  5KAI H;  4D6T J;  5APS A;  3Q1M A;  1USE A;  1SQP K;  1LTI C;  2JR8 A;  2KNC A;  1SQB D;  2N1T D;  3AE7 C;  3I5C A;  2WPS A;  1SQX D;  2E74 D;  3N7N A;  3M0D A;  3W67 A;  2O01 H;  1FZA A;  2WSF H;  4I2L C;  3ZDM A;  1IK7 A;  1LT9 A;  3VMX A;  5B5E H;  2MJZ A;  2A45 H;  3LID A;  5E79 H;  3GF7 A;  3P7K A;  3BVH A;  3D6Z A;  5KKZ B;  4YXW H;  4D6T G;  5AVT B;  2G3A A;  4I6M C;  1NTM J;  1HUC A;  1OVV A;  1K05 A;  4EIJ A;  1NU1 D;  5GTI H;  2P2U A;  5KLV G;  3EQ2 A;  2WPQ A;  3MTU E;  1LTS C;  1YYC A;  3B5N D;  1R5S A;  1FJP A;  3RBZ A;  2WQY C;  2QJP C;  2XNX A;  1LT9 B;  1AVO A;  1YTZ I;  2QJY B;  2FKW B;  2PGD A;  3L73 J;  2PFX A;  1KQS O;  1FDM A;  4OGQ C;  2ZXE B;  2KNC B;  3I55 P;  2OAR A;  3A7O A;  2KSJ A;  1FS0 E;  1WRG A;  4IFM A;  3RL0 g;  3F5H A;  4PD4 H;  1XTC C;  2B87 A;  2PRR A;  3BRT B;  3CX5 H;  4U3F J;  1NU1 G;  1FU1 A;  1G2C B;  1CI6 B;  1BCC J;  2M5A B;  5B66 E;  4XE5 B;  5BU8 B;  2LKM A;  1USD A;  2ZVO B;  3QWO C;  1KFM A;  1S1C X;  4KJM A;  4KHX A;  5BVZ A;  3SWF A;  1DD3 A;  2A06 E;  4QMA A;  1UII A;  3CCQ P;  2KS1 B;  3MP7 B;  1EDI A;  1J1E B;  2V7Q H;  4YXD C;  1JY3 P;  1M1J A;  1E5W A;  3GF3 A;  1KIL E;  2KLU A;  2C9L Y;  2AXT H;  2HLO A;  1PGO A;  5AW2 B;  2NPS A;  2W83 C;  2JWA A;  3GLM A;  2L91 A;  2FXO A;  1OW7 A;  2E76 D;  2WSE H;  1OVU A;  1VQ7 P;  4HB1 A;  1SQQ J;  1LWU B;  4PD4 I;  2ZYD A;  1PGP A;  3AE6 C;  5C39 A;  4ASW A;  1E79 H;  1J2J B;  1K8A Q;  2FFD B;  3V2N A;  4DT0 A;  1FDI A;  4IL6 E;  3L74 J;  4Y28 J;  2J59 M;  1PP9 G;  2R5B A;  2K1A A;  1JOC A;  3BCC G;  5AVS B;  3RK3 C;  3PTZ A;  3RK2 C;  1SQX E;  5E79 E;  1X22 A;  5CCH D;  2FYU E;  1N73 B;  4Z1M H;  4ZNC A;  5CJ0 A;  5AVQ B;  2OTJ P;  3A5T A;  3GG2 A;  3SFE C;  1BGY E;  1NTK K;  1RE4 C;  2YMY A;  4XFJ A;  3TGU D;  3Q5S A;  1FZE A;  4YPC A;  4AYC A;  1OXZ A;  1OZH A;  4EYY Q;  1CSB A;  3E1R A;  2JEE A;  2V4H A;  3CCE P;  2Y9Z A;  1KN7 A;  1NKN A;  1N7S D;  2BEZ F;  2E75 C;  4TLF A;  5AVU B;  1NO4 A;  3VOP A;  2OYH A;  1YIT P;  1JMB A;  3H1J E;  2W27 A;  1IZN B;  4O9B A;  1U7M A;  1EZV I;  3JCU H;  3PRJ A;  2NPS C;  1SQV J;  3I56 P;  2HFE D;  1K73 Q;  1VQ8 P;  1X8Y A;  2B89 A;  1GL2 C;  2KSE A;  3AEE C;  1L0N G;  2FXP A;  1JTH A;  4L74 A;  2JKV A;  2ZT9 C;  2D2C D;  3GHG C;  3GHG A;  4WB4 A;  2AEJ A;  3Q3D A;  1NGM B;  3H1J J;  4GDO A;  4L76 A;  1BSH A;  2AXC A;  4ZMD A;  3H1L J;  4H44 D;  1NYH A;  3OJA B;  2XZR A;  3E1I A;  1SFC C;  1JMM A;  1VQP P;  3HE5 B; 
#chains in the Genus database with same CATH homology
 2IZ1 A;  1OX3 A;  2ZYA A;  2IZ0 A;  1AVY A;  2ZYG A;  3FWN A;  1NAY A;  1PGJ A;  2IYO A;  1PGQ A;  2JKV A;  1PGP A;  1PGO A;  2PGD A;  2W90 A;  1AA0 A;  2W8Z A;  2ZYD A;  2IYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...