1AVYA

Fibritin deletion mutant m (bacteriophage t4)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
TNKIKAIETDIASVRQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVLLSTFLSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRITIN
publication title Structure of bacteriophage T4 fibritin M: a troublesome packing arrangement.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Coiled coil
total genus 19
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1avyA00
2IZ1A 2IZ0A 2W8ZA 3FWNA 1PGOA 1AA0A 2JKVA 1OX3A 2IYPA 2PGDA 2IYOA 2ZYAA 1PGPA 1PGQA 2ZYDA 1PGJA 1AVYA 2W90A 2ZYGA 1NAYA
chains in the Genus database with same CATH superfamily
3L70D 4PD4H 2WZ7A 1KZUB 1BGYE 4BRYA 4YXWH 3A0BH 1H0TB 2K9JA 4JQ0D 4UB8H 4WY4C 2NRGA 3PHLA 2QJKC 4H44C 2JWAA 3AEAC 5B5EH 3CI9A 3GG2A 2P1JA 2JJLA 5TISH 1LT9C 3AE5C 2M5AA 3HUSB 3D71A 5C39A 1VL2A 2OTKE 5AVYB 3RK3C 3CCLP 2KS1A 2C9NY 1N73A 3MHVA 1NTZD 2Z5HA 3HD7A 2YXRB 1SFCC 2M8RA 2O01H 3BCCJ 1JB0J 2A06E 2YNYA 5KAFH 5K5GB 3PJSK 3RK3E 2RH0A 4I1LA 3TNUB 1KILA 1JO5A 2V7QJ 3CCMP 1JTHA 1OW8A 1PPJE 2KB7P 3A3YB 3R4YA 3VMZA 1HBWA 1L0LK 1YBKA 1GDTA 2GUSA 1J2JB 5M1BA 3V2NA 1VF5D 2D2CB 3VTPC 2RKLA 1J1EB 3AECC 1Z56A 2M0BA 1IFIA 2OYHC 3AE1C 4KHXA 5KLVG 1NTMG 3H1LG 1W5CE 3CWBG 2PGDA 1RF0A 2BEQD 2E74D 2A45H 2BCCG 3PRJA 2Q1KA 2E42A 4JF7A 2YMKA 3L72E 1X22A 4RKUJ 1EDLA 4C46A 2KP8A 2K37A 3C8VA 1PPJD 1M56D 1PGJA 3JC22 1L0ND 2A45G 3CMEP 1URQA 1LP1B 1KV4A 4EDFA 1KFMA 1OZHA 1M57D 3EFFK 4I7ZC 1AQTA 5KLIC 5APVA 3M0AA 5APSA 3H1IG 4KT0J 2AEJA 3TDKA 3U1CA 4RO0A 1Q2NA 4K35A 1G2CA 4WWIA 2W6BA 1KYOH 1JCCA 1CI6B 3GHGB 2NZ2A 5H2FH 2FFDA 1QL1A 3L72D 1KB9I 3EQ2A 5B66H 3S9OA 1J1DB 3WU2H 4N6JA 1R8EA 4ASWA 3MIWA 5EFWB 5APTA 3Q1MA 5GTIE 3HTKB 1LWUC 2HODB 2CK3H 2FXMA 1S5LH 4N78E 3BRTB 2KIKA 2IBZI 5AW9B 1YIJP 2GM4A 1P84I 1BDDA 1N7LA 2RN0A 1T3UA 4IL6X 1FZBA 1N7SB 5CBOA 3T97A 2YKOA 1GMJA 1NU1G 3QH9A 2B89A 3CCSP 4GT1A 1LGHB 3E1RA 4UB6E 2O1JA 2QJPC 3HE5A 5GTHE 1SQPK 1SQQJ 3H1LJ 1JY3N 2KI7B 3SWKA 2Z4EA 1JEKA 2IFNA 1SQBK 3MTUE 2BCCJ 4IOIH 3CX5E 1L0LD 3H6PA 1NJIQ 1L4AC 4PD4I 2M3BA 1YTZI 1FZAA 3RL0g 4H13C 2G3AA 1EDIA 3L37A 3L70G 1XTGB 5KJ7A 1IJDB 1SLQA 2Y9YA 1FZCC 4C7NA 1A02J 1LTJA 2HPCB 3H1IJ 3VP9A 4WY4B 3I5CA 3CCJP 2E76C 2FYUE 3CCQP 4I2LC 2QJYC 1EZVE 2QJKB 4I6MC 4H44B 3M9QA 3WMM0 1E5WA 2J59M 1PGOA 3VP8A 4HKZH 3H1HG 2ZYDA 2C9LY 1JMMA 1SQVE 2YO3A 4ZKPA 2NPSA 4NPFX 1SQQE 2WSEH 3RK3B 2P2UA 1GL2A 1H8AA 3V5BA 1MKMA 1M90Q 1HGZA 1SFCB 4M3LA 1FJPA 3KYQA 1DEEG 4ZMDA 2R3CA 1HF9A 2XNDH 2QE7H 1OVUA 5CCHC 3KQGA 5BU5A 1NTKK 1UIXA 1YQ3C 1LTAC 3B71A 2FYUD 4YTPC 1GTWA 2WSFJ 2GA1A 2HFED 2E43A 1L2PA 3G3ZA 3WUTA 4DOJA 4HYTB 2A45I 1FJKA 3N4XA 3VMXA 2G8YA 3GF3A 1SQVD 1K8AQ 2OYHB 2E5TA 2KNCB 1MV8A 2KK7A 4XA4A 1K73Q 4EOTA 3LW5J 3E1IA 1X9VA 1Q82Q 3O6QA 1LJ2A 3TYYA 2QM7A 4IL6H 1BCCJ 3TGUJ 1FBMA 3V4WA 3S4RA 3KZIE 2RMZA 3A0HE 1E79H 1N73C 2BASA 1SQBD 3L75D 3L71D 3GF7A 4XE5B 3P7KA 3HD7C 1IC2A 1L0NG 1SQXG 2D2CD 1KYOI 1ZW0A 2ZVNB 1JY3P 4OGQC 5CJ4A 1Q86Q 1RF1B 1KILC 1AFOA 3CC2P 1VQKP 5CBNA 3Q5PA 3H1HJ 1H0TA 1RQUA 2WSCH 1PZQA 5CCGA 1VQNP 3G6EP 3CCEP 3CCVP 2YKPA 1NH4A 1LWUB 1RF0C 1BCCE 3TGUE 1PGQA 4N3YB 4L74A 2KSJA 3D6ZA 1LNQA 3EWKA 5GTIH 4A7PA 1GD2E 4AYCA 2L5GB 4U7JA 2Q5UA 1Y8AA 1URQC 2JWDA 4PV1C 3L36A 1KQFB 2QJPB 1VPCA 1BE3J 1DIPA 1NTKD 3GW6A 1OMIA 4JBZA 1NAYA 1HVVA 3MZWB 3H1HE 3K5BA 1L4AB 1QVFO 2OYOA 1BCCD 2E75C 2W6JH 1S5LX 1RE3A 2FFDC 1JY2O 3PTZA 4H13B 2OARA 1FU1A 1N7SD 2FYNC 3QWOC 1SP4A 2C0XA 2C0WA 1SQXJ 2WTYA 2N1TD 2R5BA 4EYYQ 3VMAA 3F5HA 3B5ND 4EIJA 3H1KE 3ITKA 2ZJSE 2FY8A 3CC4P 5AW6B 1NHLA 2I8DA 3R2PA 2O3JA 2QJYB 4GOFA 4W7YA 1Q81Q 3IFMA 3V2PA 2QRXA 1LP1A 4RJTA 2KLVA 4U3FJ 1BGYD 4B86A 3RK2D 1CW5A 1BE3E 4IFDK 3NTNA 3BATA 2B87A 4WB4A 3P8CE 3IAOA 1MUUA 1HTLC 2LXBA 1NOHA 4XFJA 4NPDA 1NVOA 2Z5IA 1YYCA 3H1KD 1W2BO 4QMAA 1G1JA 2P67A 2IDBA 1X8YA 3BRVB 1YQ4C 3NMDA 4WY4D 3CL3D 3HTKA 1VQ6P 1ZRTE 2HODA 2UWJE 3B4SA 4H44D 5KJ7C 1GZLA 1GK4A 4JYBA 1G1IA 4BRYB 1AVYA 1PP9J 1OVRA 3KHUA 2A06D 1S4XA 3VN0A 1LTJC 3RGUA 3RK3D 2O01N 1BSNA 2J58A 1LTTC 1Y47A 4ZNCA 1SFCD 1SS1A 3BCCE 4U3FE 2WWWA 1HWTC 2M5AB 1EC5A 3VMYA 3NXSA 1FZEA 3CXHH 3Q5RA 1SQPG 2NPSC 3O8ZA 1GL2C 2KS1B 1ZRTD 3L75G 4JPZB 2ZVOB 4LC1A 3HD7B 2SPZA 1KB9E 3PH0A 3LIDA 1OW6A 1FOSE 3JCUE 2W83C 1ZMEC 3M91A 5AVUB 2Q7CA 3OW2O 2K1AA 1KILB 1DX7A 1JTHB 1N2DC 2IBZE 2FYUK 2FBWC 1P84E 3RL0C 1PP9E 3BCCD 1VQLP 2Y0EA 2HPCA 2XKMA 2ZFCA 1KQGB 1SQVK 1LTIC 2JDIH 3H1JG 1IFPA 2WPSA 3L73G 1SQQK 3H25A 2Q6QA 4IFFA 1QX8A 1ZLLA 2N1TB 2Y0DA 2O01J 1KTMA 2Y9ZA 1NGMB 2IFMA 3B5NB 1JUNA 3V2QA 2WT7A 4D6TG 4LGDE 5KLVJ 1NKNA 1NTMJ 5AW7B 3PP5A 3CWBJ 2KZJA 3L74G 4PD4E 1VQ8P 2IBZD 3KDPB 3Q2YA 1P84D 3FX0A 3FWNA 1BDCA 3A0BE 2ZXEB 1D7MA 4N78D 1URQB 1HJBA 3RK2B 2P58A 4W80A 4PV1B 3CLQA 1ZP0C 1NTKG 2OYIA 3E7KA 3AEDC 5KKZB 1DD3A 2AXTH 1EDJA 2CPSA 3M9BA 5B5EE 5TISE 1G2CB 1LTBC 1K9MQ 1H89A 2E75B 1FDMA 1AQ5A 2OYHA 2B9BA 4TT3H 5CCGC 5AW2B 1T2KC 2WSSH 2KNCA 3V6IA 1UIIA 4NPEA 3ABVC 2FYNB 3GMAA 2XV5A 3C1LA 1FS0E 3CX5D 2K88A 2ZYAA 1PGPA 2JEEA 3WUUA 1LT9B 4R4LA 1JY2N 5KAFE 1KFNA 5KLVE 1NTME 1JM0A 5AVZB 3H1LE 2QM8A 4DCKA 1IFNA 3CWBE 4GDOA 1OWAA 1VQ7P 2QA4P 1VDFA 1NTZG 2BCCE 3P8MC 1BGYG 1L4AD 1QEXA 2YIUC 2ZT9C 3H32B 3H1JJ 1RF1A 3L73J 5APYA 3HE5B 4H13D 1RY3A 1RE4A 4YXDC 2MKVA 1T6AA 1S1CX 2JKVA 2IYPA 1EZVD 1PL5A 1NU1J 1K04A 5L8RJ 1FDIA 2OTLP 1HUCA 1WT6A 4H0LC 4D6TJ 1K05A 1M1JA 1RE3C 3H1IE 3L35A 1FE6A 3EFGA 5KLVD 1NTMD 1SQQD 3H1LD 3GLMA 3L74J 2E76D 2H8PD 2BCCD 1R5SA 1Q90D 3AEFC 4C7NB 5APUA 3Q3DA 1LTJB 5APXA 2QVAA 3CXHI 2Y0CA 1OIPA 1JOCA 3L70J 3VOPA 1PPJG 2H89C 1RH5B 1YTZT 1KYOE 2KLUA 2FYZA 5B66E 2XZRA 5AW4B 3WU2E 5CCHD 3H1ID 4I7ZB 3MUDA 2KXPB 5KLIB 1GL2B 4DJGA 4AUWA 1FZFA 5TJHA 3II6A 1NU1E 1GW3A 1MZ9A 2OQQA 5AW3B 3AE9C 1IK9A 1SVFA 3L72G 1J1DC 1YI2P 2M3EA 1OX3A 3L74E 2V7QH 1KILE 1HJ0A 3N7NA 4GODA 1NTZJ 1AVOA 4PJ0E 4WVZA 5AW1B 3RL0B 3HUSA 1TU3F 3JCUH 2H88C 1MFTA 4C7RA 2WSEJ 3SWYA 3L70E 2LXCB 1U7MA 3C9IA 4GIFA 3HD7D 5AW0B 1JY2P 2WMMA 2OTJP 1ZXGA 3LIEA 3O6QB 1LT1A 3A2AA 3TNUA 5DJTB 2R5DA 4OGQD 1EDKA 1KILD 3TK1A 2P7JA 3M9HA 5APWA 3G4SP 4LLHA 2QEXP 1L0LG 2IYOA 3PLNA 4UB6H 3TGUD 1R5LA 3D6YA 2QIWA 3BVHA 4WBAA 5GTHH 1VQ5P 3U59A 1NTZE 1NKZB 3UIAA 3G71P 3JSVC 3HE4B 5CHXA 2KOGA 1PFIA 1OVVA 1VF5C 1L0NJ 3CX5H 4L76A 1FZCB 1IFMA 1DH3A 1QVGO 1WMKA 2IPPA 2KYVA 2E74C 2E76B 2PP6A 1NO4A 5AVVB 1W2EA 2HG5D 1X0TA 3H1HD 3L72J 1URQD 3IF4A 4PV1D 4OVNF 2KUBA 1PV3A 4Z1MH 5BU8B 4GOEA 3NFQA 1AJYA 2FXOA 4Y99C 2AEMA 1VQ9P 2BEZF 2YXQB 1CI6A 3GHGA 3KXDA 2JO1A 1EXJA 3AE8C 2WSCJ 5AW8B 2YIUB 2E75D 2ZT9B 2DW3A 3USSA 1A02F 4OWFA 3L4FA 2IZ1A 2OYIC 1HGVA 1YJWP 2K9YA 2FYUG 1L0NE 1EZVG 1SQXE 4CPGA 5E79E 3CCUP 3AE7C 1YITP 4IFMA 4IL6E 3G9RA 4H0LB 3I55P 3F89A 5KAIE 1N7SA 1BE3D 1SQVG 2K9JB 1USDA 2IZ0A 1SQQG 1OFCX 2QG4A 1KQLA 1M1KQ 2B88A 3AE4C 2N1TA 3P8CD 1L0LJ 3B5NA 1ZR2A 1IK7A 4R4MA 3M0DA 1S9KE 3P32A 2YO2A 3TF5A 3AE2C 1DD4A 2FXPA 3FXEA 1N73B 1SQBG 4JYCA 2WVRA 3L71G 4KJMA 1LTGC 1SQXD 1FAVA 2PFXA 1VQMP 1RF1C 3KZIH 1H88A 4OGQB 1KN7A 2L91A 3A0HH 1RE4C 2B87B 4W7ZA 2LR2A 1U57A 2AEFA 3MD0A 4DZOA 4ZKUA 2ZAEB 5KJ7D 3M06A 4U3FD 2P10A 2W27A 4ASVA 4YPCA 2VRSA 1YHQP 1QGKB 5AW5B 4WY4A 1M1JC 1ZV8A 1S9KD 1CZQA 2WPQA 5KLVK 1NTMK 4BXLA 2WPRA 4K3AA 3RBZA 1L0LE 2WSFH 3SSUA 4HB1A 3AEEC 2N9BA 1LT9A 2IX7C 1KB9D 3I56P 3BASA 1N8RQ 2YMYA 3IN6A 2NPSD 1T8ZA 1M7LA 2FYUJ 4PJ0H 2ITAA 1GL2D 1SFCA 2N9YB 2Q9IA 5DJUB 2XNXA 3LW5H 1YJNP 2H43A 1PIXA 1M8OB 3H32A 1GW4A 1PP9D 1SQVJ 4UB8E 4EI2A 2HR3A 3MUDC 3CC7P 3WUVA 2AXCA 1JCDA 3A5TA 1QL2A 4GKGA 3AEGC 3RL0D 1GU5A 1AA0A 3CX5I 2ZXXA 1BCCG 3TGUG 1IFJA 2FFDB 1SQPJ 2Q3IA 3TSIA 1N86A 1SQBJ 1BSHA 3L75J 3L71J 1VQPP 4MN4C 2R32A 1VF5B 4PD4D 1USEA 4Y28J 5AVWB 1U7JA 1NYHA 3HUSC 5CJ0A 2GUVA 3FGAD 3W68A 3OAKA 1AV1A 1ZN5A 5CMZA 2MJZA 1KD1Q 3T97B 1KMIZ 2E74B 3V2RA 1NU1K 1EZVI 3S1KA 1NAFA 2R3SA 4O9BA 3SFDC 5AVSB 3Q5SA 2WT7B 1HH0A 3MGNA 1DEBA 2QSIA 4Y99B 1OXZA 1IO4A 1T3JA 3B8EB 2D2CC 1GU4A 1ZOYC 3VYIA 3ZDMA 1RQVA 1J1EC 1X79B 2OGUA 1SQPE 3H1KG 5CCGD 1T2KD 2PAJA 1SQBE 2OYIB 3L75E 3L71E 1LTSC 3FWLA 5AVQB 2W6AA 1JNMA 3MP7B 1LWUA 3CWBD 1YJ9P 4AQRD 1Y9BA 2KSEA 1WRGA 3RBXA 1S72P 1VQOP 2W90A 1OW7A 2A06G 3CXHE 3A7OA 1QLED 1BE3G 1NTKJ 2JR8A 3U1AA 1Q7YQ 5AVXB 1KC8Q 3OA7A 5AVTB 5E79H 4DT0A 2FKWB 3D70A 4L75A 5H2FE 4L73A 1RHZB 3H1JE 5KAIH 2J5UA 1SQPD 4OH8B 2ZT9D 3L73E 1S3JA 3AE6C 1FOSF 2NPSB 4HJGH 3W67A 1NTZK 3AEBC 3KPEA 3CCRP 1KQSO 2POHA 1L4AA 5APQA 1S5LE 1KORA 3CPWO 3GHGC 1FDOA 3CD6P 2H7HA 4D6TE 3HRNA 4H0LD 3CXHD 2I1JA 2WQYC 2PRRA 3HE4A 4TLFA 2CPBA 1XTCC 5KTBA 2WITA 2JP3A 5BVZA 1FZCA 1KYOD 1BGYJ 1KB9H 3BCCG 1CSBA 4U3FG 1FZGA 1EXIA 2O1KA 1NTKE 3CMAP 3H1JD 1M1JB 1N7SC 3L73D 4HH2A 3IR9A 1JY3O 1IZNB 3SFEC 2ZYGA 2N1TC 3FXDA 1NU1D 1JMBA 1P84H 1IFDA 3B5NC 1FC2C 2HLOA 4D6TD 3H1KJ 2R44A 3M0DC 2AXTE 1NWQA 2E5YA 2HYNA 3L74D 2LKMA 2V4HA 2Q3EA 1GK6A 4RESB 2I1KA 1S2EA 2IBZG 1ZR4A 3V4QA 1VQ4P 1L0NK 1SQXK 2W8ZA 5AVRB 3SWFA 3RK2C 1PP9G 5CCHA 1EQ7A 2YKQA 2XU6A 4BWNA 2XDJA 5KKZC 3OJAB 2KZIA 2WPVB 3AE3C 1MFZA 2K3RA
chains in the Genus database with same CATH topology
2IZ1A 2IZ0A 2W8ZA 3FWNA 1PGOA 1AA0A 2JKVA 1OX3A 2IYPA 2PGDA 2IYOA 2ZYAA 1PGPA 1PGQA 2ZYDA 1PGJA 1AVYA 2W90A 2ZYGA 1NAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZ1 A;  2IZ0 A;  2W8Z A;  3FWN A;  1PGO A;  1AA0 A;  2JKV A;  1OX3 A;  2IYP A;  2PGD A;  2IYO A;  2ZYA A;  1PGP A;  1PGQ A;  2ZYD A;  1PGJ A;  1AVY A;  2W90 A;  2ZYG A;  1NAY A; 
#chains in the Genus database with same CATH topology
 3L70 D;  4PD4 H;  2WZ7 A;  1KZU B;  1BGY E;  4BRY A;  4YXW H;  3A0B H;  1H0T B;  2K9J A;  4JQ0 D;  4UB8 H;  4WY4 C;  2NRG A;  3PHL A;  2QJK C;  4H44 C;  2JWA A;  3AEA C;  5B5E H;  3CI9 A;  3GG2 A;  2P1J A;  2JJL A;  5TIS H;  1LT9 C;  3AE5 C;  2M5A A;  3HUS B;  3D71 A;  5C39 A;  1VL2 A;  2OTK E;  5AVY B;  3RK3 C;  3CCL P;  2KS1 A;  2C9N Y;  1N73 A;  3MHV A;  1NTZ D;  2Z5H A;  3HD7 A;  2YXR B;  1SFC C;  2M8R A;  2O01 H;  3BCC J;  1JB0 J;  2A06 E;  2YNY A;  5KAF H;  5K5G B;  3PJS K;  3RK3 E;  2RH0 A;  4I1L A;  3TNU B;  1KIL A;  1JO5 A;  2V7Q J;  3CCM P;  1JTH A;  1OW8 A;  1PPJ E;  2KB7 P;  3A3Y B;  3R4Y A;  3VMZ A;  1HBW A;  1L0L K;  1YBK A;  1GDT A;  2GUS A;  1J2J B;  5M1B A;  3V2N A;  1VF5 D;  2D2C B;  3VTP C;  2RKL A;  1J1E B;  3AEC C;  1Z56 A;  2M0B A;  1IFI A;  2OYH C;  3AE1 C;  4KHX A;  5KLV G;  1NTM G;  3H1L G;  1W5C E;  3CWB G;  2PGD A;  1RF0 A;  2BEQ D;  2E74 D;  2A45 H;  2BCC G;  3PRJ A;  2Q1K A;  2E42 A;  4JF7 A;  2YMK A;  3L72 E;  1X22 A;  4RKU J;  1EDL A;  4C46 A;  2KP8 A;  2K37 A;  3C8V A;  1PPJ D;  1M56 D;  1PGJ A;  3JC2 2;  1L0N D;  2A45 G;  3CME P;  1URQ A;  1LP1 B;  1KV4 A;  4EDF A;  1KFM A;  1OZH A;  1M57 D;  3EFF K;  4I7Z C;  1AQT A;  5KLI C;  5APV A;  3M0A A;  5APS A;  3H1I G;  4KT0 J;  2AEJ A;  3TDK A;  3U1C A;  4RO0 A;  1Q2N A;  4K35 A;  1G2C A;  4WWI A;  2W6B A;  1KYO H;  1JCC A;  1CI6 B;  3GHG B;  2NZ2 A;  5H2F H;  2FFD A;  1QL1 A;  3L72 D;  1KB9 I;  3EQ2 A;  5B66 H;  3S9O A;  1J1D B;  3WU2 H;  4N6J A;  1R8E A;  4ASW A;  3MIW A;  5EFW B;  5APT A;  3Q1M A;  5GTI E;  3HTK B;  1LWU C;  2HOD B;  2CK3 H;  2FXM A;  1S5L H;  4N78 E;  3BRT B;  2KIK A;  2IBZ I;  5AW9 B;  1YIJ P;  2GM4 A;  1P84 I;  1BDD A;  1N7L A;  2RN0 A;  1T3U A;  4IL6 X;  1FZB A;  1N7S B;  5CBO A;  3T97 A;  2YKO A;  1GMJ A;  1NU1 G;  3QH9 A;  2B89 A;  3CCS P;  4GT1 A;  1LGH B;  3E1R A;  4UB6 E;  2O1J A;  2QJP C;  3HE5 A;  5GTH E;  1SQP K;  1SQQ J;  3H1L J;  1JY3 N;  2KI7 B;  3SWK A;  2Z4E A;  1JEK A;  2IFN A;  1SQB K;  3MTU E;  2BCC J;  4IOI H;  3CX5 E;  1L0L D;  3H6P A;  1NJI Q;  1L4A C;  4PD4 I;  2M3B A;  1YTZ I;  1FZA A;  3RL0 g;  4H13 C;  2G3A A;  1EDI A;  3L37 A;  3L70 G;  1XTG B;  5KJ7 A;  1IJD B;  1SLQ A;  2Y9Y A;  1FZC C;  4C7N A;  1A02 J;  1LTJ A;  2HPC B;  3H1I J;  3VP9 A;  4WY4 B;  3I5C A;  3CCJ P;  2E76 C;  2FYU E;  3CCQ P;  4I2L C;  2QJY C;  1EZV E;  2QJK B;  4I6M C;  4H44 B;  3M9Q A;  3WMM 0;  1E5W A;  2J59 M;  1PGO A;  3VP8 A;  4HKZ H;  3H1H G;  2ZYD A;  2C9L Y;  1JMM A;  1SQV E;  2YO3 A;  4ZKP A;  2NPS A;  4NPF X;  1SQQ E;  2WSE H;  3RK3 B;  2P2U A;  1GL2 A;  1H8A A;  3V5B A;  1MKM A;  1M90 Q;  1HGZ A;  1SFC B;  4M3L A;  1FJP A;  3KYQ A;  1DEE G;  4ZMD A;  2R3C A;  1HF9 A;  2XND H;  2QE7 H;  1OVU A;  5CCH C;  3KQG A;  5BU5 A;  1NTK K;  1UIX A;  1YQ3 C;  1LTA C;  3B71 A;  2FYU D;  4YTP C;  1GTW A;  2WSF J;  2GA1 A;  2HFE D;  2E43 A;  1L2P A;  3G3Z A;  3WUT A;  4DOJ A;  4HYT B;  2A45 I;  1FJK A;  3N4X A;  3VMX A;  2G8Y A;  3GF3 A;  1SQV D;  1K8A Q;  2OYH B;  2E5T A;  2KNC B;  1MV8 A;  2KK7 A;  4XA4 A;  1K73 Q;  4EOT A;  3LW5 J;  3E1I A;  1X9V A;  1Q82 Q;  3O6Q A;  1LJ2 A;  3TYY A;  2QM7 A;  4IL6 H;  1BCC J;  3TGU J;  1FBM A;  3V4W A;  3S4R A;  3KZI E;  2RMZ A;  3A0H E;  1E79 H;  1N73 C;  2BAS A;  1SQB D;  3L75 D;  3L71 D;  3GF7 A;  4XE5 B;  3P7K A;  3HD7 C;  1IC2 A;  1L0N G;  1SQX G;  2D2C D;  1KYO I;  1ZW0 A;  2ZVN B;  1JY3 P;  4OGQ C;  5CJ4 A;  1Q86 Q;  1RF1 B;  1KIL C;  1AFO A;  3CC2 P;  1VQK P;  5CBN A;  3Q5P A;  3H1H J;  1H0T A;  1RQU A;  2WSC H;  1PZQ A;  5CCG A;  1VQN P;  3G6E P;  3CCE P;  3CCV P;  2YKP A;  1NH4 A;  1LWU B;  1RF0 C;  1BCC E;  3TGU E;  1PGQ A;  4N3Y B;  4L74 A;  2KSJ A;  3D6Z A;  1LNQ A;  3EWK A;  5GTI H;  4A7P A;  1GD2 E;  4AYC A;  2L5G B;  4U7J A;  2Q5U A;  1Y8A A;  1URQ C;  2JWD A;  4PV1 C;  3L36 A;  1KQF B;  2QJP B;  1VPC A;  1BE3 J;  1DIP A;  1NTK D;  3GW6 A;  1OMI A;  4JBZ A;  1NAY A;  1HVV A;  3MZW B;  3H1H E;  3K5B A;  1L4A B;  1QVF O;  2OYO A;  1BCC D;  2E75 C;  2W6J H;  1S5L X;  1RE3 A;  2FFD C;  1JY2 O;  3PTZ A;  4H13 B;  2OAR A;  1FU1 A;  1N7S D;  2FYN C;  3QWO C;  1SP4 A;  2C0X A;  2C0W A;  1SQX J;  2WTY A;  2N1T D;  2R5B A;  4EYY Q;  3VMA A;  3F5H A;  3B5N D;  4EIJ A;  3H1K E;  3ITK A;  2ZJS E;  2FY8 A;  3CC4 P;  5AW6 B;  1NHL A;  2I8D A;  3R2P A;  2O3J A;  2QJY B;  4GOF A;  4W7Y A;  1Q81 Q;  3IFM A;  3V2P A;  2QRX A;  1LP1 A;  4RJT A;  2KLV A;  4U3F J;  1BGY D;  4B86 A;  3RK2 D;  1CW5 A;  1BE3 E;  4IFD K;  3NTN A;  3BAT A;  2B87 A;  4WB4 A;  3P8C E;  3IAO A;  1MUU A;  1HTL C;  2LXB A;  1NOH A;  4XFJ A;  4NPD A;  1NVO A;  2Z5I A;  1YYC A;  3H1K D;  1W2B O;  4QMA A;  1G1J A;  2P67 A;  2IDB A;  1X8Y A;  3BRV B;  1YQ4 C;  3NMD A;  4WY4 D;  3CL3 D;  3HTK A;  1VQ6 P;  1ZRT E;  2HOD A;  2UWJ E;  3B4S A;  4H44 D;  5KJ7 C;  1GZL A;  1GK4 A;  4JYB A;  1G1I A;  4BRY B;  1AVY A;  1PP9 J;  1OVR A;  3KHU A;  2A06 D;  1S4X A;  3VN0 A;  1LTJ C;  3RGU A;  3RK3 D;  2O01 N;  1BSN A;  2J58 A;  1LTT C;  1Y47 A;  4ZNC A;  1SFC D;  1SS1 A;  3BCC E;  4U3F E;  2WWW A;  1HWT C;  2M5A B;  1EC5 A;  3VMY A;  3NXS A;  1FZE A;  3CXH H;  3Q5R A;  1SQP G;  2NPS C;  3O8Z A;  1GL2 C;  2KS1 B;  1ZRT D;  3L75 G;  4JPZ B;  2ZVO B;  4LC1 A;  3HD7 B;  2SPZ A;  1KB9 E;  3PH0 A;  3LID A;  1OW6 A;  1FOS E;  3JCU E;  2W83 C;  1ZME C;  3M91 A;  5AVU B;  2Q7C A;  3OW2 O;  2K1A A;  1KIL B;  1DX7 A;  1JTH B;  1N2D C;  2IBZ E;  2FYU K;  2FBW C;  1P84 E;  3RL0 C;  1PP9 E;  3BCC D;  1VQL P;  2Y0E A;  2HPC A;  2XKM A;  2ZFC A;  1KQG B;  1SQV K;  1LTI C;  2JDI H;  3H1J G;  1IFP A;  2WPS A;  3L73 G;  1SQQ K;  3H25 A;  2Q6Q A;  4IFF A;  1QX8 A;  1ZLL A;  2N1T B;  2Y0D A;  2O01 J;  1KTM A;  2Y9Z A;  1NGM B;  2IFM A;  3B5N B;  1JUN A;  3V2Q A;  2WT7 A;  4D6T G;  4LGD E;  5KLV J;  1NKN A;  1NTM J;  5AW7 B;  3PP5 A;  3CWB J;  2KZJ A;  3L74 G;  4PD4 E;  1VQ8 P;  2IBZ D;  3KDP B;  3Q2Y A;  1P84 D;  3FX0 A;  3FWN A;  1BDC A;  3A0B E;  2ZXE B;  1D7M A;  4N78 D;  1URQ B;  1HJB A;  3RK2 B;  2P58 A;  4W80 A;  4PV1 B;  3CLQ A;  1ZP0 C;  1NTK G;  2OYI A;  3E7K A;  3AED C;  5KKZ B;  1DD3 A;  2AXT H;  1EDJ A;  2CPS A;  3M9B A;  5B5E E;  5TIS E;  1G2C B;  1LTB C;  1K9M Q;  1H89 A;  2E75 B;  1FDM A;  1AQ5 A;  2OYH A;  2B9B A;  4TT3 H;  5CCG C;  5AW2 B;  1T2K C;  2WSS H;  2KNC A;  3V6I A;  1UII A;  4NPE A;  3ABV C;  2FYN B;  3GMA A;  2XV5 A;  3C1L A;  1FS0 E;  3CX5 D;  2K88 A;  2ZYA A;  1PGP A;  2JEE A;  3WUU A;  1LT9 B;  4R4L A;  1JY2 N;  5KAF E;  1KFN A;  5KLV E;  1NTM E;  1JM0 A;  5AVZ B;  3H1L E;  2QM8 A;  4DCK A;  1IFN A;  3CWB E;  4GDO A;  1OWA A;  1VQ7 P;  2QA4 P;  1VDF A;  1NTZ G;  2BCC E;  3P8M C;  1BGY G;  1L4A D;  1QEX A;  2YIU C;  2ZT9 C;  3H32 B;  3H1J J;  1RF1 A;  3L73 J;  5APY A;  3HE5 B;  4H13 D;  1RY3 A;  1RE4 A;  4YXD C;  2MKV A;  1T6A A;  1S1C X;  2JKV A;  2IYP A;  1EZV D;  1PL5 A;  1NU1 J;  1K04 A;  5L8R J;  1FDI A;  2OTL P;  1HUC A;  1WT6 A;  4H0L C;  4D6T J;  1K05 A;  1M1J A;  1RE3 C;  3H1I E;  3L35 A;  1FE6 A;  3EFG A;  5KLV D;  1NTM D;  1SQQ D;  3H1L D;  3GLM A;  3L74 J;  2E76 D;  2H8P D;  2BCC D;  1R5S A;  1Q90 D;  3AEF C;  4C7N B;  5APU A;  3Q3D A;  1LTJ B;  5APX A;  2QVA A;  3CXH I;  2Y0C A;  1OIP A;  1JOC A;  3L70 J;  3VOP A;  1PPJ G;  2H89 C;  1RH5 B;  1YTZ T;  1KYO E;  2KLU A;  2FYZ A;  5B66 E;  2XZR A;  5AW4 B;  3WU2 E;  5CCH D;  3H1I D;  4I7Z B;  3MUD A;  2KXP B;  5KLI B;  1GL2 B;  4DJG A;  4AUW A;  1FZF A;  5TJH A;  3II6 A;  1NU1 E;  1GW3 A;  1MZ9 A;  2OQQ A;  5AW3 B;  3AE9 C;  1IK9 A;  1SVF A;  3L72 G;  1J1D C;  1YI2 P;  2M3E A;  1OX3 A;  3L74 E;  2V7Q H;  1KIL E;  1HJ0 A;  3N7N A;  4GOD A;  1NTZ J;  1AVO A;  4PJ0 E;  4WVZ A;  5AW1 B;  3RL0 B;  3HUS A;  1TU3 F;  3JCU H;  2H88 C;  1MFT A;  4C7R A;  2WSE J;  3SWY A;  3L70 E;  2LXC B;  1U7M A;  3C9I A;  4GIF A;  3HD7 D;  5AW0 B;  1JY2 P;  2WMM A;  2OTJ P;  1ZXG A;  3LIE A;  3O6Q B;  1LT1 A;  3A2A A;  3TNU A;  5DJT B;  2R5D A;  4OGQ D;  1EDK A;  1KIL D;  3TK1 A;  2P7J A;  3M9H A;  5APW A;  3G4S P;  4LLH A;  2QEX P;  1L0L G;  2IYO A;  3PLN A;  4UB6 H;  3TGU D;  1R5L A;  3D6Y A;  2QIW A;  3BVH A;  4WBA A;  5GTH H;  1VQ5 P;  3U59 A;  1NTZ E;  1NKZ B;  3UIA A;  3G71 P;  3JSV C;  3HE4 B;  5CHX A;  2KOG A;  1PFI A;  1OVV A;  1VF5 C;  1L0N J;  3CX5 H;  4L76 A;  1FZC B;  1IFM A;  1DH3 A;  1QVG O;  1WMK A;  2IPP A;  2KYV A;  2E74 C;  2E76 B;  2PP6 A;  1NO4 A;  5AVV B;  1W2E A;  2HG5 D;  1X0T A;  3H1H D;  3L72 J;  1URQ D;  3IF4 A;  4PV1 D;  4OVN F;  2KUB A;  1PV3 A;  4Z1M H;  5BU8 B;  4GOE A;  3NFQ A;  1AJY A;  2FXO A;  4Y99 C;  2AEM A;  1VQ9 P;  2BEZ F;  2YXQ B;  1CI6 A;  3GHG A;  3KXD A;  2JO1 A;  1EXJ A;  3AE8 C;  2WSC J;  5AW8 B;  2YIU B;  2E75 D;  2ZT9 B;  2DW3 A;  3USS A;  1A02 F;  4OWF A;  3L4F A;  2IZ1 A;  2OYI C;  1HGV A;  1YJW P;  2K9Y A;  2FYU G;  1L0N E;  1EZV G;  1SQX E;  4CPG A;  5E79 E;  3CCU P;  3AE7 C;  1YIT P;  4IFM A;  4IL6 E;  3G9R A;  4H0L B;  3I55 P;  3F89 A;  5KAI E;  1N7S A;  1BE3 D;  1SQV G;  2K9J B;  1USD A;  2IZ0 A;  1SQQ G;  1OFC X;  2QG4 A;  1KQL A;  1M1K Q;  2B88 A;  3AE4 C;  2N1T A;  3P8C D;  1L0L J;  3B5N A;  1ZR2 A;  1IK7 A;  4R4M A;  3M0D A;  1S9K E;  3P32 A;  2YO2 A;  3TF5 A;  3AE2 C;  1DD4 A;  2FXP A;  3FXE A;  1N73 B;  1SQB G;  4JYC A;  2WVR A;  3L71 G;  4KJM A;  1LTG C;  1SQX D;  1FAV A;  2PFX A;  1VQM P;  1RF1 C;  3KZI H;  1H88 A;  4OGQ B;  1KN7 A;  2L91 A;  3A0H H;  1RE4 C;  2B87 B;  4W7Z A;  2LR2 A;  1U57 A;  2AEF A;  3MD0 A;  4DZO A;  4ZKU A;  2ZAE B;  5KJ7 D;  3M06 A;  4U3F D;  2P10 A;  2W27 A;  4ASV A;  4YPC A;  2VRS A;  1YHQ P;  1QGK B;  5AW5 B;  4WY4 A;  1M1J C;  1ZV8 A;  1S9K D;  1CZQ A;  2WPQ A;  5KLV K;  1NTM K;  4BXL A;  2WPR A;  4K3A A;  3RBZ A;  1L0L E;  2WSF H;  3SSU A;  4HB1 A;  3AEE C;  2N9B A;  1LT9 A;  2IX7 C;  1KB9 D;  3I56 P;  3BAS A;  1N8R Q;  2YMY A;  3IN6 A;  2NPS D;  1T8Z A;  1M7L A;  2FYU J;  4PJ0 H;  2ITA A;  1GL2 D;  1SFC A;  2N9Y B;  2Q9I A;  5DJU B;  2XNX A;  3LW5 H;  1YJN P;  2H43 A;  1PIX A;  1M8O B;  3H32 A;  1GW4 A;  1PP9 D;  1SQV J;  4UB8 E;  4EI2 A;  2HR3 A;  3MUD C;  3CC7 P;  3WUV A;  2AXC A;  1JCD A;  3A5T A;  1QL2 A;  4GKG A;  3AEG C;  3RL0 D;  1GU5 A;  1AA0 A;  3CX5 I;  2ZXX A;  1BCC G;  3TGU G;  1IFJ A;  2FFD B;  1SQP J;  2Q3I A;  3TSI A;  1N86 A;  1SQB J;  1BSH A;  3L75 J;  3L71 J;  1VQP P;  4MN4 C;  2R32 A;  1VF5 B;  4PD4 D;  1USE A;  4Y28 J;  5AVW B;  1U7J A;  1NYH A;  3HUS C;  5CJ0 A;  2GUV A;  3FGA D;  3W68 A;  3OAK A;  1AV1 A;  1ZN5 A;  5CMZ A;  2MJZ A;  1KD1 Q;  3T97 B;  1KMI Z;  2E74 B;  3V2R A;  1NU1 K;  1EZV I;  3S1K A;  1NAF A;  2R3S A;  4O9B A;  3SFD C;  5AVS B;  3Q5S A;  2WT7 B;  1HH0 A;  3MGN A;  1DEB A;  2QSI A;  4Y99 B;  1OXZ A;  1IO4 A;  1T3J A;  3B8E B;  2D2C C;  1GU4 A;  1ZOY C;  3VYI A;  3ZDM A;  1RQV A;  1J1E C;  1X79 B;  2OGU A;  1SQP E;  3H1K G;  5CCG D;  1T2K D;  2PAJ A;  1SQB E;  2OYI B;  3L75 E;  3L71 E;  1LTS C;  3FWL A;  5AVQ B;  2W6A A;  1JNM A;  3MP7 B;  1LWU A;  3CWB D;  1YJ9 P;  4AQR D;  1Y9B A;  2KSE A;  1WRG A;  3RBX A;  1S72 P;  1VQO P;  2W90 A;  1OW7 A;  2A06 G;  3CXH E;  3A7O A;  1QLE D;  1BE3 G;  1NTK J;  2JR8 A;  3U1A A;  1Q7Y Q;  5AVX B;  1KC8 Q;  3OA7 A;  5AVT B;  5E79 H;  4DT0 A;  2FKW B;  3D70 A;  4L75 A;  5H2F E;  4L73 A;  1RHZ B;  3H1J E;  5KAI H;  2J5U A;  1SQP D;  4OH8 B;  2ZT9 D;  3L73 E;  1S3J A;  3AE6 C;  1FOS F;  2NPS B;  4HJG H;  3W67 A;  1NTZ K;  3AEB C;  3KPE A;  3CCR P;  1KQS O;  2POH A;  1L4A A;  5APQ A;  1S5L E;  1KOR A;  3CPW O;  3GHG C;  1FDO A;  3CD6 P;  2H7H A;  4D6T E;  3HRN A;  4H0L D;  3CXH D;  2I1J A;  2WQY C;  2PRR A;  3HE4 A;  4TLF A;  2CPB A;  1XTC C;  5KTB A;  2WIT A;  2JP3 A;  5BVZ A;  1FZC A;  1KYO D;  1BGY J;  1KB9 H;  3BCC G;  1CSB A;  4U3F G;  1FZG A;  1EXI A;  2O1K A;  1NTK E;  3CMA P;  3H1J D;  1M1J B;  1N7S C;  3L73 D;  4HH2 A;  3IR9 A;  1JY3 O;  1IZN B;  3SFE C;  2ZYG A;  2N1T C;  3FXD A;  1NU1 D;  1JMB A;  1P84 H;  1IFD A;  3B5N C;  1FC2 C;  2HLO A;  4D6T D;  3H1K J;  2R44 A;  3M0D C;  2AXT E;  1NWQ A;  2E5Y A;  2HYN A;  3L74 D;  2LKM A;  2V4H A;  2Q3E A;  1GK6 A;  4RES B;  2I1K A;  1S2E A;  2IBZ G;  1ZR4 A;  3V4Q A;  1VQ4 P;  1L0N K;  1SQX K;  2W8Z A;  5AVR B;  3SWF A;  3RK2 C;  1PP9 G;  5CCH A;  1EQ7 A;  2YKQ A;  2XU6 A;  4BWN A;  2XDJ A;  5KKZ C;  3OJA B;  2KZI A;  2WPV B;  3AE3 C;  1MFZ A;  2K3R A; 
#chains in the Genus database with same CATH homology
 2IZ1 A;  2IZ0 A;  2W8Z A;  3FWN A;  1PGO A;  1AA0 A;  2JKV A;  1OX3 A;  2IYP A;  2PGD A;  2IYO A;  2ZYA A;  1PGP A;  1PGQ A;  2ZYD A;  1PGJ A;  1AVY A;  2W90 A;  2ZYG A;  1NAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...