1AW0A

Fourth metal-binding domain of the menkes copper-transporting atpase, nmr, 20 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
72
structure length
72
Chain Sequence
LTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MENKES COPPER-TRANSPORTING ATPASE
publication title Solution structure of the fourth metal-binding domain from the Menkes copper-transporting ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 72
sequence length 72
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 1997-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1aw0A00
3VTIA 1URRA 2RILA 5F0WA 5T7LA 1MWYA 2XMTA 4QOTA 3BR8A 1RJJA 1N5SA 2XMVA 3FRYA 4OIXA 4OJGA 5KAKA 1V3ZA 2IFXA 2OP5A 1FVSA 1Y3JA 3HHLD 1TL4A 2QLWA 4HI2A 2ZDOA 4ZA1A 4HH0A 4OJHA 2OD4A 2HFNA 1P6TA 2HIQA 4A47A 1WD6A 1OSDA 3KNGA 2KYZA 2XMUA 2VV5A 1Q8BA 4YDXA 2KT2A 5B09A 2HFOA 1N5TA 1OPZA 1TZ0A 2HQIA 2K7JA 4A46A 1AW0A 2N7YA 2OFHX 3FGVA 5B0FA 5T7LB 1TR0A 1YJVA 3DCAA 1CC8A 2PD1A 4OJ3A 1S6UA 5IXUA 3F44A 2BUNA 3KG1A 3MZIA 1OQ3A 3HHLC 1YJTA 1AFIA 1SQEA 2AJ0A 2EW9A 4Q2MA 2ZDPA 5B08A 4HI1A 4A48A 2ASYA 1AFJA 3LGMA 4A4JA 2LQBA 3MCSA 4U9RA 1KQKA 1APSA 1VQSA 3UDCA 1JK9B 2L3MA 3E8OA 2OFGX 2GGPB 2BBEA 2IYIA 1YJRA 2OD6A 1CC7A 2PGCA 2ROPA 4HL9A 5B0BA 3BN7A 5B0EA 3TOQA 1QUPA 2GGPA 3BGUA 2FIUA 1FE4A 4YEAA 3T9NA 3LGNA 2FHMA 2N4DA 4DL0C 2GCFA 2K1RA 2OAUA 1X7VA 1P8GA 4Q2LA 1U7LA 2LQ9A 3CJKB 3HX9A 4OJ1A 4FNIA 2OKQA 4Y2MA 1X8DA 1FD8A 5A6PA 1X0PA 3BB5A 2BJEA 3BM7A 3KG0A 3CJKA 1Y9OA 2Q3PA 1Y3KA 2BJDA 2W4CA 5A6WA 2RU9A 3IWLA 4DN9A 3HHLB 2RSQA 2XMJA 2JDJA 2XMKA 2GA7A 2K7KA 1S6OA 1SB6A 1MWZA 3HHLA 1LQ9A 2FB0A 1TUVA 1GXUA 2N4CA 1KVJA 2ACYA 1FVQA 2BYCA 1FEEA 1TL5A 1YG0A 2AJ1A 2K1RB 5B0AA 3TRGA 1YJUA 1N5VA 1JWWA 2CRLA 1R6YA 3DXSX 2HLTA 1FE0A 1KVIA 2OMOA 2XMMA 1GXTA 2VH7A 3BF4A 3GZ7A 5B0CA 2GFFA 5B0GA 3HDSA 3K7RA 3HFKA 2HLUA 1SI9A 2GV1A 2K2PA 2QYCA 2GO8A 2ROGA 4NPOA 4Y2IA 3HF5A 2G9OA 2QLXA 3IWXA 2IYGA 1Q8LA 3FMBA 2ROEA 2XMWA 3QMQA 4ZOSA 4EFAC 1CPZA 2QIFA 1XBWA 4DPOA 1K0VA 1Y0HA 1FESA 2AP6A 2KT3A 3I9ZA 3KKFA 4HH1A 2W4DA 1W2IA 2FTRA 5K9FA 3QGPA 5B0DA 1OQ6A 1VQYA 1Q53A 1YRXA 2LDIA 1IUJA 3TNVA 4F67A 3WDOA 4NL5A 3BDEA 1ULRA 2KKHA 2RMLA 2W4PA 5F0UA 1Q4RA 4Y2KA 3LO3A 2LXFA 1N5QA 4FNHA 2AW0A
chains in the Genus database with same CATH superfamily
2CPEA 1NK8A 1U6BA 4OV1A 4WYLA 3DOKB 4IG3B 2FZGB 4RUCA 1YHQS 4YB1P 2DO4A 1YBUA 3K5LA 4KV8B 3EVOA 1RT7B 5E3AA 4LUBA 3AD8C 3HJVA 4L3KA 1PYTA 3KLIA 3OVBA 2HHSA 1S12A 3OFEA 2MXYA 4TQSA 2BEFA 4GVLA 2HHPA 1EB0A 2OEMA 5AXNA 4ELTA 1Q8KA 4FPIA 1VIOA 4URSA 5IV3A 3R1HA 1S9GB 4PR6A 3KLGA 1IBLF 2HBYB 4DQIA 3BQ1A 4M8LA 2XQCA 1N5VA 2YH1A 1TUWA 1J5OB 1FE0A 5HVHA 3CD6S 1DBDA 3DM2B 4KO0B 4C3MA 3C66A 3TR5A 1ITPA 3KJFB 1NHUA 2AZ3A 4DSJA 3HVTA 3DI6A 1ULRA 4JI5J 3H90A 2FLOA 1UMJA 4NCGB 1JNZB 3HD2A 2ZVSA 2OPPB 2ZOMA 4ED4A 1B0TA 5KFOA 3PFOA 5FD1A 5HJXA 4DSFA 2AYBA 2BKPA 3AFGA 3QO9B 1B3TA 4U67Q 4CWBA 4TKTA 4J9UE 1RTZA 1C2PA 3MEEB 4LR9A 2Z2YB 2AEJA 5E41A 4IR9A 4DSIA 1IVZA 2BJDA 5GVQA 1N88A 5GAHU 3UDLA 2C3UA 1FXRA 5K8PA 1XR7A 2YKMA 3JS9A 2VODA 4LFCF 8AT1B 4Y6IA 1EKSA 4DN0A 2NXJA 2UXBJ 1X4CA 1QSYA 1WHVA 1R8HA 2IHR1 2RILA 2CQIA 1YKWA 3PXGa 1JLGB 2IM2A 2V9KA 1ZETA 2GVZB 3AJDA 1LWFB 5J1EA 3M1VA 4PKDB 3C14B 2I2YA 4LQ3A 2OTLS 2KI2A 1RYSA 3SXLA 1T9XA 2RQCA 3HMJG 3CO9A 5DM7Q 4I2PA 5U47A 2J7UA 3NAIA 3HM9A 4P73A 5KFGA 4LSNA 4RO0A 3TQEA 1NH8A 3CJRA 4QBUA 3IWLA 2QC3A 2R7OA 2FLNA 3K17A 3OSPA 3BGRB 4RW7A 4JV5J 1YLXA 1C1BB 2ZNZA 1WWHA 4USJC 1RAGB 3T3FA 2HK3A 1VISA 3R3TA 2DCLA 2QYCA 2DNGA 4Q44A 3KUHA 4K0KF 3UI3A 5KFQA 3PX4A 2MSTA 1RADB 2NS1B 3CIZA 1UKUA 2QG9B 1HHQA 1S1WB 4JV2A 2YNFB 2X7IA 3SCIE 2G1HA 4DV1F 1FKOA 1UTAA 4UUWA 1R27B 1X31C 2G0CA 2QFJA 1F0XA 2ZBQA 3ICLA 1VQ6S 1X4AA 5CYJA 2KFYA 4OHZA 1OPZA 1TZ0A 3DKDA 2B9WA 4J9OA 1D0EA 3DCAA 2J9CA 1OQ3A 4QIGA 5L1KA 3J80Y 5MAOA 1YJ9S 4A48A 4X4QA 2WW8A 1A0OB 4R5PA 4ZHRB 3W65A 1VC0A 2VG7A 2WAQD 3KK2A 2PDAA 5KFZA 4DSEA 1IKVA 2XHCA 1NM2A 3Q8SB 2YKQA 3C6TA 1S1UB 3DLEA 2Q3PA 4O0IA 1EIYB 3E3XA 2EI5A 2ZKTA 2WSFC 3ZTRA 1RBLA 3HKWA 3OFFA 3M8QB 3BBCA 4YS2A 1RBAA 4WFNQ 4EZ6A 2Y3YA 1SUQB 2JVOA 2GV1A 2JLGA 3FSXA 4G1QB 1PJ6A 1R0AB 1RP5A 4O4GA 2MY8A 3IBFB 1HBNA 4GKKF 4YHHF 3HCXA 3LPYA 4KHMA 4MKAA 1HWLA 3GTYX 3DLGB 1Q4RA 2RRBA 2AF6A 2HMIA 3FRYA 4ZLJA 4HI2A 3NP5A 3JSYA 3RR7A 2BM1A 4PG6A 3IS9B 4K4ZA 1CEZA 4WFAQ 1DJ0A 2WBRA 3C15A 3NBPA 3QLHA 4FP9A 4U9RA 4TYBA 1QTNB 3NGKA 1LW0A 2B9YA 3GCWP 2QN6B 1JLQA 3NS7B 2DRBA 4B9SA 2PC6A 4OJ1A 1UL3A 3B78A 4CO0A 1HQ2A 2YX4A 2XMKA 4WE1A 2QTWA 4J9LA 2BXJA 3NCRA 1DY3A 1CS4B 2VU5A 3CF5Q 1KQFB 4Q43A 2ATCB 1LWEA 1KN6A 1CJVA 5A2QY 4KH1B 4G1PA 3MAAA 3FEXB 4ILRA 1IBLJ 2J9DA 3M7VA 2ZH4A 2YVSA 3CSKA 2ILYA 2FJDB 2DNZA 2DNMA 3D67A 4CLLA 1TKZB 1URRA 4RZRA 2BW7A 4WZMA 4ZCMA 4DL5A 1RBOB 2IFXA 2ZBRA 1HLWA 3AQPA 4NLYA 1TK5A 4QIEA 5K5MA 4B3SF 2JEFA 3N9UC 1AW0A 3QBCA 1E6YB 3W5YA 4K4SA 4P10A 4OX8A 2GJ2A 2D1CA 1TP7A 1U6ZA 4DWIA 4RNFA 2DK2A 2GGPA 1FE4A 1PKUA 4EEYA 3C6UA 3SSQA 1GFWB 2BJEA 4XO0A 4DFKA 1VBYA 3DHXA 5KFTA 2CG4A 2ACYA 2CPYA 4NZ6A 4NLQA 2YY3A 3D28A 3NY0A 3DU5A 4FF4A 5B0CA 4P2SA 1KFSA 3GONA 3J7ZT 3QRRA 2VC0A 3KHLA 4F04B 4W90B 1FESA 2VUGA 3NEKA 1XJWB 1TKDA 3G87A 5D4NA 4IQXA 2KKHA 2NSCA 3K8VA 3CCVS 2OIHA 5K14A 2G0JA 3EX7B 4KIAA 1ZYQA 4CYUA 2N7CA 4UTGA 3BJYA 3BH6B 3M30B 2UVVA 2OGUA 3ENVA 5L38A 4PWDB 2XHWA 1S7HA 2Q6BA 3AA9A 1S0NA 4KGZB 3D1HA 2E66A 3EGNA 3H2LA 4EI2A 2BW2A 1N6QB 1TMJA 3NWGA 1RWMB 2W25A 3LTOA 4XPCA 1FWLA 3U1MA 1KWMA 4DX7A 3P3DA 2HHXA 4DU7A 5KG2A 1MMNA 3DRSB 3MM5A 3HVAA 4UZBA 1S6OA 3B54A 3I6PA 3TJ9A 3CB4A 1WG5A 4EO8A 3P8BB 4DV7F 2B7CB 3MMCA 2BJ3A 4DHVA 3SIPB 1AUSL 4MKYA 2ZH3A 2MHEA 1V6HA 2C2RA 3X1LB 2VFVA 4Y0FA 4IDKA 2DNRA 2GMJA 4LSZB 1LFPA 4WWSA 4BC7A 3TZXA 2IC3A 3N5FA 3G6YA 3NGTA 5ETVA 2QL9B 1MWYA 4K0KJ 4I67A 2R7RA 4LRCA 2OP5A 2BDPA 4ZA1A 4FPRA 2KT5A 3ZTPA 1P6TA 4A47A 1WD6A 3V6KA 2KDOA 3N6MA 5I42A 1S97A 2FY8A 3LP2B 3LF0A 2ZM6F 2VIHA 2DGOA 3J81U 4BC9A 1SXLA 4DV5F 5KFDA 1JMTA 3W2WA 2HGMA 2IM3A 2AU0A 4W92B 5IFMA 3HT0A 3MAQA 4NLXA 3CPWR 4F2SA 3CJKB 4PCQA 2DNHA 1UJ6A 1X0PA 1BY9A 1Y3KA 3FRZA 1HR0F 3GR1A 1WSRA 2R8KA 4YB5A 4QCLA 2ZHOA 4GRSA 4FYXB 4O44A 3A3PB 5EDWA 2RQ4A 4WFZA 2JH3A 2I1RA 1YBAA 3FEYB 2IJNA 1CQNA 4PAAA 1NJXA 1N0UA 4F2RA 3Q8PB 4LF7J 5HBMB 1XBWA 3MMBA 1FX2A 5CD4A 2QA1A 5KFFA 1Q95G 3WHIA 1N5QA 5IM0A 5KFEA 4DLEA 2I5JA 2DR6A 4PG5A 4M95A 2GW8A 3TAMA 4KH0B 4YHHJ 4ANDA 2KFNA 1PBUA 4CLUA 4MFBB 1WEYA 1K1SA 3M9MB 4LIWA 2JC0A 2KTQA 3B82A 1MU2A 2DYAA 1X5PA 1JXLA 4OQJA 4IH7A 1G6BA 4RBUA 2DHGA 3MXHP 4RNOA 3L3CA 2YWWA 2K1RA 6FD1A 2V4JB 1B99A 3CCSS 4YDDB 3ONQA 3QGGA 3QYYA 1PILA 3BM7A 5E3CA 1YRUA 1NZAA 2K3IA 3PYEA 2J9DE 3HHLA 3D4JA 4ZIVA 3MM9A 3D68A 1SKWA 3DGPA 1D8ZA 4PQUB 5AXMA 5EX3A 4ED6A 2Y1JA 4M5IA 2HURA 3DRPB 1U2RA 2LDIA 1NB7A 2HHUA 2W4PA 3CCES 4OHYA 2E1AA 4F50A 3M2RA 5J2QB 4WP8A 1UWAA 4UY85 1WJ9A 1SIZA 3QNWB 5CH7B 3ILJA 2GZOA 3CJQA 2HFSA 4EZ9A 2EKNA 2XMAA 2RDJA 2WK4A 2CKWA 2VFUA 4A8XA 1VQSA 4ZVGA 2L3MA 4B3SJ 4NLVA 2AT1B 2NSBA 3LGNA 4KJIA 3VALA 1HW8A 2J76E 2BQUA 3PKYA 1KTQA 3A8EA 5IOLA 2FVQA 3ZNJ1 4G6VB 1X4FA 6AT1B 2HVZA 1IXKA 3MEDA 4LBHA 3MUVP 4IOAQ 3FQKA 2HHTA 3CMAS 2EBGA 2XGQA 3I5BA 3VTIA 3D6TB 3POTA 4OMFG 4F4KA 1IJFB 1V3ZA 2LEPA 3QT7A 4GVBA 3VQSA 3RRKA 3R1LA 3R97A 4FYDA 1LV5A 2KT2A 2QMUB 3JSRA 5A0YA 1KLMA 1SQEA 3NG8A 4Q2MA 1NSKL 1UFWA 4WBFA 4LT6A 3LGMA 1TVRA 3M8SA 1S4EA 2MKHA 3GCXP 3MM8B 1RHKB 2H54B 3R5BA 3ZZUA 4O23A 1UZHA 2QSFA 2XM3A 3JYTB 5HVFA 3IN5A 5D0GA 4M5DA 1EETB 2ZJPQ 4ZCKA 2V8VA 4AL7A 4RW9A 1KLNA 3LOUA 1RWOB 1H0HB 1IJEB 4KRWA 4C6AA 3I0RB 5ETPA 1WDDA 5T41A 2QGFB 2V67A 2LA6A 5DJBA 3QATA 3GIJA 2HHHJ 2YNIB 2VJVA 3B6BA 4EBCA 2Z57B 3HHKA 1RT4B 3EE3A 1AT1B 1YRXA 1YSJA 1JIHA 5EN1A 4X4OA 2W2PP 1GK8A 1XR5A 3BR8A 5GAGU 1RT3B 3QWPA 1HIYA 2VA3A 3MTJA 2Z4PA 3I9V9 4FF2A 3VV2B 1QD1A 1TR0A 5IXUA 4DR6F 4DR5F 4P71A 2ZD1A 3EUNA 2PGCA 5THWA 2XCPA 4DV5J 4PXBA 3GWCA 3S1TA 5A6PA 4JI6J 2VG5B 3VCDA 4C0HA 2LP4A 5KT2A 2GA7A 4HT7A 1DTTA 3V6HA 5CQGA 1WHYA 1OYDA 1HBUA 3BPSP 3P49B 4RUBA 2F8HA 1AYEA 2CNNB 1NJYA 2IBOA 1YJUA 2H4WB 4UQTA 4ZVEA 1D3WA 2CQDA 4YB6A 1HR0J 5HP1B 4DQPA 1FF2A 4O3RA 2E7WA 2IYGA 4JI1J 4P2XA 1P9QC 5G0RB 3KKFA 3KLHA 3MEGA 4CO1A 3T6JA 1HYSA 4JI8F 4F67A 1KOOA 3B8HA 3LP0A 1HNIA 1H73A 2YKNA 4HVZA 1YITS 3CCRS 3KJVA 1FFGB 2YKOA 2JNJA 2HGNA 2Z2MA 2L9DA 4HH0A 2MZSA 2GS8A 4MYTA 3CD7A 3T5LA 1D09B 5KT4A 1N5TA 3HZEA 5DGAA 5I3UB 1HWIA 3KDNA 3LWMA 2A6MA 3I96A 3DDIA 4DL7A 3KYLA 3GIIA 1CC7A 1SQGA 3BKFA 4XDDA 1WTFA 1X4GA 1NH7A 1G2EA 3ILLA 1N5YB 3D6HB 1LKZA 4ED3A 5FLXY 5FDLB 1ZZFA 2LQJA 1M5OC 3ZZOA 1TELA 3OJSA 2QYGA 4DN9A 1Z4UA 2L9NA 3HXMA 2AYGA 2CG8A 2XEXA 4XAKA 1LWCA 2VF3A 5E2QA 1TL1A 3PR4A 2BKNA 4ZVHA 1FTRA 3OV7A 2XYPB 2DH7A 3AAWB 1PJ5A 5FJ4A 2R7WA 5D3GB 4P6QA 4DCPB 2G1DA 4AQYF 1PYSB 2XMVA 4L73A 1EARA 2FJAB 3O3LA 2M88A 5E7OB 2YNGA 2VG6A 4DXLA 5C42A 2IBKA 1YIJS 1HWKA 1OSDA 2MYFA 2HRUA 1WC6A 3T1YF 1H7WA 2XS2A 3GQCA 2Y1RI 4OHVA 5LJ5Y 3CJ8A 1L3UA 5BXIA 3EM1A 3VAKA 1GMWA 5D6GA 5DM6Q 4CT9A 1S5ZA 2MGZB 4I64A 3SCJE 1QAIA 3THTA 4F36A 2JRSA 3CJ4A 4QZVB 2UUCJ 2LEAA 2XS7A 3FVYA 2PMHA 1IN0A 2H9ZA 5DZ6A 2CPFA 3L09A 5SUHA 3Q23A 4J37A 3CGIA 4USTA 2ZZMA 1IM6A 1U45A 1FJEB 1RWPB 2VOOA 3RBZA 2XY6A 1VI7A 3E01B 4KGKA 1TQLA 4H4OB 5AJ3J 5F8MA 4OI3A 5HL7Q 1RKJA 3OL8A 4C8YA 3SYZA 4ZOSA 3CCUS 2ZHBA 3W2VA 2LVWA 1NU4A 4DL3A 4Y2AA 5KT6A 3RW7A 3P5BP 1NJIT 2H65B 1UWBB 1MLAA 4OIXA 2PN6A 4ITSA 5KAKA 1WI6A 3OTOF 2UVRA 4MK7A 4A8OA 1GQEA 4EMDA 1H2TZ 1KSPA 4NXNF 3CD0A 3DXBA 3KG1A 3PHEA 2CVIA 2QLFB 4DV2F 2MKIA 1JJCB 1Z2LA 4OYPA 4Q8FA 1PYOB 1RT2A 3J7YU 2IIHA 2MZTA 2ZH7A 4J7CA 1JLBA 3OXLA 1QAYA 2DGXA 3H59A 2NXNA 5CYMA 2XSJB 2RU9A 5E5NA 4X62F 4OZ2A 4HDHA 3DLJA 4JI3F 2QE5A 2JFDA 3DDNA 2E1CA 2RDDA 5HN0A 3TUJC 3GLJA 1RKIA 4W4MA 2F4VJ 5HO4A 3HT3A 4I0WA 5AXLA 2M8DB 4ZIWA 1RAJA 1SV5A 1FRLA 2HAIA 4YR2A 4AFFA 1HW9A 1NK7A 1UVNA 5D78A 4ED0A 2FHJA 4Q7AA 4DR2F 1RLCL 4J90A 2J5AA 4ID5A 5I4MA 2ZH8A 3VWSA 4ZVUB 4URQU 2Y0BB 1HBMA 4ECVA 1LFWA 4CO4A 1J2VA 4IO9Q 5K8OA 2IMOA 4DR3F 1CSJA 1PAEX 3T9NA 1B4SA 2CJKA 4TY8A 1QE1A 1ICEB 2BA9A 4DR6J 2J6SA 1NKBA 4LFBJ 4DR5J 3V81B 3UN3A 4HACB 4B9TA 3THPA 3GFZA 1T9UA 1O51A 2C3OA 2E7VA 1F60B 2E44A 3AOAA 4DS4A 3WBZA 2BOAA 5GADU 4CLPA 2CQBA 5LXYA 1S4FA 3KHGA 1U1MA 1EJ7L 2OPSB 2BABA 3DN9A 3R7NB 1SC3B 2XWXA 3MM7A 3JTOA 1WACA 3RJMB 2ZH1A 3RB4A 2FPHX 4WK1A 1DQ9A 4OYMA 2EFPA 5J2PB 2UUWA 2AX0A 4CO2A 1T8EA 3DOKA 1KRPA 4IG3A 4MT1A 1VQ7S 2E9RX 4OYAA 2DEJA 5IQQA 1RT7A 4QR1A 1NLKL 2DBBA 3UDVA 4KPYA 2PE8A 3IM8A 3NKYA 1F5BA 1XC9A 1B64A 2E29A 3C2PA 4J5OA 3MPYA 3G8QA 3EGWB 3W9JA 4RR5A 4UT4A 1B0VA 1X4HA 2F9DA 1P1LA 1GEHA 3F73A 4LIRA 4PG8A 1BE4A 2ZZNA 2O66A 2OMOA 1J5OA 2B8QA 3DM2A 4M63A 3UVJB 3R27A 3TUIC 1SVDA 4W98A 4N76A 3LW5C 4UF4A 2KRRA 4URGA 3N6LA 5LT5A 3WX8A 2Q6CA 3QAUA 4AQYJ 1XMQF 4USIA 3IXQA 1ZM2A 2X1BA 2JEGA 4ZCLA 3T1HJ 3ETOA 3MR2A 3BSOA 4OZ3A 4F0HA 3QO9A 1IKXA 1IM4A 1X9SA 1NCLA 4U7UD 7FDRA 2D41A 4PPZA 4ECSA 3Q86A 4OYWA 4X4SA 1TFYA 4O3SA 8RUCA 4C11B 5RUBA 2DNOA 4K4YA 4FF1A 3IRXB 3GIMA 5DQGA 1SBRA 1WKLA 4WP3A 3QJJA 1TKTB 1NZ8A 3CDEA 2QA4S 1AROP 4C8KA 5LL6d 3VF0B 4GC6A 2B6AB 3GG1A 3G82B 2ZKUA 2LXFA 2C2KB 2MSSA 3NXZA 2YPYA 1DLOB 2W8LA 5M2PA 2NLWA 3FCVA 4IFYB 1JLGA 1XMBA 1F9HA 3M8RA 1LWFA 1NUEA 3KLFB 3HFZB 3C14A 2B5JB 3M6UA 4TN2A 1PIEA 3T19A 2ZITA 4ES2A 4NLPA 3OTOJ 1X0FA 3M6WA 1M5KC 1XWLA 4NZ7A 3PO5A 2IJRA 4X66F 4NXNJ 2MQNA 3VGUA 1XNQJ 4CRJA 3AD9C 1TAUA 2VDHA 4DV2J 2ZBIA 4YY3F 1JB0C 4FNIA 1FJGF 1RUSA 2F3JA 3UN5A 4A8WA 2XULA 2ATLA 3SV3A 3RRHA 4DL4A 1E6VB 3WC0A 2Y1IA 3M6VA 1TL5A 3GFHA 1C1BA 3SMZA 4Q45A 1I94F 2HQCA 4WKYA 2B9XA 4YB7A 2F4FA 4X62J 4DX8H 5J2MA 2QJ3A 2NZ4A 1FXLA 4JI3J 2LQ5A 1FHTA 4UOHA 1CQMA 1Q16B 2I8EA 2F7VA 1S1WA 3RG6A 2XMTA 3K5OA 4ID8A 2YNFA 4LR8A 2R2RA 4BCAA 5L9XA 2ZEJA 3UWTA 2B0GA 1AUDA 2IAJB 3Q8UA 1RA7A 2QO3A 2PT0A 4DR4F 1VQ8S 1NAQA 2UP1A 1C0TA 3FCWA 4DR2J 1S6PB 3UN2A 2ZZTA 2BANB 4WU2A 1JK9B 3EJMA 4OI0A 3C16B 1T9VA 2F5GA 1CULA 2FHMA 3K58A 3W1YC 2RKIB 2H1YA 5DGBA 2A10A 3BB5A 5DS7A 4QIVA 1S1UA 4DV4J 5DQIA 4K8RA 2EK1A 3CCZA 3G6VA 3M8QA 2HRTA 2OELA 3HP6A 4C3LA 1RT1B 2KM8B 5EHHA 3EDRB 4G1QA 1HBOB 4F3MA 1DHMA 1NB2A 4NLDA 1N32F 3IGNA 2W9BB 2HNYB 5J2NA 1DZ5A 1GMWD 2HBQB 3DLGA 5E33A 4OX6A 3K5MA 4C2MA 4ENOA 1T03A 2R7XA 3EZUA 4OZ0A 2XZWA 1U24A 2YNHA 3D0GE 5HQMA 1KQKA 4Q0BA 4B9LA 4IKAA 1WC4A 2FIUA 4I56A 2FY1A 4YOEA 4CNYA 3ISZA 2GCFA 1M5HA 5DG8A 3KK3A 4IG0B 2V50A 5BYRA 4L75A 1FTCA 3FFIB 2ASLA 3IA0A 3W9HA 5DLFA 4PEOA 3AXKA 3VAMA 1CS4A 4FKXA 1JJ4A 4E2FB 5B0GA 4EBEA 3LP1B 4HEA9 3D1OA 1GH8A 1HNXF 1EP4A 4FN5A 3G8TA 2RQMA 2UXDF 5H9FJ 4HT5A 5H9EK 2HHWA 4DV6F 3KG4A 3UW1A 2B3TB 1JLFB 1K73T 1UFLA 1K8AT 1HNWJ 2A3JA 4X64F 2FJEB 3EICA 2X1FA 3TWZA 3AH6A 2WTFA 2P8IA 2N7YA 1OS5A 4OJ3A 2BUNA 1E6YA 5CAAA 4DV3F 3V6DA 2BQ3A 3LALA 2W7PA 4ANEA 1GNKA 2AJ4A 1REVA 4KGVB 2F9JA 4RW6A 3MPDA 1XMQJ 2RAQA 3M2VA 2EKYA 3T9ZA 2DH9A 3KLIB 2E5GA 4QWEA 4PABA 4KFBB 4KYZA 2BE7D 1NK5A 1FVQA 4NEZA 1T9WA 4LFAF 3TJ8A 4ETZA 4E0DA 5IC4B 1MN9A 2VPZB 3D6FB 3G8SA 1SH3A 1RABB 3ET6A 1SJ4P 2FHJD 2WCXA 5LXRA 4FXVA 1VHIA 1VQOS 3KLGB 2EVZA 1X5TA 4HH1A 1XIQA 3DLHA 3L95X 3ENQA 2NXEA 2C3YA 4K4VA 1YJ7A 2V5HG 2DNKA 1EAYC 4B9MA 1XMOF 2XLJA 2EPIA 5M2RA 2ZUGA 4HYKA 3M30A 2ZH6A 4R8UB 2BOPA 3DI6B 3KUGA 4PWDA 3GG0A 4LQ9A 3FUYA 4KKOB 1AB8A 4QIFA 4N47A 3HHEA 4HLBA 2Z2ZA 4HTIA 5GMKa 3HHNB 3U02A 3ENAA 3FC9A 5KG0A 1U1QA 3VGSA 4C8OA 1FFSB 3MURP 1QLNA 4N56A 2O1PA 2E7XA 1TMMA 4Z7YA 4DEZA 3IBWA 1S79A 4CP5A 4K5RA 1TKXA 3K5NA 1XR6A 2NYHA 4QWBA 2GC8A 4X66J 3DRSA 4YUDA 3PYGA 2ZC3A 2R3VA 1UW4A 4OZ1A 1FJGJ 4BS2A 1WSVA 1OWXA 4OZ5A 4L3NA 1FT8A 1QAXA 4KR0B 2R7TA 2YKMB 1I94J 4USHA 3BDEA 2HWTA 2HQ3A 3EWGA 2M52A 3GSDA 3MI7X 2WVCA 3UNYA 2CJXB 4XIUA 1RCOB 2ZWPA 4WFXA 3CO0P 2W01A 4CLKA 5KFHA 5B09A 4YDXA 1KBRA 3TX0A 3EVMA 2NZCA 2I6WA 3LP2A 1RAEB 1RQ0A 2HS4A 1L3TA 2LLZA 4J9RA 4HI1A 2ASYA 1AFJA 5J1EB 1S9EB 2CNLB 2PA8D 3MECB 3UD4P 3KUEA 4ES3A 4WP9A 1T9TA 5ETQA 4DR4J 4IH6A 3F41A 1R3NA 3CJKA 4I2PB 2R8JA 1FK9B 3JAMU 3AQOA 1HQUB 1U1RA 2HQDA 3FZ2A 4LREA 2H5JB 2KG1A 2X3GA 4ZP7A 4U7UK 3ENWA 1Q5YA 3SI8A 4GKJJ 2FZKB 5D8HB 5HATA 4JYAJ 4P9SA 3N01A 3UCZP 2M8HA 4RW7B 2R7SA 5HBMA 2DGUA 2FTRA 2Z30B 3FKBA 2AJFE 1NK9A 1KR4A 3DOMB 3I5AA 1IKWA 2V0NA 4Y2CA 4ZPVR 3M4XA 4YR3A 4F25A 2OD4A 2AWZA 1H98A 1N32J 2ZHAA 3LGHA 4MFBA 1S1VB 3TQ1A 1ZAXA 3QT6A 1FKOB 3PW7A 1WF1A 4TQRA 3IAS9 3J7AN 3MCSA 3OHAA 2IYIA 4DOZA 1W25A 3OPKA 1DARA 3HO1A 4NRTA 2V4JA 3GJTB 4JUZA 3KLEA 3M32A 2VG7B 3R5AA 2UUAF 2FHKA 2R8IA 3CWJA 3DFEA 4I4BA 4MAKA 1IKVB 3CCLS 3BR9A 3L7OA 3U1LA 1QM9A 3ZC4A 2BX6A 1S0OA 2QMXA 3C6TB 1TV6A 3GSIA 3R7SB 5HVGA 3MR3A 2C1EB 3O8WA 3D3BJ 2IA6A 2DHHA 3D1QA 4KB7A 4ZCIA 3ZZPA 3V4IB 2IMWP 4CH0S 5E3PA 1HMVA 2VBXA 3H5XA 4K4XA 4LJMA 3K2YA 3TUZC 3N4WA 3J7Z5 1QVFR 2OEJA 4FYYB 2GVDB 1I3OB 4O4GB 1NPKA 3DYAB 3ITHB 1HNXJ 4ILMA 5J2QA 4F4ZA 4GO7X 4NLWA 1WOOA 3G6ES 2HFZA 4JV5F 3O44A 2UXDJ 2E1RA 3CJ2A 5F8NA 4DV6J 4R25A 1TK8A 3CW2C 2YQ3A 3MM6B 2MJNA 4F0MA 4X64J 3RAQA 4WFYA 3E8OA 5CXTA 5BR8F 4ED5A 5DDQC 1U6FA 5CYQB 5L8RC 2OAUA 3NBPB 2LQ9A 4DV3J 2BJ7A 1X4EA 2RU3A 3KDOA 3I5CA 4D3GA 1S72S 3R6GB 4CH1A 3GIKA 4BBYA 3DMJA 4OLPA 3NS6A 1NK6A 1LW0B 3PW0A 1JLQB 1V9OA 1CJUB 3IWNC 1RTJB 1FFWB 2V2VA 1RAHB 4ECQA 2GAGC 4WE1B 2QLXA 1Q8LA 3OTDA 3D54A 5F8IA 4CH7A 4RUAA 2X1GA 2UUBF 4TXSA 1L5UA 3L7PA 2N82B 3HLUA 3C46A 2AW0A 2G0IA 2WVEA 3SZ2A 4J91A 2A2DA 5KFJA 2PFDA 3EMTA 5LMUF 2HFNA 1K1QA 2KH9A 3BO2A 4H54A 2JEIA 1ZAWA 1UW9A 1HL6A 1Y5LB 3F44A 4EYHB 3GILA 5ITHA 3HSGA 4WFBQ 3E2EA 4YEAA 3TYTA 2P9EA 3I0SA 4RBVA 2ILZA 3DRRA 5DRKA 3JYTA 3FQLA 2IRXA 1S77D 1R8AA 1CLFA 5EGYA 1MSWD 1EETA 3I4PA 4WF9Q 4I69A 4ZVPB 3GR0A 2DGTA 3C6UB 4TLQA 1UZDA 4CM0A 5A8RB 4OZLA 2XLIA 4O3QA 2K3KA 3VGVA 1KC8T 3I56S 1J5EF 1BQMA 1NEEA 2NPFA 1RT4A 2PA3A 1WEXA 2Q79A 3VAIA 2YBVA 3M9OB 1YGYA 3MHYA 3CULA 5IT9U 1HARA 1NK4A 2KYZA 3FJ2A 4OYBA 3R2DJ 3Q24A 4CYUB 2DNPA 2IA0A 4K4WA 1PAUB 2HIYA 3PCOB 4WU3A 1U48A 2AJ2A 1LW2B 1SJFA 4FS2A 2HW3A 2GNKA 1RT5B 3GV7B 3ZZTA 2J7WA 4F4YA 3PYDA 1EQ0A 1S10A 4MH8A 1WOSA 3CJSA 1KEKA 2VG5A 2K7KA 4DUTA 1LQ9A 4JI4J 5F3ZA 1KP6A 3L4BC 2BE9B 4KHPF 1FCAA 3KFWX 4K59A 3K7RA 3SQGA 1VHFA 2C28A 4NPOA 3MM5B 3Q8YA 5HP1A 2XMWA 1K0VA 4EK2A 3H20A 4LBPA 2RJZA 3JQJA 2JOQA 5C25B 3TVKA 3RBDA 2B4OA 5HJYA 2VICA 2DNYA 1R89A 2JHEA 4DFMA 2WOMB 1RTDA 3AA8A 5KTQA 4XPEA 4IOBA 2C3PA 5F8HA 3H0PA 4I2QB 2XSFA 1REGX 3SV4A 3SSRA 1UVJA 3HVWA 3CJ5A 3NNAA 3BKUA 3QRPA 3A8IA 3AY0A 1JQGA 5EUHA 2IPOB 4FYVB 1BHNA 2CJ9A 3S7RA 4K50A 5CHCB 3VZHA 5HANA 1FRJA 5HQ8A 2VFTA 2C3MA 5FDLA 2FJVA 2OH2A 5ETNA 3ZZRA 4B9UA 2AJ1A 3RRGA 2NXUA 3OVSA 1T7PA 5JVGQ 2OSQA 2XI3A 4U7CA 4U96A 3M2UB 2BM0A 2DT9A 5DG9A 3UR0A 2AIRB 2UUAJ 2ROEA 3OR1B 1FA0A 3W8GA 1U09A 1T02A 4M5HA 2DHAA 2ZOGA 1MROB 4KY3A 2N3LA 4ETXA 3CC2S 5T7LA 5D3GA 1U0HA 1ZPVA 4MJKA 1F5AA 5HI7A 1EX8A 3D0HE 3IG1B 3O5TB 4ZJLA 4CTAB 2Q66A 5IM0B 2V2KA 2B9EA 2M5YA 4PRFA 4NI2A 3CIMA 2YWFA 3PRVA 4UQGA 1UVLA 3IM9A 2KYXA 4NA1A 1OPIA 1AZSB 2V8DA 1VRTA 2WONB 1ZTTA 1VC5A 2WZ1A 2DO0A 1VQMS 2RRNA 1XNRF 1VQNS 5BR8J 2AQ4A 3SFUA 3RZAA 4M94A 5LOQA 5DO2A 5F3TA 2HFUA 3FBBA 4A8SA 3JXOA 2K1RB 1FWPA 2MQPA 3AOCA 2XMMA 2W24A 3KJNB 2GQCA 3E01A 4O3OA 4C3KA 4H4OA 1LWXA 2A18A 3FMBA 4B3MJ 4LRDA 2VPXB 3MM9B 5AE3A 1X5OA 5KOWA 3DGPB 1RXOB 4O4RA 1W2IA 2AEMA 4NE9C 1SKUB 3PJWA 5CCMA 5F0UA 1A7GE 1TTHB 1WEZA 2FYXA 2VJUA 1UWBA 3PW5A 2UUBJ 3IMQJ 1PCAA 5MLCV 2VA2A 2KZMA 2UXCF 1ZBTA 1F9FA 1IBKF 5GAEI 5LMUJ 3H4DA 4LF7F 4CLSA 1ACMB 4DJBA 2HHVA 4DL0C 1IWGA 2R4FA 4MIAA 1S1TB 2VFSA 2JDJA 4ES1A 5BYQA 2MJUA 3N0VA 2CNKB 3CDBA 1QAJA 3HI9A 1S59A 1OY6A 4NLTA 5HAOA 2GFFA 2FJXA 1RWNB 3WC2A 3ZTSA 4D3HA 3MPUB 1OYEA 9ATCB 3PJ9A 2E5LJ 2R7QA 1HD1A 4NLSA 1MN7A 4I68A 3MR5A 3PO4A 2VBYA 2HZCA 4Y2KA 5HQLA 1H6KX 3R5JB 4ZLNA 4ZN3A 3FMWA 1PO6A 3W61A 1J5EJ 2DPJA 4Z7CA 3B4MA 1YDLA 4X65F 1GX5A 2WSEC 3F56A 1HI1A 4ZVOB 5F8LA 4JBCA 4QWCA 3POTB 5I3PA 4GVBB 2WSCC 2C2EA 4F0KA 1HA1A 3SFGA 3OVAA 1FKPA 2KG0A 4Y00A 3BN7A 1NHKL 4NZ0A 2QEXS 1S6QA 3QGIA 2V9WA 4UOGA 3R5GA 3GFXA 2YKAA 1U2FA 2QA4G 1SJQA 5F8GA 5E3RA 2XMJA 3IGVA 1NNDA 1SC6A 3TA1A 4DUZF 1VRUA 4MMOA 4GC7A 5A8KB 3FBFA 4RBTA 4M5DB 3NOCA 4B02A 4RW9B 3HFVA 3QZ8A 4EFAC 3OL9A 4FXWA 4KHPJ 4NWBA 2FVSA 2PSZA 1VQYA 2JLFA 3QIPB 4ED1A 3MMAB 1NSQA 2WB1D 1HD0A 1L3VA 1VIXA 5L1LA 5J2PA 2PIIA 4KTQA 1RHMB 1WOPA 2LMIA 5BJRA 4B3OA 3CCTA 5FIIA 4PUOA 4ZLLA 1SJRA 1WF0A 2E1PA 1PJ7A 1HNZF 3LANA 4K4TA 2EFOA 1RT6B 2WBMA 5L1IA 1IWAA 3BKTA 1UVIA 5JVHQ 1MW7A 4ECZA 4P2FA 3UPFA 3O6QA 2OJ3A 5A6WA 2QZ8A 2ZD1B 1EKRA 2CPXA 4FYWB 5IT0A 1B0PA 3QZ7A 3I82A 1WKKA 3W60A 2VPYB 3CUNA 2PO4A 3EZOA 3CJTA 1UETA 2D3OR 3TO8A 1GXLA 3TANA 3VVUA 3OXFA 1NMEB 3JSMA 3KHRA 2OMLA 1Q7LB 3DOLA 3QFWA 4IRCA 2H4YB 1FERA 3LP0B 1HNIB 2DGVA 4QYZK 2AZ1A 4U6PA 1M5VC 3R6LB 1DTQA 3NRBA 3TZYA 1UJ5A 3DGVA 2HVEA 2HHHF 2UV8G 2I9SA 2Q43A 3PACA 1M1HA 2CZ4A 4DX6A 2XGPA 3J80U 5KFWA 3DU6A 5B7WA 1NKCA 1RB0A 2M0GB 3TAPA 4WXWA 1UPMB 1RHJB 4NYOA 2OPQB 4LF6F 5HMYA 1UVMA 2EBEA 3QT8A 1G4CA 2MZQA 3Q0AA 4RUHA 4CT8A 3BQ2A 3R9LA 1KD1T 4ECUA 3IRXA 2MPUA 3NMAA 2IRUA 1XNRJ 3EPIA 3C19A 2VASA 2F1FA 3QMQA 1U2CA 4NA2A 2FUG9 4WZQA 1KHWA 2L41A 1YBTA 1IUJA 3BDPA 2CWXA 2EFNA 2Z56B 2B6AA 4DCJB 4DQQA 4USKA 4OJGA 2HZAA 1DLOA 2GO9A 3CDWA 2ASDA 4JI6F 4CO5A 3AOBA 3W64A 3TARA 3RW6A 2NR0A 4CM2A 3QFHA 4C9DA 2VBZA 1WUUA 4QR0A 3KLFA 1NRKA 3UNGC 1KTVA 4R0JA 2VG6B 1AA1B 3MCNA 3BBFA 1Q82T 4JI1F 5JUMA 1TL7B 4LBIA 1OJ4A 2UXCJ 3NWRA 1IBKJ 2RHQB 3DLLQ 4NLUA 5KG7A 2R7VA 3T6BA 5L1JA 4N77A 3RB0A 2XYHB 2KJVA 3HSDA 3T5KA 2YX1A 3OR2A 1E6VA 2XNRA 1C0UA 1Y5NB 3N28A 3MGJA 2HGLA 5CCLA 2KRBA 1V5IB 2YH0A 5K9FA 5C2CA 5A2QU 3CC7S 3P6YC 4UZCA 2EFGA 2OPRA 3Q2SC 3THVA 4OL8A 3GJRB 1M1KT 4M5NA 4USMA 4EGLA 3W2VB 4EU0A 4OX7A 1Q8BA 3W5XA 2MHNA 2LYVA 2AYMA 1M0SA 3FGVA 3BYPA 5ETSA 2J7KA 1IR0A 3HVRA 3RGIA 3Q8RB 1XEZA 1S7IA 3RU0A 4DSLA 1S6PA 4X65J 5KFAA 2W2OP 2BANA 5K8NA 4NYPA 2N4DA 4DPYA 1VQLS 3R5CA 4FXDA 4OZJA 4QW8A 1RACB 3EGZA 4TU7A 2RKIA 3RYLA 1FNOA 1RDRA 5A8WA 1RT2B 5KFCA 3ZFVA 4B17A 2DH8A 1M1GA 1GMVA 5B0AA 2KJWA 1F9EB 3AXMA 1HNVA 2APOA 2W9AA 3G86A 1RWWB 3HFKA 5CYMB 1SI9A 1SJ1A 4DZ6A 5KFMA 4DUZJ 1RT1A 2HBRB 4OLOA 4MK9A 3GV8B 4IRKA 3OFHA 4C8MA 1OQ6A 3UO0A 3ZNUA 3DHWC 3OT9A 1IBMJ 2DVIA 2FZCB 4CIOA 1U8WA 2UUCF 2HNYA 4HDGA 4RNMA 4OI4A 3M8YA 2HS0A 2QLWA 3TI0A 2V69A 2AGOA 1VFJA 2XWYA 5KFIA 2BJ1A 4DG1A 3KNGA 4FF3A 4NMLA 3MDFA 3G71S 1JLCB 4LF8F 3U27A 2G13A 2ZFHA 3CT9A 5AJ3F 3BO4A 4K4UA 1F2GA 3IP0A 3CDUA 1SKRA 3PR5B 2ACMA 2YX7A 1UVKA 4OHWA 2J8AA 3UD5A 4ID5B 2NCKL 3W8PA 1HNZJ 4TVAB 2HNZB 1SL2A 4JI0F 1CJTB 1HBMB 2V63A 2DNNA 2MZ1A 4IG0A 4EBDA 2ALYB 2UUTA 1ZS6A 3FFIA 3D3CJ 2EFQA 3WQPA 4TY8B 1QE1B 4ATNA 2VH7A 2XBPA 3MUTP 3ZZ0A 3F0NA 3BZQA 1V3SA 2COLA 1K47A 2OI2A 1CPZA 3K8WA 1I6JA 1MMLA 2B7BB 2PMZD 5KFUA 3QGPA 3CCQS 3PYFA 4PXDA 1PSDA 4MYUA 1NHVA 2WRMA 3LQVA 1A9NB 4C48A 2J8SA 4CLWA 1K0TA 3Q2TC 1YI2S 2A0FB 2CADA 3NCPA 4L74A 1S6UA 2DITA 1JKHA 1Q7YT 2KN4A 4OV6A 2F4VF 1I5OB 3K0JA 3P4UB 4K2JA 4JOUA 3HJFA 3BGUA 2LU2A 3CVKA 2PI5A 4PZVA 1HI0P 2OKQA 5ETRA 4ECWA 1WF2A 2LEBA 2DR9A 3TUPA 1U0SA 1IR2A 4KFBA 2SXLA 3PV8A 5DDRC 2HLTA 1VQKS 3FEZA 5K20B 1FRXA 4LF6J 1CG2A 4J9QA 2VZ9A 3LUYA 3J7A1 3EDQB 3PX6A 3PIPQ 1OIAA 3DLBA 4LMZA 1XN9A 1U1OA 3RB6A 4ER8A 2RMLA 2F8EX 2XMUA 2BRLA 1ZTWA 2D3O1 3WX4A 1XTZA 1V5VA 4X84A 4FBUA 4LFBF 1WC5A 1Y11A 2DNQA 4ELUA 2NUUG 1T05A 1XQIA 2H3EB 3BBBA 3K59A 5ETTA 2CXEA 3G6XA 3FCHA 4R8UA 2MTLA 5LMNF 3VHQA 2XY5A 4KE5A 5C24B 5HMZA 2GIQA 1M90T 2FC9A 1VS3A 4KKOA 3T1AA 1DURA 1R43A 4QJVA 1U47A 4K5SA 4WPAA 1TL3B 2YKPA 1S1XA 4GMKA 2R2UA 4HKQA 4RKUC 3K57A 2EWHA 1IKXB 3M6XA 3CD5A 4QPTA 1JLAB 2LU1A 1DFDA 2MB0B 3TVYA 3OHBA 6FDRA 2IVYA 4P75A 2L48A 2AP6A 1YZ6A 1RTIA 1HQEB 2VQFF 4DPUA 2O01C 3OUYA 1U25A 4FNHA 2JFKA 4PPDA 4QOTA 5AE2A 1X4DA 5HK4A 2HHQA 1Y10A 5D15A 3G2XA 2V94A 1B70B 2HQIA 1YJVA 3JTNA 2FC8A 1VCTA 4N41A 2O5DA 1MG7A 3D7SB 4ED7A 2CJYB 1P27B 5IV4A 2HQGA 3K89A 1S9EA 5B0EA 2Y8YA 3MECA 2BE2B 3VQTA 2M3DA 4LR7A 1JLEA 3M8PA 1FNMA 1WC0A 2XLKA 4WTYA 1WC3A 1Y9OA 4G3IA 4L76A 5IT4A 2ZOFA 1MMDA 2XZDB 1FK9A 2IDEA 1JJ2R 3A1YG 5D0EA 3D66A 1YG0A 4LSLA 1HQUA 2VOPA 4OYIA 4IYQA 1KVIA 2QX0A 1U26A 1IQTA 4P2MA 2W7OA 2GO8A 1SC1B 1H72C 3T1HF 1L3KA 3I31A 2CQ4A 3GV5B 2B56A 2RH3A 5F9NA 3DOMA 5KG5A 3UD3P 5J2MB 4N7TA 2GIRA 2EC0A 4ZVQB 2XNQA 1RLDA 1VOMA 1G1XA 1OMSA 2HIQA 5AT1B 3ETMA 1G3OA 3PKMA 2OFHX 2WHOA 2ZVIA 3MZIA 1S1VA 2EW9A 1RZMA 2Y1LB 4WIQA 4KPCA 4MIBA 5GAHI 3H98A 4ZITA 4LF8J 3MFHA 3FBEA 2DD8S 1C0TB 2GQ2A 3QPIA 1QDUB 4N8OA 3NMRA 1BXNA 1GXUA 2N4CA 1CULB 4F7VA 2BYCA 5F41A 3M9NB 4J9PA 2DR5A 2PFFB 4JI0J 3LA0A 3JSBA 2D74B 3AD7C 4A8MP 4EUVA 3BSCA 3T41A 2RF2A 2GHPA 3MCOA 3PW4A 2R42A 3HK2A 3V4IA 3WDOA 2IDLA 3H40A 1SCJB 2ZE2A 1XNQF 3PZPA 3CNQP 2NREA 4ILLA 2PEBA 1IKYA 3J81Y 2GVDA 3QSIA 3DYAA 3ITHA 3UE2A 2W9CB 1D8YA 5KT3A 2JVRA 1BQXA 1ZA2B 5J2NB 4A46A 3GYXB 2V34A 4AL6A 3PY8A 5LJ3Y 2XI2A 3MM6A 4BHQA 2CQPA 3DDKA 1T03B 4UUXA 3VVTA 4P74A 1CJKA 1RAAB 3WZ0A 4M5MA 2YNHB 1OY8A 4KGMA 2YTCA 5CYQA 4DCOB 3CMES 1HKAA 3AT1B 4M5KA 4Q0BB 1DRZA 4RW8A 3GE9A 2VPWB 2DGQA 1FDAA 3EZ5A 2X1AA 3MUMP 5C7PA 3KK3B 4Y28C 1GXTA 4RW4A 1CJUA 1RTJA 1YWXA 2B4UA 4USWA 4DR1F 5F9LA 2L9WA 5KFBA 4LRBA 1Q53A 1TAQA 3VAFA 1QUVA 1ELOA 1NPRA 3MCMA 2J6TA 4OYOA 1UAWA 5JJBA 3HHLD 1BQNA 2ZDOA 1N52B 5KG6A 1T11A 5D0RA 4DV4F 1EP4B 2VKZG 3MMJA 2MEWA 4AXIA 3PX0A 1X9MA 2EG1A 3RAXA 4I1TA 3IRWP 2OFGX 1KFDA 5LMNJ 3SDEA 4IO1A 1NO8A 2JL9A 3PFEA 3CE8A 2WVFA 2KHCA 1RHRB 5D4PA 3V6DB 4ANCA 5SZTA 4NLOA 4OYZA 1R7IA 3ILOA 3ZXWA 1REVB 2GJIA 1VLOA 2QL5B 4RW6B 2IVMA 1R0CB 5FLXU 4I7FB 5HLFA 3M2VB 4ZPCA 3PG9A 5KFLA 3D5MA 3CJ3A 5A8RA 2B51A 2K2PA 5CA5A 3I9ZA 3BGFA 2CPJA 3I55S 2NYIA 5L39A 2HFVA 4KV8A 4IFVB 3ET6B 3OTCA 1ZA1B 4C0OC 1SC4B 2C42A 2CZ9A 3OL6A 4G65A 2E5HA 4EO6A 1X4BA 3W3SA 3QSYB 2VQFJ 1UCNA 3LPEA 2NXCA 1SJ3P 1Q0NA 4LFCJ 3H2VE 4FS1A 1J27A 2C2MB 3UDEA 4CLFA 2CQGA 3NGSA 1S9GA 2MY7A 1JX4A 3O2IA 3MD1A 1WKJA 1LNQA 2FGOA 1OSCA 3PTWA 1F5CA 1LW2A 3MPVA 4X4RA 1VBKA 2XG8A 4KSEB 1RT5A 4DBQA 4DL2A 4KO0A 5K8MA 1HNWF 2QRRA 2V8GA 1WI8A 4TY9A 5LM7E 2ZBPA 3EGVA 3H25A 2MQMA 4WK3A 2QT7A 2MKJA 2VFRA 3GJSB 1NJZA 1FO1A 4PYAA 4NRUA 1TKXB 4QW9A 3T5JA 1ZPWX 4ECTA 2G9OA 3HKZD 1D9AA 4NCGA 1FDBA 2OPPA 3OTBA 1RU1A 4DDFA 2B4PA 2JZ5A 4ELVA 1RTHB 5F0WA 5C25A 1ROFA 2QLJB 3OFGA 2WOMA 2HBZB 4ZK7M 2D3ZA 4I2QA 3MEEA 5D4OA 2BMBA 1LOUA 4ED2A 1S0MA 5GMEA 5DDOC 2CQ3A 1APSA 2JSXA 4UOFA 4DX5A 1QUPA 2Q1LA 2OLWA 2G2YA 1BWEA 3W5ZA 4A8KA 1C1CB 1M5PC 4M5LA 1N8RT 4DV1J 3J81j 3ISNC 1HPZB 1P9YA 3BREA 4R0EA 3DXSX 1QVGR 4ECYA 7AT1B 3TVZA 2AX1A 3W62A 3DLKB 3M2UA 1ZM9A 4LF2A 2DNLA 3DC2A 2D9OA 4K2XA 2P6TA 2GVZA 3OR1A 4WXOA 2W1BA 3R8YA 3PRDA 2MQLA 1GX6A 3LO3A 1PC5A 1MROA 1R8PA 3ZTOA 1YK9A 2H48B 4ZKAA 4ZJOA 1VC6A 2V2ZA 3IG1A 1KVKA 5G4DA 1Q86T 4ZLPA 3IFEA 1IKWB 4CTAA 4PXEA 3LWLA 4OHXA 5B08A 2QFIA 4GKKJ 4H4MB 5F8JA 1PGZA 1R0BG 2POKA 3BGRA 2P2CB 4WCEQ 1AZSA 3GYNA 2C2NA 3Q22A 2WONA 5DZ7A 1X9WA 5A76A 1VQ9S 3CMQA 4CLYA 2W4CA 4P7TA 1UFKA 3NLCA 1TUVA 1Q79A 4QU7A 5ETOA 5KFKA 4ECRA 2YQ0A 3FSIA 3KLEB 2GMLA 3QJLA 3M32B 1VYAA 1P1TA 4DQRA 1H38A 1M5SA 1ZZNA 4BDPA 2VQEF 1TV6B 4ERDA 2OD6A 2W8KA 4F02A 5KOXA 4DR1J 1TL4A 4TLRA 2KXFA 2UVWA 2HVHA 1JNRB 1K9MT 4ZHRA 1HMVB 1WDTA 1Q78A 4J9NA 1FWKA 3ZO7A 4Y3CA 1FRHA 4GKJF 1FJCA 2HNDB 4JYAF 4AUKA 2FLLA 5IZHA 5KFYA 2XB2D 3EXYA 1U4BA 2H5IB 1FDDA 5AXKA 4ALZA 1X7VA 1U1LA 4ZMMA 1G7CB 4J9KA 2DTJA 5CD4H 3R2CJ 1VQPS 1SUQA 5KT5A 3EYZA 4PWWA 2N3OA 1S1TA 2YWHA 1R0AA 1EZZB 1IQZA 1URNA 3CCWA 4ZJQA 3MTKA 4F4AA 2HWIA 4HHJA 2BKOA 3BGOP 5L46A 3SCKE 2MKYA 4YFUA 4RWXA 2YWGA 1ZH5A 4ICLB 1CVJA 2CJAA 3D2WA 3A13A 3DMJB 3TNVA 2AHOB 3IS9A 1WELA 4ZPAA 2XYGB 3QJPA 2DJWA 1KNZA 2E1MC 1N5SA 2NUHA 4RLEA 4TNOA 4LRAA 4OJHA 3VAJA 4QIWD 5HROB 1S76D 1ZOTA 2GAHC 3S01A 4ZS6A 4PG7A 3GB0A 1YRTA 3KK1B 1VGYA 4OFZA 3CTRA 2AD9A 4O3NA 2JWNA 2F63A 3MOJB 2I0XA 4X4VA 3BQ0A 1GT8A 3QQCD 4ZPBA 2I38A 2AEFA 1T3NA 4CI0B 4JV0A 3BSNA 2P6SA 2CDQA 4OI6A 3GPAA 1C4CA 2OO4A 2DGSA 2FB0A 3IR6B 4DV0F 3I0SB 3W63A 1FEEA 5DDPC 2FVRA 3US5A 2OSRA 4NMXA 2IRYA 4MTPA 5A8KA 3BEGB 3DRRB 1TKZA 4FKYA 2ROGA 3JQMA 4IUFA 5CZXA 2QIFA 2GHVC 2D7SA 3TA2A 4QWDA 2RUGA 1R8BA 5I3QA 3PJXA 4M5GA 9RUBA 3QIPA 5HMXA 1RJJA 5EWEA 4NYZA 2A2CA 1Y3JA 2KO1A 3MMAA 2BV3A 5ETLA 4ZPDA 1I51B 4NLRA 3TZZA 1BQMB 1PBAA 2OUGA 4DV7J 3CEDA 3BN4A 3T5HA 3N5BA 1YJTA 2AJ0A 2Y9HA 2BJ8A 1U1KA 1RT6A 4Q8EA 3ILIA 2DCUB 4XK8C 2M9KA 3W66A 2Y8WA 2BRKA 2CA9A 4NXMF 1H7XA 3PEHA 3JB9k 3C8YA 3K5PA 2P9CA 2KFZA 4RX6A 4DU8A 2ZM6J 4WIIA 4F3QA 2DPIA 5L9NA 3GZ7A 1N54B 5KFXA 4Y2IA 4DF4A 2DHSA 3HHDA 4RU9A 3NNCA 1XK8A 3HVTB 3P45B 3H5YA 3A8KA 3SSSA 4EYIB 4H4KC 3SQGB 4DUYF 4YMEA 5KT7A 1D9DA 2V2QA 1N36F 2LA4A 1N6QA 3Q8QB 1KQGB 1SIWB 1WG4A 1UEUA 4X4UA 1KDNA 2O3DA 1RTDB 2M70A 5IWAF 2CDRB 4JB8B 1N48A 4CLTA 5IC6B 1LXNA 3EPGA 2V4RA 3CDAA 2XZTB 4DQSA 4DPTA 1MWZA 2OPQA 2B43A 3JQKA 4IQMA 3NNHA 2BR0A 3H5UA 1T9YA 4AYBD 3HZGA 2HEKA 3HSJA 4ZVRB 4AD6A 2DGWA 4HR2A 3OBIA 5GAGI 2HLUA 1BMQB 2M7SA 2RHSB 3HF5A 3V4MA 1I1GA 5B0DA 2ASJA 1RAOA 2QMWA 2DIUA 1NXIA 4U8YA 2MKSA 3M8ZA 1HWJA 4DLGA 4C8NA 3M1VB 3ULHA 3Q83A 4JI4F 5LSRA 2VQEJ 1PC4A 1Y5IB 3SEOA 3MEKA 1KQSR 5T7LB 1NSAA 1U0HB 2CPZA 2F65A 1AFIA 2J0QD 2ZDPA 2PI4A 2AYEA 1S57A 1VQ5S 4LSNB 2LXUA 4FVMA 2RS2A 3VR1A 2BACA 1Z1ZA 1TL7A 2CJQA 2H5EA 4I6YA 3H42A 3KNAA 2XS5A 1BWVA 2BJ9A 4NI2B 4Z2XA 4CCHA 1SQFA 2RIJA 1EQMA 1VRTB 2HVDA 4OX9F 2V8HA 4TU8A 2WVDA 4KBIA 2D3UA 4F3OA 2AGQA 1EHWA 2QLBB 1Z2ZA 3IWXA 4AL5A 2HRYA 2IM1A 4CDIA 2NQPA 2DR8A 4PXCA 4DPOA 4C8LA 1TUGB 4F8RA 2LXIA 4WTOB 2X51A 2LCWA 4OI1A 3OTEA 3GP9A 1FVSA 4IR1A 3V5RA 3RBEA 2MKKA 2YQ1A 1RK8A 2HG4A 5H9EJ 3JTPA 2GX8A 1S9FA 4NCAA 2JJ4D 1N33F 3AJ2A 2KM8C 5E3QA 1RCXB 1AXQA 4IOCQ 3UFCX 4R5PB 1YJNS 3MFIA 2MZJA 4QR2A 3KK2B 1YJRA 2K8GA 3CCMS 4YP3A 2KL8A 1VDHA 4PQUA 3SBMA 4E8UA 1TFWA 3H2UB 1F3VA 3DLEB 4U8VA 5JMNA 2A6OA 4LF9F 1RAFB 2UVUA 2LQ8A 3MF5A 2DY9A 1KOHA 8ATCB 3DRPA 1SB6A 2G2ZA 3PVXA 3H5SA 3ADAC 1Y7PA 3GJQB 3V6JA 2W2MP 4XDCA 3WIVA 3DNCA 4JV1A 1A6LA 4ECXA 2V68A 5ETKA 2ABYA 3OXGA 4CNZA 1HBNB 1S49A 1XERA 3BYRA 2G4BA 4LF5F 5M2UA 3GIRA 4DV0J 3RB3A 3ZZZA 1S99A 5GMDA 4DL6A 4DMZA 4Y34A 4NASA 2HMIB 2C2OB 1SL1A 5EWGA 2FD2A 3OLAA 1WORA 3NS5A 3GYGA 1VRQC 4M1KA 4FDFA 2E9TA 4F26A 2CUYA 1N34F 1RISA 3MAHA 2K7JA 2IVFB 1HFEL 3C15B 2IM0A 4K7QA 3QLHB 1JLCA 2VBWA 1LEOA 1WHWA 4I6AA 2PMWA 4B08A 3TA0A 4X4TA 4B3MF 2XO7A 2BBEA 1RGVA 2W2QP 4J9VA 4Z37A 4CO3A 3TX8A 2HZVA 3FZBA 1B7YB 2HNZA 2C2ZB 3BS9A 1CJTA 2RSQA 3FK4A 1FKPB 1S6QB 2Y0SD 1FRKA 4KGXB 4NXMJ 1LWEB 4J9SA 1CJVB 3MAAB 1Y4ZB 2CQ2A 1HHTP 1RHQB 1NBEB 1BD6A 2J9EA 1VRUB 4HTJA 1SH0A 1KONA 3O1LA 5T14A 2ZC4A 1W7WA 2MKCA 4NL5A 3OL7A 2EC2A 4L72B 2V6AA 1N0VC 1NSPA 3PDNA 2LFVA 5DLGA 3J7YI 3MM8A 2VV5A 4YR0A 4DUYJ 2LDYA 3U7JA 2LECA 1N36J 4A4JA 2LQBA 4ZPTR 4B3OB 2R2SA 2GGPB 4PUOB 4JI8J 2E5LF 3CJ0A 2AJQA 1NJWA 4QPXA 1QY7A 3SQOP 3I0RA 5D77A 5KFVA 5IWAJ 2ZNYA 1RWVB 1TK0A 2YNIA 1RWKB 3QRQA 1RU2A 3U1NA 4KAIA 1O8BA 2VDIA 2WW4A 1IBCB 3HDSA 1NDPA 1WC1A 1RT3A 2CFXA 1FI4A 4UY8T 1YJWS 4BWMA 5DQHA 3RR8A 5K14B 4MKBA 2CQ1A 4CLZA 4RNNA 2DHXA 4QU6A 2RDIA 2FJWA 3IBCB 3MPWA 3NAHA 4KC5A 2E9ZA 4RWWA 1T94A 1LXJA 1UEKA 4ZVSB 3KTQA 2LKZA 1FX4A 3JSMB 4DS5A 3DOLB 3H8YA 5C24A 1ZAVA 4PG4A 2NPIA 1NDKA 3MOZA 2KU7A 4DSKA 2RRAA 2V8PA 2GMHA 2VC1A 3HSZA 2RS8A 3S6EA 1UP1A 1VK8A 4NA3A 4TU9A 2BVZA 1DTQB 1JJHA 2CPIA 3KWMA 1TL3A 1SPBP 3P5TL 2M2BA 5GADI 2CQ0A 2BZ2A 2AMCB 3OLBA 3QGHA 3MWBA 3T1YJ 4WKRA 5G0RA 1X5SA 5CZVA 3IO1A 3TRGA 1N56A 3MMCB 1R6YA 2ZH2A 1JLAA 3BF4A 3FBCA 3P96A 5H9FK 3I32A 4IDKB 1Q81T 1DQAA 2DISA 2VL1A 3BO3A 4OX9J 1BC6A 2IC3B 3CCJS 1HQEA 2YPZA 5I3UA 2HYIB 2ZH5A 4G1IA 4RU2A 4AE5A 2RB7A 1SL0A 2VD3A 2GIFA 5KFSA 5I42B 4P72A 3TJAA 2KHDA 1RSCA 5ADZA 1YTYA 2UU9F 3ZTQA 3A8JA 1H3DA 1FEHA 1N5YA 4A8QA 2Z8QA 1VLYA 3HD1A 3W2WB 1LK5A 4AXJA 4RJVA 1T3OA 1YZ7A 4PYDA 3TOQA 1RI7A 1N33J 3PNIA 1HWUA 2BE2A 3G4SS 5IS2A 3D6MB 5GAEU 2MQ8A 2VB6A 1X60A 1O0PA 2R2TA 2MLZA 1KHVA 4O44B 3HPOA 2P5VA 2DR7A 1JWWA 3EVWA 4TYAA 4LF9J 2XTJP 1GTHA 1NDLA 3E51A 1UA1A 2AV5A 3MMBB 3L7UA 1FXDA 3OR2B 3Q89A 2G2OA 2IY5B 1C0UB 2DIVA 3AB2B 3TEGA 2I5JB 1FKAF 2DY1A 3TAMB 4LF4F 3VAHA 2D9PA 2MDAA 4DFJA 4LF5J 1F6TA 3A3OB 2JLEA 4Q5VA 2MGZA 4DF8A 4X4NA 2CVEA 4DI6A 2PEHA 2GJFA 2OPRB 2PD1A 3QT5A 2AKWB 4NLGA 1MU2B 3N6NA 1NK0A 2F40A 4C98A 5DETA 5D4LA 1F2HA 1H2UX 2R8GA 3B4DA 1N34J 5B0BA 4LVNP 3ZZYA 3BH7B 4HHHA 2P9GA 4V19J 2ZH9A 4LF1A 1RWXB 1MNEA 4YN3B 4Y2MA 1L3SA 2VKRA 3HHLB 2DXFA 1FRIA 2ZBCA 4V19X 4PQAA 3W7BA 5IQ6A 2BQRA 3NOGA 3DRYA 5C5JA 1VQ4S 5A8WB 2E5JA 4DR3J 3S8SA 3KXDA 3TP2A 5C2GA 1T0TV 5LSOA 2FDNA 2OEKA 1Q1KA 1U1NA 1QTMA 5D0HA 4ZVTB 1D9FA 1R8CA 1HNVB 2ALZA 4S0MA 2U1AA 2C2DA 3M2RB 2RUSA 2JEJA 4YQWA 2ZJRQ 3UR3C 2RNEA 2DEIA 2ZUAA 1F1BB 3FDSA 2XY7A 2HFOA 2W9CA 4ZPWR 1UJ4A 4N8NA 4C0BA 3BGLA 3GU0A 4IRDA 2CAJA 1K44A 3RAMA 2XSJA 4DPWA 4DG1B 1U8SA 4ZP6A 4HHUA 2KVIA 1UEVA 3JAMY 3RUBL 3HX9A 4J9MA 2A1BA 1IR1A 3IC1A 1F3FA 2HPUA 2EFVA 3MEDB 2Z2LA 1KVJA 1H74A 4KT0C 4WYWA 4IH5A 5AE1A 7FD1A 3OW2R 4U95A 4EWTA 3PIOQ 4JI2F 2EXUA 2CQCA 1BGXT 4C4WA 2KB2A 1BUXA 3FSYA 1DAXA 3TZWA 3M05A 4B3RF 3W9IA 2VONA 3D9BA 2CJBA 3VZIA 1JXVA 5A0YB 1KLMB 1WNEA 4JP8A 2YWEA 1TVRB 3OD2A 3V81A 4HACA 2DB1A 3WIUA 4DZDA 3C3LA 3RBXA 3CXCR 1WTBA 1P8GA 4Q2LA 1JKHB 1IBMF 4P52A 1X8DA 3QWUA 2JC1A 1V3RA 3MR7A 1KS2A 4UW2A 2OPSA 1R6VA 3HULA 2HSEB 4I7FA 1Q5VA 3BV8A 3FNNA 3KLVA 4ZN1A 2CIMA 1BLUA 1VJWA 4C7QA 2L08A 4L6V3 1Y0HA 5LSLA 3ELHA 1VMBA 3A12A 2KXNB 2WVBA 3QIDA 3AB4B 4B3TF 3NCQA 1CBKA 4JI7F 4C97A 4RNHA 4DR7F 2DRDA 2RE1A 5KG1A 4IFVA 4C8ZA 4FZVA 1NDCA 2V4QA 5EWFA 5J1PA 1ZM4A 1W26A 5B0FA 2CNOB 1HHSA 1OY9A 1T05B 2QL7B 2R7UA 1U49A 2X3DA 4CQ1A 2GQQA 2UU9J 3KMQA 3LAMA 3OSNA 3PEJA 3R5DA 3V2UC 3OQ2A 1DTTB 3G96A 4USUA 1HBUB 2RT3A 4AT1B 1RHUB 4LRFA 2HS3A 3UVJA 2MMYA 4USVA 3L9ZA 3M8WA 5HMWA 1VR6A 1S1XB 2JX2A 2HK2A 4E98A 5DG7A 3KLHB 4QQBA 3MEGB 2ZWOA 2KT3A 1HYSB 5KFNA 4QYRA 3IR5B 2YKNB 3I4HX 2OHDA 3KJVB 4WJBA 5JXSA 4YY3J 1W2BR 1FRMA 2J0SD 1RTHA 2R9LA 1ZM3A 2RQKA 5HSPA 1MWQA 3UCGA 1S0VA 1RTIB 2XCAA 3VAGA 3KMSA 1R31A 3OUYB 2YWKA 1TU0B 1VBZA 1FNXH 4MIWA 2DKOB 4LF4J 3AODA 4GO5X 4H4KA 2W2NP 3G9CA 4RPFA 4X4PA 2M4MA 4NX9A 1QSLA 2KZZA 2FVCA 2MLXA 4C11A 2MQQA 1PG5B 4Y65A 1C1CA 1FD8A 2HQFA 3BSAA 3IAM9 1HPZA 1TKTA 1LWCB 2FGCA 4I6WA 2J6UA 1JLEB 3M8PB 2QV6A 1TL1B 1RWUA 3G82A 1YQHA 5KFRA 2EG2A 4JI5F 2RVJA 3AHPA 3TEHB 1FDNA 3BPDA 2U2FA 5KG4A 1YX2A 3DLKA 1NPPA 2UV8A 4IFYA 4F4XA 3PW2A 1RYRA 4LSLB 4V1Ak 1UA0A 3LAKA 5IT9Y 4O3PA 1FJ7A 5KFPA 1H2VZ 5J1NA 5BYSA 1GTEA 2B5JA 2YNGB 3NGRA 5C42B 1RE1B 2B4VA 2AGPA 4A8FA 5E0OA 4UOCA 2UZAA 1GMUA 1WG1A 1CC8A 2CQHA 2H51B 4MKVA 3HHLC 3PM9A 2QA2A 3Q8VA 2J0WA 4DFPA 4M5JA 4XTTA 2C22A 4A8YA 3UDCA 1VK3A 4BLGA 2ROPA 3X3UA 4H4MA 4NCBA 3TAQA 2WB4A 3PRBA 1JXEA 1U7LA 3NGDA 1U02A 2XC9A 3UCUP 1T95A 2F8MA 1U1PA 3GFYA 5H1SV 2MZRA 2UXBF 3GMGA 4OZNA 1Q8IA 1Y00A 2MLYA 5EX0A 2CRLA 1QJHA 3CC4S 2CYYA 3TW0A 2FQQB 3MR6A 3KOAA 1S48A 1GAOA 1C4AA 4X2BA 1SKSA 4N5SA 2W4DA 4ZP9A 4OYXA 4RL1A 4QWAA 3EXCX 1B7FA 2IAJA 3N79A 2DRAA 2CPHA 1KKHA 4MK8A 4NOHA 2W7AA 4JI2J 2RF2B 2VHGA 3C16A 2ZE2B 4DPXA 4ZVFA 1RA6A 2MQOA 1IKYB 2KVQE 3NGUA 2OTJS 4B3RJ 1VJQA 2FVPA 1JLBB 2HNDA 3LH2S 1OO0B 3D0IE 2YXLA 4ZDNA 2CPDA 3IR7B 4F4WA 3VGTA 4PWUA 2CWKA 5ETMA 4ZP8A 3KG0A 4O0NA 1VBXA 2DXEA 2HAFA 1WHXA 1O5JA 3ISND 1YVFA 1O6XA 3KJQB 4CZCA 1HBOA 1LK7A 2EEYA 1CJKB 4B9NA 2CZVC 2DXDA 1DQ8A 1QSSA 2W9BA 2HKEA 2QSWA 2ADBA 2EK6A 4FVCA 2GHWA 1SH2A 4RW8B 4ICLA 1SV5B 2J0XA 3OJUA 2FHOB 2K06A 2FLPA 4RW4B 2HWHA 2IJFA 1UPPA 2B8PA 2XO6A 2Z58B 3UQSA 3I87A 4NEYA 4LFAJ 2RD5C 4B3TJ 3H7HB 5HROA 2O67A 4JI7J 2ERRA 1RAIB 2ADCA 4DR7J 3MD3A 3KK1A 1BQNB 4OI2A 3QAEA 5KG3A 3PHTA 4QYZJ 4HL9A 2HVIA 1NKEA 4KQZA 1D1UA 4B9VA 1XMOJ 3H4BA 3SCLE 4LVOP 1N4LA 3LP1A 3R7BB 2R8HA 3KHHA 3SDEB 2D69A 3RTVA 3NL0A 4FBTA 2Z0GA 4ED8A 4BWJA 1JLFA 2ZJQQ 3A3NB 3MM7B 2FJBB 2E5IA 3A4TA 5HLFB 3DRXA 4P7VA 1FD2A 2KXHA 1HI8A 3AJ1A 4KHRA 5CABA
chains in the Genus database with same CATH topology
1DQ9A 4ED1A 2EFPA 3MMAB 3QIPA 2CPEA 5HMXA 1NK8A 1RJJA 2WB1D 5J2PB 2UUWA 4NYZA 5EWEA 1HD0A 2A2CA 1Y3JA 2KO1A 3MMAA 4OV1A 4WYLA 1U6BA 1L3VA 3DOKB 1VIXA 5L1LA 2AX0A 4CO2A 5J2PA 2BV3A 1T8EA 2PIIA 4KTQA 4IG3B 4ZPDA 4RUCA 3DOKA 1YHQS 4NLRA 4YB1P 1BQMB 1KRPA 2LMIA 5BJRA 4B3OA 4IG3A 3CCTA 2DO4A 5FIIA 3K5LA 4PUOA 1SJRA 4KV8B 1WF0A 3CEDA 3BN4A 3T5HA 1VQ7S 2E9RX 1HNZF 3LANA 1RT7B 4K4TA 5E3AA 4LUBA 2EFOA 1RT6B 3N5BA 1YJTA 2AJ0A 5IQQA 1RT7A 2WBMA 1U1KA 1RT6A 4QR1A 4Q8EA 2DBBA 3KLIA 5L1IA 2DCUB 2XS2A 3OVBA 4XK8C 4KPYA 1UVIA 2HHSA 2M9KA 2PE8A 5JVHQ 3NKYA 3OFEA 2MXYA 4TQSA 1F5BA 1XC9A 1MW7A 1B64A 4ECZA 2HHPA 2E29A 3UPFA 2BRKA 3C2PA 4J5OA 3O6QA 5AXNA 4ELTA 3MPYA 4NXMF 1VIOA 1H7XA 3PEHA 3G8QA 4URSA 3EGWB 3R1HA 3JB9k 1S9GB 4PR6A 2OJ3A 5A6WA 3C8YA 2QZ8A 3K5PA 1B0VA 2P9CA 2ZD1B 1X4HA 2CPXA 2F9DA 3KLGA 1P1LA 1IBLF 5IT0A 2KFZA 1B0PA 3QZ7A 4DQIA 4RX6A 3F73A 3I82A 4LIRA 4WIIA 4PG8A 3BQ1A 4M8LA 4F3QA 1N5VA 2YH1A 1J5OB 2DPIA 2ZZNA 1FE0A 5L9NA 2O66A 2OMOA 3CD6S 3GZ7A 1J5OA 1DBDA 3DM2B 2VPYB 3CUNA 1N54B 2PO4A 4KO0B 4Y2IA 5KFXA 4C3MA 3C66A 4DF4A 3DM2A 4M63A 3TR5A 2DHSA 3HHDA 4RU9A 3R27A 3TUIC 1XK8A 3NNCA 3HVTB 1NHUA 3H5YA 4DSJA 1UETA 2D3OR 3TO8A 1GXLA 3HVTA 4N76A 3TANA 3DI6A 3SSSA 1ULRA 3LW5C 4EYIB 3OXFA 4H4KC 3SQGB 4DUYF 2FLOA 1UMJA 3JSMA 4YMEA 5KT7A 2OMLA 1Q7LB 3DOLA 3KHRA 1D9DA 4NCGB 1JNZB 1N36F 2LA4A 2KRRA 4IRCA 2ZVSA 2OPPB 2ZOMA 4URGA 1N6QA 3Q8QB 1B0TA 3N6LA 5KFOA 3PFOA 1KQGB 1FERA 1SIWB 5FD1A 5LT5A 1WG4A 3LP0B 1HNIB 2DGVA 1UEUA 4X4UA 4DSFA 2Q6CA 3QAUA 1XMQF 2O3DA 4USIA 4U6PA 1M5VC 3IXQA 1ZM2A 2X1BA 1DTQA 2JEGA 3NRBA 1RTDB 1UJ5A 2M70A 2AYBA 4ZCLA 3ETOA 2HHHF 5IWAF 2UV8G 2I9SA 3MR2A 3QO9B 3BSOA 2Q43A 3PACA 2CZ4A 2XGPA 3QO9A 1IKXA 4U67Q 4TKTA 1C2PA 1IM4A 5KFWA 3MEEB 1N48A 3DU6A 5B7WA 1X9SA 1NKCA 2M0GB 3TAPA 1LXNA 5E41A 3EPGA 4IR9A 7FDRA 4DSIA 2D41A 4WXWA 4PPZA 4ECSA 2V4RA 4NYOA 3CDAA 2BJDA 5GVQA 2OPQB 4LF6F 5HMYA 1UVMA 4DQSA 1N88A 4X4SA 2EBEA 1MWZA 2OPQA 2B43A 5GAHU 2MZQA 3UDLA 3Q0AA 4IQMA 2C3UA 4RUHA 4CT8A 3H5UA 3BQ2A 2BR0A 4O3SA 1FXRA 1TFYA 3NNHA 5K8PA 1XR7A 4AYBD 3HZGA 4C11B 1KD1T 2YKMA 2DNOA 4K4YA 4FF1A 3IRXB 4ECUA 2DGWA 2VODA 4LFCF 3IRXA 2MPUA 3NMAA 2IRUA 3OBIA 5GAGI 2HLUA 3GIMA 4Y6IA 3EPIA 2M7SA 5DQGA 1SBRA 2VASA 3HF5A 3V4MA 4DN0A 2F1FA 3QJJA 3QMQA 1TKTB 1X4CA 1QSYA 4NA2A 3CDEA 2QA4S 1AROP 4C8KA 2FUG9 1I1GA 4WZQA 1WHVA 5LL6d 5B0DA 1KHWA 3VF0B 2ASJA 2L41A 4GC6A 1IUJA 2QMWA 1R8HA 2IHR1 3BDPA 2B6AB 2DIUA 3GG1A 2EFNA 2ZKUA 2LXFA 2MKSA 2MSSA 2RILA 2B6AA 1DLOB 2CQIA 2W8LA 4DQQA 4OJGA 1DLOA 2GO9A 3PXGa 5M2PA 3CDWA 2ASDA 4JI6F 4CO5A 1JLGB 2IM2A 2NLWA 2V9KA 4IFYB 1HWJA 3TARA 1ZETA 3RW6A 1LWFB 2NR0A 5J1EA 1JLGA 4DLGA 1XMBA 3M8RA 4C8NA 4C9DA 3M1VB 3ULHA 2VBZA 1LWFA 4JI4F 4QR0A 5LSRA 3M1VA 1PC4A 4PKDB 3KLFB 2I2YA 4LQ3A 2OTLS 1Y5IB 3SEOA 2KI2A 3MEKA 1KQSR 1RYSA 3SXLA 5T7LB 3KLFA 1NRKA 3UNGC 2B5JB 2CPZA 3M6UA 4TN2A 1KTVA 4R0JA 2RQCA 3HMJG 3T19A 1AFIA 2ZITA 3CO9A 4ES2A 2J0QD 4NLPA 2VG6B 1X0FA 5DM7Q 2ZDPA 3M6WA 2PI4A 2AYEA 4I2PA 1M5KC 5U47A 1VQ5S 2J7UA 4LSNB 1XWLA 2LXUA 3NAIA 4FVMA 4NZ7A 3HM9A 1Q82T 2RS2A 3VR1A 3PO5A 4JI1F 5KFGA 5JUMA 4X66F 4LSNA 2BACA 1Z1ZA 2MQNA 1NH8A 2H5EA 2CJQA 4WK1A 4I6YA 1TAUA 3KNAA 2ZBIA 2XS5A 4YY3F 1JB0C 4FNIA 3DLLQ 4QBUA 1FJGF 2F3JA 4NLUA 5KG7A 2R7VA 4A8WA 3IWLA 4Z2XA 3T6BA 4CCHA 2R7OA 5L1JA 2XULA 4N77A 2ATLA 2RIJA 3RB0A 3SV3A 2FLNA 3RRHA 2KJVA 3OSPA 3BGRB 4DL4A 4RW7A 3T5KA 1E6VB 3WC0A 1VRTB 1C1BB 2YX1A 2Y1IA 3M6VA 3OR2A 1E6VA 1TL5A 2ZNZA 3GFHA 1WWHA 2XNRA 1C1BA 4OX9F 2V8HA 3SMZA 4Q45A 4TU8A 1I94F 4WKYA 4KBIA 4USJC 1C0UA 2B9XA 2D3UA 3T3FA 4F3OA 4YB7A 2AGQA 3R3TA 2DCLA 2QYCA 1Y5NB 2DNGA 4DX8H 4Q44A 5J2MA 1Z2ZA 3UI3A 5KFQA 3PX4A 4K0KF 3IWXA 3N28A 2HRYA 2IM1A 3MGJA 4AL5A 2NZ4A 1FXLA 2DR8A 2HGLA 4PXCA 2MSTA 5CCLA 2NQPA 2KRBA 4DPOA 4C8LA 2LQ5A 2NS1B 4F8RA 2LXIA 1FHTA 3CIZA 2YH0A 5K9FA 1UKUA 1CQMA 1Q16B 2X51A 2I8EA 3CC7S 2LCWA 2F7VA 3P6YC 1S1WB 4JV2A 4OI1A 2EFGA 1S1WA 2OPRA 2YNFB 2XMTA 3OTEA 3Q2SC 3K5OA 4ID8A 3THVA 3SCIE 2YNFA 1FVSA 2R2RA 4DV1F 4OL8A 1FKOA 1GH8A 4BCAA 4UUWA 1R27B 5L9XA 1M1KT 4IR1A 3V5RA 3RBEA 2G0CA 2MKKA 4EGLA 3W2VB 4EU0A 2QFJA 1F0XA 4OX7A 3ICLA 1RK8A 2HG4A 1VQ6S 1X4AA 5H9EJ 3JTPA 5CYJA 2KFYA 1Q8BA 4OHZA 3UWTA 2GX8A 1S9FA 2MHNA 1OPZA 1TZ0A 2AYMA 2B0GA 2LYVA 1M0SA 2B9WA 3FGVA 2JJ4D 4J9OA 2IAJB 3DCAA 1AUDA 1D0EA 4NCAA 1N33F 3AJ2A 2KM8C 1RA7A 2J9CA 1OQ3A 2J7KA 4QIGA 2QO3A 1IR0A 5E3QA 5L1KA 2PT0A 3J80Y 4DR4F 3HVRA 1AXQA 5MAOA 3Q8RB 4IOCQ 3UFCX 1NAQA 1YJ9S 1VQ8S 2UP1A 1C0TA 1XEZA 4R5PB 4A48A 4X4QA 1S6PB 2WW8A 3RU0A 4DSLA 1YJNS 3MFIA 2MZJA 2BANB 4R5PA 4QR2A 4WU2A 4ZHRB 1JK9B 1S6PA 5KFAA 1VC0A 4OI0A 3KK2B 1YJRA 2K8GA 2VG7A 2BANA 5K8NA 3CCMS 4YP3A 2WAQD 3KK2A 2PDAA 5KFZA 4NYPA 4DSEA 1IKVA 2FHMA 2N4DA 3K58A 4PQUA 1TFWA 4E8UA 3H2UB 2RKIB 1VQLS 3DLEB 3Q8SB 3R5CA 4FXDA 4OZJA 4QW8A 2YKQA 3C6TA 5DGBA 3EGZA 2A10A 1S1UB 4TU7A 2RKIA 4LF9F 3BB5A 3DLEA 3RYLA 5DS7A 1FNOA 1RDRA 2Q3PA 4QIVA 4O0IA 2UVUA 1S1UA 1RT2B 3E3XA 3MF5A 5A8WA 2EI5A 5KFCA 2ZKTA 1KOHA 3DRPA 2WSFC 3ZFVA 5DQIA 4B17A 1SB6A 2EK1A 3PVXA 3H5SA 2DH8A 3HKWA 1Y7PA 3OFFA 3M8QB 3V6JA 3CCZA 3G6VA 5B0AA 2KJWA 4XDCA 3M8QA 1HNVA 4WFNQ 3DNCA 4JV1A 2APOA 2W9AA 4EZ6A 3G86A 1A6LA 3HP6A 4C3LA 1SUQB 3HFKA 5CYMB 4ECXA 2JVOA 1SI9A 2GV1A 2ABYA 2JLGA 3FSXA 1RT1B 4G1QB 3OXGA 1R0AB 4CNZA 1HBNB 1SJ1A 2KM8B 1RP5A 1S49A 5EHHA 4O4GA 5KFMA 1XERA 4G1QA 1RT1A 2MY8A 2G4BA 1HBNA 4LF5F 4OLOA 4MK9A 4GKKF 3GV8B 4YHHF 5M2UA 4IRKA 3OFHA 3RB3A 1HBOB 2KTQA 3LPYA 3ZZZA 4C8MA 4KHMA 4F3MA 1DHMA 1OQ6A 1S99A 4MKAA 4NLDA 3DHWC 4DL6A 1N32F 1HWLA 4DMZA 3DLGB 3IGNA 1Q4RA 4Y34A 2HNYB 2W9BB 5J2NA 1DZ5A 2DVIA 2HMIB 4CIOA 2UUCF 3DLGA 5E33A 1SL1A 2RRBA 2HNYA 4HDGA 2AF6A 4OX6A 4RNMA 2HMIA 3FRYA 4OI4A 5EWGA 2HS0A 2QLWA 2FD2A 3K5MA 4HI2A 3TI0A 2AGOA 1VFJA 3NP5A 3OLAA 2XWYA 5KFIA 3JSYA 4C2MA 3NS5A 3RR7A 4M1KA 1T03A 2BM1A 2E9TA 4DG1A 2R7XA 3KNGA 4PG6A 4FF3A 4NMLA 3MDFA 4F26A 3EZUA 3G71S 4OZ0A 1N34F 1JLCB 1RISA 2K7JA 3IS9B 3MAHA 2IVFB 1HFEL 4LF8F 4K4ZA 3U27A 2G13A 1CEZA 2IM0A 3QLHB 1JLCA 4WFAQ 2VBWA 1DJ0A 2WBRA 2XZWA 1U24A 2YNHA 2ZFHA 3CT9A 3NBPA 3QLHA 5AJ3F 1WHWA 4I6AA 3BO4A 4K4UA 1F2GA 3CDUA 1SKRA 3D0GE 4FP9A 4B08A 3PR5B 1KQKA 4U9RA 4TYBA 3TA0A 4X4TA 2YX7A 3NGKA 4Q0BA 4B3MF 4B9LA 1UVKA 4OHWA 2XO7A 2BBEA 2J8AA 4ID5B 1RGVA 4IKAA 4I56A 2FIUA 2FY1A 1LW0A 4YOEA 2B9YA 4CNYA 4Z37A 1JLQA 2HNZB 4CO3A 3ISZA 2GCFA 3TX8A 2DRBA 1SL2A 4B9SA 1M5HA 3FZBA 4JI0F 5DG8A 1HBMB 2HNZA 2PC6A 3KK3A 3BS9A 4OJ1A 4IG0B 1UL3A 2DNNA 3B78A 4CO0A 2MZ1A 4IG0A 4EBDA 2YX4A 2RSQA 5BYRA 2XMKA 4WE1A 1FKPB 4J9LA 1FTCA 3FFIB 2ASLA 2BXJA 3IA0A 1S6QB 2Y0SD 2UUTA 3FFIA 2EFQA 3NCRA 5DLFA 4TY8B 1QE1B 1FRKA 3VAMA 1LWEB 4J9SA 4ATNA 3CF5Q 2VH7A 2XBPA 1KQFB 4Q43A 1JJ4A 1LWEA 1KN6A 3MUTP 5B0GA 3ZZ0A 4EBEA 1Y4ZB 5A2QY 2CQ2A 3LP1B 3BZQA 4G1PA 1V3SA 4HEA9 1HHTP 3FEXB 4ILRA 2COLA 2J9DA 1CPZA 2ZH4A 1BD6A 2YVSA 3D1OA 3K8WA 3CSKA 2ILYA 2J9EA 1MMLA 1I6JA 1VRUB 2B7BB 4HTJA 1SH0A 2PMZD 5KFUA 2FJDB 1HNXF 1KONA 3O1LA 1EP4A 5T14A 3QGPA 2DNZA 2ZC4A 4FN5A 3CCQS 2DNMA 2MKCA 4NL5A 4PXDA 3OL7A 3G8TA 4L72B 2RQMA 1PSDA 1TKZB 4MYUA