1AWBA

Human myo-inositol monophosphatase in complex with d-inositol-1-phosphate and calcium
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Enzyme-Substrate Complex and the Catalytic Mechanism of Human Brain Myo-Inositol Monophosphatase
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords MYO-INOSITOL MONOPHOSPHATASE
total genus 85
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1awbA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1awbA02
4H46A 1YZ0A 1KZ8A 3B8BA 1FPLA 4G61A 1AWBA 4HE0A 4GX6A 1NV4A 1NV6A 4H45A 3A29A 2JJKA 2Q74A 4GWXA 2F3BA 1IMFA 5EYGA 2WBBA 3RPLB 4HE2A 5EQ9A 2WBDA 1DBZA 5IZ3A 1K9ZA 2FVZA 1FPKA 1FJ9A 3LUZA 1YYZA 2P3NA 2VT5A 1LBXA 4GWWA 3ROJA 1EYKA 1NV3A 3T0JA 2FIXA 4GWZA 4FBPA 1FBCA 1FPDA 1FSAA 4GX4A 4KXPA 1JP4A 5I3SA 2F3DA 1DCUA 1FBFA 1IMBA 1LBVA 4HE1A 1IMAA 2R8TA 1NV0A 1NV5A 5FBPA 4IR8A 1QGXA 2QVRA 5DW8A 1NUYA 5EYHA 2QVVA 1NV2A 2GQ1A 2HHMA 5EQ7A 5EQ8A 3QMFA 1KA0A 4N81A 1YXIA 1DK4A 5J16A 1FPGA 1FPJA 1BK4A 1Q9DA 4GWSA 4I40A 5IZ3B 1LBYA 2BJIA 5ET5A 1NUWA 2OWZA 3KC0A 4HXVA 1SPIA 3LV0A 1NV1A 1IMDA 1IMEA 2DDKA 5T3JA 1EYJA 1NUXA 4O7IA 1FBGA 2Q8MA 5A5LA 4AS4A 5ET6A 1G0HA 3RPLA 3RYDA 3IFAA 2FHYA 2Y5KA 3BIHA 1KA1A 1FBEA 5ET8A 1NI9A 1INPA 5LDZA 1EYIA 3FBPA 1FTAA 4I3YA 2Y5LA 3IFCA 5IZ1A 4AS5A 5EQAA 1RDZA 2QVUA 2CZHA 1LEVA 1FRPA 1IMCA 5F24A 2WEFA 4GBWA 2QFLA 1G0IA 2OX3A 3KBZA 4GWUA 4I3EA 5ET7A 2FBPA 1RDYA 1RDXA 2FIEA 3BIGA 1XI6A 1CNQA 4GBVA 4GX3A 4MJOA 1NUZA 1FBPA 1FBHA 2CZIA 1FPFA 1VDWA 1FJ6A 2P3VA 2PCRA 3D1RA 4QXDA 5ESYA 3KC1A 1LBWA 1FPIA 4GWYA 1D9QA 1K9YA 1FPEA 4PTKA 1NV7A 1FBDA 1FPBA 1LBZA 2CZKA
chains in the Genus database with same CATH superfamily
4OVTA 5FTHA 2V93A 2V3UA 2QMWA 4GX6A 3TFLA 1LAFE 5JK4A 3TQLA 3V8XB 4I8CA 3HHGA 1B1HA 1IXHA 4ELQA 3G3GA 1N3WA 1N3XA 1M5BA 1SBPA 2FVZA 4XXUA 1MY1A 1T0KA 3UA8A 2Q2AA 4MNCA 4OEUA 1B3LA 4FEBA 3OO7A 2QJEA 2LAOA 1L5TA 4F1UA 3E13X 1LGBC 1OQHA 3WAFA 2Q9TA 4F2OA 1NV2A 2F5XA 3HCQA 1OVBA 2Q89A 3S4UA 1B5JA 4PFIA 1MQHA 4LZ5A 5F7VA 4JVIA 4PFRA 5BUUA 1SI1A 1Y4CA 3GYYA 3JV9A 2ZXTA 4P0IA 1UIUA 4EUOA 2QMXA 2Q8MA 3G7WA 3R6UA 1PBQA 4PF8A 3IFAA 5HM4B 1QJMA 2QS4A 2QS2A 5L8DA 1P1WA 3FXBA 3IOUA 4C1TA 4H65A 4AB6A 3KBRA 1PB9A 4KR5A 3JYRA 5HPQA 4OENA 3B6QA 3HFUA 1NUZA 4JVCA 1PDAA 1SDXA 3CG3A 3D1RA 1NL5A 3M3FA 4OVQA 3PPPA 4GXSB 3O28A 4ZZEA 3HV1A 4Q0CA 4XTCQ 2P1SA 1KZ8A 4RY1A 2VGQA 4PFBA 4GRKA 1NV6A 4G4PA 4E0WA 1NKXA 1IMFA 2XXQA 1MXXA 2Y7KA 5F1QA 5DTBA 4NHBA 5CMMA 5H8NA 5I58B 3TTMA 4KD5A 1LCFA 4DZ1A 1QW0A 3S2VA 3HO7A 4F3BA 5FHNA 3KZGA 1FBCA 1JP4A 4GVOA 4C0RA 4ZZAA 1IMBA 2QRYA 2DOJA 3DM0A 4U4XA 1NV5A 2Z22A 4IR8A 5DW8A 2UVIA 3TKDA 1B46A 1YAEA 2AIXA 1JEUA 3KGCA 2BJIA 2P2AA 4LZ7A 2G29A 4HXVA 1RYOA 4YZZA 4G68B 1TWYA 1DSNA 4KHZE 1EYJA 4PBQA 2KLFA 2PVUA 3ZSFA 5ICTA 3DELB 2RC9A 2WYKA 3OENA 1P1OA 4R6KA 4MCOA 4LONB 1FTAA 2Y5LA 1P1UA 3RTWB 3K2DA 2XX9A 3EF7A 3E9XA 4NQ8A 3ISPA 1A40A 4GBWA 4RPNA 3SKPA 1IITA 1OVTA 2F7BA 2VP1A 3Q25A 4N8YA 1Z7ME 4N07A 2XX7A 4POWA 4QSCA 3GXAA 2QSXA 2IA4A 4NF5B 4XEQA 4OQOA 5DVFA 3KN7A 4BDQA 4ZEKA 3FJMA 2F3BA 4YMAA 2H9BA 3G3IA 4OYVA 3PPQA 4KFQA 1FBFA 3FGSA 2REJA 3OMBA 2VHAA 3BFTA 3T96B 1UIVA 4RK9A 3H3GA 1B3EA 4IO7A 5TPAB 2Z8EA 1IZ1A 4I1DA 5J16A 1Q9DA 1O63A 3MZ1A 1H44A 2XWIA 1UTBB 3IOWA 3LSLA 5LDZA 5LOMA 4O94A 3IFCA 3B7DA 3SETA 4AS5A 1O64A 4N17A 4EF1A 1MPDA 1Y1MA 2DXRA 2UVGA 3MBPA 3UK4A 4I3EA 5TU0A 3KFMA 4N91A 4JWYA 1JVXA 1NNPA 3MWBA 2DP8A 4MHFA 3IORA 3Q28A 1K9YA 3MZ9A 3G3HA 4PTKA 2ZNSA 1B5HA 1M5FA 4MLQA 4JWOA 1URSA 4DI4B 4QSEA 4HS7A 3VFJA 4DIGA 3H7MA 3UP9A 4MNPA 2MKZA 4MX6A 4HW8A 3C31A 4K3FA 4R74A 2THIA 5I56A 4PGPA 3TCFA 4NTLA 4KPTA 5EYFA 5JTYB 5DVJA 4PAFA 3N94A 4BDMA 2YJPA 3RUMA 3BFUA 3K1PA 1LCTA 3U1OA 1I6BA 2GQ1A 2DQVA 3RT6B 1N7WA 4ZE9A 3TEPA 4MF3A 2P0SA 4N81A 4R72A 1NMUA 4X1DA 1A7LA 3BKIB 2OCUA 1QKBA 4MEVA 5I57A 3QUJA 3RNNA 2XXPA 3TYHA 4XKNA 5I59A 2FHYA 3BIHA 1NI9A 3CFLA 3QAXA 3USDA 5I2NA 1B7UA 4UACA 2D21A 1FCKA 3TUSA 3KJ7A 3T22A 2HZKA 4GWUA 3FV2A 1N0TA 1GV8A 1FQFA 1ZIUA 3AXFA 3PV0E 2DE3A 3TZAA 2HQ0A 1FPBA 3H6UA 3U92A 5FHOA 3ECRA 4G77A 2KQZA 3KN3A 4ESWA 3HHFA 4OA4A 3LSFB 3IR1A 4GWXA 2GHBA 1MDP1 3EHUA 3PMXA 3T93B 4YB6A 2VD3A 1B6HA 3TTNA 3VXBA 2HZLA 2ZNTA 2F36A 4YU0A 3T0JA 4H67A 4WEDA 1MXYA 2E0SA 1QULA 4Q8RA 1HSLA 4JSOA 5FBPA 2O7IA 1QGXA 1UQWA 3GBBA 1OLCA 5EQ7A 3IL1B 4LA9A 2DSFA 1B1XA 1LBBA 4DCXA 4MMPA 1FPGA 2CEXA 4NN3A 2OWZA 3KC0A 4PF6A 1M5EA 3OD7A 4KCDA 3H6VA 5KCJB 5T3JA 5TPAA 4RK2A 3C32A 3N6TA 1VR5A 1IUDA 4EQBA 5AA2A 4H5FA 3T9UA 2IEEA 2O6AA 1J1NA 4PE3A 4F19A 3K6XA 1QUJA 2ONSA 5AA2D 4IO4A 3H6WA 4DI3D 1MH4A 5F24A 4H5GA 3SEUA 3H4ZA 3B6WA 1G0IA 4G8HA 4GX3A 1ATGA 1DOTA 3HN0A 5AE4A 3G3KA 4U1OA 1A99A 4BDLA 1B2HA 4X48A 4O8MA 2VOZA 3R7XA 3PD8A 1NV7A 1LBZA 4Q5TA 2B4MA 3RPWA 3G3FA 1O7TA 3PUVE 4O3AA 1NV4A 4OMBA 3GBAA 4C1UA 1SW2A 3UIFA 3RN8A 4F1YA 3WAEA 4PFYA 2XD3A 2I3VA 4KQPA 3A3UA 1NNKA 5CMCA 1MY4A 2NOOA 4GWWA 4LQ2A 2FNCA 4X1BA 1KWHA 2OLBA 3MSTA 3MVWA 1FQDA 4DDDA 2X7QA 1MXVA 5A5XA 1R9QA 4XF5A 4IO6A 2PMSA 5JTYA 1BLFA 4NF4A 1NUYA 5CMBA 1S7YA 3BBRA 2XXUA 4KYEA 4O3CA 4ISUA 3SERA 1DTGA 3EHTA 4P47A 1FTJA 2B3FA 2FA7A 3MC2A 3OO8A 1EZPA 4P56A 3KOSA 3TTLA 5IKBA 5DEXB 5L9SA 1GVCA 1N04A 4NAPA 4ZDMA 1EYIA 2AYSA 3KG2A 1LFGA 1JNFA 3VVFA 2Y7PA 1DMBA 2XXWA 5ET7A 2D5WA 2XXHA 3CG1A 4GBVA 3N5LA 3KSJA 4TQUQ 4DXUA 1JQFA 4XIGQ 2I3WA 4DCYA 3FXRA 4R6HA 1MS7A 2R6GE 2I48A 3O6GA 2RC7A 2DWIA 4PCDA 2I6EA 2GHAA 5ISUA 5IAIA 1HSEA 5IZ3A 3QSLA 4G68C 3K6UA 3PPRA 3U93A 2D3IA 3RT8A 2Y7IA 3M8UA 3VVEA 4F22A 4LUBA 4YB5A 2CMOA 2PT1A 2M8CA 5AA2B 3TDJA 1URDA 2REGA 2ZYKA 2VT5A 5ITPA 1XHYA 3HPIA 4KYDA 3ROJA 2I58A 3MPLA 3IB1A 2KR0A 4R9GA 1N84A 2XWVA 4M1VA 4KXPA 4OVPA 1SVXB 1SW1A 3EKIA 4OVRA 3QMFA 3ODBA 1KA0A 5L9OA 4MFIA 1ANFA 2HXRA 4YB7A 1IMEA 2ONKE 4IO3A 1B4HA 3FD3A 3O29A 1ELJA 1A8EA 4ONYA 4N8GA 2Y5KA 3O66A 3DP8A 3TMGA 3S9EA 1P99A 5KCJA 3KN8A 1TFAA 3V89B 2CZHA 5K2YA 1H45A 4NEDA 1IMCA 2ZZXA 1LFHA 2XXTA 3MQ9A 3MZBA 3LR1A 1LLSA 2NVUB 1FBHA 5I7IA 4NF4B 2I4BA 1LB8A 3OOAA 4WKMA 3CHGA 4OERA 1FQCA 2ZYNA 4TLMB 3ZKLA 4U23A 2PFZA 4P3LA 4I62A 2HAVA 3TAJA 4G61A 2PFYA 3VXCA 2UYFA 3A29A 5KDTA 3HSTA 2OPDA 4H6DA 2V84A 5A5XB 5FTIA 3LUZA 4OEVA 1B0LA 3PPOA 4R73A 2UVHA 1AIVA 1A54A 1XT8A 5I3SA 4MH5A 4OETA 4IGTA 4O3BA 3L6HA 1NV0A 3DP4A 2F97A 4JB7A 1B4ZA 1YTVA 1Y9UA 1Y4TA 5EYHA 2PYYA 2O51A 1PC3A 1H76A 1I6QA 1ZTYA 3RTFB 4QF9A 4IY6A 1LBYA 1MRPA 1SPIA 3I5OA 3LSXA 4R2FA 3W9WA 3PUYE 3W15C 1NUXA 5IGAA 1CE2A 4PAIA 4P8BA 3K00A 1KA1A 2ANJA 3M3LA 2V4CA 3LUYA 1FTKA 3FJGA 1RDZA 4NE4A 4G8MA 5DVIA 3SEYA 2B4LA 1B3GA 1M5CA 1OIBA 5H8SA 2QFLA 3KBZA 3S9LC 1AH5A 2PT2A 4FEDA 4P9KA 2XXKA 3SZPA 1FPIA 4GIZA 3PU5A 1FBDA 3C35A 1DPEA 2I0CA 5L9MA 2VPOA 1AOVA 3NOHA 1AWBA 5AA3A 1H43A 5TP9A 4THIA 4H45A 1EZ9A 2WBBA 5IZZA 2OJTA 1K9ZA 3C36A 4F1VA 1LBXA 1OLAA 5CI5A 4GXAA 4RPOA 2NWJA 2FIXA 1VE4A 3PUXE 1II5A 4WEPA 1MXZA 2G93A 2DXYA 4NF6B 2Z8FA 4P0GA 5DT6A 1ZBMA 3MUQA 4QSDA 4F29A 4LATA 4MIJA 4DLDA 4BDNA 1YPNA 4OFOA 4NF8A 5H8FA 3EQ1A 4N4UA 2DE2A 3ILTB 2QS1A 1R1NA 2DWAA 1USYE 3Q29A 3THIA 1NV1A 3C4MA 3EN3A 3FVGA 3QXMA 4PFTA 3Q26A 1BIYA 4NWDA 5ET6A 1PB7A 3I6VA 5CMKA 1FBEA 5I56B 1QVSA 3MPKA 3FZVA 1D3KA 3FXUA 3T9HB 5I84A 3MYUA 1SW4A 1D4NA 2A5SA 2RINA 1LBCA 2QS3A 2OPEA 3PMWA 1LEVA 2DWHA 1FRPA 4ZEBA 3MP1A 3IK6B 1QKAA 2OK2A 4PGNA 2F35A 3IJOB 1MY0A 4KYSA 4OANA 4GLIA 4EF2A 4QXDA 3CFZA 3K1MA 1FW0A 2YPNA 5CBRA 3O6HA 2RF1A 3TELA 1OMPA 3IB0A 5I57B 4LN5A 2JJKA 3C34A 3VLWA 1LAXA 4RYAA 5ICQA 4R6YA 2Y7RA 1XS5A 5LTCA 3FJ7A 3FVNA 4ZEIA 2V25A 4JDFA 3UN6A 1MM6A 4HE1A 1B32A 1WDNA 2R8TA 3EPEA 2Q2CA 3PUZE 1JW4A 1Y3NA 2DE4A 2XX8A 1AMFA 3OO9A 1R9LA 3P7IA 1D9YA 3RGYA 2FYIA 1B51A 3OO6A 5ITOA 4FORA 5I2NB 1FBGA 4N15A 1B0HA 3IB2A 2DWJA 1Y3QA 4GQOA 1MM7A 1G0HA 3RPLA 2RCBA 2VPNA 3T9XB 2DVCA 4ELOA 1INPA 3A3CA 4I3YA 3T1BA 3QK6A 1POY1 1Y3PA 3SEWA 1B3FA 4U2RA 3MP8A 3VV5A 1BP5A 4F31B 4XFEA 2HFBA 5ELVA 3U72A 5AA4B 2FIEA 4GD5A 4YICA 5H8HA 2ZMBA 3CIJA 2O69A 3LSWA 4ESXA 1MG1A 2O84X 1SD3A 2PX1A 4WXJA 3CI8A 3RLFE 1JW1A 4H46A 1YZ0A 5CRYA 1BKAA 1FTOA 2O7UA 4RNSA 1MPBA 3PPNA 3FUZA 2Q74A 3IO4A 2QL3A 1XVYA 1A55A 4U4SA 2ONRA 4PFWA 3I3VA 3N6UA 1Z7NE 4OHNA 5BWJA 2F34A 3N26A 4KCCA 5H8FB 4E0XA 1OQGA 1SQYA 4OVSA 3OSRA 4GWOA 3C9HA 3B50A 4QHQA 1USYH 2HHMA 4X9TA 2X7PA 3O2AA 4F3SA 5EQ8A 3S9MC 3PGFA 1I69A 1FPJA 2XXIA 3U65A 2V3TA 5M2VA 3IJXB 3G3JA 2DDKA 4HCWA 1M5DA 5EHSA 3E78A 2HEUA 2F8DA 3IOVA 3FIRA 3RYDA 1PBPA 1MY3A 4NMYA 4EXKA 3VLUA 5CBSA 4LP2B 2NXOA 1MQGA 3S9NC 5I5PA 1YCJA 5DYHA 2OWSA 1LFIA 1B7HA 2Y84A 2WEFA 2BJJX 4YKIA 4NF6A 2UYEA 1US4A 2XHDA 3FV1A 4IO2A 1AL3A 3OEKA 2CZIA 1FPFA 5ESYA 1B05A 3MVXA 5CM6A 1LBWA 2GFEA 4GWYA 2GH9A 1D9QA 5JEIA 3D4GA 4QFOA 4FATA 2O1MA 2ZZWA 5IM2A 4EQ7A 4NX1A 1DPPA 2Y7WA 3B8BA 1URGA 3PUWE 2RC8A 1SYIA 2ESNA 4G68A 4ECFA 5H8NB 3VDFA 4RJZA 1MPCA 4JWXA 5AA1A 4X04A 2B65A 5DEXA 4HTGA 4HE2A 2NUVA 3K6WA 4XKPA 1DBZA 3K4UA 1QUIA 4G8NA 4Z0IA 1FPKA 4ZECA 4O7MA 2P3NA 3K1NA 1B7ZA 4PFUA 2XXRA 3IX1A 1SW5A 1FPDA 3ZKKA 2WX9A 1LBVA 4YKJA 2XXXA 2I0BA 2F7CA 2QVVA 1YXIA 1EH3A 5IZ3B 3QYTA 3K01A 1RYXA 3V83A 4L17A 4Q30B 3FVKA 4OXVA 3SEXA 4QFPA 1R6ZA 1IXIA 3T66A 4IO5A 5I58A 4ZE8A 1VFDA 1IEJA 1PEBA 4FJPA 3IAZA 1EZOA 3MVYA 1XOCA 1RDYA 1TT1A 3BIGA 2A5TB 1XI6A 2I4CA 4MJOA 3QIMA 2H5YA 1VDWA 2PCRA 4P11A 3TCGA 2H98A 2L5VA 3M3KA 3O9PA 2W7YA 4AB5A 5AA4A 1FPEA 1IQ7A 4F3GA 2AL5A 2DVZA 3O6IA 3VLVA 5B70A 3FXQA 2I49A 1LAHE 3VVDA 2HPGA 4LVQA 4BDRA 4BLAA 1B3HA 1S9TA 4H1XA 1FJ9A 1ZKBA 1NV3A 1Q35A 4GWZA 1FSAA 2R71A 4LZ8A 1Q1KA 3FATA 3CSBA 2DS9A 5H8HB 1FTLA 5H8QA 5I2KB 4ZEDA 3W9VA 4XKRA 4JBZA 1S50A 1Y20A 1NH7A 3DLNA 1BK4A 4GWSA 1ZJLA 4I40A 2O1LA 4ZEFA 4PETA 4QFKA 4QBAA 1B40A 4O7IA 3EHSA 3E79A 4YKKA 3PD9A 4QRZA 3K6VA 3ZS6A 4R2BA 2PBWA 4M4GA 4DXCA 4PP0A 5ET8A 3FBPA 1BTJA 4ZS9A 5IZ1A 2Q8JA 1UTBA 2Z8DA 3H06B 4JSDA 3KSXA 2OX3A 4R9FA 3E4RA 1RDXA 1B9JA 2WKYA 3PTYA 4PAKA 5FHMA 1FQAA 4H8IA 4FE8A 4IY5A 3TTRA 2ABHA 4DE8A 1MXUA 2QVRA 4PBHA 5KDTB 4NF0A 1Y1ZA 3MVZA 3D4CA 3IO6A 3E3KA 4OFLA 4KI0E 1IXCA 1VFEA 3CVGA 5I59B 1MQDA 4FECA 3GLBA 3H03A 4N6PA 1TFDA 2O68A 2XD2A 1EYKA 3ILUB 1ZU0A 2CZLA 4FBPA 4GX4A 4JXIA 3U8QA 3V5AA 1RKMA 4OFJA 4GF8A 4N6DA 1P1NA 4GOTA 1UTHB 2XWOA 1I6AA 4F2QA 1LSTA 1SYHA 3TTKA 4R75A 1NH8A 3MJNA 4F18A 4AQ4A 4NWCA 5TP9B 4I9DA 3RQTA 1GR2A 4H8JA 4LQ5A 4GFRA 2HCAA 4OZ9A 3TCHA 3CSGA 4YMBA 2XA5A 4BDOA 4NGUA 2FBPA 4JVDA 3LBSA 1IIWA 1ZMGA 4MBPA 2H4IA 4PQJA 3U94A 4RA1A 2Q88A 3ONMA 1DTZA 3TODA 3UORA 3KOTA 4Z7EA 4HCYA 3CRBA 1HSJA 1MQJA 4PDHA 1FPLA 1WODA 1FTMA 2E1SA 2RCAA 4N13A 2WBDA 2F78A 1FQEA 4TLLB 3CFXA 4FAJA 4MLVA 3SDFA 1PB8A 1B58A 4EDPA 3O97A 4U1ZA 2A5TA 4NF8B 2DYXA 2F6GA 4GL8A 4POXA 1P1QA 2OWTA 4P1LA 3CR9A 3OELA 2ALUA 5HBCA 1A8FA 1XC1A 4YAHX 1B5IA 4FIMA 1IXGA 5ET5A 3JZJA 1NUWA 5I2KA 3LV0A 1MY2A 1IMDA 3KJTA 3T9VA 2GRVA 2V3QA 4G2ZA 1NNFA 1US5A 4OESA 4AS4A 1JETA 1B52A 1WVJA 3L6GA 4H0WA 3MAMA 5K2XA 3FASA 1LB9A 2CEYA 5EQAA 2QVUA 2F6PA 4RXLA 1N7XA 2UXAA 1JVYA 2ZNUA 4OWDA 1CB6A 2XXVA 1F9BA 2UVJA 4UABA 1CNQA 5H8QB 2B3BA 2ZYOA 4GL0A 1MDQA 3A09A 1JW5A 2ZYMA 4TOZA 2CZKA 4OVJA 4MAGA 2QPQA 2RKMA 1EU8A 4HE0A 4N6KA 3LC8A 2OBGA 5B7DA 2HAUA 4NG7A 5EYGA 3RPLB 5EQ9A 1GGGA 3GZGA 1LAGE 4QFNA 3PMVA 4X8RA 1N76A 4IGRA 1GTKA 1YYZA 3OXNA 4QFLA 4PC9A 1MH3A 4ELPA 4ND9A 4UA8A 2F7AA 4U22A 1JEVA 3Q27A 2F3DA 1DCUA 2H25A 3KEIA 3TQWA 4XKQA 1ZLQA 3F11A 4YKPA 2YLNA 1IMAA 3UGWA 5KZTA 4IB2A 3IOTA 1NFTA 3SEVA 3RY3A 4DXBA 1POTA 2R9JA 1DK4A 4MNIA 1UTHA 1MXWA 4NF5A 3K02A 4OTEA 3R26A 1H3DA 3MP6A 2HXWA 3B6TA 4U21A 4PDDA 3TPAA 5A5LA 2XWKA 2XXYA 3QUFA 2VD2A 5J1DA 4EQ9A 4PE5B 3MW0A 1MQIA 4ELRA 3C33A 3SESA 2WYPA 3FVOA 3H6TA 5CC2A 1VSOA 1TXFA 2OZZA 2AL4A 2ZZVA 3OSQA 1NNTA 2H99A 1FBPA 1FQBA 1XVXA 1QUKA 4P1EA 1FJ6A 2X26A 2P3VA 3KC1A 3VE1B 4F3PA 4EXLA 1SI0A 4F39A 3K0VA 3DP6A 5EHMA 3OEMA 2Z23A 1D9VA
chains in the Genus database with same CATH topology
4H46A 4XEQA 2PFZA 4PBHA 2B4MA 4MAGA 4P3LA 1YZ0A 4NX1A 4NF0A 4OVTA 4DI4B 2KQZA 4PDHA 2QPQA 1KZ8A 3B8BA 2VPOA 1FPLA 3NOHA 4OA4A 4G61A 1AWBA 4HE0A 4GX6A 2DVZA 2PFYA 4N6KA 4PFBA 1NV4A 4LN5A 1NV6A 4H45A 3A29A 5JK4A 2JJKA 4MNPA 2MKZA 4NG7A 2Q74A 4MX6A 4X04A 4GWXA 2F3BA 1IMFA 5EYGA 2WBBA 3RPLB 4HE2A 2HPGA 5EQ9A 2WBDA 5IZZA 1DBZA 5LTCA 5IZ3A 4NHBA 1K9ZA 4X8RA 2FVZA 4F1VA 4PGPA 1FPKA 1FJ9A 3LUZA 1YYZA 4O7MA 2P3NA 2VT5A 1LBXA 4PC9A 2HZLA 4GWWA 3ROJA 4MNCA 2KR0A 1EYKA 1NV3A 3T0JA 2XWVA 2FIXA 3MSTA 4PAFA 4GWZA 4FBPA 1FBCA 1FPDA 1FSAA 4GX4A 4M1VA 4KXPA 1JP4A 5I3SA 2F3DA 1DCUA 1FBFA 4OVPA 2ZZWA 1IMBA 2WX9A 4N6DA 1LBVA 4HE1A 4XF5A 4F1UA 3EKIA 1IMAA 4OVSA 2R8TA 1NV0A 1NV5A 5FBPA 2XWOA 4IR8A 1QGXA 2QVRA 5DW8A 1NUYA 3W9VA 5EYHA 2QVVA 2Q9TA 4OVRA 3B50A 1NV2A 2F5XA 4MIJA 2GQ1A 2HHMA 5EQ7A 4P1LA 4X9TA 4YICA 2DE4A 5EQ8A 3QMFA 1KA0A 4N4UA 4N81A 1YXIA 1DK4A 2DE2A 4MNIA 4PFIA 4NGUA 4MMPA 5J16A 1FPGA 1FPJA 1BK4A 2CEXA 1Q9DA 4GWSA 4NN3A 4I40A 5IZ3B 1LBYA 2BJIA 5ET5A 4JVIA 4PFRA 3U65A 1NUWA 2OWZA 3KC0A 4HXVA 2HXRA 1SPIA 3LV0A 4MEVA 1NV1A 1IMDA 4PETA 4PF6A 4F18A 1IMEA 2DDKA 3GYYA 4HCWA 4P47A 4QBAA 5T3JA 4YZZA 3W9WA 1EYJA 2V3QA 4PBQA 4P56A 4PDDA 1NUXA 4O7IA 1FBGA 2Q8MA 5A5LA 2XWIA 4AS4A 2XWKA 3E79A 4N15A 2WYKA 3E78A 5ET6A 4PAIA 1G0HA 4P8BA 4N8GA 4PF8A 3RPLA 3RYDA 5J1DA 3IFAA 2VPNA 2FHYA 2Y5KA 3BIHA 1KA1A 1FBEA 4MCOA 5IGAA 5ET8A 1NI9A 1INPA 4NAPA 5LDZA 1EYIA 3FBPA 2CEYA 1FTAA 4I3YA 4O94A 2Y5LA 3IFCA 2V4CA 3T1BA 5IZ1A 2WYPA 4AS5A 3MYUA 5EQAA 1RDZA 3FXBA 4PE3A 4F19A 5I5PA 4N17A 2QVUA 2CZHA 2B4LA 1LEVA 4DI3D 1FRPA 4NQ8A 1IMCA 5F24A 2WEFA 2ZZXA 4GBWA 2QFLA 3ISPA 4XFEA 2XA5A 1G0IA 2OX3A 3KBZA 4GWUA 4I3EA 5ET7A 2FBPA 2HZKA 2ZZVA 4JVDA 4N91A 1RDYA 1RDXA 2FIEA 3BIGA 1XI6A 3HFUA 4PGNA 1CNQA 4GBVA 4GX3A 4MJOA 4UABA 1NUZA 1FBPA 4JVCA 1FBHA 2CZIA 3PTYA 4MHFA 1FPFA 4OANA 1VDWA 4P1EA 1FJ6A 4P9KA 4PAKA 5I7IA 2P3VA 2PCRA 3D1RA 4QXDA 5ESYA 3KC1A 2DE3A 2XXKA 1LBWA 3SZPA 4N8YA 4O8MA 4OVQA 1FPIA 2L5VA 5CM6A 4GWYA 1D9QA 1K9YA 1FPEA 3CHGA 4PTKA 4PCDA 1NV7A 1FBDA 1FPBA 4HCYA 1LBZA 2CZKA 5IM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H46 A;  1YZ0 A;  1KZ8 A;  3B8B A;  1FPL A;  4G61 A;  1AWB A;  4HE0 A;  4GX6 A;  1NV4 A;  1NV6 A;  4H45 A;  3A29 A;  2JJK A;  2Q74 A;  4GWX A;  2F3B A;  1IMF A;  5EYG A;  2WBB A;  3RPL B;  4HE2 A;  5EQ9 A;  2WBD A;  1DBZ A;  5IZ3 A;  1K9Z A;  2FVZ A;  1FPK A;  1FJ9 A;  3LUZ A;  1YYZ A;  2P3N A;  2VT5 A;  1LBX A;  4GWW A;  3ROJ A;  1EYK A;  1NV3 A;  3T0J A;  2FIX A;  4GWZ A;  4FBP A;  1FBC A;  1FPD A;  1FSA A;  4GX4 A;  4KXP A;  1JP4 A;  5I3S A;  2F3D A;  1DCU A;  1FBF A;  1IMB A;  1LBV A;  4HE1 A;  1IMA A;  2R8T A;  1NV0 A;  1NV5 A;  5FBP A;  4IR8 A;  1QGX A;  2QVR A;  5DW8 A;  1NUY A;  5EYH A;  2QVV A;  1NV2 A;  2GQ1 A;  2HHM A;  5EQ7 A;  5EQ8 A;  3QMF A;  1KA0 A;  4N81 A;  1YXI A;  1DK4 A;  5J16 A;  1FPG A;  1FPJ A;  1BK4 A;  1Q9D A;  4GWS A;  4I40 A;  5IZ3 B;  1LBY A;  2BJI A;  5ET5 A;  1NUW A;  2OWZ A;  3KC0 A;  4HXV A;  1SPI A;  3LV0 A;  1NV1 A;  1IMD A;  1IME A;  2DDK A;  5T3J A;  1EYJ A;  1NUX A;  4O7I A;  1FBG A;  2Q8M A;  5A5L A;  4AS4 A;  5ET6 A;  1G0H A;  3RPL A;  3RYD A;  3IFA A;  2FHY A;  2Y5K A;  3BIH A;  1KA1 A;  1FBE A;  5ET8 A;  1NI9 A;  1INP A;  5LDZ A;  1EYI A;  3FBP A;  1FTA A;  4I3Y A;  2Y5L A;  3IFC A;  5IZ1 A;  4AS5 A;  5EQA A;  1RDZ A;  2QVU A;  2CZH A;  1LEV A;  1FRP A;  1IMC A;  5F24 A;  2WEF A;  4GBW A;  2QFL A;  1G0I A;  2OX3 A;  3KBZ A;  4GWU A;  4I3E A;  5ET7 A;  2FBP A;  1RDY A;  1RDX A;  2FIE A;  3BIG A;  1XI6 A;  1CNQ A;  4GBV A;  4GX3 A;  4MJO A;  1NUZ A;  1FBP A;  1FBH A;  2CZI A;  1FPF A;  1VDW A;  1FJ6 A;  2P3V A;  2PCR A;  3D1R A;  4QXD A;  5ESY A;  3KC1 A;  1LBW A;  1FPI A;  4GWY A;  1D9Q A;  1K9Y A;  1FPE A;  4PTK A;  1NV7 A;  1FBD A;  1FPB A;  1LBZ A;  2CZK A; 
#chains in the Genus database with same CATH topology
 4OVT A;  5FTH A;  2V93 A;  2V3U A;  2QMW A;  4GX6 A;  3TFL A;  1LAF E;  5JK4 A;  3TQL A;  3V8X B;  4I8C A;  3HHG A;  1B1H A;  1IXH A;  4ELQ A;  3G3G A;  1N3W A;  1N3X A;  1M5B A;  1SBP A;  2FVZ A;  4XXU A;  1MY1 A;  1T0K A;  3UA8 A;  2Q2A A;  4MNC A;  4OEU A;  1B3L A;  4FEB A;  3OO7 A;  2QJE A;  2LAO A;  1L5T A;  4F1U A;  3E13 X;  1LGB C;  1OQH A;  3WAF A;  2Q9T A;  4F2O A;  1NV2 A;  2F5X A;  3HCQ A;  1OVB A;  2Q89 A;  3S4U A;  1B5J A;  4PFI A;  1MQH A;  4LZ5 A;  5F7V A;  4JVI A;  4PFR A;  5BUU A;  1SI1 A;  1Y4C A;  3GYY A;  3JV9 A;  2ZXT A;  4P0I A;  1UIU A;  4EUO A;  2QMX A;  2Q8M A;  3G7W A;  3R6U A;  1PBQ A;  4PF8 A;  3IFA A;  5HM4 B;  1QJM A;  2QS4 A;  2QS2 A;  5L8D A;  1P1W A;  3FXB A;  3IOU A;  4C1T A;  4H65 A;  4AB6 A;  3KBR A;  1PB9 A;  4KR5 A;  3JYR A;  5HPQ A;  4OEN A;  3B6Q A;  3HFU A;  1NUZ A;  4JVC A;  1PDA A;  1SDX A;  3CG3 A;  3D1R A;  1NL5 A;  3M3F A;  4OVQ A;  3PPP A;  4GXS B;  3O28 A;  4ZZE A;  3HV1 A;  4Q0C A;  4XTC Q;  2P1S A;  1KZ8 A;  4RY1 A;  2VGQ A;  4PFB A;  4GRK A;  1NV6 A;  4G4P A;  4E0W A;  1NKX A;  1IMF A;  2XXQ A;  1MXX A;  2Y7K A;  5F1Q A;  5DTB A;  4NHB A;  5CMM A;  5H8N A;  5I58 B;  3TTM A;  4KD5 A;  1LCF A;  4DZ1 A;  1QW0 A;  3S2V A;  3HO7 A;  4F3B A;  5FHN A;  3KZG A;  1FBC A;  1JP4 A;  4GVO A;  4C0R A;  4ZZA A;  1IMB A;  2QRY A;  2DOJ A;  3DM0 A;  4U4X A;  1NV5 A;  2Z22 A;  4IR8 A;  5DW8 A;  2UVI A;  3TKD A;  1B46 A;  1YAE A;  2AIX A;  1JEU A;  3KGC A;  2BJI A;  2P2A A;  4LZ7 A;  2G29 A;  4HXV A;  1RYO A;  4YZZ A;  4G68 B;  1TWY A;  1DSN A;  4KHZ E;  1EYJ A;  4PBQ A;  2KLF A;  2PVU A;  3ZSF A;  5ICT A;  3DEL B;  2RC9 A;  2WYK A;  3OEN A;  1P1O A;  4R6K A;  4MCO A;  4LON B;  1FTA A;  2Y5L A;  1P1U A;  3RTW B;  3K2D A;  2XX9 A;  3EF7 A;  3E9X A;  4NQ8 A;  3ISP A;  1A40 A;  4GBW A;  4RPN A;  3SKP A;  1IIT A;  1OVT A;  2F7B A;  2VP1 A;  3Q25 A;  4N8Y A;  1Z7M E;  4N07 A;  2XX7 A;  4POW A;  4QSC A;  3GXA A;  2QSX A;  2IA4 A;  4NF5 B;  4XEQ A;  4OQO A;  5DVF A;  3KN7 A;  4BDQ A;  4ZEK A;  3FJM A;  2F3B A;  4YMA A;  2H9B A;  3G3I A;  4OYV A;  3PPQ A;  4KFQ A;  1FBF A;  3FGS A;  2REJ A;  3OMB A;  2VHA A;  3BFT A;  3T96 B;  1UIV A;  4RK9 A;  3H3G A;  1B3E A;  4IO7 A;  5TPA B;  2Z8E A;  1IZ1 A;  4I1D A;  5J16 A;  1Q9D A;  1O63 A;  3MZ1 A;  1H44 A;  2XWI A;  1UTB B;  3IOW A;  3LSL A;  5LDZ A;  5LOM A;  4O94 A;  3IFC A;  3B7D A;  3SET A;  4AS5 A;  1O64 A;  4N17 A;  4EF1 A;  1MPD A;  1Y1M A;  2DXR A;  2UVG A;  3MBP A;  3UK4 A;  4I3E A;  5TU0 A;  3KFM A;  4N91 A;  4JWY A;  1JVX A;  1NNP A;  3MWB A;  2DP8 A;  4MHF A;  3IOR A;  3Q28 A;  1K9Y A;  3MZ9 A;  3G3H A;  4PTK A;  2ZNS A;  1B5H A;  1M5F A;  4MLQ A;  4JWO A;  1URS A;  4DI4 B;  4QSE A;  4HS7 A;  3VFJ A;  4DIG A;  3H7M A;  3UP9 A;  4MNP A;  2MKZ A;  4MX6 A;  4HW8 A;  3C31 A;  4K3F A;  4R74 A;  2THI A;  5I56 A;  4PGP A;  3TCF A;  4NTL A;  4KPT A;  5EYF A;  5JTY B;  5DVJ A;  4PAF A;  3N94 A;  4BDM A;  2YJP A;  3RUM A;  3BFU A;  3K1P A;  1LCT A;  3U1O A;  1I6B A;  2GQ1 A;  2DQV A;  3RT6 B;  1N7W A;  4ZE9 A;  3TEP A;  4MF3 A;  2P0S A;  4N81 A;  4R72 A;  1NMU A;  4X1D A;  1A7L A;  3BKI B;  2OCU A;  1QKB A;  4MEV A;  5I57 A;  3QUJ A;  3RNN A;  2XXP A;  3TYH A;  4XKN A;  5I59 A;  2FHY A;  3BIH A;  1NI9 A;  3CFL A;  3QAX A;  3USD A;  5I2N A;  1B7U A;  4UAC A;  2D21 A;  1FCK A;  3TUS A;  3KJ7 A;  3T22 A;  2HZK A;  4GWU A;  3FV2 A;  1N0T A;  1GV8 A;  1FQF A;  1ZIU A;  3AXF A;  3PV0 E;  2DE3 A;  3TZA A;  2HQ0 A;  1FPB A;  3H6U A;  3U92 A;  5FHO A;  3ECR A;  4G77 A;  2KQZ A;  3KN3 A;  4ESW A;  3HHF A;  4OA4 A;  3LSF B;  3IR1 A;  4GWX A;  2GHB A;  1MDP 1;  3EHU A;  3PMX A;  3T93 B;  4YB6 A;  2VD3 A;  1B6H A;  3TTN A;  3VXB A;  2HZL A;  2ZNT A;  2F36 A;  4YU0 A;  3T0J A;  4H67 A;  4WED A;  1MXY A;  2E0S A;  1QUL A;  4Q8R A;  1HSL A;  4JSO A;  5FBP A;  2O7I A;  1QGX A;  1UQW A;  3GBB A;  1OLC A;  5EQ7 A;  3IL1 B;  4LA9 A;  2DSF A;  1B1X A;  1LBB A;  4DCX A;  4MMP A;  1FPG A;  2CEX A;  4NN3 A;  2OWZ A;  3KC0 A;  4PF6 A;  1M5E A;  3OD7 A;  4KCD A;  3H6V A;  5KCJ B;  5T3J A;  5TPA A;  4RK2 A;  3C32 A;  3N6T A;  1VR5 A;  1IUD A;  4EQB A;  5AA2 A;  4H5F A;  3T9U A;  2IEE A;  2O6A A;  1J1N A;  4PE3 A;  4F19 A;  3K6X A;  1QUJ A;  2ONS A;  5AA2 D;  4IO4 A;  3H6W A;  4DI3 D;  1MH4 A;  5F24 A;  4H5G A;  3SEU A;  3H4Z A;  3B6W A;  1G0I A;  4G8H A;  4GX3 A;  1ATG A;  1DOT A;  3HN0 A;  5AE4 A;  3G3K A;  4U1O A;  1A99 A;  4BDL A;  1B2H A;  4X48 A;  4O8M A;  2VOZ A;  3R7X A;  3PD8 A;  1NV7 A;  1LBZ A;  4Q5T A;  2B4M A;  3RPW A;  3G3F A;  1O7T A;  3PUV E;  4O3A A;  1NV4 A;  4OMB A;  3GBA A;  4C1U A;  1SW2 A;  3UIF A;  3RN8 A;  4F1Y A;  3WAE A;  4PFY A;  2XD3 A;  2I3V A;  4KQP A;  3A3U A;  1NNK A;  5CMC A;  1MY4 A;  2NOO A;  4GWW A;  4LQ2 A;  2FNC A;  4X1B A;  1KWH A;  2OLB A;  3MST A;  3MVW A;  1FQD A;  4DDD A;  2X7Q A;  1MXV A;  5A5X A;  1R9Q A;  4XF5 A;  4IO6 A;  2PMS A;  5JTY A;  1BLF A;  4NF4 A;  1NUY A;  5CMB A;  1S7Y A;  3BBR A;  2XXU A;  4KYE A;  4O3C A;  4ISU A;  3SER A;  1DTG A;  3EHT A;  4P47 A;  1FTJ A;  2B3F A;  2FA7 A;  3MC2 A;  3OO8 A;  1EZP A;  4P56 A;  3KOS A;  3TTL A;  5IKB A;  5DEX B;  5L9S A;  1GVC A;  1N04 A;  4NAP A;  4ZDM A;  1EYI A;  2AYS A;  3KG2 A;  1LFG A;  1JNF A;  3VVF A;  2Y7P A;  1DMB A;  2XXW A;  5ET7 A;  2D5W A;  2XXH A;  3CG1 A;  4GBV A;  3N5L A;  3KSJ A;  4TQU Q;  4DXU A;  1JQF A;  4XIG Q;  2I3W A;  4DCY A;  3FXR A;  4R6H A;  1MS7 A;  2R6G E;  2I48 A;  3O6G A;  2RC7 A;  2DWI A;  4PCD A;  2I6E A;  2GHA A;  5ISU A;  5IAI A;  1HSE A;  5IZ3 A;  3QSL A;  4G68 C;  3K6U A;  3PPR A;  3U93 A;  2D3I A;  3RT8 A;  2Y7I A;  3M8U A;  3VVE A;  4F22 A;  4LUB A;  4YB5 A;  2CMO A;  2PT1 A;  2M8C A;  5AA2 B;  3TDJ A;  1URD A;  2REG A;  2ZYK A;  2VT5 A;  5ITP A;  1XHY A;  3HPI A;  4KYD A;  3ROJ A;  2I58 A;  3MPL A;  3IB1 A;  2KR0 A;  4R9G A;  1N84 A;  2XWV A;  4M1V A;  4KXP A;  4OVP A;  1SVX B;  1SW1 A;  3EKI A;  4OVR A;  3QMF A;  3ODB A;  1KA0 A;  5L9O A;  4MFI A;  1ANF A;  2HXR A;  4YB7 A;  1IME A;  2ONK E;  4IO3 A;  1B4H A;  3FD3 A;  3O29 A;  1ELJ A;  1A8E A;  4ONY A;  4N8G A;  2Y5K A;  3O66 A;  3DP8 A;  3TMG A;  3S9E A;  1P99 A;  5KCJ A;  3KN8 A;  1TFA A;  3V89 B;  2CZH A;  5K2Y A;  1H45 A;  4NED A;  1IMC A;  2ZZX A;  1LFH A;  2XXT A;  3MQ9 A;  3MZB A;  3LR1 A;  1LLS A;  2NVU B;  1FBH A;  5I7I A;  4NF4 B;  2I4B A;  1LB8 A;  3OOA A;  4WKM A;  3CHG A;  4OER A;  1FQC A;  2ZYN A;  4TLM B;  3ZKL A;  4U23 A;  2PFZ A;  4P3L A;  4I62 A;  2HAV A;  3TAJ A;  4G61 A;  2PFY A;  3VXC A;  2UYF A;  3A29 A;  5KDT A;  3HST A;  2OPD A;  4H6D A;  2V84 A;  5A5X B;  5FTI A;  3LUZ A;  4OEV A;  1B0L A;  3PPO A;  4R73 A;  2UVH A;  1AIV A;  1A54 A;  1XT8 A;  5I3S A;  4MH5 A;  4OET A;  4IGT A;  4O3B A;  3L6H A;  1NV0 A;  3DP4 A;  2F97 A;  4JB7 A;  1B4Z A;  1YTV A;  1Y9U A;  1Y4T A;  5EYH A;  2PYY A;  2O51 A;  1PC3 A;  1H76 A;  1I6Q A;  1ZTY A;  3RTF B;  4QF9 A;  4IY6 A;  1LBY A;  1MRP A;  1SPI A;  3I5O A;  3LSX A;  4R2F A;  3W9W A;  3PUY E;  3W15 C;  1NUX A;  5IGA A;  1CE2 A;  4PAI A;  4P8B A;  3K00 A;  1KA1 A;  2ANJ A;  3M3L A;  2V4C A;  3LUY A;  1FTK A;  3FJG A;  1RDZ A;  4NE4 A;  4G8M A;  5DVI A;  3SEY A;  2B4L A;  1B3G A;  1M5C A;  1OIB A;  5H8S A;  2QFL A;  3KBZ A;  3S9L C;  1AH5 A;  2PT2 A;  4FED A;  4P9K A;  2XXK A;  3SZP A;  1FPI A;  4GIZ A;  3PU5 A;  1FBD A;  3C35 A;  1DPE A;  2I0C A;  5L9M A;  2VPO A;  1AOV A;  3NOH A;  1AWB A;  5AA3 A;  1H43 A;  5TP9 A;  4THI A;  4H45 A;  1EZ9 A;  2WBB A;  5IZZ A;  2OJT A;  1K9Z A;  3C36 A;  4F1V A;  1LBX A;  1OLA A;  5CI5 A;  4GXA A;  4RPO A;  2NWJ A;  2FIX A;  1VE4 A;  3PUX E;  1II5 A;  4WEP A;  1MXZ A;  2G93 A;  2DXY A;  4NF6 B;  2Z8F A;  4P0G A;  5DT6 A;  1ZBM A;  3MUQ A;  4QSD A;  4F29 A;  4LAT A;  4MIJ A;  4DLD A;  4BDN A;  1YPN A;  4OFO A;  4NF8 A;  5H8F A;  3EQ1 A;  4N4U A;  2DE2 A;  3ILT B;  2QS1 A;  1R1N A;  2DWA A;  1USY E;  3Q29 A;  3THI A;  1NV1 A;  3C4M A;  3EN3 A;  3FVG A;  3QXM A;  4PFT A;  3Q26 A;  1BIY A;  4NWD A;  5ET6 A;  1PB7 A;  3I6V A;  5CMK A;  1FBE A;  5I56 B;  1QVS A;  3MPK A;  3FZV A;  1D3K A;  3FXU A;  3T9H B;  5I84 A;  3MYU A;  1SW4 A;  1D4N A;  2A5S A;  2RIN A;  1LBC A;  2QS3 A;  2OPE A;  3PMW A;  1LEV A;  2DWH A;  1FRP A;  4ZEB A;  3MP1 A;  3IK6 B;  1QKA A;  2OK2 A;  4PGN A;  2F35 A;  3IJO B;  1MY0 A;  4KYS A;  4OAN A;  4GLI A;  4EF2 A;  4QXD A;  3CFZ A;  3K1M A;  1FW0 A;  2YPN A;  5CBR A;  3O6H A;  2RF1 A;  3TEL A;  1OMP A;  3IB0 A;  5I57 B;  4LN5 A;  2JJK A;  3C34 A;  3VLW A;  1LAX A;  4RYA A;  5ICQ A;  4R6Y A;  2Y7R A;  1XS5 A;  5LTC A;  3FJ7 A;  3FVN A;  4ZEI A;  2V25 A;  4JDF A;  3UN6 A;  1MM6 A;  4HE1 A;  1B32 A;  1WDN A;  2R8T A;  3EPE A;  2Q2C A;  3PUZ E;  1JW4 A;  1Y3N A;  2DE4 A;  2XX8 A;  1AMF A;  3OO9 A;  1R9L A;  3P7I A;  1D9Y A;  3RGY A;  2FYI A;  1B51 A;  3OO6 A;  5ITO A;  4FOR A;  5I2N B;  1FBG A;  4N15 A;  1B0H A;  3IB2 A;  2DWJ A;  1Y3Q A;  4GQO A;  1MM7 A;  1G0H A;  3RPL A;  2RCB A;  2VPN A;  3T9X B;  2DVC A;  4ELO A;  1INP A;  3A3C A;  4I3Y A;  3T1B A;  3QK6 A;  1POY 1;  1Y3P A;  3SEW A;  1B3F A;  4U2R A;  3MP8 A;  3VV5 A;  1BP5 A;  4F31 B;  4XFE A;  2HFB A;  5ELV A;  3U72 A;  5AA4 B;  2FIE A;  4GD5 A;  4YIC A;  5H8H A;  2ZMB A;  3CIJ A;  2O69 A;  3LSW A;  4ESX A;  1MG1 A;  2O84 X;  1SD3 A;  2PX1 A;  4WXJ A;  3CI8 A;  3RLF E;  1JW1 A;  4H46 A;  1YZ0 A;  5CRY A;  1BKA A;  1FTO A;  2O7U A;  4RNS A;  1MPB A;  3PPN A;  3FUZ A;  2Q74 A;  3IO4 A;  2QL3 A;  1XVY A;  1A55 A;  4U4S A;  2ONR A;  4PFW A;  3I3V A;  3N6U A;  1Z7N E;  4OHN A;  5BWJ A;  2F34 A;  3N26 A;  4KCC A;  5H8F B;  4E0X A;  1OQG A;  1SQY A;  4OVS A;  3OSR A;  4GWO A;  3C9H A;  3B50 A;  4QHQ A;  1USY H;  2HHM A;  4X9T A;  2X7P A;  3O2A A;  4F3S A;  5EQ8 A;  3S9M C;  3PGF A;  1I69 A;  1FPJ A;  2XXI A;  3U65 A;  2V3T A;  5M2V A;  3IJX B;  3G3J A;  2DDK A;  4HCW A;  1M5D A;  5EHS A;  3E78 A;  2HEU A;  2F8D A;  3IOV A;  3FIR A;  3RYD A;  1PBP A;  1MY3 A;  4NMY A;  4EXK A;  3VLU A;  5CBS A;  4LP2 B;  2NXO A;  1MQG A;  3S9N C;  5I5P A;  1YCJ A;  5DYH A;  2OWS A;  1LFI A;  1B7H A;  2Y84 A;  2WEF A;  2BJJ X;  4YKI A;  4NF6 A;  2UYE A;  1US4 A;  2XHD A;  3FV1 A;  4IO2 A;  1AL3 A;  3OEK A;  2CZI A;  1FPF A;  5ESY A;  1B05 A;  3MVX A;  5CM6 A;  1LBW A;  2GFE A;  4GWY A;  2GH9 A;  1D9Q A;  5JEI A;  3D4G A;  4QFO A;  4FAT A;  2O1M A;  2ZZW A;  5IM2 A;  4EQ7 A;  4NX1 A;  1DPP A;  2Y7W A;  3B8B A;  1URG A;  3PUW E;  2RC8 A;  1SYI A;  2ESN A;  4G68 A;  4ECF A;  5H8N B;  3VDF A;  4RJZ A;  1MPC A;  4JWX A;  5AA1 A;  4X04 A;  2B65 A;  5DEX A;  4HTG A;  4HE2 A;  2NUV A;  3K6W A;  4XKP A;  1DBZ A;  3K4U A;  1QUI A;  4G8N A;  4Z0I A;  1FPK A;  4ZEC A;  4O7M A;  2P3N A;  3K1N A;  1B7Z A;  4PFU A;  2XXR A;  3IX1 A;  1SW5 A;  1FPD A;  3ZKK A;  2WX9 A;  1LBV A;  4YKJ A;  2XXX A;  2I0B A;  2F7C A;  2QVV A;  1YXI A;  1EH3 A;  5IZ3 B;  3QYT A;  3K01 A;  1RYX A;  3V83 A;  4L17 A;  4Q30 B;  3FVK A;  4OXV A;  3SEX A;  4QFP A;  1R6Z A;  1IXI A;  3T66 A;  4IO5 A;  5I58 A;  4ZE8 A;  1VFD A;  1IEJ A;  1PEB A;  4FJP A;  3IAZ A;  1EZO A;  3MVY A;  1XOC A;  1RDY A;  1TT1 A;  3BIG A;  2A5T B;  1XI6 A;  2I4C A;  4MJO A;  3QIM A;  2H5Y A;  1VDW A;  2PCR A;  4P11 A;  3TCG A;  2H98 A;  2L5V A;  3M3K A;  3O9P A;  2W7Y A;  4AB5 A;  5AA4 A;  1FPE A;  1IQ7 A;  4F3G A;  2AL5 A;  2DVZ A;  3O6I A;  3VLV A;  5B70 A;  3FXQ A;  2I49 A;  1LAH E;  3VVD A;  2HPG A;  4LVQ A;  4BDR A;  4BLA A;  1B3H A;  1S9T A;  4H1X A;  1FJ9 A;  1ZKB A;  1NV3 A;  1Q35 A;  4GWZ A;  1FSA A;  2R71 A;  4LZ8 A;  1Q1K A;  3FAT A;  3CSB A;  2DS9 A;  5H8H B;  1FTL A;  5H8Q A;  5I2K B;  4ZED A;  3W9V A;  4XKR A;  4JBZ A;  1S50 A;  1Y20 A;  1NH7 A;  3DLN A;  1BK4 A;  4GWS A;  1ZJL A;  4I40 A;  2O1L A;  4ZEF A;  4PET A;  4QFK A;  4QBA A;  1B40 A;  4O7I A;  3EHS A;  3E79 A;  4YKK A;  3PD9 A;  4QRZ A;  3K6V A;  3ZS6 A;  4R2B A;  2PBW A;  4M4G A;  4DXC A;  4PP0 A;  5ET8 A;  3FBP A;  1BTJ A;  4ZS9 A;  5IZ1 A;  2Q8J A;  1UTB A;  2Z8D A;  3H06 B;  4JSD A;  3KSX A;  2OX3 A;  4R9F A;  3E4R A;  1RDX A;  1B9J A;  2WKY A;  3PTY A;  4PAK A;  5FHM A;  1FQA A;  4H8I A;  4FE8 A;  4IY5 A;  3TTR A;  2ABH A;  4DE8 A;  1MXU A;  2QVR A;  4PBH A;  5KDT B;  4NF0 A;  1Y1Z A;  3MVZ A;  3D4C A;  3IO6 A;  3E3K A;  4OFL A;  4KI0 E;  1IXC A;  1VFE A;  3CVG A;  5I59 B;  1MQD A;  4FEC A;  3GLB A;  3H03 A;  4N6P A;  1TFD A;  2O68 A;  2XD2 A;  1EYK A;  3ILU B;  1ZU0 A;  2CZL A;  4FBP A;  4GX4 A;  4JXI A;  3U8Q A;  3V5A A;  1RKM A;  4OFJ A;  4GF8 A;  4N6D A;  1P1N A;  4GOT A;  1UTH B;  2XWO A;  1I6A A;  4F2Q A;  1LST A;  1SYH A;  3TTK A;  4R75 A;  1NH8 A;  3MJN A;  4F18 A;  4AQ4 A;  4NWC A;  5TP9 B;  4I9D A;  3RQT A;  1GR2 A;  4H8J A;  4LQ5 A;  4GFR A;  2HCA A;  4OZ9 A;  3TCH A;  3CSG A;  4YMB A;  2XA5 A;  4BDO A;  4NGU A;  2FBP A;  4JVD A;  3LBS A;  1IIW A;  1ZMG A;  4MBP A;  2H4I A;  4PQJ A;  3U94 A;  4RA1 A;  2Q88 A;  3ONM A;  1DTZ A;  3TOD A;  3UOR A;  3KOT A;  4Z7E A;  4HCY A;  3CRB A;  1HSJ A;  1MQJ A;  4PDH A;  1FPL A;  1WOD A;  1FTM A;  2E1S A;  2RCA A;  4N13 A;  2WBD A;  2F78 A;  1FQE A;  4TLL B;  3CFX A;  4FAJ A;  4MLV A;  3SDF A;  1PB8 A;  1B58 A;  4EDP A;  3O97 A;  4U1Z A;  2A5T A;  4NF8 B;  2DYX A;  2F6G A;  4GL8 A;  4POX A;  1P1Q A;  2OWT A;  4P1L A;  3CR9 A;  3OEL A;  2ALU A;  5HBC A;  1A8F A;  1XC1 A;  4YAH X;  1B5I A;  4FIM A;  1IXG A;  5ET5 A;  3JZJ A;  1NUW A;  5I2K A;  3LV0 A;  1MY2 A;  1IMD A;  3KJT A;  3T9V A;  2GRV A;  2V3Q A;  4G2Z A;  1NNF A;  1US5 A;  4OES A;  4AS4 A;  1JET A;  1B52 A;  1WVJ A;  3L6G A;  4H0W A;  3MAM A;  5K2X A;  3FAS A;  1LB9 A;  2CEY A;  5EQA A;  2QVU A;  2F6P A;  4RXL A;  1N7X A;  2UXA A;  1JVY A;  2ZNU A;  4OWD A;  1CB6 A;  2XXV A;  1F9B A;  2UVJ A;  4UAB A;  1CNQ A;  5H8Q B;  2B3B A;  2ZYO A;  4GL0 A;  1MDQ A;  3A09 A;  1JW5 A;  2ZYM A;  4TOZ A;  2CZK A;  4OVJ A;  4MAG A;  2QPQ A;  2RKM A;  1EU8 A;  4HE0 A;  4N6K A;  3LC8 A;  2OBG A;  5B7D A;  2HAU A;  4NG7 A;  5EYG A;  3RPL B;  5EQ9 A;  1GGG A;  3GZG A;  1LAG E;  4QFN A;  3PMV A;  4X8R A;  1N76 A;  4IGR A;  1GTK A;  1YYZ A;  3OXN A;  4QFL A;  4PC9 A;  1MH3 A;  4ELP A;  4ND9 A;  4UA8 A;  2F7A A;  4U22 A;  1JEV A;  3Q27 A;  2F3D A;  1DCU A;  2H25 A;  3KEI A;  3TQW A;  4XKQ A;  1ZLQ A;  3F11 A;  4YKP A;  2YLN A;  1IMA A;  3UGW A;  5KZT A;  4IB2 A;  3IOT A;  1NFT A;  3SEV A;  3RY3 A;  4DXB A;  1POT A;  2R9J A;  1DK4 A;  4MNI A;  1UTH A;  1MXW A;  4NF5 A;  3K02 A;  4OTE A;  3R26 A;  1H3D A;  3MP6 A;  2HXW A;  3B6T A;  4U21 A;  4PDD A;  3TPA A;  5A5L A;  2XWK A;  2XXY A;  3QUF A;  2VD2 A;  5J1D A;  4EQ9 A;  4PE5 B;  3MW0 A;  1MQI A;  4ELR A;  3C33 A;  3SES A;  2WYP A;  3FVO A;  3H6T A;  5CC2 A;  1VSO A;  1TXF A;  2OZZ A;  2AL4 A;  2ZZV A;  3OSQ A;  1NNT A;  2H99 A;  1FBP A;  1FQB A;  1XVX A;  1QUK A;  4P1E A;  1FJ6 A;  2X26 A;  2P3V A;  3KC1 A;  3VE1 B;  4F3P A;  4EXL A;  1SI0 A;  4F39 A;  3K0V A;  3DP6 A;  5EHM A;  3OEM A;  2Z23 A;  1D9V A; 
#chains in the Genus database with same CATH homology
 4H46 A;  4XEQ A;  2PFZ A;  4PBH A;  2B4M A;  4MAG A;  4P3L A;  1YZ0 A;  4NX1 A;  4NF0 A;  4OVT A;  4DI4 B;  2KQZ A;  4PDH A;  2QPQ A;  1KZ8 A;  3B8B A;  2VPO A;  1FPL A;  3NOH A;  4OA4 A;  4G61 A;  1AWB A;  4HE0 A;  4GX6 A;  2DVZ A;  2PFY A;  4N6K A;  4PFB A;  1NV4 A;  4LN5 A;  1NV6 A;  4H45 A;  3A29 A;  5JK4 A;  2JJK A;  4MNP A;  2MKZ A;  4NG7 A;  2Q74 A;  4MX6 A;  4X04 A;  4GWX A;  2F3B A;  1IMF A;  5EYG A;  2WBB A;  3RPL B;  4HE2 A;  2HPG A;  5EQ9 A;  2WBD A;  5IZZ A;  1DBZ A;  5LTC A;  5IZ3 A;  4NHB A;  1K9Z A;  4X8R A;  2FVZ A;  4F1V A;  4PGP A;  1FPK A;  1FJ9 A;  3LUZ A;  1YYZ A;  4O7M A;  2P3N A;  2VT5 A;  1LBX A;  4PC9 A;  2HZL A;  4GWW A;  3ROJ A;  4MNC A;  2KR0 A;  1EYK A;  1NV3 A;  3T0J A;  2XWV A;  2FIX A;  3MST A;  4PAF A;  4GWZ A;  4FBP A;  1FBC A;  1FPD A;  1FSA A;  4GX4 A;  4M1V A;  4KXP A;  1JP4 A;  5I3S A;  2F3D A;  1DCU A;  1FBF A;  4OVP A;  2ZZW A;  1IMB A;  2WX9 A;  4N6D A;  1LBV A;  4HE1 A;  4XF5 A;  4F1U A;  3EKI A;  1IMA A;  4OVS A;  2R8T A;  1NV0 A;  1NV5 A;  5FBP A;  2XWO A;  4IR8 A;  1QGX A;  2QVR A;  5DW8 A;  1NUY A;  3W9V A;  5EYH A;  2QVV A;  2Q9T A;  4OVR A;  3B50 A;  1NV2 A;  2F5X A;  4MIJ A;  2GQ1 A;  2HHM A;  5EQ7 A;  4P1L A;  4X9T A;  4YIC A;  2DE4 A;  5EQ8 A;  3QMF A;  1KA0 A;  4N4U A;  4N81 A;  1YXI A;  1DK4 A;  2DE2 A;  4MNI A;  4PFI A;  4NGU A;  4MMP A;  5J16 A;  1FPG A;  1FPJ A;  1BK4 A;  2CEX A;  1Q9D A;  4GWS A;  4NN3 A;  4I40 A;  5IZ3 B;  1LBY A;  2BJI A;  5ET5 A;  4JVI A;  4PFR A;  3U65 A;  1NUW A;  2OWZ A;  3KC0 A;  4HXV A;  2HXR A;  1SPI A;  3LV0 A;  4MEV A;  1NV1 A;  1IMD A;  4PET A;  4PF6 A;  4F18 A;  1IME A;  2DDK A;  3GYY A;  4HCW A;  4P47 A;  4QBA A;  5T3J A;  4YZZ A;  3W9W A;  1EYJ A;  2V3Q A;  4PBQ A;  4P56 A;  4PDD A;  1NUX A;  4O7I A;  1FBG A;  2Q8M A;  5A5L A;  2XWI A;  4AS4 A;  2XWK A;  3E79 A;  4N15 A;  2WYK A;  3E78 A;  5ET6 A;  4PAI A;  1G0H A;  4P8B A;  4N8G A;  4PF8 A;  3RPL A;  3RYD A;  5J1D A;  3IFA A;  2VPN A;  2FHY A;  2Y5K A;  3BIH A;  1KA1 A;  1FBE A;  4MCO A;  5IGA A;  5ET8 A;  1NI9 A;  1INP A;  4NAP A;  5LDZ A;  1EYI A;  3FBP A;  2CEY A;  1FTA A;  4I3Y A;  4O94 A;  2Y5L A;  3IFC A;  2V4C A;  3T1B A;  5IZ1 A;  2WYP A;  4AS5 A;  3MYU A;  5EQA A;  1RDZ A;  3FXB A;  4PE3 A;  4F19 A;  5I5P A;  4N17 A;  2QVU A;  2CZH A;  2B4L A;  1LEV A;  4DI3 D;  1FRP A;  4NQ8 A;  1IMC A;  5F24 A;  2WEF A;  2ZZX A;  4GBW A;  2QFL A;  3ISP A;  4XFE A;  2XA5 A;  1G0I A;  2OX3 A;  3KBZ A;  4GWU A;  4I3E A;  5ET7 A;  2FBP A;  2HZK A;  2ZZV A;  4JVD A;  4N91 A;  1RDY A;  1RDX A;  2FIE A;  3BIG A;  1XI6 A;  3HFU A;  4PGN A;  1CNQ A;  4GBV A;  4GX3 A;  4MJO A;  4UAB A;  1NUZ A;  1FBP A;  4JVC A;  1FBH A;  2CZI A;  3PTY A;  4MHF A;  1FPF A;  4OAN A;  1VDW A;  4P1E A;  1FJ6 A;  4P9K A;  4PAK A;  5I7I A;  2P3V A;  2PCR A;  3D1R A;  4QXD A;  5ESY A;  3KC1 A;  2DE3 A;  2XXK A;  1LBW A;  3SZP A;  4N8Y A;  4O8M A;  4OVQ A;  1FPI A;  2L5V A;  5CM6 A;  4GWY A;  1D9Q A;  1K9Y A;  1FPE A;  3CHG A;  4PTK A;  4PCD A;  1NV7 A;  1FBD A;  1FPB A;  4HCY A;  1LBZ A;  2CZK A;  5IM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...