1AWBA

Human myo-inositol monophosphatase in complex with d-inositol-1-phosphate and calcium
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
272
structure length
272
Chain Sequence
WQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYO-INOSITOL MONOPHOSPHATASE
publication title Structure of an Enzyme-Substrate Complex and the Catalytic Mechanism of Human Brain Myo-Inositol Monophosphatase
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 85
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1awbA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1awbA02
5ET6A 4H46A 5F24A 4I3EA 2CZKA 2Q8MA 1K9ZA 4KXPA 1EYIA 1FPFA 1FPLA 2BJIA 3IFAA 4QXDA 1FPJA 1DBZA 2Y5LA 3B8BA 4G61A 2FHYA 1NV7A 5IZ3A 4MJOA 1FJ9A 4GWXA 4HE1A 5EQ8A 1LBVA 4AS5A 1DK4A 4HE2A 3BIGA 5ET8A 1FJ6A 1G0IA 5DW8A 2WEFA 1FPGA 5A5LA 5I3SA 1IMDA 5EQ7A 2WBDA 1FRPA 4GWZA 2P3VA 2FIXA 4PTKA 2PCRA 1NUWA 1LEVA 4GBWA 1FBGA 4GWSA 3BIHA 4AS4A 1FPKA 2OX3A 1D9QA 1QGXA 2CZIA 2OWZA 1YYZA 5IZ3B 1NV4A 2FIEA 1LBZA 2GQ1A 1XI6A 1FBPA 3KC1A 1AWBA 1EYJA 1RDXA 2F3DA 4IR8A 2JJKA 1RDZA 3RYDA 5J16A 1YXIA 1KA0A 5EYHA 4O7IA 2Y5KA 5EQAA 1IMCA 4GBVA 1NV2A 1NV6A 3KC0A 1IMFA 1NUYA 3IFCA 4FBPA 3T0JA 2QVVA 1RDYA 1JP4A 2Q74A 1KZ8A 5EYGA 1LBXA 1IMBA 1FPEA 3LUZA 2P3NA 4H45A 1VDWA 1K9YA 1NUXA 4I40A 2F3BA 3FBPA 1NV5A 4GX3A 2HHMA 1BK4A 5T3JA 1FSAA 5ESYA 3ROJA 1NV1A 2R8TA 4GWWA 4GWYA 4N81A 1FBHA 1FBDA 4GX6A 2FVZA 1FTAA 1FBFA 3LV0A 1G0HA 1FBEA 1YZ0A 2DDKA 5ET7A 2QVRA 2CZHA 4GX4A 1CNQA 1NV0A 2VT5A 1LBYA 1FPBA 1KA1A 1FBCA 3RPLA 1IMAA 3D1RA 5LDZA 2FBPA 4HXVA 1Q9DA 1NV3A 3A29A 5ET5A 1EYKA 1NI9A 3RPLB 3QMFA 4HE0A 5EQ9A 3KBZA 1INPA 4I3YA 4GWUA 5IZ1A 2QVUA 2QFLA 2WBBA 1FPDA 1FPIA 1DCUA 1LBWA 1SPIA 5FBPA 1NUZA 1IMEA
chains in the Genus database with same CATH superfamily
1B4HA 3ILUB 1US4A 3EHTA 2XXXA 4PBQA 2WKYA 4YKKA 1FPJA 2B3BA 2PBWA 3K6VA 1DBZA 3EKIA 4NMYA 2DXRA 3EQ1A 2OJTA 2YJPA 2Y7RA 1IXHA 4O94A 2UYFA 2D21A 5ITOA 1URGA 3T9VA 1LB8A 3OSRA 4R72A 3QYTA 2WBDA 5I56B 5FHNA 1EZOA 4YMAA 2Q2CA 4UACA 3MZBA 5DYHA 2FIEA 3L6HA 3FV2A 1DTZA 2O51A 4F19A 1KA0A 1H45A 4OFOA 1NV2A 3IFCA 2AYSA 4NF4B 1CE2A 3VLUA 1SYHA 1FPEA 4QRZA 3LUZA 2R6GE 1VDWA 1PC3A 4PGNA 2HZLA 4FE8A 5AA2D 4XKPA 2ZYMA 4EF1A 2VHAA 4OYVA 3PUYE 1FBDA 1IUDA 2GFEA 2QMWA 3G3IA 1HSJA 2DWHA 5ET7A 1NL5A 4FEDA 4H5FA 3MUQA 3N6UA 5K2XA 3IORA 5I84A 4OFJA 2I3VA 1IMAA 3D1RA 1SQYA 1ZTYA 3CI8A 1ATGA 3KOTA 3K2DA 1USYH 2X7PA 3C35A 2V3UA 2YPNA 1M5CA 1OLAA 3C33A 4QF9A 3I6VA 4U2RA 1N04A 4ELQA 4XKRA 1XT8A 4O8MA 4MMPA 3IO4A 5AA2B 2HCAA 4U1ZA 1Y20A 3EPEA 1FTLA 3CHGA 3GLBA 4GL0A 2F78A 1MXWA 3WAFA 4NAPA 1F9BA 3OO7A 3IB0A 3K0VA 3IAZA 2P2AA 1FBGA 1JVXA 4ZEKA 1QKBA 1LAHE 3UN6A 4RXLA 4PFYA 5FTIA 2GQ1A 4DE8A 2F3DA 2NWJA 5JEIA 2F7AA 2XXWA 3RN8A 2AIXA 1XHYA 2DXYA 4ZDMA 4YMBA 1K9YA 3PPOA 3RUMA 2Q9TA 4E0XA 4GX3A 2F34A 3B6TA 3OXNA 3EF7A 1I6BA 3ROJA 1TT1A 4ISUA 3MQ9A 1FBHA 4GX6A 2XXYA 1FBFA 3LR1A 1B1HA 2O7IA 1LFHA 2VD3A 4P1LA 3T93B 5I58B 1ZMGA 1NH8A 1LBCA 1FBCA 5CI5A 4P9KA 1QUIA 5EQ9A 4GWUA 4OWDA 2VD2A 2WBBA 2RCAA 5FBPA 1N3XA 3O6GA 3G3FA 3RY3A 4JB7A 4HS7A 4QFKA 3T9UA 1IZ1A 1K9ZA 4YU0A 5I2KB 4NEDA 5I2NA 5H8FB 3BFUA 1I6QA 2G29A 3U65A 4NF0A 3BIGA 5TP9B 3HO7A 5EQ7A 1FQAA 4FJPA 1EU8A 1B5HA 2ZYOA 1MPBA 3SKPA 1ANFA 2VGQA 3N26A 1NH7A 4ESWA 4YB7A 4FIMA 3PU5A 5H8HB 4H65A 4Q0CA 2IA4A 5ELVA 1YXIA 3ZSFA 4BDRA 4GVOA 3CVGA 5EYHA 3FXQA 3SEUA 5EQAA 4GXSB 4P11A 2P0SA 4RY1A 1D9YA 1RDYA 5EYGA 4TLLB 2I4BA 3C36A 4QFNA 3SEYA 2QSXA 5AE4A 3FUZA 1KWHA 2Z8EA 4GWWA 1B32A 4JWOA 3THIA 3K01A 1ELJA 3KJTA 2Z23A 2Z22A 4BDNA 5LTCA 1B52A 1N84A 1H76A 1A8FA 5A5XA 4NF5B 3EHSA 2Q88A 4AQ4A 4POWA 3KGCA 1II5A 1NUZA 2I48A 3SZPA 3FGSA 1MDP1 3GXAA 3ONMA 4MNCA 1MY4A 3IJOB 4N07A 1MXUA 2DWIA 3V89B 5DTBA 1MY3A 4ZE8A 3FV1A 3KBRA 2V3TA 1OLCA 4PBHA 5EHMA 3TODA 3VVEA 3VDFA 1SW4A 3H06B 2F6GA 3R6UA 1SW2A 3LSLA 1G0IA 3OO9A 4EQ7A 1FQEA 4PAIA 4ZZAA 1IMDA 4AB5A 1P1NA 2LAOA 4RYAA 4LQ2A 4O3AA 4AS4A 2B4LA 3FATA 1FBPA 1AWBA 3CFXA 3D4GA 4U23A 5CMKA 5I5PA 5J16A 1UTHA 1NUYA 4OENA 1A8EA 3VXBA 1XS5A 1DSNA 4QFLA 4KYEA 3FD3A 1TFAA 3OELA 1Y4TA 4LZ8A 5DVJA 3QAXA 1BTJA 3K1PA 3FBPA 2NOOA 1NV5A 3C32A 1DPEA 2PT1A 2RKMA 1XOCA 4OERA 4RNSA 3O66A 1LAXA 2BJJX 3TTNA 3C4MA 3RPWA 3VV5A 2FYIA 3B50A 2GH9A 4OVTA 3UGWA 1OMPA 1S7YA 4H6DA 3TEPA 4HTGA 4YKPA 2XWVA 4NHBA 4GXAA 5LDZA 4N15A 1B7HA 2HAUA 3JYRA 4KQPA 2V84A 2H25A 3VVDA 2XXIA 5H8QA 5EYFA 3PD8A 3EHUA 4F1UA 5I56A 2XX9A 5ISUA 3LSFB 4NWCA 4KHZE 2DWAA 2UVJA 3TZAA 4MNIA 2F6PA 2Y7WA 4G61A 1EH3A 2DSFA 1SYIA 3MVXA 4GWXA 1P1OA 2KLFA 4XEQA 4Q5TA 2KQZA 3VLWA 3PMXA 1B7ZA 5TPAA 5A5LA 4NF4A 3R7XA 2ZZVA 4QFPA 4FORA 3DP6A 5F7VA 2DE2A 2IEEA 1PB9A 2O69A 3CR9A 1YYZA 4DLDA 3O2AA 3I3VA 4NE4A 1B7UA 3Q27A 3O29A 4PF6A 3OSQA 1IMCA 4ESXA 4N17A 1MXYA 1LBXA 1IMBA 4PF8A 3O28A 3H3GA 1NUXA 3OEKA 3MZ9A 3HN0A 2A5SA 5T3JA 4ELOA 2O6AA 1MXVA 3IOTA 3N94A 4OANA 5DT6A 3HHFA 5KCJB 2ZMBA 3ODBA 4LUBA 4YKIA 3PPNA 4N6PA 4F22A 2OK2A 3QUFA 2OWTA 1M5EA 3KN8A 3HHGA 4ECFA 4X9TA 1YAEA 3FXBA 3RPLB 3RNNA 3OEMA 5I59B 1SPIA 2O84X 4Q30B 2XX8A 1A54A 4MLQA 1MQJA 5F24A 4IO3A 5CMMA 3IFAA 1IITA 1R1NA 4XFEA 2GHAA 5BWJA 2F35A 1NV7A 4BLAA 2QPQA 1TWYA 3TDJA 2UVHA 1GTKA 3RTWB 4PFTA 1ZIUA 5TU0A 4LVQA 1FCKA 3T66A 1D3KA 1FTKA 3DP4A 1HSEA 3DM0A 1UTBB 1RYXA 1JVYA 2HFBA 4IGTA 4ZEIA 4GBWA 4PDDA 4DI3D 3IB2A 1QGXA 2OWZA 1JW4A 4MAGA 3P7IA 1EYJA 4OEVA 4XXUA 3DP8A 4GLIA 4JWYA 4U22A 1FW0A 1A7LA 1OQHA 1Y4CA 5FTHA 4IY6A 4GIZA 4RA1A 1BLFA 3ZS6A 1URSA 4H67A 1B3HA 4U21A 4MIJA 1BP5A 3FJMA 3C34A 4MEVA 1LAFE 3PD9A 3RQTA 4X1DA 5I2KA 3SEWA 5H8FA 4FATA 2OZZA 5L8DA 3WAEA 1NI9A 3U92A 3OENA 3CSBA 4EXKA 2DS9A 3OO6A 4YB6A 5TP9A 1IMEA 4LN5A 5KZTA 2Q8MA 5I57B 3S9NC 3MPKA 3K1MA 4P47A 3PUXE 3M3LA 5H8HA 1I6AA 4G68C 3O9PA 4NTLA 4AS5A 5AA1A 4MH5A 3EN3A 1FQBA 3IR1A 3R26A 5AA3A 1SD3A 3G3GA 3PPPA 3TAJA 5AA4B 1CB6A 3VE1B 4IO4A 4YKJA 3QIMA 4DXCA 4RPNA 3C9HA 1P1UA 3O6IA 2Y7KA 2A5TB 1LBZA 4X1BA 1XI6A 3FVKA 4GWOA 4F3PA 3HFUA 1NV6A 1RKMA 4NQ8A 2FA7A 2QL3A 4NF5A 1DMBA 1MG1A 3I5OA 1GGGA 2XWIA 3Q26A 4N6DA 3MVZA 4XIGQ 3V83A 2O68A 4M1VA 3CIJA 4GWYA 2ESNA 2O1MA 1JQFA 1FBEA 1NV0A 4FEBA 3UORA 4RK2A 1N3WA 2FBPA 4OTEA 5L9SA 3MWBA 3K6WA 2OPDA 3T22A 2GRVA 3FXUA 3TTLA 1DCUA 2D3IA 2R9JA 2XXUA 4WXJA 1NNTA 4BDOA 3MP8A 2UVGA 4F31B 4N6KA 3UP9A 3IB1A 4G4PA 5HM4B 1PB8A 3PV0E 1QVSA 3TTRA 2DE4A 2F5XA 3BKIB 2CMOA 2Y7IA 3KZGA 4GD5A 4NF8A 4KR5A 5DW8A 1S50A 3MAMA 1J1NA 1NKXA 5IZZA 2UXAA 3FVOA 4KFQA 2UYEA 3IOWA 1Y3PA 1EZPA 2RC9A 2QJEA 3V5AA 4TQUQ 1O64A 2HPGA 4IR8A 1POTA 4ELRA 4N13A 2XWKA 1OIBA 2QMXA 1IEJA 4H45A 2H5YA 1MPDA 1QULA 3JV9A 5ICQA 4G8NA 4P56A 3TTMA 1US5A 1MQHA 3SEVA 3RLFE 4R75A 1B05A 4UABA 4QHQA 1VFDA 4HW8A 2H4IA 3UK4A 4ZEBA 4R9FA 3TYHA 2F7BA 3W15C 3MSTA 1IXIA 3DLNA 4HXVA 1LSTA 1NV3A 5HBCA 4OVPA 2V93A 4Q8RA 1INPA 4JVIA 1MY1A 3E3KA 4F18A 4PQJA 3TCGA 4H1XA 1N7WA 3K4UA 1FPFA 1H3DA 4QXDA 1NNKA 3IK6B 1O7TA 4P1EA 3RGYA 4ELPA 4R9GA 2PFZA 3RTFB 2E1SA 3F11A 1UIUA 3PUZE 2V25A 1MM7A 2WYKA 1LCTA 3CFLA 4FAJA 2V3QA 3TKDA 3Q29A 3FIRA 1SW1A 4EDPA 1BKAA 3M3KA 2F97A 4NX1A 1B6HA 1Y9UA 3L6GA 3BBRA 2X7QA 4WEPA 3TCHA 3E13X 3W9VA 1MY0A 1Y3NA 3VLVA 4R6KA 1ZLQA 4N8GA 4O7IA 1N76A 1WODA 1L5TA 1IIWA 2I4CA 4PGPA 1B5IA 3LUYA 4PAFA 5H8NB 4H0WA 4IB2A 3A3UA 2VPOA 1M5DA 1NV1A 4U4SA 4DCYA 4MNPA 4NF6A 4OVRA 3G3HA 2RC8A 4NN3A 4GX4A 1CNQA 5BUUA 3V8XB 1FPBA 4JBZA 2CEYA 4LONB 2I0CA 2XD3A 2XA5A 1LFGA 3IJXB 4O7MA 1R6ZA 4IO2A 2B4MA 2VPNA 4MX6A 1UTBA 2F7CA 4MFIA 3SDFA 3S9LC 3KN3A 1WDNA 3TMGA 3TTKA 3N5LA 2FHYA 4HE1A 1LFIA 2ZNUA 4P8BA 3CSGA 4FECA 4EXLA 4F3BA 1JNFA 5ITPA 3G3KA 3FXRA 2ONKE 4C0RA 4U1OA 1MDQA 1GV8A 2OX3A 1VE4A 4G77A 2PFYA 3GYYA 4IO7A 3VXCA 4YZZA 2THIA 3K00A 3KC1A 3QXMA 2JJKA 2DQVA 4OEUA 3KN7A 4PAKA 1IMFA 3UIFA 2QVVA 1FQDA 1MXZA 1MH3A 5IGAA 3K6XA 4OETA 4LATA 5ESYA 2NVUB 1LCFA 4N81A 2FVZA 2AL4A 1B40A 3LV0A 1G0HA 1JW1A 5J1DA 4EQBA 2ZNTA 4MHFA 4IO5A 3FJ7A 1UIVA 1Q9DA 3A29A 5ET5A 1P99A 3QMFA 1ZKBA 5IZ1A 4THIA 2QVUA 2QFLA 1D9VA 4POXA 3C31A 4BDMA 2ZZWA 4GOTA 4Z0IA 4QSEA 3Q25A 1Y1ZA 2CZKA 1IQ7A 3USDA 1D4NA 1QUKA 3IX1A 4KI0E 4DIGA 3ZKLA 3TELA 4OXVA 4HCWA 1Z7NE 2A5TA 2Q8JA 5AA2A 1P1WA 1LBVA 1QKAA 2YLNA 3GZGA 5I3SA 2M8CA 4R6YA 1FRPA 2P3VA 2HXRA 4I62A 1M5BA 1OQGA 1QUJA 2PX1A 3O97A 5ICTA 2XXQA 4OVJA 2H99A 4F3SA 5IZ3B 3MPLA 4R74A 2ZYKA 4M4GA 2XD2A 4TOZA 1RDXA 4Z7EA 1PBPA 3KJ7A 1O63A 5M2VA 4GBVA 3JZJA 4ONYA 4PE3A 2Q74A 5CM6A 5CMCA 1NNFA 4I40A 4KPTA 2ZYNA 3LBSA 1XC1A 1TFDA 4G8HA 4LP2B 4R2BA 2HHMA 4P3LA 4WEDA 3SESA 3W9WA 4OESA 1N0TA 3SEXA 3TFLA 4H8IA 3SETA 4ZECA 5KDTB 1YZ0A 2ONSA 5I58A 5JTYB 3NOHA 4G68B 1LBYA 3CG3A 1B3GA 1MRPA 3MC2A 1JEUA 4HE0A 1B1XA 1AH5A 1MQIA 1T0KA 1VR5A 5H8QB 4F2OA 4DDDA 4U4XA 3U93A 3CG1A 2NXOA 1EZ9A 1LAGE 1H44A 2XXVA 4BDLA 4H46A 1B0LA 4AB6A 2XWOA 4GL8A 1ZJLA 4RJZA 3T96B 3B8BA 3FVNA 3KSJA 4F1VA 1R9QA 1SI1A 3N6TA 4OFLA 1FTMA 4PDHA 1Y1MA 1S9TA 1Q35A 4HE2A 5DEXB 5ET8A 3KOSA 4IGRA 4R2FA 4XTCQ 5TPAB 4JSOA 3S9EA 3LSXA 1NUWA 1NMUA 4GWSA 2O7UA 1VFEA 3U72A 1B9JA 2I3WA 2ALUA 2DVZA 3OOAA 3T9XB 4I8CA 1MH4A 3T9HB 3M8UA 3B6WA 1RDZA 1ZU0A 3ILTB 3MP1A 3PPRA 4C1UA 4YB5A 5K2YA 4F2QA 3KC0A 4O3BA 1KZ8A 1B4ZA 2H98A 3OO8A 3MYUA 2CEXA 3O6HA 2REJA 1MM6A 2XX7A 5CBRA 4DI4B 5FHOA 1FSAA 3FVGA 2R71A 4F1YA 5CRYA 3KFMA 1LLSA 4GFRA 1B3LA 2CZHA 5CMBA 4C1TA 1KA1A 2B65A 3AXFA 3PUVE 2I0BA 1N7XA 3CFZA 1FPDA 1MQGA 3TQLA 4ZZEA 4YICA 3SERA 4F29A 4EF2A 2D5WA 4KXPA 4JVDA 4ND9A 4O3CA 5CBSA 5B7DA 2L5VA 3DELB 2CZLA 4MJOA 4H8JA 4R73A 1NNPA 5EQ8A 1MQDA 3Q28A 3MP6A 1DK4A 2WEFA 1B51A 4KCCA 4DZ1A 1AIVA 4GWZA 2ZXTA 4PTKA 3MBPA 2WYPA 3BIHA 3LSWA 5H8NA 4OZ9A 1FPKA 3S2VA 4L17A 1ZBMA 3QSLA 5EHSA 2GHBA 2XXRA 4JVCA 3QUJA 3HSTA 1Y3QA 5IKBA 2QS4A 3OMBA 4PFWA 3T0JA 4FBPA 4PP0A 4DXBA 4LZ7A 2P3NA 2OPEA 2ZNSA 1BIYA 4ZE9A 2PVUA 3B6QA 1FQCA 4MF3A 3E78A 2DYXA 3BFTA 3IO6A 4MBPA 4RPOA 1WVJA 3H4ZA 1XVYA 3FASA 2DDKA 3MJNA 3H6VA 4JWXA 1H43A 5DVFA 4LQ5A 3RT8A 2ZZXA 3PUWE 3S4UA 4QSDA 3KBZA 5DVIA 1OVTA 2RF1A 1FPIA 1SVXB 4IY5A 1SDXA 4PE5B 2I6EA 2MKZA 2OWSA 5ET6A 3GBBA 4P0GA 4PFIA 1POY1 2B3FA 4YAHX 1FPLA 4ZEFA 2Z8DA 3HCQA 1AL3A 2DVCA 1JW5A 4K3FA 3OD7A 2Y5LA 3FZVA 2I49A 4MCOA 1B58A 1FJ9A 4KYDA 2I58A 5IM2A 2XXKA 4PFBA 2NUVA 2QS3A 4XKNA 4UA8A 1YTVA 2XXTA 1SW5A 2FIXA 1LEVA 1B3EA 1MY2A 1SI0A 3IOUA 2G93A 5F1QA 1B46A 3E9XA 3K02A 3TUSA 3H6WA 3RYDA 3PMWA 3HPIA 2Y5KA 1RYOA 3D4CA 2RC7A 1SBPA 2HZKA 1JP4A 2QS2A 2AL5A 4OQOA 4PETA 2V4CA 1DOTA 4PFUA 4IO6A 1PB7A 2QS1A 2R8TA 4PCDA 4PC9A 4LZ5A 5LOMA 3PMVA 4WKMA 5KCJA 1FTAA 4I1DA 5FHMA 2ABHA 3GBAA 3S9MC 1P1QA 4I9DA 3K6UA 3RPLA 1A99A 3VVFA 4N91A 5I59A 5L9OA 1USYE 2F36A 2H9BA 2ONRA 3PGFA 1LGBC 2XXHA 1OVBA 1MPCA 5IZ3A 3CRBA 5B70A 3U1OA 1MXXA 1FJ6A 4NF8B 2WX9A 3T1BA 1FTJA 1PBQA 4H5GA 2XHDA 4F39A 2X26A 2PCRA 5JK4A 2FNCA 4P0IA 5I2NB 1YPNA 4ZEDA 1AOVA 2VP1A 3G7WA 4QFOA 2ANJA 1NV4A 4HCYA 4QSCA 4TLMB 1GR2A 3E4RA 1Q1KA 1B0HA 2Y7PA 5KDTA 2KR0A 4N8YA 5JTYA 3MW0A 4G68A 2QRYA 2OCUA 3KSXA 3M3FA 3ECRA 1PDAA 2Q2AA 3MVYA 4JXIA 2DE3A 2F3BA 2Y84A 1DTGA 1BK4A 4XKQA 1JEVA 1A55A 1FTOA 4R6HA 4DCXA 2PYYA 4DXUA 1VSOA 4E0WA 2QVRA 4NG7A 3A3CA 1M5FA 4X8RA 1FQFA 2O1LA 1DPPA 3U8QA 2F8DA 3H6TA 5L9MA 1I69A 2RCBA 3U94A 5HPQA 4MLVA 1UQWA 3QK6A 1QJMA 3A09A 4EUOA 1LB9A 5DEXA 4OA4A 1LBWA 4OMBA 5IAIA 3LC8A 2XXPA 2REGA 4I3EA 5I57A 3K1NA 2HAVA 1URDA 4PFRA 3TCFA 1EYIA 2HEUA 3H6UA 1GVCA 2BJIA 2VOZA 5A5XB 3PPQA 1IXCA 2Q89A 2Z8FA 1IXGA 2E0SA 4GRKA 2DOJA 4EQ9A 1FPGA 3PTYA 3VFJA 4NGUA 5I7IA 4KCDA 3ZKKA 4KD5A 4NWDA 5AA4A 2P1SA 1NFTA 5H8SA 1R9LA 4RK9A 2OBGA 4G2ZA 1TXFA 2PT2A 1D9QA 2CZIA 4KYSA 3TQWA 4LA9A 2W7YA 3TPAA 3G3JA 4F3GA 3RT6B 3MVWA 4X04A 4ZS9A 3B7DA 4JDFA 3KG2A 3H03A 3MZ1A 1XVXA 3ISPA 1HSLA 3H7MA 1B2HA 4GQOA 1LBBA 2DWJA 3FJGA 1QW0A 1Z7ME 4QBAA 4X48A 2OLBA 1A40A 1YCJA 4N4UA 2HQ0A 4BDQA 1AMFA 1MS7A 4G8MA 3IOVA 1JETA 5CC2A 2PMSA 4XF5A 4NF6B 4JSDA 3HV1A 2RINA 1PEBA 2VT5A 1UTHB 4OVQA 4OHNA 3UA8A 3IL1B 1EYKA 1B3FA 4I3YA 3KEIA 2DP8A 1B5JA 4GF8A 2UVIA 2HXWA 4OVSA 3E79A
chains in the Genus database with same CATH topology
4KXPA 4JVDA 4PBQA 1FPFA 4QXDA 4P1EA 1FPJA 2L5VA 1DBZA 2PFZA 3EKIA 4MNIA 4G61A 4MJOA 4GWXA 5EQ8A 2WYKA 4O94A 4XEQA 1DK4A 2KQZA 2V3QA 2WEFA 5A5LA 2ZZVA 2WBDA 4GWZA 4NX1A 4PTKA 2WYPA 2DE2A 3BIHA 1FPKA 1YYZA 2FIEA 3W9VA 4JVCA 4F19A 4PF6A 1KA0A 4N8GA 4O7IA 1IMCA 1NV2A 3IFCA 3T0JA 4FBPA 4N17A 4PGPA 1LBXA 1IMBA 1FPEA 3LUZA 2P3NA 4PF8A 1VDWA 1NUXA 4PAFA 4PGNA 2HZLA 3E78A 5T3JA 2VPOA 1NV1A 1FBDA 4OANA 4MNPA 4OVRA 2DDKA 5ET7A 4NN3A 4GX4A 1CNQA 1FPBA 2ZZXA 2CEYA 4X9TA 1IMAA 3D1RA 3FXBA 3RPLB 3KBZA 2XA5A 1FPIA 1SPIA 4O7MA 2MKZA 2B4MA 2VPNA 4MX6A 5ET6A 5F24A 4PFIA 1FPLA 3IFAA 4XFEA 2Y5LA 2FHYA 1NV7A 4MCOA 1FJ9A 4O8MA 2QPQA 4MMPA 4HE1A 4P8BA 5IM2A 2XXKA 3CHGA 4NAPA 4PFBA 2FIXA 1LEVA 4GBWA 1FBGA 2OX3A 4PDDA 4DI3D 1QGXA 2OWZA 2PFYA 3GYYA 4YZZA 2GQ1A 4MAGA 3KC1A 1EYJA 2F3DA 2JJKA 3RYDA 4PAKA 2Y5KA 1IMFA 2QVVA 2HZKA 1JP4A 5IGAA 1K9YA 4PETA 2V4CA 2Q9TA 4GX3A 4MIJA 5ESYA 3ROJA 4PC9A 2R8TA 4PCDA 4MEVA 4N81A 1FBHA 4GX6A 2FVZA 1FTAA 1FBFA 3LV0A 1G0HA 4P1LA 5J1DA 4MHFA 1FBCA 3RPLA 1Q9DA 3A29A 5ET5A 4P9KA 1NI9A 3QMFA 5EQ9A 4N91A 4GWUA 5IZ1A 2QVUA 2QFLA 2WBBA 5FBPA 2ZZWA 1IMEA 4LN5A 2CZKA 2Q8MA 1K9ZA 4P47A 5IZ3A 3U65A 4HCWA 1LBVA 4NF0A 4AS5A 3BIGA 1FJ6A 2WX9A 3T1BA 5I3SA 5EQ7A 1FRPA 2P3VA 2HXRA 2PCRA 5JK4A 5IZ3B 1NV4A 4HCYA 1LBZA 1XI6A 1RDXA 1YXIA 2KR0A 5EYHA 4N8YA 5EQAA 3HFUA 4GBVA 1NV6A 4NQ8A 1RDYA 4PE3A 2Q74A 5EYGA 5CM6A 4I40A 2DE3A 2XWIA 2F3BA 2HHMA 1BK4A 4N6DA 4P3LA 3W9WA 4M1VA 4GWWA 4GWYA 1FBEA 5LTCA 1YZ0A 2QVRA 4NG7A 1NV0A 4X8RA 3NOHA 1LBYA 2FBPA 4HE0A 4OA4A 1DCUA 1LBWA 1NUZA 4H46A 4I3EA 3SZPA 4PFRA 1EYIA 4MNCA 2BJIA 4N6KA 2XWOA 3B8BA 4F1VA 4PBHA 4PDHA 2DE4A 2F5XA 4HE2A 5ET8A 1G0IA 5DW8A 1FPGA 3PTYA 4NGUA 5I7IA 4PAIA 1IMDA 5IZZA 1NUWA 4GWSA 4AS4A 1D9QA 2CZIA 2B4LA 2DVZA 1FBPA 1AWBA 2HPGA 4IR8A 1RDZA 5I5PA 5J16A 2XWKA 4X04A 3KC0A 1NUYA 3ISPA 1KZ8A 4H45A 4F1UA 3MYUA 2CEXA 4P56A 3FBPA 4QBAA 1NV5A 4N4UA 4DI4B 1FSAA 4UABA 3B50A 4XF5A 4OVTA 2CZHA 2VT5A 4OVQA 2XWVA 4NHBA 1KA1A 3MSTA 5LDZA 4N15A 4HXVA 1NV3A 1EYKA 4OVPA 1INPA 4JVIA 4I3YA 1FPDA 4F18A 4OVSA 4YICA 3E79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ET6 A;  4H46 A;  5F24 A;  4I3E A;  2CZK A;  2Q8M A;  1K9Z A;  4KXP A;  1EYI A;  1FPF A;  1FPL A;  2BJI A;  3IFA A;  4QXD A;  1FPJ A;  1DBZ A;  2Y5L A;  3B8B A;  4G61 A;  2FHY A;  1NV7 A;  5IZ3 A;  4MJO A;  1FJ9 A;  4GWX A;  4HE1 A;  5EQ8 A;  1LBV A;  4AS5 A;  1DK4 A;  4HE2 A;  3BIG A;  5ET8 A;  1FJ6 A;  1G0I A;  5DW8 A;  2WEF A;  1FPG A;  5A5L A;  5I3S A;  1IMD A;  5EQ7 A;  2WBD A;  1FRP A;  4GWZ A;  2P3V A;  2FIX A;  4PTK A;  2PCR A;  1NUW A;  1LEV A;  4GBW A;  1FBG A;  4GWS A;  3BIH A;  4AS4 A;  1FPK A;  2OX3 A;  1D9Q A;  1QGX A;  2CZI A;  2OWZ A;  1YYZ A;  5IZ3 B;  1NV4 A;  2FIE A;  1LBZ A;  2GQ1 A;  1XI6 A;  1FBP A;  3KC1 A;  1AWB A;  1EYJ A;  1RDX A;  2F3D A;  4IR8 A;  2JJK A;  1RDZ A;  3RYD A;  5J16 A;  1YXI A;  1KA0 A;  5EYH A;  4O7I A;  2Y5K A;  5EQA A;  1IMC A;  4GBV A;  1NV2 A;  1NV6 A;  3KC0 A;  1IMF A;  1NUY A;  3IFC A;  4FBP A;  3T0J A;  2QVV A;  1RDY A;  1JP4 A;  2Q74 A;  1KZ8 A;  5EYG A;  1LBX A;  1IMB A;  1FPE A;  3LUZ A;  2P3N A;  4H45 A;  1VDW A;  1K9Y A;  1NUX A;  4I40 A;  2F3B A;  3FBP A;  1NV5 A;  4GX3 A;  2HHM A;  1BK4 A;  5T3J A;  1FSA A;  5ESY A;  3ROJ A;  1NV1 A;  2R8T A;  4GWW A;  4GWY A;  4N81 A;  1FBH A;  1FBD A;  4GX6 A;  2FVZ A;  1FTA A;  1FBF A;  3LV0 A;  1G0H A;  1FBE A;  1YZ0 A;  2DDK A;  5ET7 A;  2QVR A;  2CZH A;  4GX4 A;  1CNQ A;  1NV0 A;  2VT5 A;  1LBY A;  1FPB A;  1KA1 A;  1FBC A;  3RPL A;  1IMA A;  3D1R A;  5LDZ A;  2FBP A;  4HXV A;  1Q9D A;  1NV3 A;  3A29 A;  5ET5 A;  1EYK A;  1NI9 A;  3RPL B;  3QMF A;  4HE0 A;  5EQ9 A;  3KBZ A;  1INP A;  4I3Y A;  4GWU A;  5IZ1 A;  2QVU A;  2QFL A;  2WBB A;  1FPD A;  1FPI A;  1DCU A;  1LBW A;  1SPI A;  5FBP A;  1NUZ A;  1IME A; 
#chains in the Genus database with same CATH topology
 1B4H A;  3ILU B;  1US4 A;  3EHT A;  2XXX A;  4PBQ A;  2WKY A;  4YKK A;  1FPJ A;  2B3B A;  2PBW A;  3K6V A;  1DBZ A;  3EKI A;  4NMY A;  2DXR A;  3EQ1 A;  2OJT A;  2YJP A;  2Y7R A;  1IXH A;  4O94 A;  2UYF A;  2D21 A;  5ITO A;  1URG A;  3T9V A;  1LB8 A;  3OSR A;  4R72 A;  3QYT A;  2WBD A;  5I56 B;  5FHN A;  1EZO A;  4YMA A;  2Q2C A;  4UAC A;  3MZB A;  5DYH A;  2FIE A;  3L6H A;  3FV2 A;  1DTZ A;  2O51 A;  4F19 A;  1KA0 A;  1H45 A;  4OFO A;  1NV2 A;  3IFC A;  2AYS A;  4NF4 B;  1CE2 A;  3VLU A;  1SYH A;  1FPE A;  4QRZ A;  3LUZ A;  2R6G E;  1VDW A;  1PC3 A;  4PGN A;  2HZL A;  4FE8 A;  5AA2 D;  4XKP A;  2ZYM A;  4EF1 A;  2VHA A;  4OYV A;  3PUY E;  1FBD A;  1IUD A;  2GFE A;  2QMW A;  3G3I A;  1HSJ A;  2DWH A;  5ET7 A;  1NL5 A;  4FED A;  4H5F A;  3MUQ A;  3N6U A;  5K2X A;  3IOR A;  5I84 A;  4OFJ A;  2I3V A;  1IMA A;  3D1R A;  1SQY A;  1ZTY A;  3CI8 A;  1ATG A;  3KOT A;  3K2D A;  1USY H;  2X7P A;  3C35 A;  2V3U A;  2YPN A;  1M5C A;  1OLA A;  3C33 A;  4QF9 A;  3I6V A;  4U2R A;  1N04 A;  4ELQ A;  4XKR A;  1XT8 A;  4O8M A;  4MMP A;  3IO4 A;  5AA2 B;  2HCA A;  4U1Z A;  1Y20 A;  3EPE A;  1FTL A;  3CHG A;  3GLB A;  4GL0 A;  2F78 A;  1MXW A;  3WAF A;  4NAP A;  1F9B A;  3OO7 A;  3IB0 A;  3K0V A;  3IAZ A;  2P2A A;  1FBG A;  1JVX A;  4ZEK A;  1QKB A;  1LAH E;  3UN6 A;  4RXL A;  4PFY A;  5FTI A;  2GQ1 A;  4DE8 A;  2F3D A;  2NWJ A;  5JEI A;  2F7A A;  2XXW A;  3RN8 A;  2AIX A;  1XHY A;  2DXY A;  4ZDM A;  4YMB A;  1K9Y A;  3PPO A;  3RUM A;  2Q9T A;  4E0X A;  4GX3 A;  2F34 A;  3B6T A;  3OXN A;  3EF7 A;  1I6B A;  3ROJ A;  1TT1 A;  4ISU A;  3MQ9 A;  1FBH A;  4GX6 A;  2XXY A;  1FBF A;  3LR1 A;  1B1H A;  2O7I A;  1LFH A;  2VD3 A;  4P1L A;  3T93 B;  5I58 B;  1ZMG A;  1NH8 A;  1LBC A;  1FBC A;  5CI5 A;  4P9K A;  1QUI A;  5EQ9 A;  4GWU A;  4OWD A;  2VD2 A;  2WBB A;  2RCA A;  5FBP A;  1N3X A;  3O6G A;  3G3F A;  3RY3 A;  4JB7 A;  4HS7 A;  4QFK A;  3T9U A;  1IZ1 A;  1K9Z A;  4YU0 A;  5I2K B;  4NED A;  5I2N A;  5H8F B;  3BFU A;  1I6Q A;  2G29 A;  3U65 A;  4NF0 A;  3BIG A;  5TP9 B;  3HO7 A;  5EQ7 A;  1FQA A;  4FJP A;  1EU8 A;  1B5H A;  2ZYO A;  1MPB A;  3SKP A;  1ANF A;  2VGQ A;  3N26 A;  1NH7 A;  4ESW A;  4YB7 A;  4FIM A;  3PU5 A;  5H8H B;  4H65 A;  4Q0C A;  2IA4 A;  5ELV A;  1YXI A;  3ZSF A;  4BDR A;  4GVO A;  3CVG A;  5EYH A;  3FXQ A;  3SEU A;  5EQA A;  4GXS B;  4P11 A;  2P0S A;  4RY1 A;  1D9Y A;  1RDY A;  5EYG A;  4TLL B;  2I4B A;  3C36 A;  4QFN A;  3SEY A;  2QSX A;  5AE4 A;  3FUZ A;  1KWH A;  2Z8E A;  4GWW A;  1B32 A;  4JWO A;  3THI A;  3K01 A;  1ELJ A;  3KJT A;  2Z23 A;  2Z22 A;  4BDN A;  5LTC A;  1B52 A;  1N84 A;  1H76 A;  1A8F A;  5A5X A;  4NF5 B;  3EHS A;  2Q88 A;  4AQ4 A;  4POW A;  3KGC A;  1II5 A;  1NUZ A;  2I48 A;  3SZP A;  3FGS A;  1MDP 1;  3GXA A;  3ONM A;  4MNC A;  1MY4 A;  3IJO B;  4N07 A;  1MXU A;  2DWI A;  3V89 B;  5DTB A;  1MY3 A;  4ZE8 A;  3FV1 A;  3KBR A;  2V3T A;  1OLC A;  4PBH A;  5EHM A;  3TOD A;  3VVE A;  3VDF A;  1SW4 A;  3H06 B;  2F6G A;  3R6U A;  1SW2 A;  3LSL A;  1G0I A;  3OO9 A;  4EQ7 A;  1FQE A;  4PAI A;  4ZZA A;  1IMD A;  4AB5 A;  1P1N A;  2LAO A;  4RYA A;  4LQ2 A;  4O3A A;  4AS4 A;  2B4L A;  3FAT A;  1FBP A;  1AWB A;  3CFX A;  3D4G A;  4U23 A;  5CMK A;  5I5P A;  5J16 A;  1UTH A;  1NUY A;  4OEN A;  1A8E A;  3VXB A;  1XS5 A;  1DSN A;  4QFL A;  4KYE A;  3FD3 A;  1TFA A;  3OEL A;  1Y4T A;  4LZ8 A;  5DVJ A;  3QAX A;  1BTJ A;  3K1P A;  3FBP A;  2NOO A;  1NV5 A;  3C32 A;  1DPE A;  2PT1 A;  2RKM A;  1XOC A;  4OER A;  4RNS A;  3O66 A;  1LAX A;  2BJJ X;  3TTN A;  3C4M A;  3RPW A;  3VV5 A;  2FYI A;  3B50 A;  2GH9 A;  4OVT A;  3UGW A;  1OMP A;  1S7Y A;  4H6D A;  3TEP A;  4HTG A;  4YKP A;  2XWV A;  4NHB A;  4GXA A;  5LDZ A;  4N15 A;  1B7H A;  2HAU A;  3JYR A;  4KQP A;  2V84 A;  2H25 A;  3VVD A;  2XXI A;  5H8Q A;  5EYF A;  3PD8 A;  3EHU A;  4F1U A;  5I56 A;  2XX9 A;  5ISU A;  3LSF B;  4NWC A;  4KHZ E;  2DWA A;  2UVJ A;  3TZA A;  4MNI A;  2F6P A;  2Y7W A;  4G61 A;  1EH3 A;  2DSF A;  1SYI A;  3MVX A;  4GWX A;  1P1O A;  2KLF A;  4XEQ A;  4Q5T A;  2KQZ A;  3VLW A;  3PMX A;  1B7Z A;  5TPA A;  5A5L A;  4NF4 A;  3R7X A;  2ZZV A;  4QFP A;  4FOR A;  3DP6 A;  5F7V A;  2DE2 A;  2IEE A;  1PB9 A;  2O69 A;  3CR9 A;  1YYZ A;  4DLD A;  3O2A A;  3I3V A;  4NE4 A;  1B7U A;  3Q27 A;  3O29 A;  4PF6 A;  3OSQ A;  1IMC A;  4ESX A;  4N17 A;  1MXY A;  1LBX A;  1IMB A;  4PF8 A;  3O28 A;  3H3G A;  1NUX A;  3OEK A;  3MZ9 A;  3HN0 A;  2A5S A;  5T3J A;  4ELO A;  2O6A A;  1MXV A;  3IOT A;  3N94 A;  4OAN A;  5DT6 A;  3HHF A;  5KCJ B;  2ZMB A;  3ODB A;  4LUB A;  4YKI A;  3PPN A;  4N6P A;  4F22 A;  2OK2 A;  3QUF A;  2OWT A;  1M5E A;  3KN8 A;  3HHG A;  4ECF A;  4X9T A;  1YAE A;  3FXB A;  3RPL B;  3RNN A;  3OEM A;  5I59 B;  1SPI A;  2O84 X;  4Q30 B;  2XX8 A;  1A54 A;  4MLQ A;  1MQJ A;  5F24 A;  4IO3 A;  5CMM A;  3IFA A;  1IIT A;  1R1N A;  4XFE A;  2GHA A;  5BWJ A;  2F35 A;  1NV7 A;  4BLA A;  2QPQ A;  1TWY A;  3TDJ A;  2UVH A;  1GTK A;  3RTW B;  4PFT A;  1ZIU A;  5TU0 A;  4LVQ A;  1FCK A;  3T66 A;  1D3K A;  1FTK A;  3DP4 A;  1HSE A;  3DM0 A;  1UTB B;  1RYX A;  1JVY A;  2HFB A;  4IGT A;  4ZEI A;  4GBW A;  4PDD A;  4DI3 D;  3IB2 A;  1QGX A;  2OWZ A;  1JW4 A;  4MAG A;  3P7I A;  1EYJ A;  4OEV A;  4XXU A;  3DP8 A;  4GLI A;  4JWY A;  4U22 A;  1FW0 A;  1A7L A;  1OQH A;  1Y4C A;  5FTH A;  4IY6 A;  4GIZ A;  4RA1 A;  1BLF A;  3ZS6 A;  1URS A;  4H67 A;  1B3H A;  4U21 A;  4MIJ A;  1BP5 A;  3FJM A;  3C34 A;  4MEV A;  1LAF E;  3PD9 A;  3RQT A;  4X1D A;  5I2K A;  3SEW A;  5H8F A;  4FAT A;  2OZZ A;  5L8D A;  3WAE A;  1NI9 A;  3U92 A;  3OEN A;  3CSB A;  4EXK A;  2DS9 A;  3OO6 A;  4YB6 A;  5TP9 A;  1IME A;  4LN5 A;  5KZT A;  2Q8M A;  5I57 B;  3S9N C;  3MPK A;  3K1M A;  4P47 A;  3PUX E;  3M3L A;  5H8H A;  1I6A A;  4G68 C;  3O9P A;  4NTL A;  4AS5 A;  5AA1 A;  4MH5 A;  3EN3 A;  1FQB A;  3IR1 A;  3R26 A;  5AA3 A;  1SD3 A;  3G3G A;  3PPP A;  3TAJ A;  5AA4 B;  1CB6 A;  3VE1 B;  4IO4 A;  4YKJ A;  3QIM A;  4DXC A;  4RPN A;  3C9H A;  1P1U A;  3O6I A;  2Y7K A;  2A5T B;  1LBZ A;  4X1B A;  1XI6 A;  3FVK A;  4GWO A;  4F3P A;  3HFU A;  1NV6 A;  1RKM A;  4NQ8 A;  2FA7 A;  2QL3 A;  4NF5 A;  1DMB A;  1MG1 A;  3I5O A;  1GGG A;  2XWI A;  3Q26 A;  4N6D A;  3MVZ A;  4XIG Q;  3V83 A;  2O68 A;  4M1V A;  3CIJ A;  4GWY A;  2ESN A;  2O1M A;  1JQF A;  1FBE A;  1NV0 A;  4FEB A;  3UOR A;  4RK2 A;  1N3W A;  2FBP A;  4OTE A;  5L9S A;  3MWB A;  3K6W A;  2OPD A;  3T22 A;  2GRV A;  3FXU A;  3TTL A;  1DCU A;  2D3I A;  2R9J A;  2XXU A;  4WXJ A;  1NNT A;  4BDO A;  3MP8 A;  2UVG A;  4F31 B;  4N6K A;  3UP9 A;  3IB1 A;  4G4P A;  5HM4 B;  1PB8 A;  3PV0 E;  1QVS A;  3TTR A;  2DE4 A;  2F5X A;  3BKI B;  2CMO A;  2Y7I A;  3KZG A;  4GD5 A;  4NF8 A;  4KR5 A;  5DW8 A;  1S50 A;  3MAM A;  1J1N A;  1NKX A;  5IZZ A;  2UXA A;  3FVO A;  4KFQ A;  2UYE A;  3IOW A;  1Y3P A;  1EZP A;  2RC9 A;  2QJE A;  3V5A A;  4TQU Q;  1O64 A;  2HPG A;  4IR8 A;  1POT A;  4ELR A;  4N13 A;  2XWK A;  1OIB A;  2QMX A;  1IEJ A;  4H45 A;  2H5Y A;  1MPD A;  1QUL A;  3JV9 A;  5ICQ A;  4G8N A;  4P56 A;  3TTM A;  1US5 A;  1MQH A;  3SEV A;  3RLF E;  4R75 A;  1B05 A;  4UAB A;  4QHQ A;  1VFD A;  4HW8 A;  2H4I A;  3UK4 A;  4ZEB A;  4R9F A;  3TYH A;  2F7B A;  3W15 C;  3MST A;  1IXI A;  3DLN A;  4HXV A;  1LST A;  1NV3 A;  5HBC A;  4OVP A;  2V93 A;  4Q8R A;  1INP A;  4JVI A;  1MY1 A;  3E3K A;  4F18 A;  4PQJ A;  3TCG A;  4H1X A;  1N7W A;  3K4U A;  1FPF A;  1H3D A;  4QXD A;  1NNK A;  3IK6 B;  1O7T A;  4P1E A;  3RGY A;  4ELP A;  4R9G A;  2PFZ A;  3RTF B;  2E1S A;  3F11 A;  1UIU A;  3PUZ E;  2V25 A;  1MM7 A;  2WYK A;  1LCT A;  3CFL A;  4FAJ A;  2V3Q A;  3TKD A;  3Q29 A;  3FIR A;  1SW1 A;  4EDP A;  1BKA A;  3M3K A;  2F97 A;  4NX1 A;  1B6H A;  1Y9U A;  3L6G A;  3BBR A;  2X7Q A;  4WEP A;  3TCH A;  3E13 X;  3W9V A;  1MY0 A;  1Y3N A;  3VLV A;  4R6K A;  1ZLQ A;  4N8G A;  4O7I A;  1N76 A;  1WOD A;  1L5T A;  1IIW A;  2I4C A;  4PGP A;  1B5I A;  3LUY A;  4PAF A;  5H8N B;  4H0W A;  4IB2 A;  3A3U A;  2VPO A;  1M5D A;  1NV1 A;  4U4S A;  4DCY A;  4MNP A;  4NF6 A;  4OVR A;  3G3H A;  2RC8 A;  4NN3 A;  4GX4 A;  1CNQ A;  5BUU A;  3V8X B;  1FPB A;  4JBZ A;  2CEY A;  4LON B;  2I0C A;  2XD3 A;  2XA5 A;  1LFG A;  3IJX B;  4O7M A;  1R6Z A;  4IO2 A;  2B4M A;  2VPN A;  4MX6 A;  1UTB A;  2F7C A;  4MFI A;  3SDF A;  3S9L C;  3KN3 A;  1WDN A;  3TMG A;  3TTK A;  3N5L A;  2FHY A;  4HE1 A;  1LFI A;  2ZNU A;  4P8B A;  3CSG A;  4FEC A;  4EXL A;  4F3B A;  1JNF A;  5ITP A;  3G3K A;  3FXR A;  2ONK E;  4C0R A;  4U1O A;  1MDQ A;  1GV8 A;  2OX3 A;  1VE4 A;  4G77 A;  2PFY A;  3GYY A;  4IO7 A;  3VXC A;  4YZZ A;  2THI A;  3K00 A;  3KC1 A;  3QXM A;  2JJK A;  2DQV A;  4OEU A;  3KN7 A;  4PAK A;  1IMF A;  3UIF A;  2QVV A;  1FQD A;  1MXZ A;  1MH3 A;  5IGA A;  3K6X A;  4OET A;  4LAT A;  5ESY A;  2NVU B;  1LCF A;  4N81 A;  2FVZ A;  2AL4 A;  1B40 A;  3LV0 A;  1G0H A;  1JW1 A;  5J1D A;  4EQB A;  2ZNT A;  4MHF A;  4IO5 A;  3FJ7 A;  1UIV A;  1Q9D A;  3A29 A;  5ET5 A;  1P99 A;  3QMF A;  1ZKB A;  5IZ1 A;  4THI A;  2QVU A;  2QFL A;  1D9V A;  4POX A;  3C31 A;  4BDM A;  2ZZW A;  4GOT A;  4Z0I A;  4QSE A;  3Q25 A;  1Y1Z A;  2CZK A;  1IQ7 A;  3USD A;  1D4N A;  1QUK A;  3IX1 A;  4KI0 E;  4DIG A;  3ZKL A;  3TEL A;  4OXV A;  4HCW A;  1Z7N E;  2A5T A;  2Q8J A;  5AA2 A;  1P1W A;  1LBV A;  1QKA A;  2YLN A;  3GZG A;  5I3S A;  2M8C A;  4R6Y A;  1FRP A;  2P3V A;  2HXR A;  4I62 A;  1M5B A;  1OQG A;  1QUJ A;  2PX1 A;  3O97 A;  5ICT A;  2XXQ A;  4OVJ A;  2H99 A;  4F3S A;  5IZ3 B;  3MPL A;  4R74 A;  2ZYK A;  4M4G A;  2XD2 A;  4TOZ A;  1RDX A;  4Z7E A;  1PBP A;  3KJ7 A;  1O63 A;  5M2V A;  4GBV A;  3JZJ A;  4ONY A;  4PE3 A;  2Q74 A;  5CM6 A;  5CMC A;  1NNF A;  4I40 A;  4KPT A;  2ZYN A;  3LBS A;  1XC1 A;  1TFD A;  4G8H A;  4LP2 B;  4R2B A;  2HHM A;  4P3L A;  4WED A;  3SES A;  3W9W A;  4OES A;  1N0T A;  3SEX A;  3TFL A;  4H8I A;  3SET A;  4ZEC A;  5KDT B;  1YZ0 A;  2ONS A;  5I58 A;  5JTY B;  3NOH A;  4G68 B;  1LBY A;  3CG3 A;  1B3G A;  1MRP A;  3MC2 A;  1JEU A;  4HE0 A;  1B1X A;  1AH5 A;  1MQI A;  1T0K A;  1VR5 A;  5H8Q B;  4F2O A;  4DDD A;  4U4X A;  3U93 A;  3CG1 A;  2NXO A;  1EZ9 A;  1LAG E;  1H44 A;  2XXV A;  4BDL A;  4H46 A;  1B0L A;  4AB6 A;  2XWO A;  4GL8 A;  1ZJL A;  4RJZ A;  3T96 B;  3B8B A;  3FVN A;  3KSJ A;  4F1V A;  1R9Q A;  1SI1 A;  3N6T A;  4OFL A;  1FTM A;  4PDH A;  1Y1M A;  1S9T A;  1Q35 A;  4HE2 A;  5DEX B;  5ET8 A;  3KOS A;  4IGR A;  4R2F A;  4XTC Q;  5TPA B;  4JSO A;  3S9E A;  3LSX A;  1NUW A;  1NMU A;  4GWS A;  2O7U A;  1VFE A;  3U72 A;  1B9J A;  2I3W A;  2ALU A;  2DVZ A;  3OOA A;  3T9X B;  4I8C A;  1MH4 A;  3T9H B;  3M8U A;  3B6W A;  1RDZ A;  1ZU0 A;  3ILT B;  3MP1 A;  3PPR A;  4C1U A;  4YB5 A;  5K2Y A;  4F2Q A;  3KC0 A;  4O3B A;  1KZ8 A;  1B4Z A;  2H98 A;  3OO8 A;  3MYU A;  2CEX A;  3O6H A;  2REJ A;  1MM6 A;  2XX7 A;  5CBR A;  4DI4 B;  5FHO A;  1FSA A;  3FVG A;  2R71 A;  4F1Y A;  5CRY A;  3KFM A;  1LLS A;  4GFR A;  1B3L A;  2CZH A;  5CMB A;  4C1T A;  1KA1 A;  2B65 A;  3AXF A;  3PUV E;  2I0B A;  1N7X A;  3CFZ A;  1FPD A;  1MQG A;  3TQL A;  4ZZE A;  4YIC A;  3SER A;  4F29 A;  4EF2 A;  2D5W A;  4KXP A;  4JVD A;  4ND9 A;  4O3C A;  5CBS A;  5B7D A;  2L5V A;  3DEL B;  2CZL A;  4MJO A;  4H8J A;  4R73 A;  1NNP A;  5EQ8 A;  1MQD A;  3Q28 A;  3MP6 A;  1DK4 A;  2WEF A;  1B51 A;  4KCC A;  4DZ1 A;  1AIV A;  4GWZ A;  2ZXT A;  4PTK A;  3MBP A;  2WYP A;  3BIH A;  3LSW A;  5H8N A;  4OZ9 A;  1FPK A;  3S2V A;  4L17 A;  1ZBM A;  3QSL A;  5EHS A;  2GHB A;  2XXR A;  4JVC A;  3QUJ A;  3HST A;  1Y3Q A;  5IKB A;  2QS4 A;  3OMB A;  4PFW A;  3T0J A;  4FBP A;  4PP0 A;  4DXB A;  4LZ7 A;  2P3N A;  2OPE A;  2ZNS A;  1BIY A;  4ZE9 A;  2PVU A;  3B6Q A;  1FQC A;  4MF3 A;  3E78 A;  2DYX A;  3BFT A;  3IO6 A;  4MBP A;  4RPO A;  1WVJ A;  3H4Z A;  1XVY A;  3FAS A;  2DDK A;  3MJN A;  3H6V A;  4JWX A;  1H43 A;  5DVF A;  4LQ5 A;  3RT8 A;  2ZZX A;  3PUW E;  3S4U A;  4QSD A;  3KBZ A;  5DVI A;  1OVT A;  2RF1 A;  1FPI A;  1SVX B;  4IY5 A;  1SDX A;  4PE5 B;  2I6E A;  2MKZ A;  2OWS A;  5ET6 A;  3GBB A;  4P0G A;  4PFI A;  1POY 1;  2B3F A;  4YAH X;  1FPL A;  4ZEF A;  2Z8D A;  3HCQ A;  1AL3 A;  2DVC A;  1JW5 A;  4K3F A;  3OD7 A;  2Y5L A;  3FZV A;  2I49 A;  4MCO A;  1B58 A;  1FJ9 A;  4KYD A;  2I58 A;  5IM2 A;  2XXK A;  4PFB A;  2NUV A;  2QS3 A;  4XKN A;  4UA8 A;  1YTV A;  2XXT A;  1SW5 A;  2FIX A;  1LEV A;  1B3E A;  1MY2 A;  1SI0 A;  3IOU A;  2G93 A;  5F1Q A;  1B46 A;  3E9X A;  3K02 A;  3TUS A;  3H6W A;  3RYD A;  3PMW A;  3HPI A;  2Y5K A;  1RYO A;  3D4C A;  2RC7 A;  1SBP A;  2HZK A;  1JP4 A;  2QS2 A;  2AL5 A;  4OQO A;  4PET A;  2V4C A;  1DOT A;  4PFU A;  4IO6 A;  1PB7 A;  2QS1 A;  2R8T A;  4PCD A;  4PC9 A;  4LZ5 A;  5LOM A;  3PMV A;  4WKM A;  5KCJ A;  1FTA A;  4I1D A;  5FHM A;  2ABH A;  3GBA A;  3S9M C;  1P1Q A;  4I9D A;  3K6U A;  3RPL A;  1A99 A;  3VVF A;  4N91 A;  5I59 A;  5L9O A;  1USY E;  2F36 A;  2H9B A;  2ONR A;  3PGF A;  1LGB C;  2XXH A;  1OVB A;  1MPC A;  5IZ3 A;  3CRB A;  5B70 A;  3U1O A;  1MXX A;  1FJ6 A;  4NF8 B;  2WX9 A;  3T1B A;  1FTJ A;  1PBQ A;  4H5G A;  2XHD A;  4F39 A;  2X26 A;  2PCR A;  5JK4 A;  2FNC A;  4P0I A;  5I2N B;  1YPN A;  4ZED A;  1AOV A;  2VP1 A;  3G7W A;  4QFO A;  2ANJ A;  1NV4 A;  4HCY A;  4QSC A;  4TLM B;  1GR2 A;  3E4R A;  1Q1K A;  1B0H A;  2Y7P A;  5KDT A;  2KR0 A;  4N8Y A;  5JTY A;  3MW0 A;  4G68 A;  2QRY A;  2OCU A;  3KSX A;  3M3F A;  3ECR A;  1PDA A;  2Q2A A;  3MVY A;  4JXI A;  2DE3 A;  2F3B A;  2Y84 A;  1DTG A;  1BK4 A;  4XKQ A;  1JEV A;  1A55 A;  1FTO A;  4R6H A;  4DCX A;  2PYY A;  4DXU A;  1VSO A;  4E0W A;  2QVR A;  4NG7 A;  3A3C A;  1M5F A;  4X8R A;  1FQF A;  2O1L A;  1DPP A;  3U8Q A;  2F8D A;  3H6T A;  5L9M A;  1I69 A;  2RCB A;  3U94 A;  5HPQ A;  4MLV A;  1UQW A;  3QK6 A;  1QJM A;  3A09 A;  4EUO A;  1LB9 A;  5DEX A;  4OA4 A;  1LBW A;  4OMB A;  5IAI A;  3LC8 A;  2XXP A;  2REG A;  4I3E A;  5I57 A;  3K1N A;  2HAV A;  1URD A;  4PFR A;  3TCF A;  1EYI A;  2HEU A;  3H6U A;  1GVC A;  2BJI A;  2VOZ A;  5A5X B;  3PPQ A;  1IXC A;  2Q89 A;  2Z8F A;  1IXG A;  2E0S A;  4GRK A;  2DOJ A;  4EQ9 A;  1FPG A;  3PTY A;  3VFJ A;  4NGU A;  5I7I A;  4KCD A;  3ZKK A;  4KD5 A;  4NWD A;  5AA4 A;  2P1S A;  1NFT A;  5H8S A;  1R9L A;  4RK9 A;  2OBG A;  4G2Z A;  1TXF A;  2PT2 A;  1D9Q A;  2CZI A;  4KYS A;  3TQW A;  4LA9 A;  2W7Y A;  3TPA A;  3G3J A;  4F3G A;  3RT6 B;  3MVW A;  4X04 A;  4ZS9 A;  3B7D A;  4JDF A;  3KG2 A;  3H03 A;  3MZ1 A;  1XVX A;  3ISP A;  1HSL A;  3H7M A;  1B2H A;  4GQO A;  1LBB A;  2DWJ A;  3FJG A;  1QW0 A;  1Z7M E;  4QBA A;  4X48 A;  2OLB A;  1A40 A;  1YCJ A;  4N4U A;  2HQ0 A;  4BDQ A;  1AMF A;  1MS7 A;  4G8M A;  3IOV A;  1JET A;  5CC2 A;  2PMS A;  4XF5 A;  4NF6 B;  4JSD A;  3HV1 A;  2RIN A;  1PEB A;  2VT5 A;  1UTH B;  4OVQ A;  4OHN A;  3UA8 A;  3IL1 B;  1EYK A;  1B3F A;  4I3Y A;  3KEI A;  2DP8 A;  1B5J A;  4GF8 A;  2UVI A;  2HXW A;  4OVS A;  3E79 A; 
#chains in the Genus database with same CATH homology
 4KXP A;  4JVD A;  4PBQ A;  1FPF A;  4QXD A;  4P1E A;  1FPJ A;  2L5V A;  1DBZ A;  2PFZ A;  3EKI A;  4MNI A;  4G61 A;  4MJO A;  4GWX A;  5EQ8 A;  2WYK A;  4O94 A;  4XEQ A;  1DK4 A;  2KQZ A;  2V3Q A;  2WEF A;  5A5L A;  2ZZV A;  2WBD A;  4GWZ A;  4NX1 A;  4PTK A;  2WYP A;  2DE2 A;  3BIH A;  1FPK A;  1YYZ A;  2FIE A;  3W9V A;  4JVC A;  4F19 A;  4PF6 A;  1KA0 A;  4N8G A;  4O7I A;  1IMC A;  1NV2 A;  3IFC A;  3T0J A;  4FBP A;  4N17 A;  4PGP A;  1LBX A;  1IMB A;  1FPE A;  3LUZ A;  2P3N A;  4PF8 A;  1VDW A;  1NUX A;  4PAF A;  4PGN A;  2HZL A;  3E78 A;  5T3J A;  2VPO A;  1NV1 A;  1FBD A;  4OAN A;  4MNP A;  4OVR A;  2DDK A;  5ET7 A;  4NN3 A;  4GX4 A;  1CNQ A;  1FPB A;  2ZZX A;  2CEY A;  4X9T A;  1IMA A;  3D1R A;  3FXB A;  3RPL B;  3KBZ A;  2XA5 A;  1FPI A;  1SPI A;  4O7M A;  2MKZ A;  2B4M A;  2VPN A;  4MX6 A;  5ET6 A;  5F24 A;  4PFI A;  1FPL A;  3IFA A;  4XFE A;  2Y5L A;  2FHY A;  1NV7 A;  4MCO A;  1FJ9 A;  4O8M A;  2QPQ A;  4MMP A;  4HE1 A;  4P8B A;  5IM2 A;  2XXK A;  3CHG A;  4NAP A;  4PFB A;  2FIX A;  1LEV A;  4GBW A;  1FBG A;  2OX3 A;  4PDD A;  4DI3 D;  1QGX A;  2OWZ A;  2PFY A;  3GYY A;  4YZZ A;  2GQ1 A;  4MAG A;  3KC1 A;  1EYJ A;  2F3D A;  2JJK A;  3RYD A;  4PAK A;  2Y5K A;  1IMF A;  2QVV A;  2HZK A;  1JP4 A;  5IGA A;  1K9Y A;  4PET A;  2V4C A;  2Q9T A;  4GX3 A;  4MIJ A;  5ESY A;  3ROJ A;  4PC9 A;  2R8T A;  4PCD A;  4MEV A;  4N81 A;  1FBH A;  4GX6 A;  2FVZ A;  1FTA A;  1FBF A;  3LV0 A;  1G0H A;  4P1L A;  5J1D A;  4MHF A;  1FBC A;  3RPL A;  1Q9D A;  3A29 A;  5ET5 A;  4P9K A;  1NI9 A;  3QMF A;  5EQ9 A;  4N91 A;  4GWU A;  5IZ1 A;  2QVU A;  2QFL A;  2WBB A;  5FBP A;  2ZZW A;  1IME A;  4LN5 A;  2CZK A;  2Q8M A;  1K9Z A;  4P47 A;  5IZ3 A;  3U65 A;  4HCW A;  1LBV A;  4NF0 A;  4AS5 A;  3BIG A;  1FJ6 A;  2WX9 A;  3T1B A;  5I3S A;  5EQ7 A;  1FRP A;  2P3V A;  2HXR A;  2PCR A;  5JK4 A;  5IZ3 B;  1NV4 A;  4HCY A;  1LBZ A;  1XI6 A;  1RDX A;  1YXI A;  2KR0 A;  5EYH A;  4N8Y A;  5EQA A;  3HFU A;  4GBV A;  1NV6 A;  4NQ8 A;  1RDY A;  4PE3 A;  2Q74 A;  5EYG A;  5CM6 A;  4I40 A;  2DE3 A;  2XWI A;  2F3B A;  2HHM A;  1BK4 A;  4N6D A;  4P3L A;  3W9W A;  4M1V A;  4GWW A;  4GWY A;  1FBE A;  5LTC A;  1YZ0 A;  2QVR A;  4NG7 A;  1NV0 A;  4X8R A;  3NOH A;  1LBY A;  2FBP A;  4HE0 A;  4OA4 A;  1DCU A;  1LBW A;  1NUZ A;  4H46 A;  4I3E A;  3SZP A;  4PFR A;  1EYI A;  4MNC A;  2BJI A;  4N6K A;  2XWO A;  3B8B A;  4F1V A;  4PBH A;  4PDH A;  2DE4 A;  2F5X A;  4HE2 A;  5ET8 A;  1G0I A;  5DW8 A;  1FPG A;  3PTY A;  4NGU A;  5I7I A;  4PAI A;  1IMD A;  5IZZ A;  1NUW A;  4GWS A;  4AS4 A;  1D9Q A;  2CZI A;  2B4L A;  2DVZ A;  1FBP A;  1AWB A;  2HPG A;  4IR8 A;  1RDZ A;  5I5P A;  5J16 A;  2XWK A;  4X04 A;  3KC0 A;  1NUY A;  3ISP A;  1KZ8 A;  4H45 A;  4F1U A;  3MYU A;  2CEX A;  4P56 A;  3FBP A;  4QBA A;  1NV5 A;  4N4U A;  4DI4 B;  1FSA A;  4UAB A;  3B50 A;  4XF5 A;  4OVT A;  2CZH A;  2VT5 A;  4OVQ A;  2XWV A;  4NHB A;  1KA1 A;  3MST A;  5LDZ A;  4N15 A;  4HXV A;  1NV3 A;  1EYK A;  4OVP A;  1INP A;  4JVI A;  4I3Y A;  1FPD A;  4F18 A;  4OVS A;  4YIC A;  3E79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...