1AWCA

Mouse gabp alpha/beta domain bound to dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
IQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVIECEQKKLARM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of GABPalpha/beta: an ETS domain- ankyrin repeat heterodimer bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*AP*(BRU)P*GP*AP*CP*CP*GP*GP*AP*AP*GP*TP*AP*(CB
total genus 36
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1awcA00
3GZ5A 5LHGA 1BI0A 2RDPA 4A2UA 4N0BA 2OQRA 3F23A 1ZREA 1XCBA 3GFJA 2E7WA 3HRMA 4ZZLA 2VBWA 4UVCA 3J80K 3K2ZA 5L3CA 5ICGA 4GYIA 3HHHA 2L4AA 1ULYA 1S6LA 3GLXA 3I71A 2L4MA 1RIOH 1T6SA 4NQWA 4M72A 4MQVA 4UVBA 4KIBA 3SZTA 1O7FA 2YU3A 4YFKF 3K1PA 3WTTC 3DEUA 1IN5A 3LSTA 1FBSA 2PQ8A 2XAJA 2JT1A 2DPUA 1O3QA 1RUOA 1OPCA 2EFOA 4XSZF 2RN7A 1FC3A 3LQQA 3VB2A 2V79A 1ODDA 4KDPA 1G3WA 5AONA 1BOAA 3VEPA 2ZFWA 4BYYA 3HOSA 3E5UA 3P9KA 3K1NA 5K5RA 3BP8A 4FX4A 3QPHA 1G6NA 2E1CA 3T1BA 3V4GA 1IXRC 3DPLC 3P9CA 1KQ8A 2NNYA 5JHUA 5D8KB 2W25A 2X4HA 3R4KA 3H3UA 1I5ZA 2STTA 3U2RA 1RZ4A 3SQNA 2HGCA 2RVCA 2ZMEA 2G7HA 1W5TA 2FQ3A 2RC4A 3H3ZA 1XB4A 2GZWA 2XAQA 3ULQB 3LAPA 4EM2A 3C1DA 1BIBA 1BC7C 2IA2A 1LVAA 1IXCA 2OZUA 1Z9CA 3TQNA 3J81K 3OV8A 1G3SA 2F5DA 3GX4X 3LFKA 1FLIA 4CGZA 5AIQA 3REOA 1ONVA 2DBBA 1HW2A 5FB2A 3E5QA 3GW2A 1IN6A 4A0ZA 4R8HA 2BEOA 5FD6A 4UHTA 4IRIA 3ML6A 5CVJA 4LB5A 3OOPA 1YIOA 3TO7A 2MD5A 2K02A 3U9GA 3L9FA 3ISPA 4EJUA 3F21A 2HZTA 3MCZA 4LG0B 3KFWX 5DDGA 3BJ6A 1H0MA 2DO7A 3I58A 4I01A 4YFXF 1IZ1A 5FGMA 4G6QA 1H9TA 1FYMA 2FMYA 5LRSA 3KP2A 2H09A 3SXYA 2ELHA 1YFHA 2M5WA 1HKTA 4P55A 1G3TA 2GWRA 5BS6A 2DK8A 3SZPA 5E20A 4L18B 1HW1A 2GA1A 1P6RA 4P5OA 3G3ZA 1HSJA 3TKYA 1PP7U 4HF1A 2ZXJA 2LKPA 4Q48A 2HYGD 4IXAA 4MTEA 4N9IA 4E70A 3RKXA 4EQQA 2J5PA 3LA3A 4KIGA 2ESNA 3RIRA 1H9GA 4OIQF 2CQKA 3MZYA 2HOEA 3HSFA 5FO5A 2VONA 2O8XA 4LB6B 2A6EF 1CGPA 4ESFA 4LGWA 3QU3A 2W85A 3ECOA 2VN2A 4NB5A 1JE8A 2QWWA 4AIHA 4CDGA 3Q9VA 2OQGA 1XMAA 1MJ9A 2OBPA 2ZO4A 3EQLF 4EJWA 1ZRCA 1BM9A 3ELKA 5D8LB 4XLNF 4I09A 4JBAA 1REPC 2KKOA 5KK1A 2R7DA 2DAOA 3RI4A 3ECHA 3QAHA 1SFXA 5CVUA 2QUFA 1DPRA 1GXQA 3DV8A 1LDJA 3EYIA 1JGSA 5AIPA 4PDKA 2HS5A 3L7WA 1SD5A 5J8CA 4A6EA 1ZAOA 3ZMDA 5ILUA 3NEUA 4G6DA 4OU0A 2JSCA 3JSPA 4U0YA 1XD7A 1Z1DA 1T98A 3GYHX 3I5UA 3DPTA 1FP2A 2MA3A 1G4DA 5KVRA 1LQ1A 5JI6A 2L01A 4HDVA 4HLXA 1FZPB 1YW7A 5D5WB 3DQVC 2NAZA 2BBYA 1QQIA 5TJJA 3F6OA 4A6DA 5L3EA 1MDMA 3BWGA 3DXJF 1P4AA 2K86A 2P6TA 2PLYA 5BQTA 1PP8F 5EEGA 5F1RA 2VC1A 3F8FA 1FBUA 4IPAA 2IW5A 4RGXA 2HR3A 3LA2A 4GXOA 1PDNC 2O61A 4B09A 4WCGA 5DYMA 1E17A 4AIJA 4LLNA 4OINF 3HSEA 4IRGA 1F9NA 4KIFA 3GUDA 5J8FA 5L3FA 1Z6RA 5LHHA 1ON1A 2Q0OA 3V8JA 4BAYA 2LF8A 2P7VB 4M6XA 2BV6A 4LFUA 4KMUX 1KU7A 4G9YA 1I27A 1OYWA 2R3SA 3Q9SA 3B73A 1FOKA 2GA2A 4PGGA 4LK1F 1HQCA 2DK5A 2NS0A 4LK0F 3F22A 1B59A 1HW5A 4Q47A 3GFMA 2NRAC 3FX3A 1XSXA 3KP3A 1SD4A 3Q5FA 3WGIA 3HRSA 5D5UB 1U5TB 4G7HF 3IWFA 3ROUA 3CTAA 1B6AA 4R79A 4MQ9F 3IKTA 1B4AA 1D8JA 2A5YB 4UV8A 4YIFA 5E1WA 1X3UA 4S05A 1K78B 4R1HA 3LQRA 2P7CB 2H94A 1TNTA 1EH8A 3EDPA 2EFWA 1XDUA 4RAYA 2RNJA 1S8NA 5ERIA 3E97A 3QU6A 5BMZA 4KT5C 4HV6A 5LLQA 3O2PE 3JSOA 3N97A 1IRFA 3HTUA 2D1VA 3GWZA 2ZJ2A 4HX7A 1F4KA 1Z05A 3RYRA 3C3WA 4I0AA 3B02A 5CVVA 1IRGA 5FLXK 4A0YA 3NQOA 4EJTA 5K5OA 2F5CA 4CZZA 5E18F 2A69F 1U5TA 4KA4A 2HWVA 3HRUA 4BNCA 4EJVA 5HVQC 2QBYA 4Y13A 2YX4A 2FEZA 5LGTA 1BI2A 4OMYA 2Z5UA 4HLYA 4Y15A 4BXUA 2XHKA 2IPQX 5TRDA 1I6XA 1J59A 1MKMA 4EGYA 3JAMK 4XSXF 4FT8A 3F8CA 1PUEE 3PQJA 2HFHA 4MHGA 2FU4A 1YO5C 3IC7A 3FXRA 4F7ZA 2UZKA 1FYLA 4RAZA 3WE2A 1U3EM 4EM0B 1P92A 1KA8A 5DD4A 1YS7A 1K79A 2YPRA 3I0TA 4XBFA 1BBYA 4ESBA 1P2FA 2LDUA 2OD5A 4IF4A 1U8RA 4Y17A 3MQ0A 3RYPA 2FF4A 1ZLJA 2TDXA 4KUMA 4HQMA 1IUYA 1JHHA 3F8BA 1TW3A 1D3YA 1QNTA 2O3FA 5FD5A 1SAXA 2Z9OA 4HYEA 2EJRA 1ZN2A 3MEXA 3ABUA 3V8LA 4RGRA 2XROA 1WRJA 1KU3A 1UHMA 1MJBA 2KRFA 3W6KB 4NHJA 1XSVA 1EH6A 4U0WA 4I7HA 2BE5F 1R1UA 4AVPA 5LGUA 4HDUA 4OIOF 2K27A 2VC0A 5DEQA 4HQEA 1IXSB 4M9SA 3GEZA 2B0LA 2Z33A 4YFNF 1KU2A 3CLOA 1SFUA 1Z91A 1LDDA 4KYWA 3E3VA 5LBQA 2E1NA 3R61A 1YW9A 4O3MA 5DD8A 2H27A 2XRNA 4JK1X 1W7PD 2UXNA 1ON2A 2XKOA 4L5IA 1VTNC 3ZQ7A 3WTXC 1LB2A 4PZJA 2PEXA 3SFZA 1RUNA 1BIAA 4ON0A 3ZN0A 2JPCA 4ZYDA 4BHCA 3WGHA 5E1XA 3LA7A 3WGGA 4L0YB 2GXBA 3L09A 1BI1A 2A3SA 1ZG5A 3T5XA 5ICCA 1QZZA 5LRRA 1R22A 3I54A 1DP7P 4HOBA 4PGHA 5ILSA 2LF7A 3GO5A 4LD5A 3DFGA 1UB9A 2HTJA 4K2EA 2FSWA 3VFZA 2YSRA 5E8IA 2VOOA 1T39A 4KFCA 1FY7A 3IWZA 3CUQB 1R5GA 4RB3C 2Y75A 1D5VA 1V4RA 4G94A 2XAGA 4CXFA 1DDNA 3ZMSA 2HYFA 2KJBA 3WTWC 4BH9A 2DW4A 1AOYA 4WXCA 1OKRA 3I59A 5E17F 3TO6A 2DQLA 5HS7A 3GZ6A 2M8EA 1MGTA 1FNNA 2XKPA 2EV6A 4CYDA 2CWEA 3HYIA 3KLOA 2H6BA 3ZPLA 2P8TA 3KP6A 2VOPA 3FMSA 3D5LA 3KZYA 1R36A 3DP7A 4G8XA 3CUOA 2QENA 3WTSC 2QQ9A 3RJPA 3WODF 2VODA 3HRTA 3F8NA 5HS8A 2IJLA 1GHCA 2UWMA 1FBQA 5DCFA 4KICA 3BPVA 3F8MA 3FMRA 4IVNA 2F5FA 1W5SA 2GQQA 2EA4A 4G7ZF 2FOKA 3HOTA 1FSHA 1U78A 3F3XA 2VBXA 2CG4A 3FXQA 2FMLA 1R1TA 1QPMA 1KYZA 3R0AA 2NYXA 2P5KA 2K4JA 3MWMA 1U2WA 3T8RA 1KQ0A 4N9HA 2Y48A 4CO8A 1P4WA 1Q1HA 3R6SA 1FPQA 2ETHA 2PG4A 4TV7A 4HBLA 2UXXA 4A12A 4B8XA 2VXZA 3FHZA 3KP4A 1KYWA 2GAUA 3M9AA 2O6GE 3I4PA 3FM3A 3BPXA 2RKHA 3I64A 2DTRA 3QPTA 4AIKA 1QGPA 2FE3A 2ISZA 5HDNA 4H0EA 3GFLA 3WU0A 4M6YA 1IN8A 2EFNA 2AS5F 2A68F 2P6SA 3IHUA 2ZCWA 3IKVA 2QQBA 1O3TA 4U7DA 1XGNA 2M1BA 1A04A 2EK5A 3JTHA 3KCCA 3FM5A 4UXNA 4MTDA 2ADUA 3NRVA 2R7FA 1UCRA 1IAWA 4ENKA 3WTVC 1CF7B 4GO1A 2P4WA 2MBFA 1L3LA 2FBHA 3O6BB 3CUQC 3KLNA 3CJNA 1IN4A 5H6QA 3BJOA 1ZHFA 5CJ9A 1KQ9A 2O0YA 2H6CA 4A0XA 2XV4S 1T2KA 5H6RA 3J80Z 4YG2F 1V3FA 1TQPA 3TO9A 4OMZA 2FBKA 4PCQA 2QLZA 2J5OA 3FXUA 3R0JA 1ZG3A 5DUKA 1K7AA 1MD0A 3C7JA 1O7LA 2EB7A 1C0WA 2KJCA 2XVCA 1BI3A 2V1UA 1TLHB 2K7LA 3JTGA 1WI9A 4O6JA 5L3DA 2PMUA 2PI0A 1RNLA 5K1YA 5BOXA 3DKWA 4M9XA 5D5VB 2D1HA 3K0LA 4FHTA 1XDSA 1F1ZA 4U0VA 2WC2A 3ZMUA 4HA8A 3M8FA 5F64A 2PBIA 2PJPA 2EFQA 4WF2A 1R58A 3J7AO 5JVTA 4L0ZB 4GYGA 2L3DA 2L54A 3P9IA 1SFEA 2OAZA 5K5QA 1J7KA 4G7OF 2GIVA 1QZYA 2OZ6A 1W7PA 5ED4A 3W6JB 3RTRA 4EVIA 1WWXA 2STWA 4IHSA 4WXHA 1WQ2A 1HSTA 3CDHA 4RB1A 4HV5A 4Q4ZF 2MH9A 3KZZA 1S7AA 1TBXA 2RGVA 3CO6C 2JZYA 2YR2A 2M87A 4BQAA 2VE8A 2K4BA 3CO7C 2V6CA 3KETA 3MAJA 3KEOA 4LG0A 1YLFA 4MNUA 4Z2YA 1K6OA 2O03A 1O57A 3JW4A 4KNYA 5IT9K 4EGZA 3C18A 3WTUC 2IT0A 3ZMTA 3N4MA 4AWXB 2A61A 1S3JA 1T38A 3J81Z 3HHGA 3P7NA 2FBIA 2IA1A 2COMA 1KGSA 1WKMA 2IVMA 2EWNA 4I0BA 1XGMA 1R23A 3IRQA 2WTEA 3E6DA 3RKYA 2HEOA 3HUGA 3V7CA 3K9TA 3PFIA 4GCVA 2WWYA 1NHAA 1OR7A 3QP5A 4ESJA 1K78A 1F5TA 3EYYA 5J6XA 1O3RA 5D4RA 4I2OA 3KEQA 4EM1A 4DQ2A 4ENMA 3LWFA 5DUIA 3K1MA 3BJAA 1R00A 2F2EA 5D6FA 1O3SA 4JQFA 5ILVA 3FMQA 3V8KA 2CFXA 2VBYA 1Z7UA 2KIFA 3QP6A 3L00A 3BROA 3FWEA 5A2QZ 1JHFA 1J5YA 5A2QK 3LAJA 5BPDA 1YS6A 5HLIA 2FNAA 4HW0A 5CYVA 1ZYRF 2L02A 1ZGAA 3E6BA 5D5XB 4HZFA 4S04A 2XAHA 3HTSB 1HBXG 2QYOA 1YG2A 3T0YA 2MC3A 2EV0A 1RI7A 2DU9A 3IRRA 2ISYA 1CF7A 1L0OC 2HTSA 1BC8C 2PN6A 1I1GA 4WXDA 1UHWA 4ZYEA 3VOEA 1TTYA 4ZYGA 3HSRA 3AAFA 1DUXC 3KP5A 3GVAA 3G73A 1XGSA 2ESHA 3MZHA 5BPIA 4RB0A 5D4SA 5H20A 2YX7A 1U6GA 3GF2A 4IRHA 4BHBA 1SMTA 1P4XA 2LNBA 3TDUC 2OA4A 5HS9A 4LJZF 4YIIA 1HXDA 1S7OA 2JTVA 3DF8A 4ZYHA 1OMIA 2F5EA 4WX9A 5FLXZ 4P9FA 2Q8KA 2QZ8A 3BOQA 2ZMEB 4XRFA 1Y0UA 1U5TC 2HKXA 4BHPA 1MZBA 4GGGA 1J75A 2Y0MA 1TQMA 5JR3A 1EH7A 2A6HF 4U7BA 2VT3A 2XIGA 2WV0A 4L9TA 4WK8F 4M71A 1Z6TA 4L9VA 2BGCA 2NNNA 3GXOA 4MGRA 2HQNA 3BZ6A 2CSOA 3U1DA 2V9VA 2DFIA 1FP1D 4LMYA 3SHFA 2ZKZA 2X0LA 4EJOA 3GFIA 4UVAA 2CW0F 3ZMZA 4I98B 3R60A 5DV5A 1XMKA 4ENNA 5E1ZB 5LEJA 2C6YA 3TOBA 1FT9A 5HLGA 2XGXA 1TW2A 3RDIA 3K69A 1ZG1A 1I1SA 1R5HA 3E6MA 5LHIA 2JPBA 3ZN1A 2W24A 2Z99A 2PMHA 1WSUA 2OU2A 4QWQA 2GXGA 1GVJA 1S29A 2DQRA 1LEAA 4MEXF 3M8EA 4AD9A 4KN7X 2HKOA 3COAC 1UFMA 1BN5A 4M9ZA 2G9WA 4KMFA 4UNOA 1ZGJA 1MJAA 5HLHA 3JAMZ 1OYIA 1B9NA 1W7PB 3VODA 2FRHA 1TQIA 2QBYB 1XCVA 4HX4A 4O5VA 4RB2C 2KIMA 4EMSA 2BYVE 3ZMVA 3TOAA 2VE9A 3BDDA 3RPUA 4ASNA 1XGOA 1LJ9A 2VBZA 3IL2A 1HKQA 3H92A 4KN4X 3RKWA 3I53A 2MH2A 5ICFA 3WTZA 3EETA 4A5MA 4CICA 1QO0D 2P5LC 1J9IA 3V7SA 2M30A 2E7XA 5CVIA 4M73A 2W57A 4I02A 5EEHA 3WE3A 4P9UA 5ICEA 3WG9A 4XLPF 1LEBA 1J2XA 1FSEA 2EFPA 3T8TA 4IHTA 1YW8A 5FFXA 4QLCU 1BJAA 1R1VA 2JRTA 2FNPA 1TNSA 2AXLA 2QM3A 3RPQA 5FFZA 1ZRFA 2G7UA 5HDGA 1IW7F 1B1BA 2CGPA 2Q2EA 2P5VA 2EA2A 4HF2A 2W84A 5IT9Z 4L9NA 2RV8A 5HOOA 3E6CC 4RGSA 3M7GA 1J0RA 3BY6A 2DI3A 3F72A 4HX8A 2XUBA 2Z3YA 5HDKA 4RS8A 2ZNYA 1USTA 4MEYF 4L5JA 1ZRDA 5L3GA 2EV5A 6PAXA 1SMYF 2V1XA 2DT5A 5CLSA 2ACJA 2FA5A 3V7RA 2XASA 4IJAA 3KE2A 2LSOA 1FX7A 3QRFF 4Q5SF 4L9JA 3F6VA 5DCMB 4P96A 2CO5A 1YTYA 4OIPF 4A5NA 1STZA 4FX0A 4M74A 5IT3A 2FXAA 5CVRA 4EV0A 3WTYC 2QVOA 2HDCA 4U88A 3WU1B 3ERED 2VT2A 3QOPA 4ETSA 1E2XA 3M1EA 2D45A 4LLGF 4ZH4F 1MDMB 1W4MA 1B9MA 4CHUA 2ZBKA 3EUHA 1QBJA 1DPUA 1LNWA 4LLLA 1SD6A 3FF5A 3ABTA 2CYYA 2IP2A 3FZVA 1ZLKA 1G3YA 2D2WA 1ZH5A 2QQAA 1EV7A 3ZP5A 4OOIA 2ZNZA 2RQPA 1GXPA 2MLKA 2V1DA 4UV9A 1T0FA 1JXSA 1XSDA 2DPDA 1SD7A 1LDKB 2A07F 4HF0A 2XAFA 1OYYA 5LEKA 1YYVA 4OIRF 1XN7A 3I59B 1IF1A 5DCMA 4D0PA 5E8GA 5F6FA 1FWZA 4WWCA 4RGUA 5JFRA 1D8KA 3MFKA 3CUQA 2PFBA 4HAMA 3HIFA 3TGNA 2DLLA 2IA0A 2HQRA 1YQAA 4DNCA 3L2CA 1FYKA 3E5XA 5L3BA 2M45A 3S2WA 4ZZDA 1AWCA 1KU9A 2KIUA 3D0SA 3TDZC 2MLGA 5D6EA 1IN7A 1R7JA 1HKSA 1ZARA 4ENJA 1USSA 5LGNA 4UUVA 2IRFG 3PQKA 3KP7A 3O3KA
chains in the Genus database with same CATH superfamily
1PUFA 3W2VA 3GZ5A 5LHGA 1BI0A 5M3FJ 2RDPA 3K2AA 3BR2A 4I76A 3CZ6A 3PFYA 4A2UA 4N0BA 2HXIA 2WAFA 2OQRA 2JVGA 3F23A 5J3LA 1ZREA 1XCBA 3GFJA 2E7WA 3HRMA 3B6AA 1HDDC 4ZZLA 2MG4A 2VBWA 4UVCA 3CF2A 3J80K 4PFPA 1E0EA 3M1CA 2DOEA 3K2ZA 3LSGA 5L3CA 2M34A 2ELKA 3VYSB 4B3XA 5ICGA 4GYIA 1ERDA 3JRGA 2EIMH 3HHHA 2L4AA 1ULYA 1S6LA 1WJEA 3FISA 3GLXA 3I71A 2L4MA 4BJ6C 1RIOH 2R7ZJ 1H89C 1T6SA 1BW6A 3M8JA 4NQWA 4M72A 4BU2A 4MQVA 3H9GA 4OAZA 4UVBA 2M8GX 4KIBA 2MC4A 3SZTA 4RDUA 1K4SA 4FTHA 1O7FA 2YU3A 4YFKF 2FJ1A 2LVSA 3JRCA 3K1PA 3WTTC 1VF9A 3DEUA 4PJ0C 3K4KA 2OV7A 1IN5A 3LSTA 1WJCA 3A2KA 2GBYA 1FBSA 1K83J 2PQ8A 2XAJA 2NVQJ 1BR2A 1MMAA 4XORA 2JT1A 2DPUA 3FXOA 1MH4A 1SVLA 2WAQA 4RLQA 1XX5A 2K3PA 1O3QA 3AL0C 1N77A 1OPCA 1RUOA 2EFOA 3PUFA 1ETYA 2BZTA 2WA0A 2F48A 4XSZF 2RN7A 1FC3A 4QTRA 3LQQA 4C30A 3VB2A 1JUMA 2V79A 3L2UA 1FIPA 2LY1A 3O8GA 5FKNA 1ODDA 3EUHC 1D0ZA 1BW5A 4KDPA 1G3WA 1EJ9A 5AONA 2DDBA 1BOAA 3QODA 3VEPA 2X6OA 2ZFWA 4LITA 2CU7A 3KPHA 4BYYA 2DMUA 3HOSA 1SFKA 2KFDA 1VQKI 1FEXA 3E5UA 1T56A 3P9KA 3K1NA 5K5RA 2DA5A 3LSRA 3BP8A 4B1RA 4FX4A 2DN0A 3QPHA 1G6NA 2E1CA 4RAGA 3T1BA 3DEEA 3PNYA 1IXRC 3V4GA 1YITI 3DPLC 4C3HJ 3P9CA 1UJ8A 3H9QA 1KQ8A 2NNYA 5JHUA 4E4HA 5D8KB 2M4GA 1Z21A 2W25A 2X4HA 3R4KA 5GP9A 3F9KA 3H3UA 1I5ZA 2STTA 5F1JA 3U2RA 1RZ4A 3SQNA 2HGCA 2ZMEA 2RVCA 3I3LA 2G7HA 2Q1ZB 1W5TA 2FQ3A 2RC4A 2L7MP 3H3ZA 1F36A 1XB4A 4DJAA 1I3AA 2GZWA 1JJ8C 2XAQA 3ULQB 3LAPA 4EM2A 3C1DA 1BIBA 1DQUA 3Q0VA 2H8RA 1BC7C 2IA2A 1LVAA 3BR3A 1IXCA 2BY1A 3SZGA 4BS9A 2OZUA 9ANTA 1Z9CA 1N75A 3TQNA 1TWAJ 3J81K 1VQPI 2LRDA 3OV8A 1RETA 4A3EJ 1G3SA 2EZLA 2F5DA 2Y31A 3GX4X 3LFKA 1FLIA 4CGZA 3H3VK 5AIQA 3REOA 2V6EA 1ONVA 1TWGJ 2DBBA 2K85A 1HW2A 3ZQIA 1WJDA 1JKQC 2R7SA 5FB2A 1PVEA 1UHSA 3E5QA 4N4OB 2JWTA 1OJLA 3GW2A 1IN6A 4A0ZA 4R8HA 2ZXWH 2BEOA 3NAUA 4B3AA 1PYVA 5FD6A 1GLNA 2M4KA 3FKIJ 1WFXA 4X1EA 3LSHA 4UHTA 3BTIA 4IRIA 5DTDA 1X1DA 2I5UA 3ML6A 4E7HA 1Y39A 1MIJA 3MZ8A 3ASNH 5CVJA 3SYTA 3OYJA 2QSGX 4LB5A 5EEAA 4A3FJ 3OOPA 1YIOA 3DLLF 4BE0A 3TO7A 3A01A 2MD5A 2K02A 3U9GA 3L9FA 3ISPA 4EJUA 3QYFA 3F21A 2HZTA 3MCZA 5HODA 5J4YA 2JK3A 5M5XJ 4LG0B 3KFWX 2OCCH 1W0TA 4V2FA 2IS1A 2YUSA 5DDGA 3BJ6A 1XPXA 2OUMA 1H0MA 2DO7A 4CA0A 3HBLA 2R5YB 3OYIA 3K70C 1QPIA 3I58A 1DGWY 4PSWA 4I01A 4YFXF 3CC2I 1IZ1A 2WAEA 5FGMA 1AKHB 5EZGA 4A3JJ 3S1MJ 1B8IA 2EBIA 3FK7A 1F43A 2MFZA 3H5RA 4UUSA 2ZMEC 4G6QA 1H9TA 1FYMA 3CJRB 2FMYA 2IEKA 5LRSA 3SJMA 4IL6C 3KP2A 1FTTA 1P9QC 2H09A 2CQXA 3SXYA 2XGEA 4F52A 2ELHA 1MBHA 1YFHA 2M5WA 2VQHA 3BCBA 3HXLA 4AYBA 4I6ZA 1YJ9I 1HKTA 1JUSA 3JCUC 2LH9A 1G3TA 2GWRA 4P55A 1V5EA 3G2BA 5BS6A 2DK8A 2LTPA 1MNEA 3GTPJ 3L2RA 3SZPA 1X1PA 3H9JA 5E20A 1TP4A 1HW1A 4L18B 4AU7A 3M4OJ 1JGGA 2GA1A 1P6RA 4L5EA 4P5OA 2FX0A 2G0EA 3G3ZA 3CDLA 1HSJA 2MYSA 2IS6A 4RMNA 4DIQA 3TKYA 1PP7U 4UUSB 2XF6A 4QIWN 4HSTA 3HOZJ 4HF1A 2PMZA 2ZXJA 2CW7A 4Y7NJ 2LKPA 4Q48A 2HYGD 4IXAA 4MTEA 2BY3A 4N9IA 4E70A 1X3ZB 3RKXA 3W2AA 4EQQA 5JLXA 5KAFC 2J5PA 3LA3A 3C2HA 3JR9A 1VQ8I 1YX5A 4KIGA 2ESNA 1WCMJ 1MNDA 3RIRA 1H9GA 1RESA 4OAYA 4ZTJA 2VPRA 2KZVA 4KT6A 4OIQF 3S14J 2CQKA 3MZYA 1W36D 2HOEA 3HSFA 5FO5A 2VONA 1PUFB 1Y8QB 2E1MB 2DFFA 2X6YA 3HGYA 2O8XA 1GDTA 2W7NA 4LB6B 4XRSG 2A6EF 1CGPA 4ESFA 4LGWA 3QU3A 2W85A 3MMYB 3ECOA 3CQZJ 4AIDA 2VN2A 2EZKA 2DCEA 4NB5A 1JE8A 3PUBA 1LVKA 2QWWA 2GOXB 2LMDA 3RQ4A 4HEA2 2R5ZA 3BG7A 2AO9A 2K9LA 3HUGB 1SEUA 2IGKA 3FXMA 1HC8A 4AIHA 1BOBA 3CCYA 2BHZA 2HOSA 4CDGA 3Q9VA 3GTGJ 3DPUA 2OQGA 1XMAA 1MJ9A 2DA7A 2OBPA 2KRCA 2ZO4A 3EQLF 4EJWA 1ZRCA 1BM9A 2CMPA 3ELKA 5D8LB 3WG7H 4EEFG 1HA8A 3E7LA 4XLNF 2F6CA 1LPQA 5CQGA 2N8GA 4I09A 4JBAA 2PJRB 1REPC 2KKOA 4I99C 5KK1A 5B1BH 2R7DA 2DAOA 5CQEA 3RI4A 3ECHA 2DA1A 3QAHA 4J19A 1SFXA 5CVUA 2QUFA 2YS9A 2CUEA 2ECBA 1DPRA 1GXQA 3PSFA 3DV8A 2W00A 2DFHA 1LDJA 2VJIA 3EYIA 3HOYJ 1QZEA 1JGSA 1MBJA 5AIPA 4PDKA 2HS5A 3L2VA 3L7WA 5FKOA 1SD5A 5TGTA 5J8CA 3ABKH 1LE8B 2Z1DA 4A6EA 1ZAOA 3IAM2 3ZMDA 5ILUA 5KHDA 3NEUA 2BVLA 3RCOA 3HGGA 4G6DA 3AG3H 4OU0A 2EIKH 5IPAA 1UELB 4IO9F 3DU6A 2JSCA 2FUG2 3JSPA 1XG1A 3OL3A 4U0YA 5M5YJ 3PSIA 1XD7A 1Z1DA 1T98A 4RBOA 3GYHX 3OWTA 2ZJRF 1OCTC 3I5UA 3DPTA 1FP2A 2MA3A 1VQMI 1G4DA 5KVRA 1LQ1A 5JI6A 2ID3A 1U9OA 2L01A 4HDVA 4HLXA 4MLOA 1FZPB 1YW7A 2WY7Q 3H35A 5D5WB 3DQVC 2NAZA 1A35A 3MD2A 2BBYA 1QQIA 3VWBA 5TJJA 3F6OA 1BA5A 4A6DA 4W1UA 3G6EI 5L3EA 1MDMA 3S1NJ 3BWGA 3PIOF 3DXJF 4JYKA 2BW3B 2R93J 1P4AA 2DOFA 2K86A 5EGOB 2P6TA 2PLYA 2E36A 2JRMA 1MW7A 5BQTA 1PP8F 5EEGA 4PJLA 3D5RC 4XOPA 5F1RA 5C4XJ 2L2OA 2VC1A 3F8FA 1FBUA 3QQAA 4LG3A 2KDZA 4NUBA 4IPAA 4BQNA 3ZQHA 2IW5A 4RGXA 2E2IJ 2HR3A 2LC2A 3LA2A 3K4CA 3AFHA 2NS7A 4GXOA 3AL0B 3EPZA 1PDNC 2O61A 4B09A 1Z0XA 1V55H 2CQQA 3DKXA 4WCGA 5FKLA 3BG9A 1MMSA 5DYMA 1E17A 3BC8A 4AIJA 1EKEA 4LLNA 3A02A 4OINF 3HSEA 5J47A 4IRGA 4XR6A 1F9NA 4KIFA 3GUDA 2L9NA 2XSDC 1A31A 3Q0UA 2JQ7A 2JA8J 5J8FA 5L3FA 1Z6RA 3D5SC 5LHHA 3CMYA 1ON1A 2CQNA 2XPVA 1D0YA 3PNVA 4V2GA 2Q0OA 1B72A 3V8JA 4BAYA 2XF5A 2LF8A 3W3CA 5IYDJ 3A1YA 2P7VB 1UG2A 4M6XA 2BV6A 1WPKA 4LFUA 4ZTFA 3LSJA 4KMUX 1X3WB 4G9YA 5DM7F 1KU7A 1I27A 1OYWA 2R3SA 3Q9SA 4IOCF 2DMNA 3B73A 2CUZA 3OYDA 1FOKA 2GA2A 4PGGA 4LK1F 2R7TA 1HQCA 2DK5A 4NDLA 1MNMC 2NS0A 4LK0F 2O5RA 2R7OA 3F22A 1B59A 1HW5A 1IJWC 4Q47A 3GFMA 3HJEA 1IDZA 4YRVA 3CCVI 2NRAC 4C2UA 3FX3A 1XSXA 2A5WA 3J7ZI 3KP3A 1SD4A 4DOZA 1NG6A 1VI0A 1XS9A 4BE2A 2F5VA 3WGIA 3OYKA 3Q5FA 3HRSA 5D5UB 1U5TB 4G7HF 4HNTA 3IWFA 3ROUA 3CTAA 4D5CA 1B6AA 5EZHA 4R79A 1E3PA 4MQ9F 3IKTA 4FASD 1IGNA 1B4AA 2ICWG 3FK6A 1D8JA 2A5YB 4UV8A 4YIFA 2E34A 5E1WA 3S2DJ 1X3UA 4S05A 1K78B 3VDXA 1VQOI 4R1HA 3LQRA 2P81A 2P7CB 2H94A 1WI3A 3HOVJ 1VFCA 1TNTA 1EH8A 2PX9A 3EDPA 3VSLA 1JKOC 4U87A 2EFWA 1XDUA 3BG6A 3DBHB 4RAYA 4CCLA 4A3BJ 4B48A 2LKSA 2RNJA 1S8NA 1S9HA 3K7AJ 1GV2A 4KISA 5ERIA 3E97A 1W5CC 2B7EA 1D5YA 4XL9A 1OR7C 3QU6A 4CZCA 3K4LA 1VQ7I 5BMZA 4KT5C 4HV6A 3H5NA 2H1LA 4Y3OA 4E7IA 4NQWB 5LLQA 2DA6A 3O2PE 3JSOA 3K4NA 4IQ4A 1X4OA 3N97A 4XM3A 1IRFA 3ESWB 3HTUA 3DCFA 2MSYA 1IUFA 2BW3A 3A03A 1UZCA 2D1VA 3GWZA 2ZJ2A 2LFBA 5J1YA 2ELJA 1QHGA 2I8DA 4HX7A 4IHVA 1F4KA 1Z05A 3RYRA 2W82A 3A0BC 3C3WA 1HCRA 4I0AA 2ZFUA 2Y2ZA 3B02A 3IH3A 5CVVA 1ACIA 3M3YJ 5FLXK 4A0YA 3NQOA 1IRGA 4EJTA 3VSKA 3OYAA 5K5OA 2F5CA 4PUSA 4CZZA 3A4CA 5E18F 1K6YA 2A69F 3CCMI 3QWLA 1U5TA 2DA4A 5EGOA 4KA4A 1XMXA 4IEJA 2KIQA 2HWVA 3HRUA 4BNCA 4EJVA 3S15J 5HVQC 2QBYA 5FKMA 1W1WE 1X1BA 3CCJI 2LY9A 2X85A 4JX5A 4Y13A 1Q1VA 2BXYA 2YX4A 2FEZA 5LGTA 4S0HB 1BI2A 4FCYA 3G1LA 5C4JJ 4OMYA 1QVTA 2Z5UA 4HLYA 4Y15A 5EYRA 3CD6I 2VPLA 4BXUA 2XHKA 1NK2P 4MFDA 2IPQX 1UG0A 5TRDA 1I6XA 1JT6A 4NBQA 3P5JA 3AKZA 4G6TB 2Y69H 1J59A 1MKMA 2XAUA 3GLLA 1G2HA 4EGYA 2HQAA 4YELA 3TW7A 2XPWA 2QSHX 4BBRJ 5JLWA 3JAMK 4XSXF 1R71A 4FT8A 3RZOJ 1Y6IA 3F8CA 1PUEE 3PQJA 2W48A 4C3JJ 2HFHA 4MHGA 4C2MJ 3I4MJ 5FLMJ 2FU4A 1YO5C 3IC7A 1OFCX 3FXRA 3WU2C 4F7ZA 3JRIA 2UZKA 3I55I 1FYLA 4RAZA 3WE2A 1U3EM 2LBFA 4BQOA 4EM0B 1P92A 3IV5A 2XC7A 1KA8A 4E7KA 2BVMA 5DD4A 1YS7A 1K79A 2YPRA 3I0TA 4XBFA 4IHYA 1BBYA 4ESBA 3K70D 3BTJA 1P2FA 2LDUA 3DLAA 2OD5A 4IF4A 3ZQGA 1I50J 1U8RA 5GAEJ 2QCOA 4LIVA 4Y17A 1YE9A 2BXZA 2LK2A 3MQ0A 4BBSJ 3RYPA 1SFOJ 3WHCA 2FF4A 1ZLJA 2TDXA 2X51A 3VYTB 4KUMA 4HQMA 1IUYA 3CESA 3SDGA 1JHHA 3F8BA 3LSKA 2JUCA 1TW3A 1EA3A 1D3YA 1QNTA 2CH0A 2O3FA 3H0GJ 5FD5A 2OTLI 4F3QA 1QHHD 3S16J 3I9V2 2VQLA 1SAXA 2Z9OA 4HYEA 2EJRA 4HRIA 1ZN2A 2XF7A 3K4JA 3QYBA 1DU0A 2NVXJ 3MEXA 3ABUA 3V8LA 4RGRA 1SANA 2XROA 3WHBA 3ERMA 2I10A 1WRJA 1D0XA 1KU3A 1UHMA 1MJBA 3UNGC 2WB1N 3BQZA 1ZKGA 2KZGA 2R7WA 3KZIC 1E3OC 2IAIA 2KRFA 3W6KB 1K4TA 3OIOA 3CCQI 4NHJA 1XSVA 1V54H 1EH6A 4U0WA 4DYRA 3L1PA 4I7HA 4FISA 2BE5F 1R1UA 2K40A 3BZKA 4AVPA 5LGUA 4HDUA 4OIOF 2K27A 5EDNA 2VC0A 3U1KA 5DEQA 4DYCA 4HQEA 1IXSB 2CQ7A 3BR0A 1YOVB 3FBIB 4M9SA 1YIJI 3CC4I 1RKWA 3GEZA 2B0LA 2Z33A 2NVUB 4YFNF 1FOYA 1KU2A 3CLOA 1SFUA 1Z91A 1NH3A 2ZC2A 1LDDA 4KYWA 3E3VA 2XGCA 3KYLA 2FD5A 5LBQA 1FOWA 5E3NA 2NOJB 1VQ4I 4W97A 2E1NA 3R61A 1YW9A 4O3MA 2IGOA 3HPHA 5DD8A 5FKKA 2H27A 4RA2A 1PJRA 2XRNA 4JK1X 1W7PD 2UXNA 1ON2A 2XKOA 3JRAA 4L5IA 1VTNC 3ZQ7A 2WV1A 3WTXC 1LB2A 2HZDA 2RQQA 4PZJA 4B43A 2PEXA 3SFZA 1POGA 1BIAA 1RUNA 4ON0A 3ZN0A 2JPCA 5IP9J 4ZYDA 2OPTA 4BHCA 3WGHA 5E1XA 1QVUA 3L2WA 2F4OB 4UB8C 1MBEA 2Y0SA 1UMQA 3LA7A 3WGGA 4MIMA 4L0YB 2GXBA 2HOAA 3L09A 3EUKL 1BI1A 2A3SA 1ZG5A 1OCRH 3T5XA 1ZGWA 1O4XA 2R7UA 5ICCA 2B63J 1BJZA 3BG3A 5GTIC 1QZZA 5IP7J 5LRRA 1R22A 3I54A 4HOBA 5ILSA 4PGHA 1DP7P 2LF7A 3GO5A 4LD5A 3DFGA 1UB9A 5B1AH 2HTJA 4K2EA 3OIQA 2FSWA 1ETOA 2M0CA 3VFZA 3H1CA 2YSRA 2L7ZA 1RRJA 5E8IA 2Y9YA 2E2JJ 4CCNA 2L0KA 2VOOA 1T39A 2BY2A 2KRHA 4KFCA 4XKBA 1FY7A 3IWZA 3MKYB 3CUQB 1R5GA 4ZDOA 1BR1A 4RB3C 4DZJA 3U21A 3BTCA 2Y75A 2V1NA 2OJED 4M3EA 1D5VA 2HYJA 2H1KA 3CMAI 1V4RA 2VIXA 2XAGA 4G94A 4CXFA 1DDNA 3ZMSA 2HYFA 3FKJA 2IBDA 4AYBN 4II2A 2KJBA 2WY8Q 2ZJPF 3WTWC 4RLFA 4BH9A 2DW4A 3W2WA 4WXCA 1AOYA 2UV1A 2DXIA 1OKRA 3FXJA 3I59A 3S3NA 5E17F 2KQRA 3TO6A 2DQLA 2WBMA 5HS7A 3QOEA 3GZ6A 2R7RA 3CMEI 2M8EA 1MGTA 2ZXIA 4C3IJ 1WHUA 3AG1H 3LOCA 2VI6A 1FNNA 2EH3A 2XKPA 2BHYA 2EV6A 4CYDA 3FDYA 2CWEA 4D7NA 3HYIA 4CCKA 4D9JA 4ZC3A 3KLOA 2A6TA 4XLAA 2H6BA 3OL4A 4ZYAA 3ZPLA 4Y33A 1VQ9I 3DTKA 2HVSA 2P8TA 2VKDA 5GPAA 3KP6A 2VOPA 3FMSA 3D5LA 3KZYA 4E7JA 3VYRB 3OYFA 1R36A 3DP7A 4G8XA 1WZ2A 3CUOA 2QENA 3WTSC 1UAAA 3EUAA 1A5JA 2QQ9A 3RJPA 4P1WA 3WODF 1IV6A 2VQCA 1WJFA 2R4GA 3OYNA 2VODA 2H8WA 4KJZA 3FHNA 3HRTA 3F8NA 5HS8A 4BJTA 2IJLA 3CCLI 1GHCA 2O8KA 2UWMA 1FBQA 5DCFA 4IZZA 4Y52J 4CUGA 4KICA 4BY7J 3OYMA 3BPVA 3F8MA 2CFOA 2KL4A 4ITVA 3FMRA 4IVNA 2M3AA 1NK3P 2F5FA 1W5SA 4MFEA 2GQQA 2EA4A 4HNVA 4G7ZF 2DMTA 2FOKA 3HOTA 1FSHA 1U78A 3F3XA 2VBXA 3VYUB 3PNTA 5GTHC 5K7HA 2CG4A 4LIUA 3FXQA 3C2BA 2FMLA 1R1TA 3IAS2 2DYRH 1Y56A 4M6VA 1QPMA 3OSGA 2L9RA 1KYZA 3R0AA 1LFPA 1LFBA 1ORKA 4OWRB 2NYXA 2P5KA 2NVTJ 5B3SH 2K4JA 2K5CA 3MWMA 1U2WA 3T8RA 1KQ0A 4N9HA 2Y48A 4PSXA 1RR8C 1ZK8A 1Z67A 4NNJA 2HOTA 2E5NA 1Z77A 4A3GJ 4CO8A 1P4WA 1Q1HA 3R6SA 3TP0A 3L2QA 1FPQA 2EPFA 2ETHA 1LUJB 1TT0A 2PG4A 3PM1A 5DS9A 2XB5A 5KCMA 4TV7A 4HBLA 2UXXA 1T8IA 4A12A 1MBGA 1GUUA 4B8XA 2VXZA 4IHXA 4BACA 2HU9A 4BUPA 5CKTA 4M3FA 1IRXA 5FRNA 3FHZA 3KP4A 1KYWA 5IYCJ 1LKXA 2GAUA 3M9AA 3ASOH 2O6GE 3I4PA 2ZJQF 4KITB 3FM3A 3BPXA 4A3DJ 2X1CA 3IUOA 3DTIA 2DOAA 1RKTA 2X48A 2EZHA 4C2TA 5DM6F 1RPWA 3HDDA 2RKHA 3I64A 2DTRA 1QU3A 3QPTA 4AIKA 1QGPA 2FE3A 2ISZA 5HDNA 4XK4A 4H0EA 2XB0X 3GFLA 3WU0A 2EZIA 3HZJA 4M6YA 1IN8A 5E3LA 2EFNA 2IXSA 2AS5F 4FQGA 1AA7A 2A68F 2P6SA 3IHUA 3CCUI 2M7BA 2ZCWA 3Q3SA 2E35A 3IKVA 2QQBA 1O3TA 3PJRA 4U7DA 1IRZA 1XGNA 2M1BA 2VLAA 3G1MA 1ZTRA 1A04A 3ZQQA 1X1AA 2EK5A 3S93A 1ETXA 3JTHA 4JP0A 2L9VA 3KCCA 1ZR2A 3FM5A 4UXNA 3VPRA 4XMYA 2E19A 3A0HC 4MTDA 1Y8RB 4XRSA 2X9DA 2FOWA 2ADUA 3NRVA 3SEZA 3OYHA 1JUPA 2R7FA 2VQGA 3LMMA 1UCRA 1IAWA 4ENKA 3WTVC 5BNGA 4Z6YA 2JA7J 4AC0A 2NS8A 2TRTA 1CF7B 4XONA 5F27A 1SVMA 3ABLH 3H0DA 1X19A 4GO1A 2RNGA 2LOOA 2P4WA 2MBFA 5F0CA 1X2MA 3OS1A 1L3LA 2TCTA 5E79C 2GOMA 2FBHA 3O6BB 3CUQC 3KLNA 2JSPA 3CJNA 3OR2C 1IN4A 4ZJZA 5H6QA 4IHWA 3BJOA 1FMWA 1ZHFA 2DFEA 2QGUA 4A3KJ 3G71I 5CJ9A 1XC5A 4YEJA 4B47A 1AKHA 5HNHA 1GVDA 4IKFA 3PL8A 1KQ9A 5GPCA 2O0YA 2COBA 3TMOA 1MBFA 2H6CA 2HPIA 4A0XA 3KYDB 2XV4S 1T2KA 1MMGA 5H6RA 2JJ7A 3J80Z 2LP0A 4YG2F 3RQIA 3SFIA 4HSRA 1HLVA 3CJQB 2HVRA 4M3BA 1V3FA 1TQPA 3OIPA 4Y4RA 4OMZA 3TO9A 2FBKA 4PCQA 1R4MB 2QLZA 2KMUA 2J5OA 3FXUA 3R0JA 1BR4A 1GV5A 1ZG3A 5DUKA 3GMEA 1K7AA 1MD0A 1R9TJ 3C7JA 5J40A 1FJLA 1O7LA 2EB7A 5IP6A 4A3CJ 1C0WA 2R0QC 2KJCA 1YHQI 2XVCA 1BI3A 2V1UA 1TLHB 2K7LA 3JTGA 1WI9A 4O6JA 5C44J 1NG7A 5L3DA 3PO3J 2PMUA 2PI0A 1APLC 1RNLA 5K1YA 5BOXA 3DKWA 4M9XA 5D5VB 2D1HA 3C2GA 3S1QJ 2VL8A 2VUMJ 2MW8A 3GTQJ 2LLKA 3K0LA 4FHTA 1XDSA 5IOYA 1A6QA 2ME0A 2E60A 3ZR8X 1F1ZA 1WJAA 4U0VA 2KP6A 2WC2A 2E1OA 3ZMUA 2ZSIB 4HA8A 1MBKA 3CCEI 3FXKA 3M8FA 5F64A 2HI3A 2PBIA 2LBFB 5B5EC 2PJPA 5GADJ 4F92B 2EFQA 4WF2A 4XLCA 1R58A 3MN2A 2HPMA 1R6RA 4IQJA 1YJNI 3J7AO 5JVTA 2JA5J 4L0ZB 3TP3A 4J01A 4GYGA 5GAHJ 4PJNA 3ONQA 3ZGKA 2L3DA 1H88C 3ZCOA 2M9HA 2LY2A 1B72B 2L54A 3P9IA 1SFEA 3DKYA 2OAZA 4BEHA 5K5QA 1J7KA 5FROA 1N78A 4G7OF 2GIVA 2KLOA 2CUJA 2NOGA 2F4IA 1SC7A 2QF7A 5HLTA 1QZYA 2OZ6A 4XRMA 1Y0NA 1W7PA 5ED4A 3BT9A 3W6JB 2EINH 2V7FA 3RTRA 4EVIA 1WWXA 1HF0A 2STWA 3H5AA 4IHSA 4WXHA 1JJ6C 1WQ2A 1HSTA 3DBLB 2DT6A 3CDHA 4QPQA 4RB1A 4BY1J 4HV5A 4Q4ZF 3ZOBA 2MH9A 4QSHA 3KZZA 5EF6A 1D1CA 1S7AA 1OCZH 3HM5A 3HOWJ 1TZLA 1TBXA 3IP4B 1AU7A 4F91B 4XKWA 2RGVA 3CO6C 3S3MA 2JZYA 2YR2A 4XLFA 4BDZA 2WB1A 2M87A 4BQAA 1RC9A 5EG0B 2VE8A 2K4BA 1Y1VJ 3CO7C 2V6CA 3E0JB 2GLOA 1HOMA 3MVPA 3KETA 3MAJA 3KEOA 4LG0A 2LR8A 2MD0A 4N4NB 1ZR4A 3BTLA 1S7EA 2JMWA 5HNFA 1YLFA 2FQ4A 4MNUA 4Z2YA 1K6OA 2O03A 1O57A 2ZB9A 3JW4A 4KNYA 2GXAA 1I6HJ 5IT9K 4EGZA 2M2EA 2NXNB 3C18A 3WTUC 3H36A 4EATA 2IT0A 2ZXHA 3ZMTA 3N4MA 4AWXB 2A61A 1S3JA 3LSMA 2BOLA 4A3IJ 3GTLJ 2UUZA 1T38A 3J81Z 1ETQA 3HHGA 3P7NA 4HNUA 1ETKA 1P7IA 2R92J 2BY0A 2FBIA 2IA1A 3RSNA 2CW8A 5M5WJ 1T33A 2HQ5A 2COMA 1AHDP 1KGSA 1WKMA 2IVMA 2EWNA 4I0BA 1XGMA 1CQTA 4AUXA 4IOAF 1R23A 3IRQA 2WTEA 4D1QA 3E6DA 4M3DA 3RKYA 3OSFA 2HEOA 4X6AJ 1DGRM 3HUGA 1S5LC 4H4KC 3V7CA 1JKRC 3K9TA 4HG2A 2V26A 3PFIA 4GCVA 5FJ8J 1NHAA 1OR7A 2IGMA 3QP5A 2WWYA 4ESJA 1K78A 1F5TA 4BXXJ 3EYYA 1YX3A 3HEFA 5J6XA 1O3RA 2CV1A 1JTYA 4BXFA 5D4RA 2GM4A 4I2OA 3KEQA 4EM1A 2LREA 4DQ2A 4ENMA 3LWFA 4B4CA 5DUIA 4CYCB 3K1MA 3BJAA 1TWHJ 1R00A 1XTAA 2F2EA 2ZSHB 5D6FA 3PIPF 1O3SA 3DEWA 1T08B 3CJTB 3Q0WA 4JQFA 1VQ5I 1QRYA 3TL4X 4XLHA 5ILVA 3FMQA 2Y9ZA 3V8KA 2CFXA 2VBYA 1Y1WJ 1Z7UA 2KIFA 2JVHA 4BKXA 1U0JA 5EG0A 4E7LA 3QP6A 3OYEA 3L00A 2KPMA 2KHMA 4G12A 3BG5A 3BROA 1ITYA 2K9NA 3FWEA 5A2QZ 2VXDA 1JHFA 1FIAA 1W36C 1J5YA 5A2QK 3LAJA 5BPDA 3K4MA 1YS6A 1H8AC 5IYBJ 2HDDA 5HLIA 2FNAA 4HW0A 1JI8A 3RZDJ 5CYVA 1FTZA 1ZYRF 2L02A 2OTJI 1ZGAA 3E6BA 3K10A 5D5XB 4HZFA 3QPLA 5F0HA 2XAHA 4S04A 4RAFA 3HTSB 1HBXG 2QYOA 1YG2A 3T0YA 4AVZA 1LE8A 2MC3A 2EV0A 1RI7A 2DU9A 4NC7A 1G59A 2OCEA 5F08A 3IRRA 3KIOA 1KONA 2ISYA 3GZNB 2AXTC 1ZQ3P 2QKLB 4PFOA 4GDFA 1L0OC 2CUFA 3JRDA 1CF7A 2HTSA 3JRFA 1BC8C 2PN6A 1ETWA 1I1GA 3BR6A 4WXDA 1K61A 1UHWA 2RREA 4ZYEA 3VOEA 1TTYA 4ZYGA 3HSRA 3AAFA 1DUXC 3KP5A 3GVAA 3G73A 2R7VA 1IG7A 1XGSA 1ZELA 2ESHA 3MZHA 5BPIA 4RB0A 5D4SA 5H20A 2X6WA 2YX7A 4AM3A 3BR1A 2CJJA 2K9QA 1KZHA 1OCPA 2B9SA 1SVOA 3CP8A 2LD5A 2O9LA 1X58A 1U6GA 3GF2A 4IRHA 1MSEC 3NWSA 4BHBA 1SMTA 4RM2A 4XQFA 4A69C 1P4XA 3FXLA 2LNBA 3TDUC 2OA4A 4GRIA 5HS9A 3JRBA 4LJZF 5K7FA 4YIIA 1HXDA 1S7OA 3CLQA 4JX6A 3S3OA 2JTVA 3BR5A 2QSFX 3DF8A 2M0MA 4ZYHA 3HG9A 3S2HJ 1OMIA 3SDBA 2F5EA 1WJBA 4WX9A 5FLXZ 3DU5A 4P9FA 2Q8KA 2QZ8A 3BOQA 2A05A 2ZMEB 2VJJA 4XRFA 3BQYA 1Y0UA 2DMQA 2F4MB 1GT0C 1U5TC 3CCRI 3OS2A 1I39A 2HKXA 4BHPA 1ETVA 1MZBA 4UUTA 4GGGA 3CC7I 1J75A 3HOUJ 2Y0MA 1TQMA 1WH5A 5JR3A 1EH7A 2A6HF 3V42A 4U7BA 5GAGJ 2VT3A 2XIGA 5JVGF 2WV0A 4BL0B 4L9TA 4WK8F 3HKZN 3FBNB 2HDWA 2HVQA 4CCOA 1LFUP 4M71A 1Z6TA 4L9VA 3LL7A 2BGCA 2NNNA 4BJ5C 4IX7A 2K3FA 3ZQLA 2R7XA 4LOCA 5FLVA 3GXOA 4MGRA 1Z7LA 4XICA 2HQNA 3OY9A 3BZ6A 1E3HA 2QA4I 2CSOA 3U1DA 2WAQN 2V9VA 2DFIA 1FP1D 4LMYA 4RM3A 4FE7A 3SHFA 2ZKZA 1T0FC 2DA2A 2KDOA 2X0LA 4EJOA 3GFIA 4UVAA 4YIRX 1VQLI 4DW6A 3NWTA 1WGXA 2CW0F 2JA2A 3ZMZA 1S72I 3ABMH 4I98B 2Y30A 3DWLE 3R60A 5DV5A 3GTJJ 1N25A 1XMKA 4ENNA 5IOZA 5E1ZB 4XKCA 5LEJA 2CRGA 2CS3A 3N05A 2C6YA 5B66C 3TOBA 1FT9A 2OF7A 1TC3C 3LFUA 5HLGA 1ENHA 2XGXA 1TW2A 2L7KA 3RDIA 3S1RJ 3K69A 2EIJH 5CPRB 1ZG1A 2V9KA 4FETA 4PJMA 4XNFA 1I1SA 2DDAA 1R5HA 1B8IB 3E6MA 4XN0A 2XGDA 5LHIA 2JPBA 3ZN1A 3KEYA 4BDYA 2R7QA 2W24A 1JTXA 2Z99A 2PMHA 4ABZA 4E7ZA 1WSUA 1DP3A 2VKEA 3GTOJ 1OCOH 2OU2A 4QWQA 3CCSI 2K9SA 2GXGA 1GVJA 1S29A 2DQRA 1LEAA 2DMPA 4D7MA 3MKZA 4MEXF 1P7JA 1RR7A 3LSPA 3M8EA 3GTKJ 4AD9A 5EJCA 2JUGA 3MKWB 3KX2A 4KN7X 1VQ6I 3X2QH 2HKOA 3COAC 1UFMA 4CCMA 3HL2A 1BN5A 4M9ZA 2G9WA 4KMFA 4UNOA 1ZGJA 1MJAA 5C3EJ 2NVYJ 5HLHA 3JAMZ 2XPUA 1OYIA 1B9NA 1W7PB 2LKXA 4JOMA 2E71A 2L7FP 3VODA 2FRHA 2D5VA 1TQIA 4DGWB 3AG2H 2QBYB 1XCVA 3LSIA 3HC7A 4HX4A 2VASA 4O5VA 1WVRA 2X6XA 2KIMA 4EMSA 4RB2C 2BYVE 3ZMVA 5JHFA 4XLEA 2GIZA 3TOAA 1FOXA 2VE9A 3RPUD 3BDDA 3G4SI 4D5FA 3RPUA 2M7AA 2V9PA 4ASNA 1XGOA 1LJ9A 5E3MA 4QPOA 4HPQA 5J1RA 2IS2A 2IGNA 3CF5F 5KAIC 2VBZA 3IL2A 1HKQA 3H92A 4KN4X 3RKWA 3I53A 2L9SA 2CV2A 2AHQA 3QPSA 2MH2A 1TWCJ 5ICFA 3WTZA 3EETA 4A5MA 3ZQCA 4A93J 3OS0A 4CICA 1QO0D 2P5LC 1J9IA 3V7SA 1NTCA 2M30A 4J00A 2E7XA 3UKGA 3BZCA 5CVIA 4BQQA 1IV8A 4M73A 2W57A 2X1DA 1X4PA 1W0UA 4I02A 2DJIA 5EEHA 3WE3A 4X0GA 4P9UA 5ICEA 4GFBA 3WG9A 2WADA 3IH2A 2R5ZB 4XLPF 1LEBA 2X1EA 4V19K 2Z16A 1J2XA 1IO2A 1FSEA 1X1CA 1R4NB 2EFPA 3OMYA 1Z3XA 1IDYA 3BCAA 2PMZN 3T8TA 1V5GA 4IHTA 2MGQA 1YW8A 4ZDPA 1U8BA 1X2NA 2E5ZA 1EF4A 5FFXA 3KYCB 4QLCU 3HOXJ 1BJAA 2EQRA 1R1VA 2JRTA 2DYSH 2Q2EB 2FNPA 1TNSA 2AXLA 2QM3A 3JREA 2XSJC 3IH4A 3RPQA 3GTMJ 5FFZA 3CMMA 1ZRFA 2G7UA 5HDGA 2E1MC 1IW7F 1B1BA 2K9MA 2CGPA 2VKHA 2Q2EA 2JN6A 2P5VA 3DBRB 2EA2A 5J4VA 4HF2A 2DA3A 2W84A 2Z2SB 5IT9Z 4L9NA 4JX4A 2RV8A 5HOOA 3E6CC 4RGSA 3JRHA 1OCCH 2ECCA 3CDIA 4II3A 3TEDA 3M7GA 5F0FA 1U9NA 1J0RA 3BY6A 2DI3A 3F72A 4BE1A 3SEQA 4HX8A 3F0CA 2XUBA 2Z3YA 4E7SA 5HDKA 1A6IA 2ZNYA 1USTA 4MEYF 4RS8A 4BEHB 4L5JA 3OYBA 1ZRDA 4F55A 5L3GA 2EV5A 4E6KG 3GCMA 6PAXA 1SMYF 1OLTA 1D1BA 2DT5A 2V1XA 4C9YA 1G8XA 5CLSA 2ACJA 2KISA 2FA5A 3HKZA 3S8PA 3V7RA 3DTEA 1I3QJ 2XASA 4IJAA 3W6VA 3KE2A 2PJRA 3ZQFA 1M1EB 2RAEA 1YRNB 4DZPA 4A3LJ 2ME6A 2AQFA 2LSOA 1FX7A 3QRFF 4Q5SF 2CV0A 4L9JA 3F6VA 5DCMB 2EILH 4P96A 3OOUA 2CO5A 2AQEA 5TISC 1YTYA 3QYEA 2MABA 4B44A 4OIPF 4A5NA 3M07A 1STZA 4FX0A 2V4JC 4M74A 5IT3A 2DJNA 2FXAA 4UY8I 2L5QA 5CVRA 1DU6A 3G1OA 4EV0A 2IS4A 4DBQA 1Z3YA 2DT7B 3WTYC 1MH3A 2QVOA 3ZRGA 2HDCA 2ID6A 4U88A 3WU1B 2QQ8A 3ERED 2VT2A 3HPGA 3I4NJ 1HDPA 3QOPA 4ZDLA 4ETSA 1E2XA 3CP2A 4PK4A 2W1OA 3M1EA 2D45A 4CH7A 4LLGF 4ZH4F 2O7OA 1MDMB 1QA6A 1MSFC 1OISA 1W4MA 1B9MA 3A01B 2QEXI 2QKMB 4ANJA 1R5ID 5H2FC 2HNHA 5F04A 5IY5H 4CHUA 2ZBKA 3K6GA 3EUHA 4A3MJ 1SAUA 2VB6A 4CYCA 4M3GA 1IC8A 1QBJA 1J09A 1DPUA 1LNWA 4LLLA 2R5YA 1SD6A 3FF5A 1VQNI 1D1AA 3ABTA 3J7YJ 2CYYA 3AG4H 2IP2A 3FZVA 3OYLA 1MMDA 2YU9J 1ZLKA 1G3YA 2LYCA 1TWFJ 1VNDA 3E1SA 3S17J 2D2WA 1ZH5A 3OR1C 2QQAA 1EV7A 2XRLA 3OYCA 3ZP5A 4OOIA 1WH7A 2ZNZA 2W4SA 2RQPA 1GXPA 2E2HJ 2MLKA 3ZXSA 3J7AY 1YJWI 5M3MJ 2VJ5A 2V1DA 4UV9A 4NC8A 3O8HA 1T0FA 3PO2J 1JXSA 5LD2C 1XSDA 2DPDA 2HXOA 4NC6A 1SD7A 1LDKB 1V5FA 3NARA 4DYQA 2A07F 2Y0SN 4HF0A 2XAFA 1OYYA 1JKPC 3I56I 5LEKA 1YYVA 2DTZA 3HB9A 3B6CA 4OIRF 4F93B 1XN7A 3I59B 1IF1A 5DCMA 4D0PA 5E8GA 4CCJA 4DBRA 4XOTA 5F6FA 1FWZA 3UR3C 1VZ0A 4WWCA 4XKVA 3RKQA 4RGUA 1MMNA 2XDVA 3S32A 5JFRA 4FE4A 1D8KA 3MFKA 3CUQA 3GBGA 4XIDA 2PFBA 4HAMA 3HIFA 2OC6A 3TGNA 2DLLA 5K7ZA 2IA0A 3FIWA 1TL8A 3K4BA 4PJJA 1YI2I 2HQRA 3LNQA 1YQAA 3BLYA 4DNCA 3L2CA 5LFAA 2VJ4A 4BGDA 1JT0A 4UB6C 4CSWA 5FRMA 3E5XA 3S2WA 2M45A 1OQYA 5L3BA 1FYKA 1BL0A 4ZZDA 4MO7A 2KT0A 5J1UA 5E3OA 1YRNA 4XN3A 1AWCA 2DODA 3D1NI 1KU9A 2KIUA 2JA6J 3MKLA 3D0SA 5KNLA 3TDZC 2MLGA 3TBIA 1T95A 5D6EA 1A36A 1TT5B 1IN7A 1WJ5A 1R49A 1R7JA 1HKSA 1ZARA 2LG4A 4ENJA 3TW6A 1USSA 5LGNA 4UUVA 2P0WA 3OYGA 2IRFG 1FMVA 3PQKA 3KP7A 2VKVA 3O3KA
chains in the Genus database with same CATH topology
3GZ5A 5LHGA 1BI0A 2RDPA 4A2UA 4N0BA 2OQRA 3F23A 1ZREA 1XCBA 3GFJA 2E7WA 3HRMA 4ZZLA 2VBWA 4UVCA 3J80K 3K2ZA 5L3CA 5ICGA 4GYIA 3HHHA 2L4AA 1ULYA 1S6LA 3GLXA 3I71A 2L4MA 1RIOH 1T6SA 4NQWA 4M72A 4MQVA 4UVBA 4KIBA 3SZTA 1O7FA 2YU3A 4YFKF 3K1PA 3WTTC 3DEUA 1IN5A 3LSTA 1FBSA 2PQ8A 2XAJA 2JT1A 2DPUA 1O3QA 1RUOA 1OPCA 2EFOA 4XSZF 2RN7A 1FC3A 3LQQA 3VB2A 2V79A 1ODDA 4KDPA 1G3WA 5AONA 1BOAA 3VEPA 2ZFWA 4BYYA 3HOSA 3E5UA 3P9KA 3K1NA 5K5RA 3BP8A 4FX4A 3QPHA 1G6NA 2E1CA 3T1BA 3V4GA 1IXRC 3DPLC 3P9CA 1KQ8A 2NNYA 5JHUA 5D8KB 2W25A 2X4HA 3R4KA 3H3UA 1I5ZA 2STTA 3U2RA 1RZ4A 3SQNA 2HGCA 2RVCA 2ZMEA 2G7HA 1W5TA 2FQ3A 2RC4A 3H3ZA 1XB4A 2GZWA 2XAQA 3ULQB 3LAPA 4EM2A 3C1DA 1BIBA 1BC7C 2IA2A 1LVAA 1IXCA 2OZUA 1Z9CA 3TQNA 3J81K 3OV8A 1G3SA 2F5DA 3GX4X 3LFKA 1FLIA 4CGZA 5AIQA 3REOA 1ONVA 2DBBA 1HW2A 5FB2A 3E5QA 3GW2A 1IN6A 4A0ZA 4R8HA 2BEOA 5FD6A 4UHTA 4IRIA 3ML6A 5CVJA 4LB5A 3OOPA 1YIOA 3TO7A 2MD5A 2K02A 3U9GA 3L9FA 3ISPA 4EJUA 3F21A 2HZTA 3MCZA 4LG0B 3KFWX 5DDGA 3BJ6A 1H0MA 2DO7A 3I58A 4I01A 4YFXF 1IZ1A 5FGMA 4G6QA 1H9TA 1FYMA 2FMYA 5LRSA 3KP2A 2H09A 3SXYA 2ELHA 1YFHA 2M5WA 1HKTA 4P55A 1G3TA 2GWRA 5BS6A 2DK8A 3SZPA 5E20A 4L18B 1HW1A 2GA1A 1P6RA 4P5OA 3G3ZA 1HSJA 3TKYA 1PP7U 4HF1A 2ZXJA 2LKPA 4Q48A 2HYGD 4IXAA 4MTEA 4N9IA 4E70A 3RKXA 4EQQA 2J5PA 3LA3A 4KIGA 2ESNA 3RIRA 1H9GA 4OIQF 2CQKA 3MZYA 2HOEA 3HSFA 5FO5A 2VONA 2O8XA 4LB6B 2A6EF 1CGPA 4ESFA 4LGWA 3QU3A 2W85A 3ECOA 2VN2A 4NB5A 1JE8A 2QWWA 4AIHA 4CDGA 3Q9VA 2OQGA 1XMAA 1MJ9A 2OBPA 2ZO4A 3EQLF 4EJWA 1ZRCA 1BM9A 3ELKA 5D8LB 4XLNF 4I09A 4JBAA 1REPC 2KKOA 5KK1A 2R7DA 2DAOA 3RI4A 3ECHA 3QAHA 1SFXA 5CVUA 2QUFA 1DPRA 1GXQA 3DV8A 1LDJA 3EYIA 1JGSA 5AIPA 4PDKA 2HS5A 3L7WA 1SD5A 5J8CA 4A6EA 1ZAOA 3ZMDA 5ILUA 3NEUA 4G6DA 4OU0A 2JSCA 3JSPA 4U0YA 1XD7A 1Z1DA 1T98A 3GYHX 3I5UA 3DPTA 1FP2A 2MA3A 1G4DA 5KVRA 1LQ1A 5JI6A 2L01A 4HDVA 4HLXA 1FZPB 1YW7A 5D5WB 3DQVC 2NAZA 2BBYA 1QQIA 5TJJA 3F6OA 4A6DA 5L3EA 1MDMA 3BWGA 3DXJF 1P4AA 2K86A 2P6TA 2PLYA 5BQTA 1PP8F 5EEGA 5F1RA 2VC1A 3F8FA 1FBUA 4IPAA 2IW5A 4RGXA 2HR3A 3LA2A 4GXOA 1PDNC 2O61A 4B09A 4WCGA 5DYMA 1E17A 4AIJA 4LLNA 4OINF 3HSEA 4IRGA 1F9NA 4KIFA 3GUDA 5J8FA 5L3FA 1Z6RA 5LHHA 1ON1A 2Q0OA 3V8JA 4BAYA 2LF8A 2P7VB 4M6XA 2BV6A 4LFUA 4KMUX 1KU7A 4G9YA 1I27A 1OYWA 2R3SA 3Q9SA 3B73A 1FOKA 2GA2A 4PGGA 4LK1F 1HQCA 2DK5A 2NS0A 4LK0F 3F22A 1B59A 1HW5A 4Q47A 3GFMA 2NRAC 3FX3A 1XSXA 3KP3A 1SD4A 3Q5FA 3WGIA 3HRSA 5D5UB 1U5TB 4G7HF 3IWFA 3ROUA 3CTAA 1B6AA 4R79A 4MQ9F 3IKTA 1B4AA 1D8JA 2A5YB 4UV8A 4YIFA 5E1WA 1X3UA 4S05A 1K78B 4R1HA 3LQRA 2P7CB 2H94A 1TNTA 1EH8A 3EDPA 2EFWA 1XDUA 4RAYA 2RNJA 1S8NA 5ERIA 3E97A 3QU6A 5BMZA 4KT5C 4HV6A 5LLQA 3O2PE 3JSOA 3N97A 1IRFA 3HTUA 2D1VA 3GWZA 2ZJ2A 4HX7A 1F4KA 1Z05A 3RYRA 3C3WA 4I0AA 3B02A 5CVVA 1IRGA 5FLXK 4A0YA 3NQOA 4EJTA 5K5OA 2F5CA 4CZZA 5E18F 2A69F 1U5TA 4KA4A 2HWVA 3HRUA 4BNCA 4EJVA 5HVQC 2QBYA 4Y13A 2YX4A 2FEZA 5LGTA 1BI2A 4OMYA 2Z5UA 4HLYA 4Y15A 4BXUA 2XHKA 2IPQX 5TRDA 1I6XA 1J59A 1MKMA 4EGYA 3JAMK 4XSXF 4FT8A 3F8CA 1PUEE 3PQJA 2HFHA 4MHGA 2FU4A 1YO5C 3IC7A 3FXRA 4F7ZA 2UZKA 1FYLA 4RAZA 3WE2A 1U3EM 4EM0B 1P92A 1KA8A 5DD4A 1YS7A 1K79A 2YPRA 3I0TA 4XBFA 1BBYA 4ESBA 1P2FA 2LDUA 2OD5A 4IF4A 1U8RA 4Y17A 3MQ0A 3RYPA 2FF4A 1ZLJA 2TDXA 4KUMA 4HQMA 1IUYA 1JHHA 3F8BA 1TW3A 1D3YA 1QNTA 2O3FA 5FD5A 1SAXA 2Z9OA 4HYEA 2EJRA 1ZN2A 3MEXA 3ABUA 3V8LA 4RGRA 2XROA 1WRJA 1KU3A 1UHMA 1MJBA 2KRFA 3W6KB 4NHJA 1XSVA 1EH6A 4U0WA 4I7HA 2BE5F 1R1UA 4AVPA 5LGUA 4HDUA 4OIOF 2K27A 2VC0A 5DEQA 4HQEA 1IXSB 4M9SA 3GEZA 2B0LA 2Z33A 4YFNF 1KU2A 3CLOA 1SFUA 1Z91A 1LDDA 4KYWA 3E3VA 5LBQA 2E1NA 3R61A 1YW9A 4O3MA 5DD8A 2H27A 2XRNA 4JK1X 1W7PD 2UXNA 1ON2A 2XKOA 4L5IA 1VTNC 3ZQ7A 3WTXC 1LB2A 4PZJA 2PEXA 3SFZA 1RUNA 1BIAA 4ON0A 3ZN0A 2JPCA 4ZYDA 4BHCA 3WGHA 5E1XA 3LA7A 3WGGA 4L0YB 2GXBA 3L09A 1BI1A 2A3SA 1ZG5A 3T5XA 5ICCA 1QZZA 5LRRA 1R22A 3I54A 1DP7P 4HOBA 4PGHA 5ILSA 2LF7A 3GO5A 4LD5A 3DFGA 1UB9A 2HTJA 4K2EA 2FSWA 3VFZA 2YSRA 5E8IA 2VOOA 1T39A 4KFCA 1FY7A 3IWZA 3CUQB 1R5GA 4RB3C 2Y75A 1D5VA 1V4RA 4G94A 2XAGA 4CXFA 1DDNA 3ZMSA 2HYFA 2KJBA 3WTWC 4BH9A 2DW4A 1AOYA 4WXCA 1OKRA 3I59A 5E17F 3TO6A 2DQLA 5HS7A 3GZ6A 2M8EA 1MGTA 1FNNA 2XKPA 2EV6A 4CYDA 2CWEA 3HYIA 3KLOA 2H6BA 3ZPLA 2P8TA 3KP6A 2VOPA 3FMSA 3D5LA 3KZYA 1R36A 3DP7A 4G8XA 3CUOA 2QENA 3WTSC 2QQ9A 3RJPA 3WODF 2VODA 3HRTA 3F8NA 5HS8A 2IJLA 1GHCA 2UWMA 1FBQA 5DCFA 4KICA 3BPVA 3F8MA 3FMRA 4IVNA 2F5FA 1W5SA 2GQQA 2EA4A 4G7ZF 2FOKA 3HOTA 1FSHA 1U78A 3F3XA 2VBXA 2CG4A 3FXQA 2FMLA 1R1TA 1QPMA 1KYZA 3R0AA 2NYXA 2P5KA 2K4JA 3MWMA 1U2WA 3T8RA 1KQ0A 4N9HA 2Y48A 4CO8A 1P4WA 1Q1HA 3R6SA 1FPQA 2ETHA 2PG4A 4TV7A 4HBLA 2UXXA 4A12A 4B8XA 2VXZA 3FHZA 3KP4A 1KYWA 2GAUA 3M9AA 2O6GE 3I4PA 3FM3A 3BPXA 2RKHA 3I64A 2DTRA 3QPTA 4AIKA 1QGPA 2FE3A 2ISZA 5HDNA 4H0EA 3GFLA 3WU0A 4M6YA 1IN8A 2EFNA 2AS5F 2A68F 2P6SA 3IHUA 2ZCWA 3IKVA 2QQBA 1O3TA 4U7DA 1XGNA 2M1BA 1A04A 2EK5A 3JTHA 3KCCA 3FM5A 4UXNA 4MTDA 2ADUA 3NRVA 2R7FA 1UCRA 1IAWA 4ENKA 3WTVC 1CF7B 4GO1A 2P4WA 2MBFA 1L3LA 2FBHA 3O6BB 3CUQC 3KLNA 3CJNA 1IN4A 5H6QA 3BJOA 1ZHFA 5CJ9A 1KQ9A 2O0YA 2H6CA 4A0XA 2XV4S 1T2KA 5H6RA 3J80Z 4YG2F 1V3FA 1TQPA 3TO9A 4OMZA 2FBKA 4PCQA 2QLZA 2J5OA 3FXUA 3R0JA 1ZG3A 5DUKA 1K7AA 1MD0A 3C7JA 1O7LA 2EB7A 1C0WA 2KJCA 2XVCA 1BI3A 2V1UA 1TLHB 2K7LA 3JTGA 1WI9A 4O6JA 5L3DA 2PMUA 2PI0A 1RNLA 5K1YA 5BOXA 3DKWA 4M9XA 5D5VB 2D1HA 3K0LA 4FHTA 1XDSA 1F1ZA 4U0VA 2WC2A 3ZMUA 4HA8A 3M8FA 5F64A 2PBIA 2PJPA 2EFQA 4WF2A 1R58A 3J7AO 5JVTA 4L0ZB 4GYGA 2L3DA 2L54A 3P9IA 1SFEA 2OAZA 5K5QA 1J7KA 4G7OF 2GIVA 1QZYA 2OZ6A 1W7PA 5ED4A 3W6JB 3RTRA 4EVIA 1WWXA 2STWA 4IHSA 4WXHA 1WQ2A 1HSTA 3CDHA 4RB1A 4HV5A 4Q4ZF 2MH9A 3KZZA 1S7AA 1TBXA 2RGVA 3CO6C 2JZYA 2YR2A 2M87A 4BQAA 2VE8A 2K4BA 3CO7C 2V6CA 3KETA 3MAJA 3KEOA 4LG0A 1YLFA 4MNUA 4Z2YA 1K6OA 2O03A 1O57A 3JW4A 4KNYA 5IT9K 4EGZA 3C18A 3WTUC 2IT0A 3ZMTA 3N4MA 4AWXB 2A61A 1S3JA 1T38A 3J81Z 3HHGA 3P7NA 2FBIA 2IA1A 2COMA 1KGSA 1WKMA 2IVMA 2EWNA 4I0BA 1XGMA 1R23A 3IRQA 2WTEA 3E6DA 3RKYA 2HEOA 3HUGA 3V7CA 3K9TA 3PFIA 4GCVA 2WWYA 1NHAA 1OR7A 3QP5A 4ESJA 1K78A 1F5TA 3EYYA 5J6XA 1O3RA 5D4RA 4I2OA 3KEQA 4EM1A 4DQ2A 4ENMA 3LWFA 5DUIA 3K1MA 3BJAA 1R00A 2F2EA 5D6FA 1O3SA 4JQFA 5ILVA 3FMQA 3V8KA 2CFXA 2VBYA 1Z7UA 2KIFA 3QP6A 3L00A 3BROA 3FWEA 5A2QZ 1JHFA 1J5YA 5A2QK 3LAJA 5BPDA 1YS6A 5HLIA 2FNAA 4HW0A 5CYVA 1ZYRF 2L02A 1ZGAA 3E6BA 5D5XB 4HZFA 4S04A 2XAHA 3HTSB 1HBXG 2QYOA 1YG2A 3T0YA 2MC3A 2EV0A 1RI7A 2DU9A 3IRRA 2ISYA 1CF7A 1L0OC 2HTSA 1BC8C 2PN6A 1I1GA 4WXDA 1UHWA 4ZYEA 3VOEA 1TTYA 4ZYGA 3HSRA 3AAFA 1DUXC 3KP5A 3GVAA 3G73A 1XGSA 2ESHA 3MZHA 5BPIA 4RB0A 5D4SA 5H20A 2YX7A 1U6GA 3GF2A 4IRHA 4BHBA 1SMTA 1P4XA 2LNBA 3TDUC 2OA4A 5HS9A 4LJZF 4YIIA 1HXDA 1S7OA 2JTVA 3DF8A 4ZYHA 1OMIA 2F5EA 4WX9A 5FLXZ 4P9FA 2Q8KA 2QZ8A 3BOQA 2ZMEB 4XRFA 1Y0UA 1U5TC 2HKXA 4BHPA 1MZBA 4GGGA 1J75A 2Y0MA 1TQMA 5JR3A 1EH7A 2A6HF 4U7BA 2VT3A 2XIGA 2WV0A 4L9TA 4WK8F 4M71A 1Z6TA 4L9VA 2BGCA 2NNNA 3GXOA 4MGRA 2HQNA 3BZ6A 2CSOA 3U1DA 2V9VA 2DFIA 1FP1D 4LMYA 3SHFA 2ZKZA 2X0LA 4EJOA 3GFIA 4UVAA 2CW0F 3ZMZA 4I98B 3R60A 5DV5A 1XMKA 4ENNA 5E1ZB 5LEJA 2C6YA 3TOBA 1FT9A 5HLGA 2XGXA 1TW2A 3RDIA 3K69A 1ZG1A 1I1SA 1R5HA 3E6MA 5LHIA 2JPBA 3ZN1A 2W24A 2Z99A 2PMHA 1WSUA 2OU2A 4QWQA 2GXGA 1GVJA 1S29A 2DQRA 1LEAA 4MEXF 3M8EA 4AD9A 4KN7X 2HKOA 3COAC 1UFMA 1BN5A 4M9ZA 2G9WA 4KMFA 4UNOA 1ZGJA 1MJAA 5HLHA 3JAMZ 1OYIA 1B9NA 1W7PB 3VODA 2FRHA 1TQIA 2QBYB 1XCVA 4HX4A 4O5VA 4RB2C 2KIMA 4EMSA 2BYVE 3ZMVA 3TOAA 2VE9A 3BDDA 3RPUA 4ASNA 1XGOA 1LJ9A 2VBZA 3IL2A 1HKQA 3H92A 4KN4X 3RKWA 3I53A 2MH2A 5ICFA 3WTZA 3EETA 4A5MA 4CICA 1QO0D 2P5LC 1J9IA 3V7SA 2M30A 2E7XA 5CVIA 4M73A 2W57A 4I02A 5EEHA 3WE3A 4P9UA 5ICEA 3WG9A 4XLPF 1LEBA 1J2XA 1FSEA 2EFPA 3T8TA 4IHTA 1YW8A 5FFXA 4QLCU 1BJAA 1R1VA 2JRTA 2FNPA 1TNSA 2AXLA 2QM3A 3RPQA 5FFZA 1ZRFA 2G7UA 5HDGA 1IW7F 1B1BA 2CGPA 2Q2EA 2P5VA 2EA2A 4HF2A 2W84A 5IT9Z 4L9NA 2RV8A 5HOOA 3E6CC 4RGSA 3M7GA 1J0RA 3BY6A 2DI3A 3F72A 4HX8A 2XUBA 2Z3YA 5HDKA 4RS8A 2ZNYA 1USTA 4MEYF 4L5JA 1ZRDA 5L3GA 2EV5A 6PAXA 1SMYF 2V1XA 2DT5A 5CLSA 2ACJA 2FA5A 3V7RA 2XASA 4IJAA 3KE2A 2LSOA 1FX7A 3QRFF 4Q5SF 4L9JA 3F6VA 5DCMB 4P96A 2CO5A 1YTYA 4OIPF 4A5NA 1STZA 4FX0A 4M74A 5IT3A 2FXAA 5CVRA 4EV0A 3WTYC 2QVOA 2HDCA 4U88A 3WU1B 3ERED 2VT2A 3QOPA 4ETSA 1E2XA 3M1EA 2D45A 4LLGF 4ZH4F 1MDMB 1W4MA 1B9MA 4CHUA 2ZBKA 3EUHA 1QBJA 1DPUA 1LNWA 4LLLA 1SD6A 3FF5A 3ABTA 2CYYA 2IP2A 3FZVA 1ZLKA 1G3YA 2D2WA 1ZH5A 2QQAA 1EV7A 3ZP5A 4OOIA 2ZNZA 2RQPA 1GXPA 2MLKA 2V1DA 4UV9A 1T0FA 1JXSA 1XSDA 2DPDA 1SD7A 1LDKB 2A07F 4HF0A 2XAFA 1OYYA 5LEKA 1YYVA 4OIRF 1XN7A 3I59B 1IF1A 5DCMA 4D0PA 5E8GA 5F6FA 1FWZA 4WWCA 4RGUA 5JFRA 1D8KA 3MFKA 3CUQA 2PFBA 4HAMA 3HIFA 3TGNA 2DLLA 2IA0A 2HQRA 1YQAA 4DNCA 3L2CA 1FYKA 3E5XA 5L3BA 2M45A 3S2WA 4ZZDA 1AWCA 1KU9A 2KIUA 3D0SA 3TDZC 2MLGA 5D6EA 1IN7A 1R7JA 1HKSA 1ZARA 4ENJA 1USSA 5LGNA 4UUVA 2IRFG 3PQKA 3KP7A 3O3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZ5 A;  5LHG A;  1BI0 A;  2RDP A;  4A2U A;  4N0B A;  2OQR A;  3F23 A;  1ZRE A;  1XCB A;  3GFJ A;  2E7W A;  3HRM A;  4ZZL A;  2VBW A;  4UVC A;  3J80 K;  3K2Z A;  5L3C A;  5ICG A;  4GYI A;  3HHH A;  2L4A A;  1ULY A;  1S6L A;  3GLX A;  3I71 A;  2L4M A;  1RIO H;  1T6S A;  4NQW A;  4M72 A;  4MQV A;  4UVB A;  4KIB A;  3SZT A;  1O7F A;  2YU3 A;  4YFK F;  3K1P A;  3WTT C;  3DEU A;  1IN5 A;  3LST A;  1FBS A;  2PQ8 A;  2XAJ A;  2JT1 A;  2DPU A;  1O3Q A;  1RUO A;  1OPC A;  2EFO A;  4XSZ F;  2RN7 A;  1FC3 A;  3LQQ A;  3VB2 A;  2V79 A;  1ODD A;  4KDP A;  1G3W A;  5AON A;  1BOA A;  3VEP A;  2ZFW A;  4BYY A;  3HOS A;  3E5U A;  3P9K A;  3K1N A;  5K5R A;  3BP8 A;  4FX4 A;  3QPH A;  1G6N A;  2E1C A;  3T1B A;  3V4G A;  1IXR C;  3DPL C;  3P9C A;  1KQ8 A;  2NNY A;  5JHU A;  5D8K B;  2W25 A;  2X4H A;  3R4K A;  3H3U A;  1I5Z A;  2STT A;  3U2R A;  1RZ4 A;  3SQN A;  2HGC A;  2RVC A;  2ZME A;  2G7H A;  1W5T A;  2FQ3 A;  2RC4 A;  3H3Z A;  1XB4 A;  2GZW A;  2XAQ A;  3ULQ B;  3LAP A;  4EM2 A;  3C1D A;  1BIB A;  1BC7 C;  2IA2 A;  1LVA A;  1IXC A;  2OZU A;  1Z9C A;  3TQN A;  3J81 K;  3OV8 A;  1G3S A;  2F5D A;  3GX4 X;  3LFK A;  1FLI A;  4CGZ A;  5AIQ A;  3REO A;  1ONV A;  2DBB A;  1HW2 A;  5FB2 A;  3E5Q A;  3GW2 A;  1IN6 A;  4A0Z A;  4R8H A;  2BEO A;  5FD6 A;  4UHT A;  4IRI A;  3ML6 A;  5CVJ A;  4LB5 A;  3OOP A;  1YIO A;  3TO7 A;  2MD5 A;  2K02 A;  3U9G A;  3L9F A;  3ISP A;  4EJU A;  3F21 A;  2HZT A;  3MCZ A;  4LG0 B;  3KFW X;  5DDG A;  3BJ6 A;  1H0M A;  2DO7 A;  3I58 A;  4I01 A;  4YFX F;  1IZ1 A;  5FGM A;  4G6Q A;  1H9T A;  1FYM A;  2FMY A;  5LRS A;  3KP2 A;  2H09 A;  3SXY A;  2ELH A;  1YFH A;  2M5W A;  1HKT A;  4P55 A;  1G3T A;  2GWR A;  5BS6 A;  2DK8 A;  3SZP A;  5E20 A;  4L18 B;  1HW1 A;  2GA1 A;  1P6R A;  4P5O A;  3G3Z A;  1HSJ A;  3TKY A;  1PP7 U;  4HF1 A;  2ZXJ A;  2LKP A;  4Q48 A;  2HYG D;  4IXA A;  4MTE A;  4N9I A;  4E70 A;  3RKX A;  4EQQ A;  2J5P A;  3LA3 A;  4KIG A;  2ESN A;  3RIR A;  1H9G A;  4OIQ F;  2CQK A;  3MZY A;  2HOE A;  3HSF A;  5FO5 A;  2VON A;  2O8X A;  4LB6 B;  2A6E F;  1CGP A;  4ESF A;  4LGW A;  3QU3 A;  2W85 A;  3ECO A;  2VN2 A;  4NB5 A;  1JE8 A;  2QWW A;  4AIH A;  4CDG A;  3Q9V A;  2OQG A;  1XMA A;  1MJ9 A;  2OBP A;  2ZO4 A;  3EQL F;  4EJW A;  1ZRC A;  1BM9 A;  3ELK A;  5D8L B;  4XLN F;  4I09 A;  4JBA A;  1REP C;  2KKO A;  5KK1 A;  2R7D A;  2DAO A;  3RI4 A;  3ECH A;  3QAH A;  1SFX A;  5CVU A;  2QUF A;  1DPR A;  1GXQ A;  3DV8 A;  1LDJ A;  3EYI A;  1JGS A;  5AIP A;  4PDK A;  2HS5 A;  3L7W A;  1SD5 A;  5J8C A;  4A6E A;  1ZAO A;  3ZMD A;  5ILU A;  3NEU A;  4G6D A;  4OU0 A;  2JSC A;  3JSP A;  4U0Y A;  1XD7 A;  1Z1D A;  1T98 A;  3GYH X;  3I5U A;  3DPT A;  1FP2 A;  2MA3 A;  1G4D A;  5KVR A;  1LQ1 A;  5JI6 A;  2L01 A;  4HDV A;  4HLX A;  1FZP B;  1YW7 A;  5D5W B;  3DQV C;  2NAZ A;  2BBY A;  1QQI A;  5TJJ A;  3F6O A;  4A6D A;  5L3E A;  1MDM A;  3BWG A;  3DXJ F;  1P4A A;  2K86 A;  2P6T A;  2PLY A;  5BQT A;  1PP8 F;  5EEG A;  5F1R A;  2VC1 A;  3F8F A;  1FBU A;  4IPA A;  2IW5 A;  4RGX A;  2HR3 A;  3LA2 A;  4GXO A;  1PDN C;  2O61 A;  4B09 A;  4WCG A;  5DYM A;  1E17 A;  4AIJ A;  4LLN A;  4OIN F;  3HSE A;  4IRG A;  1F9N A;  4KIF A;  3GUD A;  5J8F A;  5L3F A;  1Z6R A;  5LHH A;  1ON1 A;  2Q0O A;  3V8J A;  4BAY A;  2LF8 A;  2P7V B;  4M6X A;  2BV6 A;  4LFU A;  4KMU X;  1KU7 A;  4G9Y A;  1I27 A;  1OYW A;  2R3S A;  3Q9S A;  3B73 A;  1FOK A;  2GA2 A;  4PGG A;  4LK1 F;  1HQC A;  2DK5 A;  2NS0 A;  4LK0 F;  3F22 A;  1B59 A;  1HW5 A;  4Q47 A;  3GFM A;  2NRA C;  3FX3 A;  1XSX A;  3KP3 A;  1SD4 A;  3Q5F A;  3WGI A;  3HRS A;  5D5U B;  1U5T B;  4G7H F;  3IWF A;  3ROU A;  3CTA A;  1B6A A;  4R79 A;  4MQ9 F;  3IKT A;  1B4A A;  1D8J A;  2A5Y B;  4UV8 A;  4YIF A;  5E1W A;  1X3U A;  4S05 A;  1K78 B;  4R1H A;  3LQR A;  2P7C B;  2H94 A;  1TNT A;  1EH8 A;  3EDP A;  2EFW A;  1XDU A;  4RAY A;  2RNJ A;  1S8N A;  5ERI A;  3E97 A;  3QU6 A;  5BMZ A;  4KT5 C;  4HV6 A;  5LLQ A;  3O2P E;  3JSO A;  3N97 A;  1IRF A;  3HTU A;  2D1V A;  3GWZ A;  2ZJ2 A;  4HX7 A;  1F4K A;  1Z05 A;  3RYR A;  3C3W A;  4I0A A;  3B02 A;  5CVV A;  1IRG A;  5FLX K;  4A0Y A;  3NQO A;  4EJT A;  5K5O A;  2F5C A;  4CZZ A;  5E18 F;  2A69 F;  1U5T A;  4KA4 A;  2HWV A;  3HRU A;  4BNC A;  4EJV A;  5HVQ C;  2QBY A;  4Y13 A;  2YX4 A;  2FEZ A;  5LGT A;  1BI2 A;  4OMY A;  2Z5U A;  4HLY A;  4Y15 A;  4BXU A;  2XHK A;  2IPQ X;  5TRD A;  1I6X A;  1J59 A;  1MKM A;  4EGY A;  3JAM K;  4XSX F;  4FT8 A;  3F8C A;  1PUE E;  3PQJ A;  2HFH A;  4MHG A;  2FU4 A;  1YO5 C;  3IC7 A;  3FXR A;  4F7Z A;  2UZK A;  1FYL A;  4RAZ A;  3WE2 A;  1U3E M;  4EM0 B;  1P92 A;  1KA8 A;  5DD4 A;  1YS7 A;  1K79 A;  2YPR A;  3I0T A;  4XBF A;  1BBY A;  4ESB A;  1P2F A;  2LDU A;  2OD5 A;  4IF4 A;  1U8R A;  4Y17 A;  3MQ0 A;  3RYP A;  2FF4 A;  1ZLJ A;  2TDX A;  4KUM A;  4HQM A;  1IUY A;  1JHH A;  3F8B A;  1TW3 A;  1D3Y A;  1QNT A;  2O3F A;  5FD5 A;  1SAX A;  2Z9O A;  4HYE A;  2EJR A;  1ZN2 A;  3MEX A;  3ABU A;  3V8L A;  4RGR A;  2XRO A;  1WRJ A;  1KU3 A;  1UHM A;  1MJB A;  2KRF A;  3W6K B;  4NHJ A;  1XSV A;  1EH6 A;  4U0W A;  4I7H A;  2BE5 F;  1R1U A;  4AVP A;  5LGU A;  4HDU A;  4OIO F;  2K27 A;  2VC0 A;  5DEQ A;  4HQE A;  1IXS B;  4M9S A;  3GEZ A;  2B0L A;  2Z33 A;  4YFN F;  1KU2 A;  3CLO A;  1SFU A;  1Z91 A;  1LDD A;  4KYW A;  3E3V A;  5LBQ A;  2E1N A;  3R61 A;  1YW9 A;  4O3M A;  5DD8 A;  2H27 A;  2XRN A;  4JK1 X;  1W7P D;  2UXN A;  1ON2 A;  2XKO A;  4L5I A;  1VTN C;  3ZQ7 A;  3WTX C;  1LB2 A;  4PZJ A;  2PEX A;  3SFZ A;  1RUN A;  1BIA A;  4ON0 A;  3ZN0 A;  2JPC A;  4ZYD A;  4BHC A;  3WGH A;  5E1X A;  3LA7 A;  3WGG A;  4L0Y B;  2GXB A;  3L09 A;  1BI1 A;  2A3S A;  1ZG5 A;  3T5X A;  5ICC A;  1QZZ A;  5LRR A;  1R22 A;  3I54 A;  1DP7 P;  4HOB A;  4PGH A;  5ILS A;  2LF7 A;  3GO5 A;  4LD5 A;  3DFG A;  1UB9 A;  2HTJ A;  4K2E A;  2FSW A;  3VFZ A;  2YSR A;  5E8I A;  2VOO A;  1T39 A;  4KFC A;  1FY7 A;  3IWZ A;  3CUQ B;  1R5G A;  4RB3 C;  2Y75 A;  1D5V A;  1V4R A;  4G94 A;  2XAG A;  4CXF A;  1DDN A;  3ZMS A;  2HYF A;  2KJB A;  3WTW C;  4BH9 A;  2DW4 A;  1AOY A;  4WXC A;  1OKR A;  3I59 A;  5E17 F;  3TO6 A;  2DQL A;  5HS7 A;  3GZ6 A;  2M8E A;  1MGT A;  1FNN A;  2XKP A;  2EV6 A;  4CYD A;  2CWE A;  3HYI A;  3KLO A;  2H6B A;  3ZPL A;  2P8T A;  3KP6 A;  2VOP A;  3FMS A;  3D5L A;  3KZY A;  1R36 A;  3DP7 A;  4G8X A;  3CUO A;  2QEN A;  3WTS C;  2QQ9 A;  3RJP A;  3WOD F;  2VOD A;  3HRT A;  3F8N A;  5HS8 A;  2IJL A;  1GHC A;  2UWM A;  1FBQ A;  5DCF A;  4KIC A;  3BPV A;  3F8M A;  3FMR A;  4IVN A;  2F5F A;  1W5S A;  2GQQ A;  2EA4 A;  4G7Z F;  2FOK A;  3HOT A;  1FSH A;  1U78 A;  3F3X A;  2VBX A;  2CG4 A;  3FXQ A;  2FML A;  1R1T A;  1QPM A;  1KYZ A;  3R0A A;  2NYX A;  2P5K A;  2K4J A;  3MWM A;  1U2W A;  3T8R A;  1KQ0 A;  4N9H A;  2Y48 A;  4CO8 A;  1P4W A;  1Q1H A;  3R6S A;  1FPQ A;  2ETH A;  2PG4 A;  4TV7 A;  4HBL A;  2UXX A;  4A12 A;  4B8X A;  2VXZ A;  3FHZ A;  3KP4 A;  1KYW A;  2GAU A;  3M9A A;  2O6G E;  3I4P A;  3FM3 A;  3BPX A;  2RKH A;  3I64 A;  2DTR A;  3QPT A;  4AIK A;  1QGP A;  2FE3 A;  2ISZ A;  5HDN A;  4H0E A;  3GFL A;  3WU0 A;  4M6Y A;  1IN8 A;  2EFN A;  2AS5 F;  2A68 F;  2P6S A;  3IHU A;  2ZCW A;  3IKV A;  2QQB A;  1O3T A;  4U7D A;  1XGN A;  2M1B A;  1A04 A;  2EK5 A;  3JTH A;  3KCC A;  3FM5 A;  4UXN A;  4MTD A;  2ADU A;  3NRV A;  2R7F A;  1UCR A;  1IAW A;  4ENK A;  3WTV C;  1CF7 B;  4GO1 A;  2P4W A;  2MBF A;  1L3L A;  2FBH A;  3O6B B;  3CUQ C;  3KLN A;  3CJN A;  1IN4 A;  5H6Q A;  3BJO A;  1ZHF A;  5CJ9 A;  1KQ9 A;  2O0Y A;  2H6C A;  4A0X A;  2XV4 S;  1T2K A;  5H6R A;  3J80 Z;  4YG2 F;  1V3F A;  1TQP A;  3TO9 A;  4OMZ A;  2FBK A;  4PCQ A;  2QLZ A;  2J5O A;  3FXU A;  3R0J A;  1ZG3 A;  5DUK A;  1K7A A;  1MD0 A;  3C7J A;  1O7L A;  2EB7 A;  1C0W A;  2KJC A;  2XVC A;  1BI3 A;  2V1U A;  1TLH B;  2K7L A;  3JTG A;  1WI9 A;  4O6J A;  5L3D A;  2PMU A;  2PI0 A;  1RNL A;  5K1Y A;  5BOX A;  3DKW A;  4M9X A;  5D5V B;  2D1H A;  3K0L A;  4FHT A;  1XDS A;  1F1Z A;  4U0V A;  2WC2 A;  3ZMU A;  4HA8 A;  3M8F A;  5F64 A;  2PBI A;  2PJP A;  2EFQ A;  4WF2 A;  1R58 A;  3J7A O;  5JVT A;  4L0Z B;  4GYG A;  2L3D A;  2L54 A;  3P9I A;  1SFE A;  2OAZ A;  5K5Q A;  1J7K A;  4G7O F;  2GIV A;  1QZY A;  2OZ6 A;  1W7P A;  5ED4 A;  3W6J B;  3RTR A;  4EVI A;  1WWX A;  2STW A;  4IHS A;  4WXH A;  1WQ2 A;  1HST A;  3CDH A;  4RB1 A;  4HV5 A;  4Q4Z F;  2MH9 A;  3KZZ A;  1S7A A;  1TBX A;  2RGV A;  3CO6 C;  2JZY A;  2YR2 A;  2M87 A;  4BQA A;  2VE8 A;  2K4B A;  3CO7 C;  2V6C A;  3KET A;  3MAJ A;  3KEO A;  4LG0 A;  1YLF A;  4MNU A;  4Z2Y A;  1K6O A;  2O03 A;  1O57 A;  3JW4 A;  4KNY A;  5IT9 K;  4EGZ A;  3C18 A;  3WTU C;  2IT0 A;  3ZMT A;  3N4M A;  4AWX B;  2A61 A;  1S3J A;  1T38 A;  3J81 Z;  3HHG A;  3P7N A;  2FBI A;  2IA1 A;  2COM A;  1KGS A;  1WKM A;  2IVM A;  2EWN A;  4I0B A;  1XGM A;  1R23 A;  3IRQ A;  2WTE A;  3E6D A;  3RKY A;  2HEO A;  3HUG A;  3V7C A;  3K9T A;  3PFI A;  4GCV A;  2WWY A;  1NHA A;  1OR7 A;  3QP5 A;  4ESJ A;  1K78 A;  1F5T A;  3EYY A;  5J6X A;  1O3R A;  5D4R A;  4I2O A;  3KEQ A;  4EM1 A;  4DQ2 A;  4ENM A;  3LWF A;  5DUI A;  3K1M A;  3BJA A;  1R00 A;  2F2E A;  5D6F A;  1O3S A;  4JQF A;  5ILV A;  3FMQ A;  3V8K A;  2CFX A;  2VBY A;  1Z7U A;  2KIF A;  3QP6 A;  3L00 A;  3BRO A;  3FWE A;  5A2Q Z;  1JHF A;  1J5Y A;  5A2Q K;  3LAJ A;  5BPD A;  1YS6 A;  5HLI A;  2FNA A;  4HW0 A;  5CYV A;  1ZYR F;  2L02 A;  1ZGA A;  3E6B A;  5D5X B;  4HZF A;  4S04 A;  2XAH A;  3HTS B;  1HBX G;  2QYO A;  1YG2 A;  3T0Y A;  2MC3 A;  2EV0 A;  1RI7 A;  2DU9 A;  3IRR A;  2ISY A;  1CF7 A;  1L0O C;  2HTS A;  1BC8 C;  2PN6 A;  1I1G A;  4WXD A;  1UHW A;  4ZYE A;  3VOE A;  1TTY A;  4ZYG A;  3HSR A;  3AAF A;  1DUX C;  3KP5 A;  3GVA A;  3G73 A;  1XGS A;  2ESH A;  3MZH A;  5BPI A;  4RB0 A;  5D4S A;  5H20 A;  2YX7 A;  1U6G A;  3GF2 A;  4IRH A;  4BHB A;  1SMT A;  1P4X A;  2LNB A;  3TDU C;  2OA4 A;  5HS9 A;  4LJZ F;  4YII A;  1HXD A;  1S7O A;  2JTV A;  3DF8 A;  4ZYH A;  1OMI A;  2F5E A;  4WX9 A;  5FLX Z;  4P9F A;  2Q8K A;  2QZ8 A;  3BOQ A;  2ZME B;  4XRF A;  1Y0U A;  1U5T C;  2HKX A;  4BHP A;  1MZB A;  4GGG A;  1J75 A;  2Y0M A;  1TQM A;  5JR3 A;  1EH7 A;  2A6H F;  4U7B A;  2VT3 A;  2XIG A;  2WV0 A;  4L9T A;  4WK8 F;  4M71 A;  1Z6T A;  4L9V A;  2BGC A;  2NNN A;  3GXO A;  4MGR A;  2HQN A;  3BZ6 A;  2CSO A;  3U1D A;  2V9V A;  2DFI A;  1FP1 D;  4LMY A;  3SHF A;  2ZKZ A;  2X0L A;  4EJO A;  3GFI A;  4UVA A;  2CW0 F;  3ZMZ A;  4I98 B;  3R60 A;  5DV5 A;  1XMK A;  4ENN A;  5E1Z B;  5LEJ A;  2C6Y A;  3TOB A;  1FT9 A;  5HLG A;  2XGX A;  1TW2 A;  3RDI A;  3K69 A;  1ZG1 A;  1I1S A;  1R5H A;  3E6M A;  5LHI A;  2JPB A;  3ZN1 A;  2W24 A;  2Z99 A;  2PMH A;  1WSU A;  2OU2 A;  4QWQ A;  2GXG A;  1GVJ A;  1S29 A;  2DQR A;  1LEA A;  4MEX F;  3M8E A;  4AD9 A;  4KN7 X;  2HKO A;  3COA C;  1UFM A;  1BN5 A;  4M9Z A;  2G9W A;  4KMF A;  4UNO A;  1ZGJ A;  1MJA A;  5HLH A;  3JAM Z;  1OYI A;  1B9N A;  1W7P B;  3VOD A;  2FRH A;  1TQI A;  2QBY B;  1XCV A;  4HX4 A;  4O5V A;  4RB2 C;  2KIM A;  4EMS A;  2BYV E;  3ZMV A;  3TOA A;  2VE9 A;  3BDD A;  3RPU A;  4ASN A;  1XGO A;  1LJ9 A;  2VBZ A;  3IL2 A;  1HKQ A;  3H92 A;  4KN4 X;  3RKW A;  3I53 A;  2MH2 A;  5ICF A;  3WTZ A;  3EET A;  4A5M A;  4CIC A;  1QO0 D;  2P5L C;  1J9I A;  3V7S A;  2M30 A;  2E7X A;  5CVI A;  4M73 A;  2W57 A;  4I02 A;  5EEH A;  3WE3 A;  4P9U A;  5ICE A;  3WG9 A;  4XLP F;  1LEB A;  1J2X A;  1FSE A;  2EFP A;  3T8T A;  4IHT A;  1YW8 A;  5FFX A;  4QLC U;  1BJA A;  1R1V A;  2JRT A;  2FNP A;  1TNS A;  2AXL A;  2QM3 A;  3RPQ A;  5FFZ A;  1ZRF A;  2G7U A;  5HDG A;  1IW7 F;  1B1B A;  2CGP A;  2Q2E A;  2P5V A;  2EA2 A;  4HF2 A;  2W84 A;  5IT9 Z;  4L9N A;  2RV8 A;  5HOO A;  3E6C C;  4RGS A;  3M7G A;  1J0R A;  3BY6 A;  2DI3 A;  3F72 A;  4HX8 A;  2XUB A;  2Z3Y A;  5HDK A;  4RS8 A;  2ZNY A;  1UST A;  4MEY F;  4L5J A;  1ZRD A;  5L3G A;  2EV5 A;  6PAX A;  1SMY F;  2V1X A;  2DT5 A;  5CLS A;  2ACJ A;  2FA5 A;  3V7R A;  2XAS A;  4IJA A;  3KE2 A;  2LSO A;  1FX7 A;  3QRF F;  4Q5S F;  4L9J A;  3F6V A;  5DCM B;  4P96 A;  2CO5 A;  1YTY A;  4OIP F;  4A5N A;  1STZ A;  4FX0 A;  4M74 A;  5IT3 A;  2FXA A;  5CVR A;  4EV0 A;  3WTY C;  2QVO A;  2HDC A;  4U88 A;  3WU1 B;  3ERE D;  2VT2 A;  3QOP A;  4ETS A;  1E2X A;  3M1E A;  2D45 A;  4LLG F;  4ZH4 F;  1MDM B;  1W4M A;  1B9M A;  4CHU A;  2ZBK A;  3EUH A;  1QBJ A;  1DPU A;  1LNW A;  4LLL A;  1SD6 A;  3FF5 A;  3ABT A;  2CYY A;  2IP2 A;  3FZV A;  1ZLK A;  1G3Y A;  2D2W A;  1ZH5 A;  2QQA A;  1EV7 A;  3ZP5 A;  4OOI A;  2ZNZ A;  2RQP A;  1GXP A;  2MLK A;  2V1D A;  4UV9 A;  1T0F A;  1JXS A;  1XSD A;  2DPD A;  1SD7 A;  1LDK B;  2A07 F;  4HF0 A;  2XAF A;  1OYY A;  5LEK A;  1YYV A;  4OIR F;  1XN7 A;  3I59 B;  1IF1 A;  5DCM A;  4D0P A;  5E8G A;  5F6F A;  1FWZ A;  4WWC A;  4RGU A;  5JFR A;  1D8K A;  3MFK A;  3CUQ A;  2PFB A;  4HAM A;  3HIF A;  3TGN A;  2DLL A;  2IA0 A;  2HQR A;  1YQA A;  4DNC A;  3L2C A;  1FYK A;  3E5X A;  5L3B A;  2M45 A;  3S2W A;  4ZZD A;  1AWC A;  1KU9 A;  2KIU A;  3D0S A;  3TDZ C;  2MLG A;  5D6E A;  1IN7 A;  1R7J A;  1HKS A;  1ZAR A;  4ENJ A;  1USS A;  5LGN A;  4UUV A;  2IRF G;  3PQK A;  3KP7 A;  3O3K A; 
#chains in the Genus database with same CATH topology
 1PUF A;  3W2V A;  3GZ5 A;  5LHG A;  1BI0 A;  5M3F J;  2RDP A;  3K2A A;  3BR2 A;  4I76 A;  3CZ6 A;  3PFY A;  4A2U A;  4N0B A;  2HXI A;  2WAF A;  2OQR A;  2JVG A;  3F23 A;  5J3L A;  1ZRE A;  1XCB A;  3GFJ A;  2E7W A;  3HRM A;  3B6A A;  1HDD C;  4ZZL A;  2MG4 A;  2VBW A;  4UVC A;  3CF2 A;  3J80 K;  4PFP A;  1E0E A;  3M1C A;  2DOE A;  3K2Z A;  3LSG A;  5L3C A;  2M34 A;  2ELK A;  3VYS B;  4B3X A;  5ICG A;  4GYI A;  1ERD A;  3JRG A;  2EIM H;  3HHH A;  2L4A A;  1ULY A;  1S6L A;  1WJE A;  3FIS A;  3GLX A;  3I71 A;  2L4M A;  4BJ6 C;  1RIO H;  2R7Z J;  1H89 C;  1T6S A;  1BW6 A;  3M8J A;  4NQW A;  4M72 A;  4BU2 A;  4MQV A;  3H9G A;  4OAZ A;  4UVB A;  2M8G X;  4KIB A;  2MC4 A;  3SZT A;  4RDU A;  1K4S A;  4FTH A;  1O7F A;  2YU3 A;  4YFK F;  2FJ1 A;  2LVS A;  3JRC A;  3K1P A;  3WTT C;  1VF9 A;  3DEU A;  4PJ0 C;  3K4K A;  2OV7 A;  1IN5 A;  3LST A;  1WJC A;  3A2K A;  2GBY A;  1FBS A;  1K83 J;  2PQ8 A;  2XAJ A;  2NVQ J;  1BR2 A;  1MMA A;  4XOR A;  2JT1 A;  2DPU A;  3FXO A;  1MH4 A;  1SVL A;  2WAQ A;  4RLQ A;  1XX5 A;  2K3P A;  1O3Q A;  3AL0 C;  1N77 A;  1OPC A;  1RUO A;  2EFO A;  3PUF A;  1ETY A;  2BZT A;  2WA0 A;  2F48 A;  4XSZ F;  2RN7 A;  1FC3 A;  4QTR A;  3LQQ A;  4C30 A;  3VB2 A;  1JUM A;  2V79 A;  3L2U A;  1FIP A;  2LY1 A;  3O8G A;  5FKN A;  1ODD A;  3EUH C;  1D0Z A;  1BW5 A;  4KDP A;  1G3W A;  1EJ9 A;  5AON A;  2DDB A;  1BOA A;  3QOD A;  3VEP A;  2X6O A;  2ZFW A;  4LIT A;  2CU7 A;  3KPH A;  4BYY A;  2DMU A;  3HOS A;  1SFK A;  2KFD A;  1VQK I;  1FEX A;  3E5U A;  1T56 A;  3P9K A;  3K1N A;  5K5R A;  2DA5 A;  3LSR A;  3BP8 A;  4B1R A;  4FX4 A;  2DN0 A;  3QPH A;  1G6N A;  2E1C A;  4RAG A;  3T1B A;  3DEE A;  3PNY A;  1IXR C;  3V4G A;  1YIT I;  3DPL C;  4C3H J;  3P9C A;  1UJ8 A;  3H9Q A;  1KQ8 A;  2NNY A;  5JHU A;  4E4H A;  5D8K B;  2M4G A;  1Z21 A;  2W25 A;  2X4H A;  3R4K A;  5GP9 A;  3F9K A;  3H3U A;  1I5Z A;  2STT A;  5F1J A;  3U2R A;  1RZ4 A;  3SQN A;  2HGC A;  2ZME A;  2RVC A;  3I3L A;  2G7H A;  2Q1Z B;  1W5T A;  2FQ3 A;  2RC4 A;  2L7M P;  3H3Z A;  1F36 A;  1XB4 A;  4DJA A;  1I3A A;  2GZW A;  1JJ8 C;  2XAQ A;  3ULQ B;  3LAP A;  4EM2 A;  3C1D A;  1BIB A;  1DQU A;  3Q0V A;  2H8R A;  1BC7 C;  2IA2 A;  1LVA A;  3BR3 A;  1IXC A;  2BY1 A;  3SZG A;  4BS9 A;  2OZU A;  9ANT A;  1Z9C A;  1N75 A;  3TQN A;  1TWA J;  3J81 K;  1VQP I;  2LRD A;  3OV8 A;  1RET A;  4A3E J;  1G3S A;  2EZL A;  2F5D A;  2Y31 A;  3GX4 X;  3LFK A;  1FLI A;  4CGZ A;  3H3V K;  5AIQ A;  3REO A;  2V6E A;  1ONV A;  1TWG J;  2DBB A;  2K85 A;  1HW2 A;  3ZQI A;  1WJD A;  1JKQ C;  2R7S A;  5FB2 A;  1PVE A;  1UHS A;  3E5Q A;  4N4O B;  2JWT A;  1OJL A;  3GW2 A;  1IN6 A;  4A0Z A;  4R8H A;  2ZXW H;  2BEO A;  3NAU A;  4B3A A;  1PYV A;  5FD6 A;  1GLN A;  2M4K A;  3FKI J;  1WFX A;  4X1E A;  3LSH A;  4UHT A;  3BTI A;  4IRI A;  5DTD A;  1X1D A;  2I5U A;  3ML6 A;  4E7H A;  1Y39 A;  1MIJ A;  3MZ8 A;  3ASN H;  5CVJ A;  3SYT A;  3OYJ A;  2QSG X;  4LB5 A;  5EEA A;  4A3F J;  3OOP A;  1YIO A;  3DLL F;  4BE0 A;  3TO7 A;  3A01 A;  2MD5 A;  2K02 A;  3U9G A;  3L9F A;  3ISP A;  4EJU A;  3QYF A;  3F21 A;  2HZT A;  3MCZ A;  5HOD A;  5J4Y A;  2JK3 A;  5M5X J;  4LG0 B;  3KFW X;  2OCC H;  1W0T A;  4V2F A;  2IS1 A;  2YUS A;  5DDG A;  3BJ6 A;  1XPX A;  2OUM A;  1H0M A;  2DO7 A;  4CA0 A;  3HBL A;  2R5Y B;  3OYI A;  3K70 C;  1QPI A;  3I58 A;  1DGW Y;  4PSW A;  4I01 A;  4YFX F;  3CC2 I;  1IZ1 A;  2WAE A;  5FGM A;  1AKH B;  5EZG A;  4A3J J;  3S1M J;  1B8I A;  2EBI A;  3FK7 A;  1F43 A;  2MFZ A;  3H5R A;  4UUS A;  2ZME C;  4G6Q A;  1H9T A;  1FYM A;  3CJR B;  2FMY A;  2IEK A;  5LRS A;  3SJM A;  4IL6 C;  3KP2 A;  1FTT A;  1P9Q C;  2H09 A;  2CQX A;  3SXY A;  2XGE A;  4F52 A;  2ELH A;  1MBH A;  1YFH A;  2M5W A;  2VQH A;  3BCB A;  3HXL A;  4AYB A;  4I6Z A;  1YJ9 I;  1HKT A;  1JUS A;  3JCU C;  2LH9 A;  1G3T A;  2GWR A;  4P55 A;  1V5E A;  3G2B A;  5BS6 A;  2DK8 A;  2LTP A;  1MNE A;  3GTP J;  3L2R A;  3SZP A;  1X1P A;  3H9J A;  5E20 A;  1TP4 A;  1HW1 A;  4L18 B;  4AU7 A;  3M4O J;  1JGG A;  2GA1 A;  1P6R A;  4L5E A;  4P5O A;  2FX0 A;  2G0E A;  3G3Z A;  3CDL A;  1HSJ A;  2MYS A;  2IS6 A;  4RMN A;  4DIQ A;  3TKY A;  1PP7 U;  4UUS B;  2XF6 A;  4QIW N;  4HST A;  3HOZ J;  4HF1 A;  2PMZ A;  2ZXJ A;  2CW7 A;  4Y7N J;  2LKP A;  4Q48 A;  2HYG D;  4IXA A;  4MTE A;  2BY3 A;  4N9I A;  4E70 A;  1X3Z B;  3RKX A;  3W2A A;  4EQQ A;  5JLX A;  5KAF C;  2J5P A;  3LA3 A;  3C2H A;  3JR9 A;  1VQ8 I;  1YX5 A;  4KIG A;  2ESN A;  1WCM J;  1MND A;  3RIR A;  1H9G A;  1RES A;  4OAY A;  4ZTJ A;  2VPR A;  2KZV A;  4KT6 A;  4OIQ F;  3S14 J;  2CQK A;  3MZY A;  1W36 D;  2HOE A;  3HSF A;  5FO5 A;  2VON A;  1PUF B;  1Y8Q B;  2E1M B;  2DFF A;  2X6Y A;  3HGY A;  2O8X A;  1GDT A;  2W7N A;  4LB6 B;  4XRS G;  2A6E F;  1CGP A;  4ESF A;  4LGW A;  3QU3 A;  2W85 A;  3MMY B;  3ECO A;  3CQZ J;  4AID A;  2VN2 A;  2EZK A;  2DCE A;  4NB5 A;  1JE8 A;  3PUB A;  1LVK A;  2QWW A;  2GOX B;  2LMD A;  3RQ4 A;  4HEA 2;  2R5Z A;  3BG7 A;  2AO9 A;  2K9L A;  3HUG B;  1SEU A;  2IGK A;  3FXM A;  1HC8 A;  4AIH A;  1BOB A;  3CCY A;  2BHZ A;  2HOS A;  4CDG A;  3Q9V A;  3GTG J;  3DPU A;  2OQG A;  1XMA A;  1MJ9 A;  2DA7 A;  2OBP A;  2KRC A;  2ZO4 A;  3EQL F;  4EJW A;  1ZRC A;  1BM9 A;  2CMP A;  3ELK A;  5D8L B;  3WG7 H;  4EEF G;  1HA8 A;  3E7L A;  4XLN F;  2F6C A;  1LPQ A;  5CQG A;  2N8G A;  4I09 A;  4JBA A;  2PJR B;  1REP C;  2KKO A;  4I99 C;  5KK1 A;  5B1B H;  2R7D A;  2DAO A;  5CQE A;  3RI4 A;  3ECH A;  2DA1 A;  3QAH A;  4J19 A;  1SFX A;  5CVU A;  2QUF A;  2YS9 A;  2CUE A;  2ECB A;  1DPR A;  1GXQ A;  3PSF A;  3DV8 A;  2W00 A;  2DFH A;  1LDJ A;  2VJI A;  3EYI A;  3HOY J;  1QZE A;  1JGS A;  1MBJ A;  5AIP A;  4PDK A;  2HS5 A;  3L2V A;  3L7W A;  5FKO A;  1SD5 A;  5TGT A;  5J8C A;  3ABK H;  1LE8 B;  2Z1D A;  4A6E A;  1ZAO A;  3IAM 2;  3ZMD A;  5ILU A;  5KHD A;  3NEU A;  2BVL A;  3RCO A;  3HGG A;  4G6D A;  3AG3 H;  4OU0 A;  2EIK H;  5IPA A;  1UEL B;  4IO9 F;  3DU6 A;  2JSC A;  2FUG 2;  3JSP A;  1XG1 A;  3OL3 A;  4U0Y A;  5M5Y J;  3PSI A;  1XD7 A;  1Z1D A;  1T98 A;  4RBO A;  3GYH X;  3OWT A;  2ZJR F;  1OCT C;  3I5U A;  3DPT A;  1FP2 A;  2MA3 A;  1VQM I;  1G4D A;  5KVR A;  1LQ1 A;  5JI6 A;  2ID3 A;  1U9O A;  2L01 A;  4HDV A;  4HLX A;  4MLO A;  1FZP B;  1YW7 A;  2WY7 Q;  3H35 A;  5D5W B;  3DQV C;  2NAZ A;  1A35 A;  3MD2 A;  2BBY A;  1QQI A;  3VWB A;  5TJJ A;  3F6O A;  1BA5 A;  4A6D A;  4W1U A;  3G6E I;  5L3E A;  1MDM A;  3S1N J;  3BWG A;  3PIO F;  3DXJ F;  4JYK A;  2BW3 B;  2R93 J;  1P4A A;  2DOF A;  2K86 A;  5EGO B;  2P6T A;  2PLY A;  2E36 A;  2JRM A;  1MW7 A;  5BQT A;  1PP8 F;  5EEG A;  4PJL A;  3D5R C;  4XOP A;  5F1R A;  5C4X J;  2L2O A;  2VC1 A;  3F8F A;  1FBU A;  3QQA A;  4LG3 A;  2KDZ A;  4NUB A;  4IPA A;  4BQN A;  3ZQH A;  2IW5 A;  4RGX A;  2E2I J;  2HR3 A;  2LC2 A;  3LA2 A;  3K4C A;  3AFH A;  2NS7 A;  4GXO A;  3AL0 B;  3EPZ A;  1PDN C;  2O61 A;  4B09 A;  1Z0X A;  1V55 H;  2CQQ A;  3DKX A;  4WCG A;  5FKL A;  3BG9 A;  1MMS A;  5DYM A;  1E17 A;  3BC8 A;  4AIJ A;  1EKE A;  4LLN A;  3A02 A;  4OIN F;  3HSE A;  5J47 A;  4IRG A;  4XR6 A;  1F9N A;  4KIF A;  3GUD A;  2L9N A;  2XSD C;  1A31 A;  3Q0U A;  2JQ7 A;  2JA8 J;  5J8F A;  5L3F A;  1Z6R A;  3D5S C;  5LHH A;  3CMY A;  1ON1 A;  2CQN A;  2XPV A;  1D0Y A;  3PNV A;  4V2G A;  2Q0O A;  1B72 A;  3V8J A;  4BAY A;  2XF5 A;  2LF8 A;  3W3C A;  5IYD J;  3A1Y A;  2P7V B;  1UG2 A;  4M6X A;  2BV6 A;  1WPK A;  4LFU A;  4ZTF A;  3LSJ A;  4KMU X;  1X3W B;  4G9Y A;  5DM7 F;  1KU7 A;  1I27 A;  1OYW A;  2R3S A;  3Q9S A;  4IOC F;  2DMN A;  3B73 A;  2CUZ A;  3OYD A;  1FOK A;  2GA2 A;  4PGG A;  4LK1 F;  2R7T A;  1HQC A;  2DK5 A;  4NDL A;  1MNM C;  2NS0 A;  4LK0 F;  2O5R A;  2R7O A;  3F22 A;  1B59 A;  1HW5 A;  1IJW C;  4Q47 A;  3GFM A;  3HJE A;  1IDZ A;  4YRV A;  3CCV I;  2NRA C;  4C2U A;  3FX3 A;  1XSX A;  2A5W A;  3J7Z I;  3KP3 A;  1SD4 A;  4DOZ A;  1NG6 A;  1VI0 A;  1XS9 A;  4BE2 A;  2F5V A;  3WGI A;  3OYK A;  3Q5F A;  3HRS A;  5D5U B;  1U5T B;  4G7H F;  4HNT A;  3IWF A;  3ROU A;  3CTA A;  4D5C A;  1B6A A;  5EZH A;  4R79 A;  1E3P A;  4MQ9 F;  3IKT A;  4FAS D;  1IGN A;  1B4A A;  2ICW G;  3FK6 A;  1D8J A;  2A5Y B;  4UV8 A;  4YIF A;  2E34 A;  5E1W A;  3S2D J;  1X3U A;  4S05 A;  1K78 B;  3VDX A;  1VQO I;  4R1H A;  3LQR A;  2P81 A;  2P7C B;  2H94 A;  1WI3 A;  3HOV J;  1VFC A;  1TNT A;  1EH8 A;  2PX9 A;  3EDP A;  3VSL A;  1JKO C;  4U87 A;  2EFW A;  1XDU A;  3BG6 A;  3DBH B;  4RAY A;  4CCL A;  4A3B J;  4B48 A;  2LKS A;  2RNJ A;  1S8N A;  1S9H A;  3K7A J;  1GV2 A;  4KIS A;  5ERI A;  3E97 A;  1W5C C;  2B7E A;  1D5Y A;  4XL9 A;  1OR7 C;  3QU6 A;  4CZC A;  3K4L A;  1VQ7 I;  5BMZ A;  4KT5 C;  4HV6 A;  3H5N A;  2H1L A;  4Y3O A;  4E7I A;  4NQW B;  5LLQ A;  2DA6 A;  3O2P E;  3JSO A;  3K4N A;  4IQ4 A;  1X4O A;  3N97 A;  4XM3 A;  1IRF A;  3ESW B;  3HTU A;  3DCF A;  2MSY A;  1IUF A;  2BW3 A;  3A03 A;  1UZC A;  2D1V A;  3GWZ A;  2ZJ2 A;  2LFB A;  5J1Y A;  2ELJ A;  1QHG A;  2I8D A;  4HX7 A;  4IHV A;  1F4K A;  1Z05 A;  3RYR A;  2W82 A;  3A0B C;  3C3W A;  1HCR A;  4I0A A;  2ZFU A;  2Y2Z A;  3B02 A;  3IH3 A;  5CVV A;  1ACI A;  3M3Y J;  5FLX K;  4A0Y A;  3NQO A;  1IRG A;  4EJT A;  3VSK A;  3OYA A;  5K5O A;  2F5C A;  4PUS A;  4CZZ A;  3A4C A;  5E18 F;  1K6Y A;  2A69 F;  3CCM I;  3QWL A;  1U5T A;  2DA4 A;  5EGO A;  4KA4 A;  1XMX A;  4IEJ A;  2KIQ A;  2HWV A;  3HRU A;  4BNC A;  4EJV A;  3S15 J;  5HVQ C;  2QBY A;  5FKM A;  1W1W E;  1X1B A;  3CCJ I;  2LY9 A;  2X85 A;  4JX5 A;  4Y13 A;  1Q1V A;  2BXY A;  2YX4 A;  2FEZ A;  5LGT A;  4S0H B;  1BI2 A;  4FCY A;  3G1L A;  5C4J J;  4OMY A;  1QVT A;  2Z5U A;  4HLY A;  4Y15 A;  5EYR A;  3CD6 I;  2VPL A;  4BXU A;  2XHK A;  1NK2 P;  4MFD A;  2IPQ X;  1UG0 A;  5TRD A;  1I6X A;  1JT6 A;  4NBQ A;  3P5J A;  3AKZ A;  4G6T B;  2Y69 H;  1J59 A;  1MKM A;  2XAU A;  3GLL A;  1G2H A;  4EGY A;  2HQA A;  4YEL A;  3TW7 A;  2XPW A;  2QSH X;  4BBR J;  5JLW A;  3JAM K;  4XSX F;  1R71 A;  4FT8 A;  3RZO J;  1Y6I A;  3F8C A;  1PUE E;  3PQJ A;  2W48 A;  4C3J J;  2HFH A;  4MHG A;  4C2M J;  3I4M J;  5FLM J;  2FU4 A;  1YO5 C;  3IC7 A;  1OFC X;  3FXR A;  3WU2 C;  4F7Z A;  3JRI A;  2UZK A;  3I55 I;  1FYL A;  4RAZ A;  3WE2 A;  1U3E M;  2LBF A;  4BQO A;  4EM0 B;  1P92 A;  3IV5 A;  2XC7 A;  1KA8 A;  4E7K A;  2BVM A;  5DD4 A;  1YS7 A;  1K79 A;  2YPR A;  3I0T A;  4XBF A;  4IHY A;  1BBY A;  4ESB A;  3K70 D;  3BTJ A;  1P2F A;  2LDU A;  3DLA A;  2OD5 A;  4IF4 A;  3ZQG A;  1I50 J;  1U8R A;  5GAE J;  2QCO A;  4LIV A;  4Y17 A;  1YE9 A;  2BXZ A;  2LK2 A;  3MQ0 A;  4BBS J;  3RYP A;  1SFO J;  3WHC A;  2FF4 A;  1ZLJ A;  2TDX A;  2X51 A;  3VYT B;  4KUM A;  4HQM A;  1IUY A;  3CES A;  3SDG A;  1JHH A;  3F8B A;  3LSK A;  2JUC A;  1TW3 A;  1EA3 A;  1D3Y A;  1QNT A;  2CH0 A;  2O3F A;  3H0G J;  5FD5 A;  2OTL I;  4F3Q A;  1QHH D;  3S16 J;  3I9V 2;  2VQL A;  1SAX A;  2Z9O A;  4HYE A;  2EJR A;  4HRI A;  1ZN2 A;  2XF7 A;  3K4J A;  3QYB A;  1DU0 A;  2NVX J;  3MEX A;  3ABU A;  3V8L A;  4RGR A;  1SAN A;  2XRO A;  3WHB A;  3ERM A;  2I10 A;  1WRJ A;  1D0X A;  1KU3 A;  1UHM A;  1MJB A;  3UNG C;  2WB1 N;  3BQZ A;  1ZKG A;  2KZG A;  2R7W A;  3KZI C;  1E3O C;  2IAI A;  2KRF A;  3W6K B;  1K4T A;  3OIO A;  3CCQ I;  4NHJ A;  1XSV A;  1V54 H;  1EH6 A;  4U0W A;  4DYR A;  3L1P A;  4I7H A;  4FIS A;  2BE5 F;  1R1U A;  2K40 A;  3BZK A;  4AVP A;  5LGU A;  4HDU A;  4OIO F;  2K27 A;  5EDN A;  2VC0 A;  3U1K A;  5DEQ A;  4DYC A;  4HQE A;  1IXS B;  2CQ7 A;  3BR0 A;  1YOV B;  3FBI B;  4M9S A;  1YIJ I;  3CC4 I;  1RKW A;  3GEZ A;  2B0L A;  2Z33 A;  2NVU B;  4YFN F;  1FOY A;  1KU2 A;  3CLO A;  1SFU A;  1Z91 A;  1NH3 A;  2ZC2 A;  1LDD A;  4KYW A;  3E3V A;  2XGC A;  3KYL A;  2FD5 A;  5LBQ A;  1FOW A;  5E3N A;  2NOJ B;  1VQ4 I;  4W97 A;  2E1N A;  3R61 A;  1YW9 A;  4O3M A;  2IGO A;  3HPH A;  5DD8 A;  5FKK A;  2H27 A;  4RA2 A;  1PJR A;  2XRN A;  4JK1 X;  1W7P D;  2UXN A;  1ON2 A;  2XKO A;  3JRA A;  4L5I A;  1VTN C;  3ZQ7 A;  2WV1 A;  3WTX C;  1LB2 A;  2HZD A;  2RQQ A;  4PZJ A;  4B43 A;  2PEX A;  3SFZ A;  1POG A;  1BIA A;  1RUN A;  4ON0 A;  3ZN0 A;  2JPC A;  5IP9 J;  4ZYD A;  2OPT A;  4BHC A;  3WGH A;  5E1X A;  1QVU A;  3L2W A;  2F4O B;  4UB8 C;  1MBE A;  2Y0S A;  1UMQ A;  3LA7 A;  3WGG A;  4MIM A;  4L0Y B;  2GXB A;  2HOA A;  3L09 A;  3EUK L;  1BI1 A;  2A3S A;  1ZG5 A;  1OCR H;  3T5X A;  1ZGW A;  1O4X A;  2R7U A;  5ICC A;  2B63 J;  1BJZ A;  3BG3 A;  5GTI C;  1QZZ A;  5IP7 J;  5LRR A;  1R22 A;  3I54 A;  4HOB A;  5ILS A;  4PGH A;  1DP7 P;  2LF7 A;  3GO5 A;  4LD5 A;  3DFG A;  1UB9 A;  5B1A H;  2HTJ A;  4K2E A;  3OIQ A;  2FSW A;  1ETO A;  2M0C A;  3VFZ A;  3H1C A;  2YSR A;  2L7Z A;  1RRJ A;  5E8I A;  2Y9Y A;  2E2J J;  4CCN A;  2L0K A;  2VOO A;  1T39 A;  2BY2 A;  2KRH A;  4KFC A;  4XKB A;  1FY7 A;  3IWZ A;  3MKY B;  3CUQ B;  1R5G A;  4ZDO A;  1BR1 A;  4RB3 C;  4DZJ A;  3U21 A;  3BTC A;  2Y75 A;  2V1N A;  2OJE D;  4M3E A;  1D5V A;  2HYJ A;  2H1K A;  3CMA I;  1V4R A;  2VIX A;  2XAG A;  4G94 A;  4CXF A;  1DDN A;  3ZMS A;  2HYF A;  3FKJ A;  2IBD A;  4AYB N;  4II2 A;  2KJB A;  2WY8 Q;  2ZJP F;  3WTW C;  4RLF A;  4BH9 A;  2DW4 A;  3W2W A;  4WXC A;  1AOY A;  2UV1 A;  2DXI A;  1OKR A;  3FXJ A;  3I59 A;  3S3N A;  5E17 F;  2KQR A;  3TO6 A;  2DQL A;  2WBM A;  5HS7 A;  3QOE A;  3GZ6 A;  2R7R A;  3CME I;  2M8E A;  1MGT A;  2ZXI A;  4C3I J;  1WHU A;  3AG1 H;  3LOC A;  2VI6 A;  1FNN A;  2EH3 A;  2XKP A;  2BHY A;  2EV6 A;  4CYD A;  3FDY A;  2CWE A;  4D7N A;  3HYI A;  4CCK A;  4D9J A;  4ZC3 A;  3KLO A;  2A6T A;  4XLA A;  2H6B A;  3OL4 A;  4ZYA A;  3ZPL A;  4Y33 A;  1VQ9 I;  3DTK A;  2HVS A;  2P8T A;  2VKD A;  5GPA A;  3KP6 A;  2VOP A;  3FMS A;  3D5L A;  3KZY A;  4E7J A;  3VYR B;  3OYF A;  1R36 A;  3DP7 A;  4G8X A;  1WZ2 A;  3CUO A;  2QEN A;  3WTS C;  1UAA A;  3EUA A;  1A5J A;  2QQ9 A;  3RJP A;  4P1W A;  3WOD F;  1IV6 A;  2VQC A;  1WJF A;  2R4G A;  3OYN A;  2VOD A;  2H8W A;  4KJZ A;  3FHN A;  3HRT A;  3F8N A;  5HS8 A;  4BJT A;  2IJL A;  3CCL I;  1GHC A;  2O8K A;  2UWM A;  1FBQ A;  5DCF A;  4IZZ A;  4Y52 J;  4CUG A;  4KIC A;  4BY7 J;  3OYM A;  3BPV A;  3F8M A;  2CFO A;  2KL4 A;  4ITV A;  3FMR A;  4IVN A;  2M3A A;  1NK3 P;  2F5F A;  1W5S A;  4MFE A;  2GQQ A;  2EA4 A;  4HNV A;  4G7Z F;  2DMT A;  2FOK A;  3HOT A;  1FSH A;  1U78 A;  3F3X A;  2VBX A;  3VYU B;  3PNT A;  5GTH C;  5K7H A;  2CG4 A;  4LIU A;  3FXQ A;  3C2B A;  2FML A;  1R1T A;  3IAS 2;  2DYR H;  1Y56 A;  4M6V A;  1QPM A;  3OSG A;  2L9R A;  1KYZ A;  3R0A A;  1LFP A;  1LFB A;  1ORK A;  4OWR B;  2NYX A;  2P5K A;  2NVT J;  5B3S H;  2K4J A;  2K5C A;  3MWM A;  1U2W A;  3T8R A;  1KQ0 A;  4N9H A;  2Y48 A;  4PSX A;  1RR8 C;  1ZK8 A;  1Z67 A;  4NNJ A;  2HOT A;  2E5N A;  1Z77 A;  4A3G J;  4CO8 A;  1P4W A;  1Q1H A;  3R6S A;  3TP0 A;  3L2Q A;  1FPQ A;  2EPF A;  2ETH A;  1LUJ B;  1TT0 A;  2PG4 A;  3PM1 A;  5DS9 A;  2XB5 A;  5KCM A;  4TV7 A;  4HBL A;  2UXX A;  1T8I A;  4A12 A;  1MBG A;  1GUU A;  4B8X A;  2VXZ A;  4IHX A;  4BAC A;  2HU9 A;  4BUP A;  5CKT A;  4M3F A;  1IRX A;  5FRN A;  3FHZ A;  3KP4 A;  1KYW A;  5IYC J;  1LKX A;  2GAU A;  3M9A A;  3ASO H;  2O6G E;  3I4P A;  2ZJQ F;  4KIT B;  3FM3 A;  3BPX A;  4A3D J;  2X1C A;  3IUO A;  3DTI A;  2DOA A;  1RKT A;  2X48 A;  2EZH A;  4C2T A;  5DM6 F;  1RPW A;  3HDD A;  2RKH A;  3I64 A;  2DTR A;  1QU3 A;  3QPT A;  4AIK A;  1QGP A;  2FE3 A;  2ISZ A;  5HDN A;  4XK4 A;  4H0E A;  2XB0 X;  3GFL A;  3WU0 A;  2EZI A;  3HZJ A;  4M6Y A;  1IN8 A;  5E3L A;  2EFN A;  2IXS A;  2AS5 F;  4FQG A;  1AA7 A;  2A68 F;  2P6S A;  3IHU A;  3CCU I;  2M7B A;  2ZCW A;  3Q3S A;  2E35 A;  3IKV A;  2QQB A;  1O3T A;  3PJR A;  4U7D A;  1IRZ A;  1XGN A;  2M1B A;  2VLA A;  3G1M A;  1ZTR A;  1A04 A;  3ZQQ A;  1X1A A;  2EK5 A;  3S93 A;  1ETX A;  3JTH A;  4JP0 A;  2L9V A;  3KCC A;  1ZR2 A;  3FM5 A;  4UXN A;  3VPR A;  4XMY A;  2E19 A;  3A0H C;  4MTD A;  1Y8R B;  4XRS A;  2X9D A;  2FOW A;  2ADU A;  3NRV A;  3SEZ A;  3OYH A;  1JUP A;  2R7F A;  2VQG A;  3LMM A;  1UCR A;  1IAW A;  4ENK A;  3WTV C;  5BNG A;  4Z6Y A;  2JA7 J;  4AC0 A;  2NS8 A;  2TRT A;  1CF7 B;  4XON A;  5F27 A;  1SVM A;  3ABL H;  3H0D A;  1X19 A;  4GO1 A;  2RNG A;  2LOO A;  2P4W A;  2MBF A;  5F0C A;  1X2M A;  3OS1 A;  1L3L A;  2TCT A;  5E79 C;  2GOM A;  2FBH A;  3O6B B;  3CUQ C;  3KLN A;  2JSP A;  3CJN A;  3OR2 C;  1IN4 A;  4ZJZ A;  5H6Q A;  4IHW A;  3BJO A;  1FMW A;  1ZHF A;  2DFE A;  2QGU A;  4A3K J;  3G71 I;  5CJ9 A;  1XC5 A;  4YEJ A;  4B47 A;  1AKH A;  5HNH A;  1GVD A;  4IKF A;  3PL8 A;  1KQ9 A;  5GPC A;  2O0Y A;  2COB A;  3TMO A;  1MBF A;  2H6C A;  2HPI A;  4A0X A;  3KYD B;  2XV4 S;  1T2K A;  1MMG A;  5H6R A;  2JJ7 A;  3J80 Z;  2LP0 A;  4YG2 F;  3RQI A;  3SFI A;  4HSR A;  1HLV A;  3CJQ B;  2HVR A;  4M3B A;  1V3F A;  1TQP A;  3OIP A;  4Y4R A;  4OMZ A;  3TO9 A;  2FBK A;  4PCQ A;  1R4M B;  2QLZ A;  2KMU A;  2J5O A;  3FXU A;  3R0J A;  1BR4 A;  1GV5 A;  1ZG3 A;  5DUK A;  3GME A;  1K7A A;  1MD0 A;  1R9T J;  3C7J A;  5J40 A;  1FJL A;  1O7L A;  2EB7 A;  5IP6 A;  4A3C J;  1C0W A;  2R0Q C;  2KJC A;  1YHQ I;  2XVC A;  1BI3 A;  2V1U A;  1TLH B;  2K7L A;  3JTG A;  1WI9 A;  4O6J A;  5C44 J;  1NG7 A;  5L3D A;  3PO3 J;  2PMU A;  2PI0 A;  1APL C;  1RNL A;  5K1Y A;  5BOX A;  3DKW A;  4M9X A;  5D5V B;  2D1H A;  3C2G A;  3S1Q J;  2VL8 A;  2VUM J;  2MW8 A;  3GTQ J;  2LLK A;  3K0L A;  4FHT A;  1XDS A;  5IOY A;  1A6Q A;  2ME0 A;  2E60 A;  3ZR8 X;  1F1Z A;  1WJA A;  4U0V A;  2KP6 A;  2WC2 A;  2E1O A;  3ZMU A;  2ZSI B;  4HA8 A;  1MBK A;  3CCE I;  3FXK A;  3M8F A;  5F64 A;  2HI3 A;  2PBI A;  2LBF B;  5B5E C;  2PJP A;  5GAD J;  4F92 B;  2EFQ A;  4WF2 A;  4XLC A;  1R58 A;  3MN2 A;  2HPM A;  1R6R A;  4IQJ A;  1YJN I;  3J7A O;  5JVT A;  2JA5 J;  4L0Z B;  3TP3 A;  4J01 A;  4GYG A;  5GAH J;  4PJN A;  3ONQ A;  3ZGK A;  2L3D A;  1H88 C;  3ZCO A;  2M9H A;  2LY2 A;  1B72 B;  2L54 A;  3P9I A;  1SFE A;  3DKY A;  2OAZ A;  4BEH A;  5K5Q A;  1J7K A;  5FRO A;  1N78 A;  4G7O F;  2GIV A;  2KLO A;  2CUJ A;  2NOG A;  2F4I A;  1SC7 A;  2QF7 A;  5HLT A;  1QZY A;  2OZ6 A;  4XRM A;  1Y0N A;  1W7P A;  5ED4 A;  3BT9 A;  3W6J B;  2EIN H;  2V7F A;  3RTR A;  4EVI A;  1WWX A;  1HF0 A;  2STW A;  3H5A A;  4IHS A;  4WXH A;  1JJ6 C;  1WQ2 A;  1HST A;  3DBL B;  2DT6 A;  3CDH A;  4QPQ A;  4RB1 A;  4BY1 J;  4HV5 A;  4Q4Z F;  3ZOB A;  2MH9 A;  4QSH A;  3KZZ A;  5EF6 A;  1D1C A;  1S7A A;  1OCZ H;  3HM5 A;  3HOW J;  1TZL A;  1TBX A;  3IP4 B;  1AU7 A;  4F91 B;  4XKW A;  2RGV A;  3CO6 C;  3S3M A;  2JZY A;  2YR2 A;  4XLF A;  4BDZ A;  2WB1 A;  2M87 A;  4BQA A;  1RC9 A;  5EG0 B;  2VE8 A;  2K4B A;  1Y1V J;  3CO7 C;  2V6C A;  3E0J B;  2GLO A;  1HOM A;  3MVP A;  3KET A;  3MAJ A;  3KEO A;  4LG0 A;  2LR8 A;  2MD0 A;  4N4N B;  1ZR4 A;  3BTL A;  1S7E A;  2JMW A;  5HNF A;  1YLF A;  2FQ4 A;  4MNU A;  4Z2Y A;  1K6O A;  2O03 A;  1O57 A;  2ZB9 A;  3JW4 A;  4KNY A;  2GXA A;  1I6H J;  5IT9 K;  4EGZ A;  2M2E A;  2NXN B;  3C18 A;  3WTU C;  3H36 A;  4EAT A;  2IT0 A;  2ZXH A;  3ZMT A;  3N4M A;  4AWX B;  2A61 A;  1S3J A;  3LSM A;  2BOL A;  4A3I J;  3GTL J;  2UUZ A;  1T38 A;  3J81 Z;  1ETQ A;  3HHG A;  3P7N A;  4HNU A;  1ETK A;  1P7I A;  2R92 J;  2BY0 A;  2FBI A;  2IA1 A;  3RSN A;  2CW8 A;  5M5W J;  1T33 A;  2HQ5 A;  2COM A;  1AHD P;  1KGS A;  1WKM A;  2IVM A;  2EWN A;  4I0B A;  1XGM A;  1CQT A;  4AUX A;  4IOA F;  1R23 A;  3IRQ A;  2WTE A;  4D1Q A;  3E6D A;  4M3D A;  3RKY A;  3OSF A;  2HEO A;  4X6A J;  1DGR M;  3HUG A;  1S5L C;  4H4K C;  3V7C A;  1JKR C;  3K9T A;  4HG2 A;  2V26 A;  3PFI A;  4GCV A;  5FJ8 J;  1NHA A;  1OR7 A;  2IGM A;  3QP5 A;  2WWY A;  4ESJ A;  1K78 A;  1F5T A;  4BXX J;  3EYY A;  1YX3 A;  3HEF A;  5J6X A;  1O3R A;  2CV1 A;  1JTY A;  4BXF A;  5D4R A;  2GM4 A;  4I2O A;  3KEQ A;  4EM1 A;  2LRE A;  4DQ2 A;  4ENM A;  3LWF A;  4B4C A;  5DUI A;  4CYC B;  3K1M A;  3BJA A;  1TWH J;  1R00 A;  1XTA A;  2F2E A;  2ZSH B;  5D6F A;  3PIP F;  1O3S A;  3DEW A;  1T08 B;  3CJT B;  3Q0W A;  4JQF A;  1VQ5 I;  1QRY A;  3TL4 X;  4XLH A;  5ILV A;  3FMQ A;  2Y9Z A;  3V8K A;  2CFX A;  2VBY A;  1Y1W J;  1Z7U A;  2KIF A;  2JVH A;  4BKX A;  1U0J A;  5EG0 A;  4E7L A;  3QP6 A;  3OYE A;  3L00 A;  2KPM A;  2KHM A;  4G12 A;  3BG5 A;  3BRO A;  1ITY A;  2K9N A;  3FWE A;  5A2Q Z;  2VXD A;  1JHF A;  1FIA A;  1W36 C;  1J5Y A;  5A2Q K;  3LAJ A;  5BPD A;  3K4M A;  1YS6 A;  1H8A C;  5IYB J;  2HDD A;  5HLI A;  2FNA A;  4HW0 A;  1JI8 A;  3RZD J;  5CYV A;  1FTZ A;  1ZYR F;  2L02 A;  2OTJ I;  1ZGA A;  3E6B A;  3K10 A;  5D5X B;  4HZF A;  3QPL A;  5F0H A;  2XAH A;  4S04 A;  4RAF A;  3HTS B;  1HBX G;  2QYO A;  1YG2 A;  3T0Y A;  4AVZ A;  1LE8 A;  2MC3 A;  2EV0 A;  1RI7 A;  2DU9 A;  4NC7 A;  1G59 A;  2OCE A;  5F08 A;  3IRR A;  3KIO A;  1KON A;  2ISY A;  3GZN B;  2AXT C;  1ZQ3 P;  2QKL B;  4PFO A;  4GDF A;  1L0O C;  2CUF A;  3JRD A;  1CF7 A;  2HTS A;  3JRF A;  1BC8 C;  2PN6 A;  1ETW A;  1I1G A;  3BR6 A;  4WXD A;  1K61 A;  1UHW A;  2RRE A;  4ZYE A;  3VOE A;  1TTY A;  4ZYG A;  3HSR A;  3AAF A;  1DUX C;  3KP5 A;  3GVA A;  3G73 A;  2R7V A;  1IG7 A;  1XGS A;  1ZEL A;  2ESH A;  3MZH A;  5BPI A;  4RB0 A;  5D4S A;  5H20 A;  2X6W A;  2YX7 A;  4AM3 A;  3BR1 A;  2CJJ A;  2K9Q A;  1KZH A;  1OCP A;  2B9S A;  1SVO A;  3CP8 A;  2LD5 A;  2O9L A;  1X58 A;  1U6G A;  3GF2 A;  4IRH A;  1MSE C;  3NWS A;  4BHB A;  1SMT A;  4RM2 A;  4XQF A;  4A69 C;  1P4X A;  3FXL A;  2LNB A;  3TDU C;  2OA4 A;  4GRI A;  5HS9 A;  3JRB A;  4LJZ F;  5K7F A;  4YII A;  1HXD A;  1S7O A;  3CLQ A;  4JX6 A;  3S3O A;  2JTV A;  3BR5 A;  2QSF X;  3DF8 A;  2M0M A;  4ZYH A;  3HG9 A;  3S2H J;  1OMI A;  3SDB A;  2F5E A;  1WJB A;  4WX9 A;  5FLX Z;  3DU5 A;  4P9F A;  2Q8K A;  2QZ8 A;  3BOQ A;  2A05 A;  2ZME B;  2VJJ A;  4XRF A;  3BQY A;  1Y0U A;  2DMQ A;  2F4M B;  1GT0 C;  1U5T C;  3CCR I;  3OS2 A;  1I39 A;  2HKX A;  4BHP A;  1ETV A;  1MZB A;  4UUT A;  4GGG A;  3CC7 I;  1J75 A;  3HOU J;  2Y0M A;  1TQM A;  1WH5 A;  5JR3 A;  1EH7 A;  2A6H F;  3V42 A;  4U7B A;  5GAG J;  2VT3 A;  2XIG A;  5JVG F;  2WV0 A;  4BL0 B;  4L9T A;  4WK8 F;  3HKZ N;  3FBN B;  2HDW A;  2HVQ A;  4CCO A;  1LFU P;  4M71 A;  1Z6T A;  4L9V A;  3LL7 A;  2BGC A;  2NNN A;  4BJ5 C;  4IX7 A;  2K3F A;  3ZQL A;  2R7X A;  4LOC A;  5FLV A;  3GXO A;  4MGR A;  1Z7L A;  4XIC A;  2HQN A;  3OY9 A;  3BZ6 A;  1E3H A;  2QA4 I;  2CSO A;  3U1D A;  2WAQ N;  2V9V A;  2DFI A;  1FP1 D;  4LMY A;  4RM3 A;  4FE7 A;  3SHF A;  2ZKZ A;  1T0F C;  2DA2 A;  2KDO A;  2X0L A;  4EJO A;  3GFI A;  4UVA A;  4YIR X;  1VQL I;  4DW6 A;  3NWT A;  1WGX A;  2CW0 F;  2JA2 A;  3ZMZ A;  1S72 I;  3ABM H;  4I98 B;  2Y30 A;  3DWL E;  3R60 A;  5DV5 A;  3GTJ J;  1N25 A;  1XMK A;  4ENN A;  5IOZ A;  5E1Z B;  4XKC A;  5LEJ A;  2CRG A;  2CS3 A;  3N05 A;  2C6Y A;  5B66 C;  3TOB A;  1FT9 A;  2OF7 A;  1TC3 C;  3LFU A;  5HLG A;  1ENH A;  2XGX A;  1TW2 A;  2L7K A;  3RDI A;  3S1R J;  3K69 A;  2EIJ H;  5CPR B;  1ZG1 A;  2V9K A;  4FET A;  4PJM A;  4XNF A;  1I1S A;  2DDA A;  1R5H A;  1B8I B;  3E6M A;  4XN0 A;  2XGD A;  5LHI A;  2JPB A;  3ZN1 A;  3KEY A;  4BDY A;  2R7Q A;  2W24 A;  1JTX A;  2Z99 A;  2PMH A;  4ABZ A;  4E7Z A;  1WSU A;  1DP3 A;  2VKE A;  3GTO J;  1OCO H;  2OU2 A;  4QWQ A;  3CCS I;  2K9S A;  2GXG A;  1GVJ A;  1S29 A;  2DQR A;  1LEA A;  2DMP A;  4D7M A;  3MKZ A;  4MEX F;  1P7J A;  1RR7 A;  3LSP A;  3M8E A;  3GTK J;  4AD9 A;  5EJC A;  2JUG A;  3MKW B;  3KX2 A;  4KN7 X;  1VQ6 I;  3X2Q H;  2HKO A;  3COA C;  1UFM A;  4CCM A;  3HL2 A;  1BN5 A;  4M9Z A;  2G9W A;  4KMF A;  4UNO A;  1ZGJ A;  1MJA A;  5C3E J;  2NVY J;  5HLH A;  3JAM Z;  2XPU A;  1OYI A;  1B9N A;  1W7P B;  2LKX A;  4JOM A;  2E71 A;  2L7F P;  3VOD A;  2FRH A;  2D5V A;  1TQI A;  4DGW B;  3AG2 H;  2QBY B;  1XCV A;  3LSI A;  3HC7 A;  4HX4 A;  2VAS A;  4O5V A;  1WVR A;  2X6X A;  2KIM A;  4EMS A;  4RB2 C;  2BYV E;  3ZMV A;  5JHF A;  4XLE A;  2GIZ A;  3TOA A;  1FOX A;  2VE9 A;  3RPU D;  3BDD A;  3G4S I;  4D5F A;  3RPU A;  2M7A A;  2V9P A;  4ASN A;  1XGO A;  1LJ9 A;  5E3M A;  4QPO A;  4HPQ A;  5J1R A;  2IS2 A;  2IGN A;  3CF5 F;  5KAI C;  2VBZ A;  3IL2 A;  1HKQ A;  3H92 A;  4KN4 X;  3RKW A;  3I53 A;  2L9S A;  2CV2 A;  2AHQ A;  3QPS A;  2MH2 A;  1TWC J;  5ICF A;  3WTZ A;  3EET A;  4A5M A;  3ZQC A;  4A93 J;  3OS0 A;  4CIC A;  1QO0 D;  2P5L C;  1J9I A;  3V7S A;  1NTC A;  2M30 A;  4J00 A;  2E7X A;  3UKG A;  3BZC A;  5CVI A;  4BQQ A;  1IV8 A;  4M73 A;  2W57 A;  2X1D A;  1X4P A;  1W0U A;  4I02 A;  2DJI A;  5EEH A;  3WE3 A;  4X0G A;  4P9U A;  5ICE A;  4GFB A;  3WG9 A;  2WAD A;  3IH2 A;  2R5Z B;  4XLP F;  1LEB A;  2X1E A;  4V19 K;  2Z16 A;  1J2X A;  1IO2 A;  1FSE A;  1X1C A;  1R4N B;  2EFP A;  3OMY A;  1Z3X A;  1IDY A;  3BCA A;  2PMZ N;  3T8T A;  1V5G A;  4IHT A;  2MGQ A;  1YW8 A;  4ZDP A;  1U8B A;  1X2N A;  2E5Z A;  1EF4 A;  5FFX A;  3KYC B;  4QLC U;  3HOX J;  1BJA A;  2EQR A;  1R1V A;  2JRT A;  2DYS H;  2Q2E B;  2FNP A;  1TNS A;  2AXL A;  2QM3 A;  3JRE A;  2XSJ C;  3IH4 A;  3RPQ A;  3GTM J;  5FFZ A;  3CMM A;  1ZRF A;  2G7U A;  5HDG A;  2E1M C;  1IW7 F;  1B1B A;  2K9M A;  2CGP A;  2VKH A;  2Q2E A;  2JN6 A;  2P5V A;  3DBR B;  2EA2 A;  5J4V A;  4HF2 A;  2DA3 A;  2W84 A;  2Z2S B;  5IT9 Z;  4L9N A;  4JX4 A;  2RV8 A;  5HOO A;  3E6C C;  4RGS A;  3JRH A;  1OCC H;  2ECC A;  3CDI A;  4II3 A;  3TED A;  3M7G A;  5F0F A;  1U9N A;  1J0R A;  3BY6 A;  2DI3 A;  3F72 A;  4BE1 A;  3SEQ A;  4HX8 A;  3F0C A;  2XUB A;  2Z3Y A;  4E7S A;  5HDK A;  1A6I A;  2ZNY A;  1UST A;  4MEY F;  4RS8 A;  4BEH B;  4L5J A;  3OYB A;  1ZRD A;  4F55 A;  5L3G A;  2EV5 A;  4E6K G;  3GCM A;  6PAX A;  1SMY F;  1OLT A;  1D1B A;  2DT5 A;  2V1X A;  4C9Y A;  1G8X A;  5CLS A;  2ACJ A;  2KIS A;  2FA5 A;  3HKZ A;  3S8P A;  3V7R A;  3DTE A;  1I3Q J;  2XAS A;  4IJA A;  3W6V A;  3KE2 A;  2PJR A;  3ZQF A;  1M1E B;  2RAE A;  1YRN B;  4DZP A;  4A3L J;  2ME6 A;  2AQF A;  2LSO A;  1FX7 A;  3QRF F;  4Q5S F;  2CV0 A;  4L9J A;  3F6V A;  5DCM B;  2EIL H;  4P96 A;  3OOU A;  2CO5 A;  2AQE A;  5TIS C;  1YTY A;  3QYE A;  2MAB A;  4B44 A;  4OIP F;  4A5N A;  3M07 A;  1STZ A;  4FX0 A;  2V4J C;  4M74 A;  5IT3 A;  2DJN A;  2FXA A;  4UY8 I;  2L5Q A;  5CVR A;  1DU6 A;  3G1O A;  4EV0 A;  2IS4 A;  4DBQ A;  1Z3Y A;  2DT7 B;  3WTY C;  1MH3 A;  2QVO A;  3ZRG A;  2HDC A;  2ID6 A;  4U88 A;  3WU1 B;  2QQ8 A;  3ERE D;  2VT2 A;  3HPG A;  3I4N J;  1HDP A;  3QOP A;  4ZDL A;  4ETS A;  1E2X A;  3CP2 A;  4PK4 A;  2W1O A;  3M1E A;  2D45 A;  4CH7 A;  4LLG F;  4ZH4 F;  2O7O A;  1MDM B;  1QA6 A;  1MSF C;  1OIS A;  1W4M A;  1B9M A;  3A01 B;  2QEX I;  2QKM B;  4ANJ A;  1R5I D;  5H2F C;  2HNH A;  5F04 A;  5IY5 H;  4CHU A;  2ZBK A;  3K6G A;  3EUH A;  4A3M J;  1SAU A;  2VB6 A;  4CYC A;  4M3G A;  1IC8 A;  1QBJ A;  1J09 A;  1DPU A;  1LNW A;  4LLL A;  2R5Y A;  1SD6 A;  3FF5 A;  1VQN I;  1D1A A;  3ABT A;  3J7Y J;  2CYY A;  3AG4 H;  2IP2 A;  3FZV A;  3OYL A;  1MMD A;  2YU9 J;  1ZLK A;  1G3Y A;  2LYC A;  1TWF J;  1VND A;  3E1S A;  3S17 J;  2D2W A;  1ZH5 A;  3OR1 C;  2QQA A;  1EV7 A;  2XRL A;  3OYC A;  3ZP5 A;  4OOI A;  1WH7 A;  2ZNZ A;  2W4S A;  2RQP A;  1GXP A;  2E2H J;  2MLK A;  3ZXS A;  3J7A Y;  1YJW I;  5M3M J;  2VJ5 A;  2V1D A;  4UV9 A;  4NC8 A;  3O8H A;  1T0F A;  3PO2 J;  1JXS A;  5LD2 C;  1XSD A;  2DPD A;  2HXO A;  4NC6 A;  1SD7 A;  1LDK B;  1V5F A;  3NAR A;  4DYQ A;  2A07 F;  2Y0S N;  4HF0 A;  2XAF A;  1OYY A;  1JKP C;  3I56 I;  5LEK A;  1YYV A;  2DTZ A;  3HB9 A;  3B6C A;  4OIR F;  4F93 B;  1XN7 A;  3I59 B;  1IF1 A;  5DCM A;  4D0P A;  5E8G A;  4CCJ A;  4DBR A;  4XOT A;  5F6F A;  1FWZ A;  3UR3 C;  1VZ0 A;  4WWC A;  4XKV A;  3RKQ A;  4RGU A;  1MMN A;  2XDV A;  3S32 A;  5JFR A;  4FE4 A;  1D8K A;  3MFK A;  3CUQ A;  3GBG A;  4XID A;  2PFB A;  4HAM A;  3HIF A;  2OC6 A;  3TGN A;  2DLL A;  5K7Z A;  2IA0 A;  3FIW A;  1TL8 A;  3K4B A;  4PJJ A;  1YI2 I;  2HQR A;  3LNQ A;  1YQA A;  3BLY A;  4DNC A;  3L2C A;  5LFA A;  2VJ4 A;  4BGD A;  1JT0 A;  4UB6 C;  4CSW A;  5FRM A;  3E5X A;  3S2W A;  2M45 A;  1OQY A;  5L3B A;  1FYK A;  1BL0 A;  4ZZD A;  4MO7 A;  2KT0 A;  5J1U A;  5E3O A;  1YRN A;  4XN3 A;  1AWC A;  2DOD A;  3D1N I;  1KU9 A;  2KIU A;  2JA6 J;  3MKL A;  3D0S A;  5KNL A;  3TDZ C;  2MLG A;  3TBI A;  1T95 A;  5D6E A;  1A36 A;  1TT5 B;  1IN7 A;  1WJ5 A;  1R49 A;  1R7J A;  1HKS A;  1ZAR A;  2LG4 A;  4ENJ A;  3TW6 A;  1USS A;  5LGN A;  4UUV A;  2P0W A;  3OYG A;  2IRF G;  1FMV A;  3PQK A;  3KP7 A;  2VKV A;  3O3K A; 
#chains in the Genus database with same CATH homology
 3GZ5 A;  5LHG A;  1BI0 A;  2RDP A;  4A2U A;  4N0B A;  2OQR A;  3F23 A;  1ZRE A;  1XCB A;  3GFJ A;  2E7W A;  3HRM A;  4ZZL A;  2VBW A;  4UVC A;  3J80 K;  3K2Z A;  5L3C A;  5ICG A;  4GYI A;  3HHH A;  2L4A A;  1ULY A;  1S6L A;  3GLX A;  3I71 A;  2L4M A;  1RIO H;  1T6S A;  4NQW A;  4M72 A;  4MQV A;  4UVB A;  4KIB A;  3SZT A;  1O7F A;  2YU3 A;  4YFK F;  3K1P A;  3WTT C;  3DEU A;  1IN5 A;  3LST A;  1FBS A;  2PQ8 A;  2XAJ A;  2JT1 A;  2DPU A;  1O3Q A;  1RUO A;  1OPC A;  2EFO A;  4XSZ F;  2RN7 A;  1FC3 A;  3LQQ A;  3VB2 A;  2V79 A;  1ODD A;  4KDP A;  1G3W A;  5AON A;  1BOA A;  3VEP A;  2ZFW A;  4BYY A;  3HOS A;  3E5U A;  3P9K A;  3K1N A;  5K5R A;  3BP8 A;  4FX4 A;  3QPH A;  1G6N A;  2E1C A;  3T1B A;  3V4G A;  1IXR C;  3DPL C;  3P9C A;  1KQ8 A;  2NNY A;  5JHU A;  5D8K B;  2W25 A;  2X4H A;  3R4K A;  3H3U A;  1I5Z A;  2STT A;  3U2R A;  1RZ4 A;  3SQN A;  2HGC A;  2RVC A;  2ZME A;  2G7H A;  1W5T A;  2FQ3 A;  2RC4 A;  3H3Z A;  1XB4 A;  2GZW A;  2XAQ A;  3ULQ B;  3LAP A;  4EM2 A;  3C1D A;  1BIB A;  1BC7 C;  2IA2 A;  1LVA A;  1IXC A;  2OZU A;  1Z9C A;  3TQN A;  3J81 K;  3OV8 A;  1G3S A;  2F5D A;  3GX4 X;  3LFK A;  1FLI A;  4CGZ A;  5AIQ A;  3REO A;  1ONV A;  2DBB A;  1HW2 A;  5FB2 A;  3E5Q A;  3GW2 A;  1IN6 A;  4A0Z A;  4R8H A;  2BEO A;  5FD6 A;  4UHT A;  4IRI A;  3ML6 A;  5CVJ A;  4LB5 A;  3OOP A;  1YIO A;  3TO7 A;  2MD5 A;  2K02 A;  3U9G A;  3L9F A;  3ISP A;  4EJU A;  3F21 A;  2HZT A;  3MCZ A;  4LG0 B;  3KFW X;  5DDG A;  3BJ6 A;  1H0M A;  2DO7 A;  3I58 A;  4I01 A;  4YFX F;  1IZ1 A;  5FGM A;  4G6Q A;  1H9T A;  1FYM A;  2FMY A;  5LRS A;  3KP2 A;  2H09 A;  3SXY A;  2ELH A;  1YFH A;  2M5W A;  1HKT A;  4P55 A;  1G3T A;  2GWR A;  5BS6 A;  2DK8 A;  3SZP A;  5E20 A;  4L18 B;  1HW1 A;  2GA1 A;  1P6R A;  4P5O A;  3G3Z A;  1HSJ A;  3TKY A;  1PP7 U;  4HF1 A;  2ZXJ A;  2LKP A;  4Q48 A;  2HYG D;  4IXA A;  4MTE A;  4N9I A;  4E70 A;  3RKX A;  4EQQ A;  2J5P A;  3LA3 A;  4KIG A;  2ESN A;  3RIR A;  1H9G A;  4OIQ F;  2CQK A;  3MZY A;  2HOE A;  3HSF A;  5FO5 A;  2VON A;  2O8X A;  4LB6 B;  2A6E F;  1CGP A;  4ESF A;  4LGW A;  3QU3 A;  2W85 A;  3ECO A;  2VN2 A;  4NB5 A;  1JE8 A;  2QWW A;  4AIH A;  4CDG A;  3Q9V A;  2OQG A;  1XMA A;  1MJ9 A;  2OBP A;  2ZO4 A;  3EQL F;  4EJW A;  1ZRC A;  1BM9 A;  3ELK A;  5D8L B;  4XLN F;  4I09 A;  4JBA A;  1REP C;  2KKO A;  5KK1 A;  2R7D A;  2DAO A;  3RI4 A;  3ECH A;  3QAH A;  1SFX A;  5CVU A;  2QUF A;  1DPR A;  1GXQ A;  3DV8 A;  1LDJ A;  3EYI A;  1JGS A;  5AIP A;  4PDK A;  2HS5 A;  3L7W A;  1SD5 A;  5J8C A;  4A6E A;  1ZAO A;  3ZMD A;  5ILU A;  3NEU A;  4G6D A;  4OU0 A;  2JSC A;  3JSP A;  4U0Y A;  1XD7 A;  1Z1D A;  1T98 A;  3GYH X;  3I5U A;  3DPT A;  1FP2 A;  2MA3 A;  1G4D A;  5KVR A;  1LQ1 A;  5JI6 A;  2L01 A;  4HDV A;  4HLX A;  1FZP B;  1YW7 A;  5D5W B;  3DQV C;  2NAZ A;  2BBY A;  1QQI A;  5TJJ A;  3F6O A;  4A6D A;  5L3E A;  1MDM A;  3BWG A;  3DXJ F;  1P4A A;  2K86 A;  2P6T A;  2PLY A;  5BQT A;  1PP8 F;  5EEG A;  5F1R A;  2VC1 A;  3F8F A;  1FBU A;  4IPA A;  2IW5 A;  4RGX A;  2HR3 A;  3LA2 A;  4GXO A;  1PDN C;  2O61 A;  4B09 A;  4WCG A;  5DYM A;  1E17 A;  4AIJ A;  4LLN A;  4OIN F;  3HSE A;  4IRG A;  1F9N A;  4KIF A;  3GUD A;  5J8F A;  5L3F A;  1Z6R A;  5LHH A;  1ON1 A;  2Q0O A;  3V8J A;  4BAY A;  2LF8 A;  2P7V B;  4M6X A;  2BV6 A;  4LFU A;  4KMU X;  1KU7 A;  4G9Y A;  1I27 A;  1OYW A;  2R3S A;  3Q9S A;  3B73 A;  1FOK A;  2GA2 A;  4PGG A;  4LK1 F;  1HQC A;  2DK5 A;  2NS0 A;  4LK0 F;  3F22 A;  1B59 A;  1HW5 A;  4Q47 A;  3GFM A;  2NRA C;  3FX3 A;  1XSX A;  3KP3 A;  1SD4 A;  3Q5F A;  3WGI A;  3HRS A;  5D5U B;  1U5T B;  4G7H F;  3IWF A;  3ROU A;  3CTA A;  1B6A A;  4R79 A;  4MQ9 F;  3IKT A;  1B4A A;  1D8J A;  2A5Y B;  4UV8 A;  4YIF A;  5E1W A;  1X3U A;  4S05 A;  1K78 B;  4R1H A;  3LQR A;  2P7C B;  2H94 A;  1TNT A;  1EH8 A;  3EDP A;  2EFW A;  1XDU A;  4RAY A;  2RNJ A;  1S8N A;  5ERI A;  3E97 A;  3QU6 A;  5BMZ A;  4KT5 C;  4HV6 A;  5LLQ A;  3O2P E;  3JSO A;  3N97 A;  1IRF A;  3HTU A;  2D1V A;  3GWZ A;  2ZJ2 A;  4HX7 A;  1F4K A;  1Z05 A;  3RYR A;  3C3W A;  4I0A A;  3B02 A;  5CVV A;  1IRG A;  5FLX K;  4A0Y A;  3NQO A;  4EJT A;  5K5O A;  2F5C A;  4CZZ A;  5E18 F;  2A69 F;  1U5T A;  4KA4 A;  2HWV A;  3HRU A;  4BNC A;  4EJV A;  5HVQ C;  2QBY A;  4Y13 A;  2YX4 A;  2FEZ A;  5LGT A;  1BI2 A;  4OMY A;  2Z5U A;  4HLY A;  4Y15 A;  4BXU A;  2XHK A;  2IPQ X;  5TRD A;  1I6X A;  1J59 A;  1MKM A;  4EGY A;  3JAM K;  4XSX F;  4FT8 A;  3F8C A;  1PUE E;  3PQJ A;  2HFH A;  4MHG A;  2FU4 A;  1YO5 C;  3IC7 A;  3FXR A;  4F7Z A;  2UZK A;  1FYL A;  4RAZ A;  3WE2 A;  1U3E M;  4EM0 B;  1P92 A;  1KA8 A;  5DD4 A;  1YS7 A;  1K79 A;  2YPR A;  3I0T A;  4XBF A;  1BBY A;  4ESB A;  1P2F A;  2LDU A;  2OD5 A;  4IF4 A;  1U8R A;  4Y17 A;  3MQ0 A;  3RYP A;  2FF4 A;  1ZLJ A;  2TDX A;  4KUM A;  4HQM A;  1IUY A;  1JHH A;  3F8B A;  1TW3 A;  1D3Y A;  1QNT A;  2O3F A;  5FD5 A;  1SAX A;  2Z9O A;  4HYE A;  2EJR A;  1ZN2 A;  3MEX A;  3ABU A;  3V8L A;  4RGR A;  2XRO A;  1WRJ A;  1KU3 A;  1UHM A;  1MJB A;  2KRF A;  3W6K B;  4NHJ A;  1XSV A;  1EH6 A;  4U0W A;  4I7H A;  2BE5 F;  1R1U A;  4AVP A;  5LGU A;  4HDU A;  4OIO F;  2K27 A;  2VC0 A;  5DEQ A;  4HQE A;  1IXS B;  4M9S A;  3GEZ A;  2B0L A;  2Z33 A;  4YFN F;  1KU2 A;  3CLO A;  1SFU A;  1Z91 A;  1LDD A;  4KYW A;  3E3V A;  5LBQ A;  2E1N A;  3R61 A;  1YW9 A;  4O3M A;  5DD8 A;  2H27 A;  2XRN A;  4JK1 X;  1W7P D;  2UXN A;  1ON2 A;  2XKO A;  4L5I A;  1VTN C;  3ZQ7 A;  3WTX C;  1LB2 A;  4PZJ A;  2PEX A;  3SFZ A;  1RUN A;  1BIA A;  4ON0 A;  3ZN0 A;  2JPC A;  4ZYD A;  4BHC A;  3WGH A;  5E1X A;  3LA7 A;  3WGG A;  4L0Y B;  2GXB A;  3L09 A;  1BI1 A;  2A3S A;  1ZG5 A;  3T5X A;  5ICC A;  1QZZ A;  5LRR A;  1R22 A;  3I54 A;  1DP7 P;  4HOB A;  4PGH A;  5ILS A;  2LF7 A;  3GO5 A;  4LD5 A;  3DFG A;  1UB9 A;  2HTJ A;  4K2E A;  2FSW A;  3VFZ A;  2YSR A;  5E8I A;  2VOO A;  1T39 A;  4KFC A;  1FY7 A;  3IWZ A;  3CUQ B;  1R5G A;  4RB3 C;  2Y75 A;  1D5V A;  1V4R A;  4G94 A;  2XAG A;  4CXF A;  1DDN A;  3ZMS A;  2HYF A;  2KJB A;  3WTW C;  4BH9 A;  2DW4 A;  1AOY A;  4WXC A;  1OKR A;  3I59 A;  5E17 F;  3TO6 A;  2DQL A;  5HS7 A;  3GZ6 A;  2M8E A;  1MGT A;  1FNN A;  2XKP A;  2EV6 A;  4CYD A;  2CWE A;  3HYI A;  3KLO A;  2H6B A;  3ZPL A;  2P8T A;  3KP6 A;  2VOP A;  3FMS A;  3D5L A;  3KZY A;  1R36 A;  3DP7 A;  4G8X A;  3CUO A;  2QEN A;  3WTS C;  2QQ9 A;  3RJP A;  3WOD F;  2VOD A;  3HRT A;  3F8N A;  5HS8 A;  2IJL A;  1GHC A;  2UWM A;  1FBQ A;  5DCF A;  4KIC A;  3BPV A;  3F8M A;  3FMR A;  4IVN A;  2F5F A;  1W5S A;  2GQQ A;  2EA4 A;  4G7Z F;  2FOK A;  3HOT A;  1FSH A;  1U78 A;  3F3X A;  2VBX A;  2CG4 A;  3FXQ A;  2FML A;  1R1T A;  1QPM A;  1KYZ A;  3R0A A;  2NYX A;  2P5K A;  2K4J A;  3MWM A;  1U2W A;  3T8R A;  1KQ0 A;  4N9H A;  2Y48 A;  4CO8 A;  1P4W A;  1Q1H A;  3R6S A;  1FPQ A;  2ETH A;  2PG4 A;  4TV7 A;  4HBL A;  2UXX A;  4A12 A;  4B8X A;  2VXZ A;  3FHZ A;  3KP4 A;  1KYW A;  2GAU A;  3M9A A;  2O6G E;  3I4P A;  3FM3 A;  3BPX A;  2RKH A;  3I64 A;  2DTR A;  3QPT A;  4AIK A;  1QGP A;  2FE3 A;  2ISZ A;  5HDN A;  4H0E A;  3GFL A;  3WU0 A;  4M6Y A;  1IN8 A;  2EFN A;  2AS5 F;  2A68 F;  2P6S A;  3IHU A;  2ZCW A;  3IKV A;  2QQB A;  1O3T A;  4U7D A;  1XGN A;  2M1B A;  1A04 A;  2EK5 A;  3JTH A;  3KCC A;  3FM5 A;  4UXN A;  4MTD A;  2ADU A;  3NRV A;  2R7F A;  1UCR A;  1IAW A;  4ENK A;  3WTV C;  1CF7 B;  4GO1 A;  2P4W A;  2MBF A;  1L3L A;  2FBH A;  3O6B B;  3CUQ C;  3KLN A;  3CJN A;  1IN4 A;  5H6Q A;  3BJO A;  1ZHF A;  5CJ9 A;  1KQ9 A;  2O0Y A;  2H6C A;  4A0X A;  2XV4 S;  1T2K A;  5H6R A;  3J80 Z;  4YG2 F;  1V3F A;  1TQP A;  3TO9 A;  4OMZ A;  2FBK A;  4PCQ A;  2QLZ A;  2J5O A;  3FXU A;  3R0J A;  1ZG3 A;  5DUK A;  1K7A A;  1MD0 A;  3C7J A;  1O7L A;  2EB7 A;  1C0W A;  2KJC A;  2XVC A;  1BI3 A;  2V1U A;  1TLH B;  2K7L A;  3JTG A;  1WI9 A;  4O6J A;  5L3D A;  2PMU A;  2PI0 A;  1RNL A;  5K1Y A;  5BOX A;  3DKW A;  4M9X A;  5D5V B;  2D1H A;  3K0L A;  4FHT A;  1XDS A;  1F1Z A;  4U0V A;  2WC2 A;  3ZMU A;  4HA8 A;  3M8F A;  5F64 A;  2PBI A;  2PJP A;  2EFQ A;  4WF2 A;  1R58 A;  3J7A O;  5JVT A;  4L0Z B;  4GYG A;  2L3D A;  2L54 A;  3P9I A;  1SFE A;  2OAZ A;  5K5Q A;  1J7K A;  4G7O F;  2GIV A;  1QZY A;  2OZ6 A;  1W7P A;  5ED4 A;  3W6J B;  3RTR A;  4EVI A;  1WWX A;  2STW A;  4IHS A;  4WXH A;  1WQ2 A;  1HST A;  3CDH A;  4RB1 A;  4HV5 A;  4Q4Z F;  2MH9 A;  3KZZ A;  1S7A A;  1TBX A;  2RGV A;  3CO6 C;  2JZY A;  2YR2 A;  2M87 A;  4BQA A;  2VE8 A;  2K4B A;  3CO7 C;  2V6C A;  3KET A;  3MAJ A;  3KEO A;  4LG0 A;  1YLF A;  4MNU A;  4Z2Y A;  1K6O A;  2O03 A;  1O57 A;  3JW4 A;  4KNY A;  5IT9 K;  4EGZ A;  3C18 A;  3WTU C;  2IT0 A;  3ZMT A;  3N4M A;  4AWX B;  2A61 A;  1S3J A;  1T38 A;  3J81 Z;  3HHG A;  3P7N A;  2FBI A;  2IA1 A;  2COM A;  1KGS A;  1WKM A;  2IVM A;  2EWN A;  4I0B A;  1XGM A;  1R23 A;  3IRQ A;  2WTE A;  3E6D A;  3RKY A;  2HEO A;  3HUG A;  3V7C A;  3K9T A;  3PFI A;  4GCV A;  2WWY A;  1NHA A;  1OR7 A;  3QP5 A;  4ESJ A;  1K78 A;  1F5T A;  3EYY A;  5J6X A;  1O3R A;  5D4R A;  4I2O A;  3KEQ A;  4EM1 A;  4DQ2 A;  4ENM A;  3LWF A;  5DUI A;  3K1M A;  3BJA A;  1R00 A;  2F2E A;  5D6F A;  1O3S A;  4JQF A;  5ILV A;  3FMQ A;  3V8K A;  2CFX A;  2VBY A;  1Z7U A;  2KIF A;  3QP6 A;  3L00 A;  3BRO A;  3FWE A;  5A2Q Z;  1JHF A;  1J5Y A;  5A2Q K;  3LAJ A;  5BPD A;  1YS6 A;  5HLI A;  2FNA A;  4HW0 A;  5CYV A;  1ZYR F;  2L02 A;  1ZGA A;  3E6B A;  5D5X B;  4HZF A;  4S04 A;  2XAH A;  3HTS B;  1HBX G;  2QYO A;  1YG2 A;  3T0Y A;  2MC3 A;  2EV0 A;  1RI7 A;  2DU9 A;  3IRR A;  2ISY A;  1CF7 A;  1L0O C;  2HTS A;  1BC8 C;  2PN6 A;  1I1G A;  4WXD A;  1UHW A;  4ZYE A;  3VOE A;  1TTY A;  4ZYG A;  3HSR A;  3AAF A;  1DUX C;  3KP5 A;  3GVA A;  3G73 A;  1XGS A;  2ESH A;  3MZH A;  5BPI A;  4RB0 A;  5D4S A;  5H20 A;  2YX7 A;  1U6G A;  3GF2 A;  4IRH A;  4BHB A;  1SMT A;  1P4X A;  2LNB A;  3TDU C;  2OA4 A;  5HS9 A;  4LJZ F;  4YII A;  1HXD A;  1S7O A;  2JTV A;  3DF8 A;  4ZYH A;  1OMI A;  2F5E A;  4WX9 A;  5FLX Z;  4P9F A;  2Q8K A;  2QZ8 A;  3BOQ A;  2ZME B;  4XRF A;  1Y0U A;  1U5T C;  2HKX A;  4BHP A;  1MZB A;  4GGG A;  1J75 A;  2Y0M A;  1TQM A;  5JR3 A;  1EH7 A;  2A6H F;  4U7B A;  2VT3 A;  2XIG A;  2WV0 A;  4L9T A;  4WK8 F;  4M71 A;  1Z6T A;  4L9V A;  2BGC A;  2NNN A;  3GXO A;  4MGR A;  2HQN A;  3BZ6 A;  2CSO A;  3U1D A;  2V9V A;  2DFI A;  1FP1 D;  4LMY A;  3SHF A;  2ZKZ A;  2X0L A;  4EJO A;  3GFI A;  4UVA A;  2CW0 F;  3ZMZ A;  4I98 B;  3R60 A;  5DV5 A;  1XMK A;  4ENN A;  5E1Z B;  5LEJ A;  2C6Y A;  3TOB A;  1FT9 A;  5HLG A;  2XGX A;  1TW2 A;  3RDI A;  3K69 A;  1ZG1 A;  1I1S A;  1R5H A;  3E6M A;  5LHI A;  2JPB A;  3ZN1 A;  2W24 A;  2Z99 A;  2PMH A;  1WSU A;  2OU2 A;  4QWQ A;  2GXG A;  1GVJ A;  1S29 A;  2DQR A;  1LEA A;  4MEX F;  3M8E A;  4AD9 A;  4KN7 X;  2HKO A;  3COA C;  1UFM A;  1BN5 A;  4M9Z A;  2G9W A;  4KMF A;  4UNO A;  1ZGJ A;  1MJA A;  5HLH A;  3JAM Z;  1OYI A;  1B9N A;  1W7P B;  3VOD A;  2FRH A;  1TQI A;  2QBY B;  1XCV A;  4HX4 A;  4O5V A;  4RB2 C;  2KIM A;  4EMS A;  2BYV E;  3ZMV A;  3TOA A;  2VE9 A;  3BDD A;  3RPU A;  4ASN A;  1XGO A;  1LJ9 A;  2VBZ A;  3IL2 A;  1HKQ A;  3H92 A;  4KN4 X;  3RKW A;  3I53 A;  2MH2 A;  5ICF A;  3WTZ A;  3EET A;  4A5M A;  4CIC A;  1QO0 D;  2P5L C;  1J9I A;  3V7S A;  2M30 A;  2E7X A;  5CVI A;  4M73 A;  2W57 A;  4I02 A;  5EEH A;  3WE3 A;  4P9U A;  5ICE A;  3WG9 A;  4XLP F;  1LEB A;  1J2X A;  1FSE A;  2EFP A;  3T8T A;  4IHT A;  1YW8 A;  5FFX A;  4QLC U;  1BJA A;  1R1V A;  2JRT A;  2FNP A;  1TNS A;  2AXL A;  2QM3 A;  3RPQ A;  5FFZ A;  1ZRF A;  2G7U A;  5HDG A;  1IW7 F;  1B1B A;  2CGP A;  2Q2E A;  2P5V A;  2EA2 A;  4HF2 A;  2W84 A;  5IT9 Z;  4L9N A;  2RV8 A;  5HOO A;  3E6C C;  4RGS A;  3M7G A;  1J0R A;  3BY6 A;  2DI3 A;  3F72 A;  4HX8 A;  2XUB A;  2Z3Y A;  5HDK A;  4RS8 A;  2ZNY A;  1UST A;  4MEY F;  4L5J A;  1ZRD A;  5L3G A;  2EV5 A;  6PAX A;  1SMY F;  2V1X A;  2DT5 A;  5CLS A;  2ACJ A;  2FA5 A;  3V7R A;  2XAS A;  4IJA A;  3KE2 A;  2LSO A;  1FX7 A;  3QRF F;  4Q5S F;  4L9J A;  3F6V A;  5DCM B;  4P96 A;  2CO5 A;  1YTY A;  4OIP F;  4A5N A;  1STZ A;  4FX0 A;  4M74 A;  5IT3 A;  2FXA A;  5CVR A;  4EV0 A;  3WTY C;  2QVO A;  2HDC A;  4U88 A;  3WU1 B;  3ERE D;  2VT2 A;  3QOP A;  4ETS A;  1E2X A;  3M1E A;  2D45 A;  4LLG F;  4ZH4 F;  1MDM B;  1W4M A;  1B9M A;  4CHU A;  2ZBK A;  3EUH A;  1QBJ A;  1DPU A;  1LNW A;  4LLL A;  1SD6 A;  3FF5 A;  3ABT A;  2CYY A;  2IP2 A;  3FZV A;  1ZLK A;  1G3Y A;  2D2W A;  1ZH5 A;  2QQA A;  1EV7 A;  3ZP5 A;  4OOI A;  2ZNZ A;  2RQP A;  1GXP A;  2MLK A;  2V1D A;  4UV9 A;  1T0F A;  1JXS A;  1XSD A;  2DPD A;  1SD7 A;  1LDK B;  2A07 F;  4HF0 A;  2XAF A;  1OYY A;  5LEK A;  1YYV A;  4OIR F;  1XN7 A;  3I59 B;  1IF1 A;  5DCM A;  4D0P A;  5E8G A;  5F6F A;  1FWZ A;  4WWC A;  4RGU A;  5JFR A;  1D8K A;  3MFK A;  3CUQ A;  2PFB A;  4HAM A;  3HIF A;  3TGN A;  2DLL A;  2IA0 A;  2HQR A;  1YQA A;  4DNC A;  3L2C A;  1FYK A;  3E5X A;  5L3B A;  2M45 A;  3S2W A;  4ZZD A;  1AWC A;  1KU9 A;  2KIU A;  3D0S A;  3TDZ C;  2MLG A;  5D6E A;  1IN7 A;  1R7J A;  1HKS A;  1ZAR A;  4ENJ A;  1USS A;  5LGN A;  4UUV A;  2IRF G;  3PQK A;  3KP7 A;  3O3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...