1AWDA

Ferredoxin [2fe-2s] oxidized form from chlorella fusca
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
94
structure length
94
Chain Sequence
YKVTLKTPSGEETIECPEDTYILDAAEEAGLDLPYSCRAGACSSCAGKVESGEVDQSDQSFLDDAQMGKGFVLTCVAYPTSDVTILTHQEAALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Crystal structure determination at 1.4 A resolution of ferredoxin from the green alga Chlorella fusca
pubmed doi rcsb
molecule tags Electron transport
total genus 23
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1awdA00
3FC4A 5GXGB 4N58A 1ZOYB 3VR8B 3W5VB 1YQ4B 4ZOHC 3W9CB 2K22A 2L83A 3P63A 1I7HA 4C7ZA 2DWQA 1E9MA 1TJEA 2JX5A 2MH7A 5H8YE 2CJOA 4JWUC 1CZPA 1WWTA 3VR9B 4YSYB 1FMAD 1E7PB 3P4PB 2E3TA 1XO3A 3AE8B 1QOAA 1XLPA 3EUB2 4YSZB 2MJ3A 2K5PA 3B9JA 1JROA 1QOGA 3AN1A 3P4SB 2KAJA 3LXFA 3HRDD 1QOFA 2L52A 3AEBB 5EE1A 1JRPA 3VRAB 3P4RB 3VRBB 1QLBB 1NVID 1B9RA 3AE7B 3P4QB 4US9A 1JW9D 3WCQA 3AE9B 3NVVA 1FO4A 1ZUD2 4HRSA 4USAA 3AE2B 3AEAB 1WGKA 3AECB 5EE9A 1ZXIA 3AE4B 4WWMA 1FRDA 5C3JB 3AH7A 1PUTA 1L6VA 4ITKA 1N62A 1V8CA 1DOYA 1ZP0B 4YXDB 2Q5WD 1JALA 1XLQA 4LTUA 2Y5CA 2N0SB 3W5UB 1NI3A 2WU2B 3CWIA 2QJLA 4KX6B 1IUEA 1KFYB 1VJKA 1VDVA 3SFDB 4C80A 4ZHPA 1JQ4A 1TYGB 1PFDA 2BS2B 3B2GA 1YQ3B 2G1EA 5AUKA 2EKIA 5C2TB 2W3RA 1NYRA 1QF6A 2OHFA 4N59A 1WXQA 2CJNA 1J7BA 1WYGA 3HVZA 4JWSC 1GAQB 4YTPB 1SF0A 2LEKA 3LB8C 1SIJA 3P1MA 3NVZA 1XLNA 3AV8A 1N5XA 2K9XA 1DOIA 5MPOA 1DOXA 2M56B 1FRRA 3AEDB 1NEKB 1QT9A 1TKEA 1E10A 3SR6A 1NYQA 2QIEB 4N6EB 2WDVB 4FXCA 1L5PA 4P6VF 1N61A 1J7CA 1FFVA 5H92C 4C7YA 2HTME 2PVOD 2WP9B 1FFUA 1GPXA 2KMMA 2WQYB 1RYJA 2M19A 3AE3B 1PDXA 2BS3B 4YT0B 1RFKA 1F0ZA 3KWLA 1TKGA 1OQQA 2W54A 2WDQB 2MJEA 1N63A 2AX5A 2BT6A 2CU3A 2DBYA 4JX1C 4YSXB 3NS1A 3BIID 4YTMB 3HUIA 5G5GA 2H88B 5AUIA 4A9AA 1AYFA 4US8A 1N5WA 4IDIA 1VLBA 3AE1B 1T3QA 3L4PA 4ZHOA 1FXAA 3AMZA 5G5HA 1NENB 2JQRB 3AM9A 3SFEB 3AE6B 1UWMA 1TKYA 2WDRB 1E6EB 3ABVB 1YJIA 1A70A 3AEGB 5EE3A 5EE0A 1L6UA 3AB5A 2W55A 2MJDA 1FXIA 2PKOA 4YTNB 1N60A 1OQRA 1FM0D 2FBWB 2WU5B 2WLBA 1FIQA 2ACZB 3PO0A 1YJJA 3NVYA 4WQMA 1AWDA 1OFFA 2W3SA 3RPFC 1E0ZA 3FAHA 1WRIA 2PIAA 2PVGC 1KF6B 3AEEB 1J7AA 2H89B 1KRHA 1JWAD 1QOBA 1ROEA 1CJEA 1RWSA 1R7SA 1EWYC 2WS3B 4HROA 3DWGC 2BS4B 1L0VB 3ETRA 1DGJA 1JWBD 3CIRB 3NRZA 1RM6C 3ZYYX 2B76B 1SB3C 1XLOA 3AEFB 3B2FA 3NVWA 3AE5B 3DWMA 1V97A
chains in the Genus database with same CATH superfamily
3FC4A 1SE4A 2JF5A 2GRIA 1P1AA 3KQ4A 1J19A 2AQ1B 3FILB 1P9DU 3P4PB 3DVGX 1EWCA 1QOGA 2KACA 4F1SA 4HK2A 4GGQA 1I4PA 3OJ3A 4FHKA 4BVUC 1B9RA 4BOZB 1ZGUB 5AZGA 3ZNZB 4WJQA 1FRDA 1LXDA 1L4ZB 3T3OA 3IBEA 4AWJA 4GB9A 5C23A 1EO6A 3A33B 3VAWA 4EFOA 4XDDA 2LVQA 3I63C 4LJOB 4IOIE 3IHPC 2MBEA 4L1BA 1V80A 1B1ZA 2WHIA 5IKCM 1WM3A 1SIJA 4KVGB 1TIFA 2Z8LA 5DPSA 4MM3B 1I4GA 1L2NA 1DOIA 4I6PA 2IGGA 3BINA 1I4RA 1N61A 4EZLA 1UZXB 2KD0A 3VTWA 5G2NA 1YNTE 1V1PA 2OEDA 3L54A 3ML8A 2BT6A 4YTMB 3DBSA 5CHVC 4RGTA 2BBCA 2DZKA 2BTEA 1FXAA 1OGWA 5D3IB 4W9FA 1MI0A 4IKGA 1Q5WB 3HHMA 1ESFA 2DZMA 3PV1A 3C19A 1ET6A 3NJTA 4WURA 1KJTA 3NS8A 2N9LA 2MCNB 3GE3C 2Z59B 1E8YA 3DWGC 1L0VB 1RM6C 4IWQA 2ZVNA 4OVUA 2AL6A 3TEWA 1VZ8A 2MLBA 5BYQA 1C9FA 1ISNA 4URKA 2LVPA 4JWUC 1ZXHA 2K6DB 1D5ZC 1IPGA 3ALBA 3Q8CA 2KTRB 2E3TA 2KWCA 2WXIA 1XLPA 2N9PC 4YSZB 4NJ6A 2KAJA 1C3TA 4S17A 3DVNV 3L0WB 1IP9A 3BY4B 3P4RB 1IGDA 3AE7B 2FCSA 1NBFC 3TBLD 1ZUD2 3EC8A 4HRSA 2INDC 1S3SG 1WJNA 4I6NB 3UI3A 1NI3A 1WGHA 1TYGB 1WJ4A 2LASA 1QF6A 4K3BA 1CMXB 5HI1A 2OHFA 1WFYA 3PREA 2D3GA 1J7BA 3AXCA 4JLCA 3KUDB 3NVZA 2ZPNA 4LNNA 2C7NB 2LGXA 2PPHA 4AQ7A 2KOXA 4HVBA 3ZTDA 1TY0A 1WGYA 2KDMA 4RM8A 2Y5BB 2M4NA 2BS3B 2D10A 3X0WA 1T0SC 4P7IA 3GZNI 1TS4A 3J9CA 2WGSA 1MPEA 3DVNU 2OOBB 3TEYA 1YX5B 2WX1A 3S2AA 4FULA 4KGRA 1V81A 3PZ7A 5EE3A 2XK5A 4MJSB 3VTVA 1VR9A 1FXIA 2Y5PA 2LWPA 2R2OA 1RLFA 3FAHA 2BPSA 2KT7A 3PVLA 2IO3B 1GG3A 1JWBD 1I4HA 4LNIA 3IVFA 1TT5B 1SB3C 2I1KA 3C0RB 3ZXRA 3VR8B 3W5VB 1Y56A 3W9CB 1WH3A 5FR6A 1WXSA 3NY5A 4TSSA 4KKIA 5J17A 2BVCA 3EUB2 5GMVA 2VZKB 4GN1A 1LM8B 1QOFA 4ZRQA 3AE9B 4FADA 2INPE 1ZXIA 4WWMA 2KN5A 1C1YB 1L6VA 1V8CA 3RYTA 4S0RA 1L4DB 3CWIA 2JT4B 1KFYB 1V1PB 4C80A 2KHWB 3Q8FA 2GBJA 3TEZA 2IYDB 3OLMD 4J3OD 2I2YA 1NYRA 1WXQA 2CJNA 1KLGD 4TMAB 3P1MA 2CR5A 3TSSA 3AI5A 2KK8A 4KV2A 1NEKB 1MHHE 2FCQA 3EECA 1DYQA 4HLEA 4LNFA 2KMMA 2ZPYA 4DWFA 2PMVA 1PDXA 1Q10A 3PS6A 1V1OA 1BUIC 1OQQA 4MGZE 1E0ZA 4XC2A 1FEHA 1FPYA 1KTKA 3LDZE 2UU7A 3SFEB 3PPAA 4KKJA 1TS3A 2WYQA 4WWNA 1T0QC 2YEPF 4XX5A 4M02A 1WXMA 4YTNB 1GB1A 2RSUA 3Q8EA 1QZEA 2MW5A 2NBUA 3RUIB 3N1YC 3HM6X 3DBLI 4P16A 5AEKB 5AZFA 1VCBA 2MWSB 1R7SA 1EWYC 1RAXA 4MH0E 3JSVA 2L00B 1V97A 3M63B 2PEAA 2MBOA 3A1QA 4KDLB 2BW2A 4WJOA 4IG7B 1I7HA 2C7HA 2MH7A 3EA6A 3ENEA 3QHTA 1WWTA 4B9KA 1E7PB 1GNUA 4DHJD 2LRUA 4OVVA 4EEWA 2L52A 3PLUA 5E6NA 4US9A 4RH6A 4JIOU 4EE2A 2R2QA 2INNE 3AECB 1GUAB 1SE2A 2RGFA 5T8IA 3M95A 4OZAA 3WAOA 2AYOB 1N6ZA 2K0PA 1WGGA 4KDIC 1MFWA 1XCQL 3W1SC 1VJKA 4KZ0A 1IBXA 1YQ3B 1T6BX 3FKYA 4FBJB 3RCZA 1HTOA 3PHWB 4P1BC 3MC8A 2WX0A 1XLNA 2JU6X 4Q2JA 2ZEQA 3RNBC 1I35A 4TQ1A 1L5PA 3OWEB 4BBNF 1VRAB 4B95A 1FFVA 4NJCA 3Q14C 4OZCA 3FILA 3R8BA 3RNGC 2VZKD 1WR1A 4DXGA 4M8NA 1C4CA 4YT0B 5D3DA 1JWMD 3Q3NC 4WH4A 3HUIA 4K7WA 4US8A 4DDID 4NQLB 4CHKA 3QX1A 1UGJA 1ZDXA 1A70A 2B3AA 2FIDA 5JXVA 2JUOA 3SDLC 3N32A 2WXKA 3IT4B 2W3SA 4ZRPA 2DYBA 2QSDA 1ACCA 5I4DA 3QAQA 4HKZE 1ROEA 1CJEA 2KX3A 4EZJA 2FAZA 1XLOA 1UBIA 1FCCC 2Y3AA 3I57A 3I3TB 1WXVA 5J2RA 4XYCA 1GJZA 2JX5A 1RRBA 5BMHA 2OJRA 1M4VA 2ZCBA 2NBVB 4BAXA 2WXMA 3VRAB 2GI9A 1WGRA 2WXHA 5CX3A 1L0XB 4M00A 1SBBB 1R4MB 3AE2B 5IN7A 3EHVA 4BOSC 2G45B 3BZDB 1N62A 2KVRA 1WI0A 3MJ5A 1JALA 3TIXA 2BWES 2QDFA 1YN4A 2EKIA 5C2TB 3DHHC 2AL3A 3AV8A 3BYTB 1E5WA 3NZ3A 4HCNB 2WP9B 3IAS1 3NZSA 2FE8A 3BK1A 5EDSA 3KWLA 2K39A 1H4RA 2WDQB 2BKRB 3VXWA 3PRZA 3KLSX 2H88B 4HCPB 4ANVA 1NENB 1AARA 1GC7A 2KDIA 3JSVB 1QILA 1TKYA 1I42A 2JSVX 3AEGB 3U2SC 3A1QB 3AB5A 4IM2A 1D5XC 3RZFA 2LUMA 4A20A 4WAFA 1C79A 2N9XA 3LJ3A 3GS2A 3T9LA 2N1VA 4MELA 5E6PA 1JWAD 4RM9A 3H7SA 4A3OA 2RDGA 3ETRA 4GIVA 4RNAA 4ZYNA 2PE6B 1K52A 3KUZA 4BKSD 4ZOHC 1TS5A 2KDFB 3SU8X 4ICVA 3VDZA 2IO1B 1FMAD 1IBXB 1JROA 4K1RB 1QKZA 4A3PA 1WE7A 3GE8C 5DCNA 3AEBB 1QLBB 3NHEB 3WCQA 1FO4A 5TSSA 2JZPA 1MVKA 4MJSA 3U7DA 5L95C 3P2BA 3HK0A 4A8XC 4HKQA 3TUOA 5KHQA 2NBWB 4NJ7A 4ARCA 3QA8A 3NG0A 4RMAA 2WXPA 4KSLC 3Q3FA 3O13A 1WYGA 1HE8A 1UD7A 3PSEB 2LEKA 2XN9C 2IBIB 1KLUD 4PS3A 1E8XA 2M56B 3DCGA 2Z0DB 3KVFB 3VH4B 1WX7A 1V9JA 1KLVA 2WXNA 1NI2A 3URYA 2FNJB 3Q2AC 2ZNVC 4R3DA 5L83A 1OTRB 3P42A 1E90A 3LYYA 4K81A 2CU3A 3BIID 5G5GA 3BWUD 2KJ6A 1YX6B 1F52A 1E6EB 2BYVE 3O65B 4PT5A 4E3CA 2HE7A 2KXJA 3ZRFA 2J52A 1FM0D 4EKUA 4ARIA 4UDUC 3VFKA 3GOEA 3EFUA 2TSSA 5FR3A 1FXTB 3DBRB 3UQAA 1JRUA 3V6EB 2BS4B 1C4PA 3APFA 4IWPA 1AW7A 1YQBA 5LNK1 2DZIA 1YQ4B 2AQ3B 2DNFA 2CJOA 1VD2A 3VR9B 3ONSA 3VTUA 2EELA 3RZWC 1A5RA 4IUMB 2ASQA 4RGMA 3B9JA 3P4SB 4W9LA 4LNOA 5IP4D 2GBNA 3VRBB 2LRWA 2Z0EB 2K6QA 2N1WA 1XD3B 4I6LB 2KQ7A 3ZRCA 1Q0WB 1Z2MA 4W9IA 1UH6A 2C9WB 3QC8B 3H8HA 3L16A 1D3ZA 3MJWA 1UGMA 4DK5A 2KYWA 3R2IA 2RR9A 4YTPB 1EF5A 4NAMA 2C7MB 3AEDB 4HPLB 4BKGA 2KFKB 4EUTA 2JWZA 1HEZE 4IC7B 1WIAA 2N7EA 4RCOA 3R7QA 1WZ0A 3K9OB 4GOCA 5AUIA 4MEMA 1AYFA 2BWFA 2DX5B 1N5WA 1TBEA 1HZ6A 2O6VA 1UWMA 4TV3A 4C00A 4DXFA 5J18A 4E74A 1WYWB 1FNUA 2JVCA 1AWDA 1QQRA 1UELA 2M17A 1GC6A 4II3B 3Q8BA 3Q6BA 3ZVVA 2M1MA 4C4VB 3V61A 2YLMA 3TMPB 4HROA 4DHJB 1NDDA 3V60A 2NS5A 2LGYA 4LCDE 5IO9A 3EGRA 4GXBA 1WXAA 1ZOYB 2KMAA 1ZW7A 5KHOA 4C7ZA 1TJEA 4BKSA 2D3BA 2DZJA 2NTSA 2GMIC 2DAFA 3H9DA 2MBQA 4YSYB 3ZNGC 2KWDA 2AEHA 3AN1A 4NAWA 3U52E 4A6QA 4NY0A 2QEJC 4NQKE 1UWXA 2L0TA 1K8RB 1C78A 1ET9A 1MG8A 5BYSA 3AEAB 2RD0A 1ZP0B 1X1MA 1XT9B 3U30A 2LJIA 4FJZA 2ON8A 2QJLA 1VDVA 3W2DA 3B2GA 2KQSA 1R4NB 5AUKA 4GDLA 4C56C 2NMQA 2SAKA 2KFJA 3KH0A 3MHSD 3RI7C 3X23A 4GDKB 1PQSA 2D5GA 4MH8A 1QT9A 2KQ4X 4J6IA 2J0KA 1NYQA 3SHQA 1J7CA 3N1ZC 5H92C 3JYUA 4REZA 4K7SA 1FFUA 4HDQA 1RYJA 2LHEA 2LJ5A 1H8CA 2HTHA 3PHXB 2LMCA 3A4RA 1WRDB 3OG5A 1P3QU 1YD8U 1PGAA 5CTRC 1T3QA 2JWUA 1XF5L 3AMZA 3DHGC 3M62B 1CK1A 3ZDMC 2KN4A 3VUXA 4MSMB 2JYTA 4A90A 1YJJA 1OFFA 2KWVB 4ICUA 1WX8A 3E9SA 2PIAA 5TR5A 2PVGC 2XNAC 3AEEB 3WAPA 3AULA 4L23A 2CKHB 1HXYD 3A9JB 1KOTA 2K22A 3RD2A 2DYOA 4IWOA 1IGCA 3WANA 4WJNA 3L10B 2MJ3A 2K5PA 3HM3A 2DYMA 4HJKA 4W9HA 3BVGA 4HPMB 2NR2A 4LDTD 4P1CC 4USAA 5E6OA 5CHWA 3ZUNA 5D94A 2BB6A 1UF0A 2L76A 1XLQA 3HVDA 1KM7A 2JPHA 4XWWA 3SFDB 1JQ4A 4ZRIA 1J0GA 2G1EA 1TY2A 4WQOB 2LHDA 1SF0A 3N1XC 3PZ8A 2MHJA 4GU2A 2O6VB 2J0MA 4XWTA 4P6VF 1YN3A 3WALA 2G3QB 1GPXA 3W1YA 3MP9A 4BZAA 1IYFA 2DBYA 1S1QB 2CU1A 1J8CA 2EMTA 2IPKD 2IO0B 1YJIA 2DENB 5EE0A 4K3CA 3MC9A 1LGRA 2MA9B 2IGHA 2FBWB 4OZBA 4G3XB 3AU4A 3PO0A 3U7ZA 1Q1OA 2XEWA 4KGTA 4LNKA 4NAWB 1BMLC 2L3ZA 1UUPA 3L08A 2WS3B 3R2TA 4G0NB 2QHOA 4EOYA 3AE5B 4IW0A 2AWTA 4XDCA 4MGYE 1HZ5A 2L0FA 2XBBC 4CQNA 4JQWC 4BKTA 2LXCA 3ZO5B 2CHZA 3DBRI 4GDLB 1SEBD 1JRPA 2L32A 2REXA 4CYEA 1WGKA 2WXQA 3BK2A 2MP2A 2LGSA 5E6JA 1PUTA 3VH3B 4ITKA 1E7UA 3QARA 1DOYA 1VZ7A 1KH0A 3W5UB 2WWZA 2GBKA 1MHXA 3L13A 1FNWA 3A9KA 2ONQA 2UWQA 2IDYA 3CSFA 2NPTA 4M0WA 1V86A 2QCZA 1HTQA 4LLGM 3BVMA 3IFWB 1WE6A 1N5XA 1UBQA 4L2YA 5JH5C 3SR6A 1WM2A 2PTLA 4HDOA 2L7RA 1MG4A 4E71A 4NZLB 1WX9A 2N7JA 3AE3B 4WIPA 5G55A 4WJPA 1P7FA 4G50A 3I5JC 2AX5A 2M0AA 1WR6E 4YSXB 3V6CB 2IJ0A 2FUG1 2K8BA 3H1UA 2FCNA 2ZVOA 4PK1A 1Y8RC 5HKHA 1TGZB 4B6WA 5BO4B 1E8ZA 5HG2A 4ACFA 2V9HA 2O6VD 3ZYYX 3APDA 3E56A 2YEPB 4N58A 4GLSC 2KFKA 1LO5D 4W9KA 2D07B 2DWQA 2RPQA 5IA7A 2LXAA 3EFCA 3KYCD 2GLSA 3D32A 2BQQA 1QOAA 3ZQ4A 1M94A 3IXSA 3LXFA 2QC8A 3HRDD 4GSWA 4ASWC 3VQIA 4MDKE 4WWPA 3V3XA 3NUHB 3AE4B 4WAAA 3NZUA 3ZXVA 1K51A 4M8MA 1D5MC 2N0SB 3NOBA 2AQ2B 4K7UA 1PFDA 1JCKB 2I1JA 3RNCC 2RPVA 2W3RA 4B0MA 3QJZA 4C4VA 2X38A 2BB5A 1AN8A 2WXFA 4EZKA 3ZGZA 2A5UA 1UNSA 5HHDG 1YJ1A 3WIMA 5DPTA 2HJ8A 2WDVB 3UIOB 1PGXA 2JXXA 3T3NA 4PYZA 2N7DA 2D3AA 4OVZA 4PS7A 2JXTA 4XZ4A 1ZPSA 2MBHA 1R4NI 4DBGA 1FD6A 2KDBA 3NS1A 1WMHA 2IGDA 1D6EC 3AE1B 3L4PA 1YMHE 3PLVA 5G5HA 5C1ZA 1C77A 2V0GA 2KLCA 3T8MA 1ENFA 3B08A 4NNJB 2KX0A 2PKOA 1JWUD 3KYDD 4W9GA 1N60A 1OQRA 3ZLZA 3ECIA 2N4FA 3QWZB 2JZZA 2V3SA 4FJYA 2HJ1A 2N9EB 2G4SA 1I4QA 4N9F4 3DHIC 3V62A 1XEEA 3CIRB 2B76B 4GDKA 1P7EA 2MP2B 2IY0B 2CS4A 2NVUI 3ZTCA 4G11A 2RDHA 3AE8B 2HD5B 3N3KB 1TZOA 3A9KB 2C60A 3BYYB 1XXGA 2NPTB 3H7PA 4M0WB 5EE1A 2PW9A 3MC0B 2BYFA 5EE9A 1I4XA 2LFIA 5C3JB 2GB1A 4B0EA 3ZJTA 1V5OA 1TZ1A 3TEXA 2DAJA 2MSED 3JW0X 2L1AA 4FLHA 4XE0A 2WXRA 3ZDTA 5FK9C 2E6XA 2VRRB 2GBRA 4MT5A 3I9V1 5BMGA 1L0YB 5MPOA 1DOXA 3ZW3A 3A9JA 3W1SA 3PZDA 3OAWA 3ZNID 2IO2B 1TS2A 4C7YA 4BBNC 2PVOD 3AU5A 2WQYB 2WXOA 3ML9A 2PJHA 3Q8AA 2W54A 3UINB 1JMLA 2MJEA 2O2VA 4KGSA 1ZKHA 1SGHA 3RT3B 3UF8A 2BYTA 5HFYA 2KNBA 3TCAA 3RN9C 2KZRA 2WU5B 1WJ6A 3NVYA 2ZZPB 1KF6B 4CO7A 2V3NA 1RWSA 4IM3A 3NRZA 4RF0A 3RULA 1SXTA 4ZRKA 3RNAC 4LDTB 2L8JA 1T0RC 3P63A 1F77A 4LJPB 4FHJA 4W9EA 1SE9A 4PYUA 4RGNA 1V5TA 1BXTA 2KMCA 1OEYA 4X57B 1V6EA 1NVID 1PYWD 3NVVA 3Q3OC 1LQBA 2M8SA 1BT0A 1PGBA 2LGIA 2CHWA 4AS1A 2LUEA 5IOIA 1WSPA 4KX6B 1IUEA 2BKFA 4AUQC 2QILA 5JHBA 3SEBA 1LFDA 4O1NA 3HVZA 1WMHB 1V2YA 3LB8C 3ZJVA 1EU3A 1WJUA 1U4AA 4KSKC 3DQVA 2W82A 3DBHB 1JWSD 1E10A 1SE3A 1C76A 3ZIMA 4AJWA 4D2KA 3CSTA 3R3MA 1VZ6A 4IM0A 2OJWA 2LZ6A 2RMMA 2WXLA 2PLPA 2LD9A 2FIFA 1F2RI 4MGIE 1TKGA 5D2MB 1XQQA 2G9HD 5LXHA 2M0XA 1RFAA 4A9AA 2CHXA 2MX2A 3Q3MC 1YOVB 4ZHOA 1P98A 2JQRB 2JRIB 4HXDA 1R4MI 4AOFA 4H2AA 1P0RA 2ZW0A 3UGBB 2ACZB 4XGAB 1TTNA 4QAYA 3KW5B 3WA0A 4GMVA 3M3JA 1KRHA 4W9JA 4BFRA 1QOBA 3PRMB 3H7PB 2JY6A 5LLIA 3TL5A 1GB4A 1K50A 3NVWA 4TUUA 3RNFC 3RPFC 2KJRA 3B1LX 2KC1A 2WDTB 4ZYSA 2BGFA 2I38A 2L83A 1E9MA 1STEA 4W9CA 5JZEB 3ZKJC 4DHZE 2R61A 2KANA 4LK0M 4OHJA 3R7RA 1ZE3D 3DDCB 4W9DA 3U4EG 2D2QA 1OQYA 5DPRA 1EU4A 2HDEA 3VVWB 2KKCA 2WXGA 3N20C 3L17A 2IY1B 2SEBD 5CHFA 3QQ8B 1YIWA 5AZHA 3TJPA 3AH7A 1OEYJ 4RGOS 2Q5WD 2Y5CA 3N9YC 5IAAC 2WU2B 1SJED 1HQRD 2D3CA 4ZHPA 4MSQB 2BS2B 1L7YA 1MJDA 3ZNHB 4YL8A 4ANWA 3DVGY 2O2VB 4ANXA 1GAQB 4HPPA 2K9XA 3JVZX 3CF6E 4HEA1 2LVOA 4N6EB 4FXCA 3PTFC 2J42A 2HTME 2V1YA 2ZJDA 2W9NA 3OJ4B 3KUCB 1SIFA 1F0ZA 1SJHD 1K53A 2NCNA 1ZDVA 2KTFA 1F1HA 2V4LA 2DLBA 2QMTA 1YN5A 3UIPB 3AM9A 4AP4C 4A55A 1L6UA 4ANUA 2X8XX 3VUYA 3KWVA 3APCA 3DOWA 5JHAA 5BYRA 1DGJA 3RMKC 3B2FA 3QK0A 2PE9A 1WY8A 5GXGB 3MFGA 2K25A 4MACA 2K8HA 5H8YE 3UQBA 2MBBB 1CZPA 4DQOC 2KLGA 1XO3A 2J53A 3SD5A 1C4AA 2V4IB 1FCLA 2J7QB 4FJVB 2GOWA 4F7ZA 4KIKA 1JW9D 4JGHB 2INCC 1EUVB 4PS8A 3QCAA 3H6NA 2EKEC 2XK5B 3R66C 3RFZB 4F8CB 3GP7A 4LTUA 2KJHB 1SSNA 3DPDA 4FA6A 2LI5A 4WWOA 3GZNB 4N59A 4OW0A 1T0YA 4YWGG 2K8CA 3U8ZA 2JRHA 3Q69A 4NPNA 1FRRA 1TKEA 4HWIB 3CMMB 2MQJA 4JL9A 3MTNB 2VH2A 4HJGE 3ZJUA 3N30A 3MHZA 1N63A 4JX1C 2MRPA 3V05A 2RDBC 4RF1A 1VLBA 4MM3A 1WF9A 2N9KA 4DHZB 3K9PB 3AE6B 2WDRB 3ABVB 3A4SC 3IG3A 1HA5A 2K1FA 2W55A 1WZ3A 3HIZA 2WLBA 4WQMA 3IT6B 3VUWA 4AJYB 1XCTL 1EF1A 2EMSA 4IDIA 3QIJA 1G6JA 1FNVA 2G4DB 2IZVB 1E7VA 1V49A 1T5XD 2KWUB 2J0JA 3PRPB 2GBMA 4JE3B 4ZRJA 2JZ3B 5LXIB 3P4QB 4TQ0A 1Z5SB 5D6JB 1CQVA 4YXDB 2JYEA 2LGDA 2KTRA 5DPWA 2ZW1A 3PGEA 2BYEA 3B0AA 4FN2A 3C8YA 4KZCA 2A4ZA 1F2RC 4DXAB 4JWSC 4MGKE 2BF8B 5D7GA 2L05A 1E8WA 2FUHB 2WNMA 3VHTC 2QIEB 2ZNVB 3PT2B 2FCMA 4II2B 2WXJA 3GB1A 2KDEB 2V3PA 2M19A 3DBLB 4M01A 1D4BA 3BVZA 1RFKA 2KVZA 2D11A 2MEKA 4DDGD 2J4XA 2ZCCA 2C5LC 3IAM1 2ICIA 3DBHI 4RFBA 5BMIA 5FKAC 2DHZA 2MJDA 2VH1A 1F9JA 1GOZA 4JPSA 1FIQA 2K3UA 1WRIA 2KC2A 3WAMA 1J7AA 2H89B 4TKNA 3Q3JA 4ZDVA 1EM7A 2NTTA 3RNEC 2YVCA 4KIKB 1WGDA 2UYZB 3AEFB 3DWMA 2KO3A
chains in the Genus database with same CATH topology
3FC4A 1SE4A 2GRIA 2K22A 3P63A 1F77A 2JX5A 3KQ4A 2AQ1B 2DYOA 3FILB 5BMHA 1M4VA 1IGCA 3P4PB 1EWCA 2MJ3A 2K5PA 1QOGA 2KACA 2DYMA 4RGNA 1I4PA 2WXMA 1BXTA 3VRAB 1B9RA 1NVID 3BVGA 2GI9A 2WXHA 1PYWD 3NVVA 1L0XB 1SBBB 4USAA 3AE2B 1FRDA 1L4ZB 3BZDB 3T3OA 1N62A 1PGBA 2LGIA 2BB6A 4AS1A 3MJ5A 1JALA 1XLQA 3HVDA 1WSPA 4XWWA 4KX6B 1IUEA 3SFDB 1JQ4A 4XDDA 2QILA 2G1EA 1YN4A 4IOIE 2EKIA 3SEBA 5C2TB 1TY2A 4O1NA 2LHDA 4L1BA 3HVZA 1B1ZA 1SF0A 3LB8C 1SIJA 3ZJVA 1EU3A 2Z8LA 3AV8A 2W82A 1I4GA 3BYTB 3PZ8A 4MM3B 1JWSD 1DOIA 1E10A 1SE3A 1C76A 2IGGA 4D2KA 3NZ3A 4XWTA 1I4RA 1VZ6A 1N61A 4P6VF 1YN3A 2RMMA 2WP9B 2WXLA 3IAS1 2PLPA 1GPXA 1YNTE 1V1PA 2FE8A 2OEDA 1F2RI 3BK1A 3MP9A 3KWLA 1TKGA 2WDQB 2BT6A 4YTMB 2DBYA 2G9HD 3KLSX 2H88B 4RGTA 2BBCA 4A9AA 2BTEA 4ZHOA 1FXAA 1NENB 2JQRB 2IPKD 5D3IB 1QILA 1TKYA 2JSVX 1YJIA 3AEGB 3U2SC 5EE0A 1MI0A 3AB5A 4H2AA 4IKGA 2ZW0A 2IGHA 1D5XC 2LUMA 2FBWB 1ESFA 4OZBA 2ACZB 3PO0A 4WAFA 1C79A 1ET6A 4WURA 3U7ZA 4KGTA 3GS2A 2N9LA 4NAWB 1KRHA 1JWAD 1BMLC 1QOBA 1UUPA 2WS3B 3R2TA 2RDGA 3DWGC 3ETRA 1L0VB 1RM6C 4RNAA 1GB4A 1K50A 3NVWA 3AE5B 3RPFC 3TEWA 1VZ8A 1K52A 4XDCA 4ZYSA 5BYQA 1C9FA 4ZOHC 1HZ5A 2I38A 2L83A 1E9MA 1STEA 1TS5A 4CQNA 4JWUC 1ZXHA 1D5ZC 2R61A 4LK0M 3Q8CA 1FMAD 1IBXB 4OHJA 2E3TA 2WXIA 1XLPA 1ZE3D 4YSZB 3U4EG 1JROA 1QKZA 4GDLB 2KAJA 3AEBB 1SEBD 1EU4A 1JRPA 3P4RB 1QLBB 2HDEA 1IGDA 3AE7B 2WXGA 3WCQA 2L32A 1FO4A 1ZUD2 4HRSA 2SEBD 5TSSA 1WGKA 2WXQA 2JZPA 3BK2A 3AH7A 1PUTA 5E6JA 1MVKA 4ITKA 1DOYA 4RGOS 1VZ7A 1KH0A 2Q5WD 3UI3A 2Y5CA 3N9YC 3W5UB 1NI3A 4A8XC 2WU2B 4HKQA 1SJED 1MHXA 1HQRD 3TUOA 4ZHPA 1TYGB 2BS2B 1FNWA 4ARCA 2ONQA 1QF6A 2IDYA 2WXPA 5HI1A 2OHFA 4M0WA 3O13A 1J7BA 1WYGA 1GAQB 2LEKA 4LLGM 3NVZA 2XN9C 3BVMA 1KLUD 1N5XA 2K9XA 4L2YA 2M56B 4HEA1 4AQ7A 3SR6A 2PTLA 4N6EB 4FXCA 2WXNA 1TY0A 2KDMA 2J42A 2HTME 3URYA 4NZLB 2N7JA 3AE3B 4WIPA 2BS3B 4R3DA 1F0ZA 1P7FA 1K53A 1SJHD 3P42A 3LYYA 2AX5A 1ZDVA 2M0AA 2CU3A 1TS4A 3J9CA 4YSXB 3BIID 1MPEA 3BWUD 5G5GA 2DLBA 2QMTA 1YN5A 2IJ0A 3TEYA 2FUG1 3AM9A 4A55A 1E6EB 4KGRA 3PZ7A 5EE3A 1L6UA 1VR9A 4PT5A 1FXIA 2Y5PA 3KWVA 2J52A 1FM0D 4ARIA 4UDUC 3FAHA 2TSSA 5FR3A 5HG2A 2BS4B 5BYRA 1DGJA 1JWBD 3ZYYX 1I4HA 1C4PA 1SB3C 3B2FA 1AW7A 5LNK1 3E56A 2YEPB 5GXGB 4N58A 3MFGA 3VR8B 3W5VB 1YQ4B 4MACA 4GLSC 1Y56A 1LO5D 3W9CB 2AQ3B 2DWQA 5H8YE 2CJOA 4TSSA 4DQOC 1CZPA 4KKIA 3VR9B 2EELA 3I57A 1XO3A 2J53A 1QOAA 1C4AA 3EUB2 2V4IB 4RGMA 1FCLA 2VZKB 3B9JA 3ZQ4A 3P4SB 3IXSA 3LXFA 3HRDD 1QOFA 3VRBB 3VQIA 1JW9D 4ZRQA 3AE9B 3V3XA 2INPE 3NUHB 1ZXIA 3AE4B 4WWMA 1L6VA 1V8CA 3RFZB 1K51A 3GP7A 4LTUA 1D5MC 1L4DB 1SSNA 2N0SB 2AQ2B 3H8HA 3CWIA 1KFYB 1V1PB 4C80A 3Q8FA 1PFDA 3TEZA 1JCKB 4J3OD 3R2IA 2I2YA 2RPVA 1NYRA 2W3RA 4B0MA 4N59A 4OW0A 1WXQA 2CJNA 2X38A 1KLGD 2BB5A 4TMAB 1AN8A 2WXFA 4YWGG 4YTPB 3P1MA 3ZGZA 1UNSA 3TSSA 3Q69A 5HHDG 1FRRA 3AEDB 1NEKB 1MHHE 1TKEA 4NAMA 1DYQA 2WDVB 1PGXA 1HEZE 4HJGE 3T3NA 3ZJUA 2KMMA 4OVZA 2PMVA 1PDXA 2JXTA 1Q10A 1ZPSA 1V1OA 1BUIC 3MHZA 1OQQA 4RCOA 1N63A 1E0ZA 1FD6A 4JX1C 3NS1A 5AUIA 3V05A 1AYFA 1FEHA 1N5WA 2IGDA 1D6EC 1KTKA 1VLBA 3AE1B 4RF1A 1HZ6A 3L4PA 1YMHE 5G5HA 2N9KA 3SFEB 3AE6B 1UWMA 2WDRB 3ABVB 1C77A 4KKJA 2V0GA 1HA5A 1ENFA 1TS3A 4DXFA 2W55A 2YEPF 2PKOA 4YTNB 1GB1A 1JWUD 3Q8EA 1N60A 1OQRA 1FNUA 2WLBA 4WQMA 1AWDA 1QQRA 3IT6B 1XCTL 4P16A 1I4QA 3Q8BA 1R7SA 1EWYC 4HROA 4IDIA 1XEEA 3CIRB 2B76B 1P7EA 1V97A 1FNVA 3EGRA 1ZOYB 2BW2A 1T5XD 1I7HA 4C7ZA 2MH7A 3EA6A 1TJEA 2NTSA 1WWTA 4YSYB 2KWDA 4JE3B 1E7PB 2RDHA 3AE8B 1TZOA 3AN1A 3BYYB 3U52E 4A6QA 2QEJC 2L52A 1XXGA 5EE1A 1UWXA 2PW9A 3P4QB 4US9A 4TQ0A 1C78A 1ET9A 4RH6A 3MC0B 5BYSA 4EE2A 3AEAB 2INNE 3AECB 5EE9A 1CQVA 1SE2A 1I4XA 2LFIA 5C3JB 2GB1A 5T8IA 4B0EA 4OZAA 1ZP0B 3ZJTA 4YXDB 3TEXA 2LJIA 2K0PA 2JYEA 2ON8A 2QJLA 1XCQL 1IBXA 1VJKA 1VDVA 2ZW1A 3W2DA 3B2GA 1YQ3B 5AUKA 4C56C 3C8YA 1T6BX 2L1AA 2NMQA 2SAKA 4XE0A 1F2RC 4JWSC 1XLNA 2WXRA 5FK9C 5D7GA 2E6XA 4GDKB 2D5GA 2JU6X 3I9V1 4MH8A 1L0YB 4MT5A 4Q2JA 5BMGA 2WNMA 3W1SA 1QT9A 5MPOA 1DOXA 2KQ4X 1NYQA 2QIEB 4TQ1A 1L5PA 3OWEB 1J7CA 1VRAB 1TS2A 1FFVA 5H92C 4NJCA 4C7YA 2PVOD 4REZA 1FFUA 2WXJA 3FILA 3GB1A 4OZCA 2WQYB 2V3PA 2WXOA 1RYJA 2LHEA 2M19A 3R8BA 1D4BA 2VZKD 4DXGA 3Q8AA 3BVZA 4YT0B 1C4CA 1RFKA 2LMCA 5D3DA 1JWMD 4WH4A 2W54A 1JMLA 2MJEA 2MEKA 3HUIA 4KGSA 2J4XA 4US8A 1PGAA 3IAM1 1T3QA 2JWUA 1XF5L 3AMZA 2BYTA 1UGJA 2ICIA 1ZDXA 1A70A 4RFBA 5JXVA 5BMIA 1CK1A 5FKAC 5HFYA 2MJDA 2KN4A 1GOZA 2WU5B 2JYTA 4A90A 4JPSA 1FIQA 2WXKA 2K3UA 1YJJA 3IT4B 3NVYA 2W3SA 1OFFA 1WRIA 3E9SA 2PIAA 2PVGC 2XNAC 1KF6B 4ZRPA 3AEEB 2QSDA 1ACCA 1J7AA 2H89B 5I4DA 2V3NA 4HKZE 1ROEA 1CJEA 4L23A 1EM7A 1RWSA 2NTTA 3NRZA 4RF0A 1XLOA 1SXTA 3AEFB 3DWMA 1FCCC 2Y3AA 1HXYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FC4 A;  5GXG B;  4N58 A;  1ZOY B;  3VR8 B;  3W5V B;  1YQ4 B;  4ZOH C;  3W9C B;  2K22 A;  2L83 A;  3P63 A;  1I7H A;  4C7Z A;  2DWQ A;  1E9M A;  1TJE A;  2JX5 A;  2MH7 A;  5H8Y E;  2CJO A;  4JWU C;  1CZP A;  1WWT A;  3VR9 B;  4YSY B;  1FMA D;  1E7P B;  3P4P B;  2E3T A;  1XO3 A;  3AE8 B;  1QOA A;  1XLP A;  3EUB 2;  4YSZ B;  2MJ3 A;  2K5P A;  3B9J A;  1JRO A;  1QOG A;  3AN1 A;  3P4S B;  2KAJ A;  3LXF A;  3HRD D;  1QOF A;  2L52 A;  3AEB B;  5EE1 A;  1JRP A;  3VRA B;  3P4R B;  3VRB B;  1QLB B;  1NVI D;  1B9R A;  3AE7 B;  3P4Q B;  4US9 A;  1JW9 D;  3WCQ A;  3AE9 B;  3NVV A;  1FO4 A;  1ZUD 2;  4HRS A;  4USA A;  3AE2 B;  3AEA B;  1WGK A;  3AEC B;  5EE9 A;  1ZXI A;  3AE4 B;  4WWM A;  1FRD A;  5C3J B;  3AH7 A;  1PUT A;  1L6V A;  4ITK A;  1N62 A;  1V8C A;  1DOY A;  1ZP0 B;  4YXD B;  2Q5W D;  1JAL A;  1XLQ A;  4LTU A;  2Y5C A;  2N0S B;  3W5U B;  1NI3 A;  2WU2 B;  3CWI A;  2QJL A;  4KX6 B;  1IUE A;  1KFY B;  1VJK A;  1VDV A;  3SFD B;  4C80 A;  4ZHP A;  1JQ4 A;  1TYG B;  1PFD A;  2BS2 B;  3B2G A;  1YQ3 B;  2G1E A;  5AUK A;  2EKI A;  5C2T B;  2W3R A;  1NYR A;  1QF6 A;  2OHF A;  4N59 A;  1WXQ A;  2CJN A;  1J7B A;  1WYG A;  3HVZ A;  4JWS C;  1GAQ B;  4YTP B;  1SF0 A;  2LEK A;  3LB8 C;  1SIJ A;  3P1M A;  3NVZ A;  1XLN A;  3AV8 A;  1N5X A;  2K9X A;  1DOI A;  5MPO A;  1DOX A;  2M56 B;  1FRR A;  3AED B;  1NEK B;  1QT9 A;  1TKE A;  1E10 A;  3SR6 A;  1NYQ A;  2QIE B;  4N6E B;  2WDV B;  4FXC A;  1L5P A;  4P6V F;  1N61 A;  1J7C A;  1FFV A;  5H92 C;  4C7Y A;  2HTM E;  2PVO D;  2WP9 B;  1FFU A;  1GPX A;  2KMM A;  2WQY B;  1RYJ A;  2M19 A;  3AE3 B;  1PDX A;  2BS3 B;  4YT0 B;  1RFK A;  1F0Z A;  3KWL A;  1TKG A;  1OQQ A;  2W54 A;  2WDQ B;  2MJE A;  1N63 A;  2AX5 A;  2BT6 A;  2CU3 A;  2DBY A;  4JX1 C;  4YSX B;  3NS1 A;  3BII D;  4YTM B;  3HUI A;  5G5G A;  2H88 B;  5AUI A;  4A9A A;  1AYF A;  4US8 A;  1N5W A;  4IDI A;  1VLB A;  3AE1 B;  1T3Q A;  3L4P A;  4ZHO A;  1FXA A;  3AMZ A;  5G5H A;  1NEN B;  2JQR B;  3AM9 A;  3SFE B;  3AE6 B;  1UWM A;  1TKY A;  2WDR B;  1E6E B;  3ABV B;  1YJI A;  1A70 A;  3AEG B;  5EE3 A;  5EE0 A;  1L6U A;  3AB5 A;  2W55 A;  2MJD A;  1FXI A;  2PKO A;  4YTN B;  1N60 A;  1OQR A;  1FM0 D;  2FBW B;  2WU5 B;  2WLB A;  1FIQ A;  2ACZ B;  3PO0 A;  1YJJ A;  3NVY A;  4WQM A;  1AWD A;  1OFF A;  2W3S A;  3RPF C;  1E0Z A;  3FAH A;  1WRI A;  2PIA A;  2PVG C;  1KF6 B;  3AEE B;  1J7A A;  2H89 B;  1KRH A;  1JWA D;  1QOB A;  1ROE A;  1CJE A;  1RWS A;  1R7S A;  1EWY C;  2WS3 B;  4HRO A;  3DWG C;  2BS4 B;  1L0V B;  3ETR A;  1DGJ A;  1JWB D;  3CIR B;  3NRZ A;  1RM6 C;  3ZYY X;  2B76 B;  1SB3 C;  1XLO A;  3AEF B;  3B2F A;  3NVW A;  3AE5 B;  3DWM A;  1V97 A; 
#chains in the Genus database with same CATH topology
 3FC4 A;  1SE4 A;  2JF5 A;  2GRI A;  1P1A A;  3KQ4 A;  1J19 A;  2AQ1 B;  3FIL B;  1P9D U;  3P4P B;  3DVG X;  1EWC A;  1QOG A;  2KAC A;  4F1S A;  4HK2 A;  4GGQ A;  1I4P A;  3OJ3 A;  4FHK A;  4BVU C;  1B9R A;  4BOZ B;  1ZGU B;  5AZG A;  3ZNZ B;  4WJQ A;  1FRD A;  1LXD A;  1L4Z B;  3T3O A;  3IBE A;  4AWJ A;  4GB9 A;  5C23 A;  1EO6 A;  3A33 B;  3VAW A;  4EFO A;  4XDD A;  2LVQ A;  3I63 C;  4LJO B;  4IOI E;  3IHP C;  2MBE A;  4L1B A;  1V80 A;  1B1Z A;  2WHI A;  5IKC M;  1WM3 A;  1SIJ A;  4KVG B;  1TIF A;  2Z8L A;  5DPS A;  4MM3 B;  1I4G A;  1L2N A;  1DOI A;  4I6P A;  2IGG A;  3BIN A;  1I4R A;  1N61 A;  4EZL A;  1UZX B;  2KD0 A;  3VTW A;  5G2N A;  1YNT E;  1V1P A;  2OED A;  3L54 A;  3ML8 A;  2BT6 A;  4YTM B;  3DBS A;  5CHV C;  4RGT A;  2BBC A;  2DZK A;  2BTE A;  1FXA A;  1OGW A;  5D3I B;  4W9F A;  1MI0 A;  4IKG A;  1Q5W B;  3HHM A;  1ESF A;  2DZM A;  3PV1 A;  3C19 A;  1ET6 A;  3NJT A;  4WUR A;  1KJT A;  3NS8 A;  2N9L A;  2MCN B;  3GE3 C;  2Z59 B;  1E8Y A;  3DWG C;  1L0V B;  1RM6 C;  4IWQ A;  2ZVN A;  4OVU A;  2AL6 A;  3TEW A;  1VZ8 A;  2MLB A;  5BYQ A;  1C9F A;  1ISN A;  4URK A;  2LVP A;  4JWU C;  1ZXH A;  2K6D B;  1D5Z C;  1IPG A;  3ALB A;  3Q8C A;  2KTR B;  2E3T A;  2KWC A;  2WXI A;  1XLP A;  2N9P C;  4YSZ B;  4NJ6 A;  2KAJ A;  1C3T A;  4S17 A;  3DVN V;  3L0W B;  1IP9 A;  3BY4 B;  3P4R B;  1IGD A;  3AE7 B;  2FCS A;  1NBF C;  3TBL D;  1ZUD 2;  3EC8 A;  4HRS A;  2IND C;  1S3S G;  1WJN A;  4I6N B;  3UI3 A;  1NI3 A;  1WGH A;  1TYG B;  1WJ4 A;  2LAS A;  1QF6 A;  4K3B A;  1CMX B;  5HI1 A;  2OHF A;  1WFY A;  3PRE A;  2D3G A;  1J7B A;  3AXC A;  4JLC A;  3KUD B;  3NVZ A;  2ZPN A;  4LNN A;  2C7N B;  2LGX A;  2PPH A;  4AQ7 A;  2KOX A;  4HVB A;  3ZTD A;  1TY0 A;  1WGY A;  2KDM A;  4RM8 A;  2Y5B B;  2M4N A;  2BS3 B;  2D10 A;  3X0W A;  1T0S C;  4P7I A;  3GZN I;  1TS4 A;  3J9C A;  2WGS A;  1MPE A;  3DVN U;  2OOB B;  3TEY A;  1YX5 B;  2WX1 A;  3S2A A;  4FUL A;  4KGR A;  1V81 A;  3PZ7 A;  5EE3 A;  2XK5 A;  4MJS B;  3VTV A;  1VR9 A;  1FXI A;  2Y5P A;  2LWP A;  2R2O A;  1RLF A;  3FAH A;  2BPS A;  2KT7 A;  3PVL A;  2IO3 B;  1GG3 A;  1JWB D;  1I4H A;  4LNI A;  3IVF A;  1TT5 B;  1SB3 C;  2I1K A;  3C0R B;  3ZXR A;  3VR8 B;  3W5V B;  1Y56 A;  3W9C B;  1WH3 A;  5FR6 A;  1WXS A;  3NY5 A;  4TSS A;  4KKI A;  5J17 A;  2BVC A;  3EUB 2;  5GMV A;  2VZK B;  4GN1 A;  1LM8 B;  1QOF A;  4ZRQ A;  3AE9 B;  4FAD A;  2INP E;  1ZXI A;  4WWM A;  2KN5 A;  1C1Y B;  1L6V A;  1V8C A;  3RYT A;  4S0R A;  1L4D B;  3CWI A;  2JT4 B;  1KFY B;  1V1P B;  4C80 A;  2KHW B;  3Q8F A;  2GBJ A;  3TEZ A;  2IYD B;  3OLM D;  4J3O D;  2I2Y A;  1NYR A;  1WXQ A;  2CJN A;  1KLG D;  4TMA B;  3P1M A;  2CR5 A;  3TSS A;  3AI5 A;  2KK8 A;  4KV2 A;  1NEK B;  1MHH E;  2FCQ A;  3EEC A;  1DYQ A;  4HLE A;  4LNF A;  2KMM A;  2ZPY A;  4DWF A;  2PMV A;  1PDX A;  1Q10 A;  3PS6 A;  1V1O A;  1BUI C;  1OQQ A;  4MGZ E;  1E0Z A;  4XC2 A;  1FEH A;  1FPY A;  1KTK A;  3LDZ E;  2UU7 A;  3SFE B;  3PPA A;  4KKJ A;  1TS3 A;  2WYQ A;  4WWN A;  1T0Q C;  2YEP F;  4XX5 A;  4M02 A;  1WXM A;  4YTN B;  1GB1 A;  2RSU A;  3Q8E A;  1QZE A;  2MW5 A;  2NBU A;  3RUI B;  3N1Y C;  3HM6 X;  3DBL I;  4P16 A;  5AEK B;  5AZF A;  1VCB A;  2MWS B;  1R7S A;  1EWY C;  1RAX A;  4MH0 E;  3JSV A;  2L00 B;  1V97 A;  3M63 B;  2PEA A;  2MBO A;  3A1Q A;  4KDL B;  2BW2 A;  4WJO A;  4IG7 B;  1I7H A;  2C7H A;  2MH7 A;  3EA6 A;  3ENE A;  3QHT A;  1WWT A;  4B9K A;  1E7P B;  1GNU A;  4DHJ D;  2LRU A;  4OVV A;  4EEW A;  2L52 A;  3PLU A;  5E6N A;  4US9 A;  4RH6 A;  4JIO U;  4EE2 A;  2R2Q A;  2INN E;  3AEC B;  1GUA B;  1SE2 A;  2RGF A;  5T8I A;  3M95 A;  4OZA A;  3WAO A;  2AYO B;  1N6Z A;  2K0P A;  1WGG A;  4KDI C;  1MFW A;  1XCQ L;  3W1S C;  1VJK A;  4KZ0 A;  1IBX A;  1YQ3 B;  1T6B X;  3FKY A;  4FBJ B;  3RCZ A;  1HTO A;  3PHW B;  4P1B C;  3MC8 A;  2WX0 A;  1XLN A;  2JU6 X;  4Q2J A;  2ZEQ A;  3RNB C;  1I35 A;  4TQ1 A;  1L5P A;  3OWE B;  4BBN F;  1VRA B;  4B95 A;  1FFV A;  4NJC A;  3Q14 C;  4OZC A;  3FIL A;  3R8B A;  3RNG C;  2VZK D;  1WR1 A;  4DXG A;  4M8N A;  1C4C A;  4YT0 B;  5D3D A;  1JWM D;  3Q3N C;  4WH4 A;  3HUI A;  4K7W A;  4US8 A;  4DDI D;  4NQL B;  4CHK A;  3QX1 A;  1UGJ A;  1ZDX A;  1A70 A;  2B3A A;  2FID A;  5JXV A;  2JUO A;  3SDL C;  3N32 A;  2WXK A;  3IT4 B;  2W3S A;  4ZRP A;  2DYB A;  2QSD A;  1ACC A;  5I4D A;  3QAQ A;  4HKZ E;  1ROE A;  1CJE A;  2KX3 A;  4EZJ A;  2FAZ A;  1XLO A;  1UBI A;  1FCC C;  2Y3A A;  3I57 A;  3I3T B;  1WXV A;  5J2R A;  4XYC A;  1GJZ A;  2JX5 A;  1RRB A;  5BMH A;  2OJR A;  1M4V A;  2ZCB A;  2NBV B;  4BAX A;  2WXM A;  3VRA B;  2GI9 A;  1WGR A;  2WXH A;  5CX3 A;  1L0X B;  4M00 A;  1SBB B;  1R4M B;  3AE2 B;  5IN7 A;  3EHV A;  4BOS C;  2G45 B;  3BZD B;  1N62 A;  2KVR A;  1WI0 A;  3MJ5 A;  1JAL A;  3TIX A;  2BWE S;  2QDF A;  1YN4 A;  2EKI A;  5C2T B;  3DHH C;  2AL3 A;  3AV8 A;  3BYT B;  1E5W A;  3NZ3 A;  4HCN B;  2WP9 B;  3IAS 1;  3NZS A;  2FE8 A;  3BK1 A;  5EDS A;  3KWL A;  2K39 A;  1H4R A;  2WDQ B;  2BKR B;  3VXW A;  3PRZ A;  3KLS X;  2H88 B;  4HCP B;  4ANV A;  1NEN B;  1AAR A;  1GC7 A;  2KDI A;  3JSV B;  1QIL A;  1TKY A;  1I42 A;  2JSV X;  3AEG B;  3U2S C;  3A1Q B;  3AB5 A;  4IM2 A;  1D5X C;  3RZF A;  2LUM A;  4A20 A;  4WAF A;  1C79 A;  2N9X A;  3LJ3 A;  3GS2 A;  3T9L A;  2N1V A;  4MEL A;  5E6P A;  1JWA D;  4RM9 A;  3H7S A;  4A3O A;  2RDG A;  3ETR A;  4GIV A;  4RNA A;  4ZYN A;  2PE6 B;  1K52 A;  3KUZ A;  4BKS D;  4ZOH C;  1TS5 A;  2KDF B;  3SU8 X;  4ICV A;  3VDZ A;  2IO1 B;  1FMA D;  1IBX B;  1JRO A;  4K1R B;  1QKZ A;  4A3P A;  1WE7 A;  3GE8 C;  5DCN A;  3AEB B;  1QLB B;  3NHE B;  3WCQ A;  1FO4 A;  5TSS A;  2JZP A;  1MVK A;  4MJS A;  3U7D A;  5L95 C;  3P2B A;  3HK0 A;  4A8X C;  4HKQ A;  3TUO A;  5KHQ A;  2NBW B;  4NJ7 A;  4ARC A;  3QA8 A;  3NG0 A;  4RMA A;  2WXP A;  4KSL C;  3Q3F A;  3O13 A;  1WYG A;  1HE8 A;  1UD7 A;  3PSE B;  2LEK A;  2XN9 C;  2IBI B;  1KLU D;  4PS3 A;  1E8X A;  2M56 B;  3DCG A;  2Z0D B;  3KVF B;  3VH4 B;  1WX7 A;  1V9J A;  1KLV A;  2WXN A;  1NI2 A;  3URY A;  2FNJ B;  3Q2A C;  2ZNV C;  4R3D A;  5L83 A;  1OTR B;  3P42 A;  1E90 A;  3LYY A;  4K81 A;  2CU3 A;  3BII D;  5G5G A;  3BWU D;  2KJ6 A;  1YX6 B;  1F52 A;  1E6E B;  2BYV E;  3O65 B;  4PT5 A;  4E3C A;  2HE7 A;  2KXJ A;  3ZRF A;  2J52 A;  1FM0 D;  4EKU A;  4ARI A;  4UDU C;  3VFK A;  3GOE A;  3EFU A;  2TSS A;  5FR3 A;  1FXT B;  3DBR B;  3UQA A;  1JRU A;  3V6E B;  2BS4 B;  1C4P A;  3APF A;  4IWP A;  1AW7 A;  1YQB A;  5LNK 1;  2DZI A;  1YQ4 B;  2AQ3 B;  2DNF A;  2CJO A;  1VD2 A;  3VR9 B;  3ONS A;  3VTU A;  2EEL A;  3RZW C;  1A5R A;  4IUM B;  2ASQ A;  4RGM A;  3B9J A;  3P4S B;  4W9L A;  4LNO A;  5IP4 D;  2GBN A;  3VRB B;  2LRW A;  2Z0E B;  2K6Q A;  2N1W A;  1XD3 B;  4I6L B;  2KQ7 A;  3ZRC A;  1Q0W B;  1Z2M A;  4W9I A;  1UH6 A;  2C9W B;  3QC8 B;  3H8H A;  3L16 A;  1D3Z A;  3MJW A;  1UGM A;  4DK5 A;  2KYW A;  3R2I A;  2RR9 A;  4YTP B;  1EF5 A;  4NAM A;  2C7M B;  3AED B;  4HPL B;  4BKG A;  2KFK B;  4EUT A;  2JWZ A;  1HEZ E;  4IC7 B;  1WIA A;  2N7E A;  4RCO A;  3R7Q A;  1WZ0 A;  3K9O B;  4GOC A;  5AUI A;  4MEM A;  1AYF A;  2BWF A;  2DX5 B;  1N5W A;  1TBE A;  1HZ6 A;  2O6V A;  1UWM A;  4TV3 A;  4C00 A;  4DXF A;  5J18 A;  4E74 A;  1WYW B;  1FNU A;  2JVC A;  1AWD A;  1QQR A;  1UEL A;  2M17 A;  1GC6 A;  4II3 B;  3Q8B A;  3Q6B A;  3ZVV A;  2M1M A;  4C4V B;  3V61 A;  2YLM A;  3TMP B;  4HRO A;  4DHJ B;  1NDD A;  3V60 A;  2NS5 A;  2LGY A;  4LCD E;  5IO9 A;  3EGR A;  4GXB A;  1WXA A;  1ZOY B;  2KMA A;  1ZW7 A;  5KHO A;  4C7Z A;  1TJE A;  4BKS A;  2D3B A;  2DZJ A;  2NTS A;  2GMI C;  2DAF A;  3H9D A;  2MBQ A;  4YSY B;  3ZNG C;  2KWD A;  2AEH A;  3AN1 A;  4NAW A;  3U52 E;  4A6Q A;  4NY0 A;  2QEJ C;  4NQK E;  1UWX A;  2L0T A;  1K8R B;  1C78 A;  1ET9 A;  1MG8 A;  5BYS A;  3AEA B;  2RD0 A;  1ZP0 B;  1X1M A;  1XT9 B;  3U30 A;  2LJI A;  4FJZ A;  2ON8 A;  2QJL A;  1VDV A;  3W2D A;  3B2G A;  2KQS A;  1R4N B;  5AUK A;  4GDL A;  4C56 C;  2NMQ A;  2SAK A;  2KFJ A;  3KH0 A;  3MHS D;  3RI7 C;  3X23 A;  4GDK B;  1PQS A;  2D5G A;  4MH8 A;  1QT9 A;  2KQ4 X;  4J6I A;  2J0K A;  1NYQ A;  3SHQ A;  1J7C A;  3N1Z C;  5H92 C;  3JYU A;  4REZ A;  4K7S A;  1FFU A;  4HDQ A;  1RYJ A;  2LHE A;  2LJ5 A;  1H8C A;  2HTH A;  3PHX B;  2LMC A;  3A4R A;  1WRD B;  3OG5 A;  1P3Q U;  1YD8 U;  1PGA A;  5CTR C;  1T3Q A;  2JWU A;  1XF5 L;  3AMZ A;  3DHG C;  3M62 B;  1CK1 A;  3ZDM C;  2KN4 A;  3VUX A;  4MSM B;  2JYT A;  4A90 A;  1YJJ A;  1OFF A;  2KWV B;  4ICU A;  1WX8 A;  3E9S A;  2PIA A;  5TR5 A;  2PVG C;  2XNA C;  3AEE B;  3WAP A;  3AUL A;  4L23 A;  2CKH B;  1HXY D;  3A9J B;  1KOT A;  2K22 A;  3RD2 A;  2DYO A;  4IWO A;  1IGC A;  3WAN A;  4WJN A;  3L10 B;  2MJ3 A;  2K5P A;  3HM3 A;  2DYM A;  4HJK A;  4W9H A;  3BVG A;  4HPM B;  2NR2 A;  4LDT D;  4P1C C;  4USA A;  5E6O A;  5CHW A;  3ZUN A;  5D94 A;  2BB6 A;  1UF0 A;  2L76 A;  1XLQ A;  3HVD A;  1KM7 A;  2JPH A;  4XWW A;  3SFD B;  1JQ4 A;  4ZRI A;  1J0G A;  2G1E A;  1TY2 A;  4WQO B;  2LHD A;  1SF0 A;  3N1X C;  3PZ8 A;  2MHJ A;  4GU2 A;  2O6V B;  2J0M A;  4XWT A;  4P6V F;  1YN3 A;  3WAL A;  2G3Q B;  1GPX A;  3W1Y A;  3MP9 A;  4BZA A;  1IYF A;  2DBY A;  1S1Q B;  2CU1 A;  1J8C A;  2EMT A;  2IPK D;  2IO0 B;  1YJI A;  2DEN B;  5EE0 A;  4K3C A;  3MC9 A;  1LGR A;  2MA9 B;  2IGH A;  2FBW B;  4OZB A;  4G3X B;  3AU4 A;  3PO0 A;  3U7Z A;  1Q1O A;  2XEW A;  4KGT A;  4LNK A;  4NAW B;  1BML C;  2L3Z A;  1UUP A;  3L08 A;  2WS3 B;  3R2T A;  4G0N B;  2QHO A;  4EOY A;  3AE5 B;  4IW0 A;  2AWT A;  4XDC A;  4MGY E;  1HZ5 A;  2L0F A;  2XBB C;  4CQN A;  4JQW C;  4BKT A;  2LXC A;  3ZO5 B;  2CHZ A;  3DBR I;  4GDL B;  1SEB D;  1JRP A;  2L32 A;  2REX A;  4CYE A;  1WGK A;  2WXQ A;  3BK2 A;  2MP2 A;  2LGS A;  5E6J A;  1PUT A;  3VH3 B;  4ITK A;  1E7U A;  3QAR A;  1DOY A;  1VZ7 A;  1KH0 A;  3W5U B;  2WWZ A;  2GBK A;  1MHX A;  3L13 A;  1FNW A;  3A9K A;  2ONQ A;  2UWQ A;  2IDY A;  3CSF A;  2NPT A;  4M0W A;  1V86 A;  2QCZ A;  1HTQ A;  4LLG M;  3BVM A;  3IFW B;  1WE6 A;  1N5X A;  1UBQ A;  4L2Y A;  5JH5 C;  3SR6 A;  1WM2 A;  2PTL A;  4HDO A;  2L7R A;  1MG4 A;  4E71 A;  4NZL B;  1WX9 A;  2N7J A;  3AE3 B;  4WIP A;  5G55 A;  4WJP A;  1P7F A;  4G50 A;  3I5J C;  2AX5 A;  2M0A A;  1WR6 E;  4YSX B;  3V6C B;  2IJ0 A;  2FUG 1;  2K8B A;  3H1U A;  2FCN A;  2ZVO A;  4PK1 A;  1Y8R C;  5HKH A;  1TGZ B;  4B6W A;  5BO4 B;  1E8Z A;  5HG2 A;  4ACF A;  2V9H A;  2O6V D;  3ZYY X;  3APD A;  3E56 A;  2YEP B;  4N58 A;  4GLS C;  2KFK A;  1LO5 D;  4W9K A;  2D07 B;  2DWQ A;  2RPQ A;  5IA7 A;  2LXA A;  3EFC A;  3KYC D;  2GLS A;  3D32 A;  2BQQ A;  1QOA A;  3ZQ4 A;  1M94 A;  3IXS A;  3LXF A;  2QC8 A;  3HRD D;  4GSW A;  4ASW C;  3VQI A;  4MDK E;  4WWP A;  3V3X A;  3NUH B;  3AE4 B;  4WAA A;  3NZU A;  3ZXV A;  1K51 A;  4M8M A;  1D5M C;  2N0S B;  3NOB A;  2AQ2 B;  4K7U A;  1PFD A;  1JCK B;  2I1J A;  3RNC C;  2RPV A;  2W3R A;  4B0M A;  3QJZ A;  4C4V A;  2X38 A;  2BB5 A;  1AN8 A;  2WXF A;  4EZK A;  3ZGZ A;  2A5U A;  1UNS A;  5HHD G;  1YJ1 A;  3WIM A;  5DPT A;  2HJ8 A;  2WDV B;  3UIO B;  1PGX A;  2JXX A;  3T3N A;  4PYZ A;  2N7D A;  2D3A A;  4OVZ A;  4PS7 A;  2JXT A;  4XZ4 A;  1ZPS A;  2MBH A;  1R4N I;  4DBG A;  1FD6 A;  2KDB A;  3NS1 A;  1WMH A;  2IGD A;  1D6E C;  3AE1 B;  3L4P A;  1YMH E;  3PLV A;  5G5H A;  5C1Z A;  1C77 A;  2V0G A;  2KLC A;  3T8M A;  1ENF A;  3B08 A;  4NNJ B;  2KX0 A;  2PKO A;  1JWU D;  3KYD D;  4W9G A;  1N60 A;  1OQR A;  3ZLZ A;  3ECI A;  2N4F A;  3QWZ B;  2JZZ A;  2V3S A;  4FJY A;  2HJ1 A;  2N9E B;  2G4S A;  1I4Q A;  4N9F 4;  3DHI C;  3V62 A;  1XEE A;  3CIR B;  2B76 B;  4GDK A;  1P7E A;  2MP2 B;  2IY0 B;  2CS4 A;  2NVU I;  3ZTC A;  4G11 A;  2RDH A;  3AE8 B;  2HD5 B;  3N3K B;  1TZO A;  3A9K B;  2C60 A;  3BYY B;  1XXG A;  2NPT B;  3H7P A;  4M0W B;  5EE1 A;  2PW9 A;  3MC0 B;  2BYF A;  5EE9 A;  1I4X A;  2LFI A;  5C3J B;  2GB1 A;  4B0E A;  3ZJT A;  1V5O A;  1TZ1 A;  3TEX A;  2DAJ A;  2MSE D;  3JW0 X;  2L1A A;  4FLH A;  4XE0 A;  2WXR A;  3ZDT A;  5FK9 C;  2E6X A;  2VRR B;  2GBR A;  4MT5 A;  3I9V 1;  5BMG A;  1L0Y B;  5MPO A;  1DOX A;  3ZW3 A;  3A9J A;  3W1S A;  3PZD A;  3OAW A;  3ZNI D;  2IO2 B;  1TS2 A;  4C7Y A;  4BBN C;  2PVO D;  3AU5 A;  2WQY B;  2WXO A;  3ML9 A;  2PJH A;  3Q8A A;  2W54 A;  3UIN B;  1JML A;  2MJE A;  2O2V A;  4KGS A;  1ZKH A;  1SGH A;  3RT3 B;  3UF8 A;  2BYT A;  5HFY A;  2KNB A;  3TCA A;  3RN9 C;  2KZR A;  2WU5 B;  1WJ6 A;  3NVY A;  2ZZP B;  1KF6 B;  4CO7 A;  2V3N A;  1RWS A;  4IM3 A;  3NRZ A;  4RF0 A;  3RUL A;  1SXT A;  4ZRK A;  3RNA C;  4LDT B;  2L8J A;  1T0R C;  3P63 A;  1F77 A;  4LJP B;  4FHJ A;  4W9E A;  1SE9 A;  4PYU A;  4RGN A;  1V5T A;  1BXT A;  2KMC A;  1OEY A;  4X57 B;  1V6E A;  1NVI D;  1PYW D;  3NVV A;  3Q3O C;  1LQB A;  2M8S A;  1BT0 A;  1PGB A;  2LGI A;  2CHW A;  4AS1 A;  2LUE A;  5IOI A;  1WSP A;  4KX6 B;  1IUE A;  2BKF A;  4AUQ C;  2QIL A;  5JHB A;  3SEB A;  1LFD A;  4O1N A;  3HVZ A;  1WMH B;  1V2Y A;  3LB8 C;  3ZJV A;  1EU3 A;  1WJU A;  1U4A A;  4KSK C;  3DQV A;  2W82 A;  3DBH B;  1JWS D;  1E10 A;  1SE3 A;  1C76 A;  3ZIM A;  4AJW A;  4D2K A;  3CST A;  3R3M A;  1VZ6 A;  4IM0 A;  2OJW A;  2LZ6 A;  2RMM A;  2WXL A;  2PLP A;  2LD9 A;  2FIF A;  1F2R I;  4MGI E;  1TKG A;  5D2M B;  1XQQ A;  2G9H D;  5LXH A;  2M0X A;  1RFA A;  4A9A A;  2CHX A;  2MX2 A;  3Q3M C;  1YOV B;  4ZHO A;  1P98 A;  2JQR B;  2JRI B;  4HXD A;  1R4M I;  4AOF A;  4H2A A;  1P0R A;  2ZW0 A;  3UGB B;  2ACZ B;  4XGA B;  1TTN A;  4QAY A;  3KW5 B;  3WA0 A;  4GMV A;  3M3J A;  1KRH A;  4W9J A;  4BFR A;  1QOB A;  3PRM B;  3H7P B;  2JY6 A;  5LLI A;  3TL5 A;  1GB4 A;  1K50 A;  3NVW A;  4TUU A;  3RNF C;  3RPF C;  2KJR A;  3B1L X;  2KC1 A;  2WDT B;  4ZYS A;  2BGF A;  2I38 A;  2L83 A;  1E9M A;  1STE A;  4W9C A;  5JZE B;  3ZKJ C;  4DHZ E;  2R61 A;  2KAN A;  4LK0 M;  4OHJ A;  3R7R A;  1ZE3 D;  3DDC B;  4W9D A;  3U4E G;  2D2Q A;  1OQY A;  5DPR A;  1EU4 A;  2HDE A;  3VVW B;  2KKC A;  2WXG A;  3N20 C;  3L17 A;  2IY1 B;  2SEB D;  5CHF A;  3QQ8 B;  1YIW A;  5AZH A;  3TJP A;  3AH7 A;  1OEY J;  4RGO S;  2Q5W D;  2Y5C A;  3N9Y C;  5IAA C;  2WU2 B;  1SJE D;  1HQR D;  2D3C A;  4ZHP A;  4MSQ B;  2BS2 B;  1L7Y A;  1MJD A;  3ZNH B;  4YL8 A;  4ANW A;  3DVG Y;  2O2V B;  4ANX A;  1GAQ B;  4HPP A;  2K9X A;  3JVZ X;  3CF6 E;  4HEA 1;  2LVO A;  4N6E B;  4FXC A;  3PTF C;  2J42 A;  2HTM E;  2V1Y A;  2ZJD A;  2W9N A;  3OJ4 B;  3KUC B;  1SIF A;  1F0Z A;  1SJH D;  1K53 A;  2NCN A;  1ZDV A;  2KTF A;  1F1H A;  2V4L A;  2DLB A;  2QMT A;  1YN5 A;  3UIP B;  3AM9 A;  4AP4 C;  4A55 A;  1L6U A;  4ANU A;  2X8X X;  3VUY A;  3KWV A;  3APC A;  3DOW A;  5JHA A;  5BYR A;  1DGJ A;  3RMK C;  3B2F A;  3QK0 A;  2PE9 A;  1WY8 A;  5GXG B;  3MFG A;  2K25 A;  4MAC A;  2K8H A;  5H8Y E;  3UQB A;  2MBB B;  1CZP A;  4DQO C;  2KLG A;  1XO3 A;  2J53 A;  3SD5 A;  1C4A A;  2V4I B;  1FCL A;  2J7Q B;  4FJV B;  2GOW A;  4F7Z A;  4KIK A;  1JW9 D;  4JGH B;  2INC C;  1EUV B;  4PS8 A;  3QCA A;  3H6N A;  2EKE C;  2XK5 B;  3R66 C;  3RFZ B;  4F8C B;  3GP7 A;  4LTU A;  2KJH B;  1SSN A;  3DPD A;  4FA6 A;  2LI5 A;  4WWO A;  3GZN B;  4N59 A;  4OW0 A;  1T0Y A;  4YWG G;  2K8C A;  3U8Z A;  2JRH A;  3Q69 A;  4NPN A;  1FRR A;  1TKE A;  4HWI B;  3CMM B;  2MQJ A;  4JL9 A;  3MTN B;  2VH2 A;  4HJG E;  3ZJU A;  3N30 A;  3MHZ A;  1N63 A;  4JX1 C;  2MRP A;  3V05 A;  2RDB C;  4RF1 A;  1VLB A;  4MM3 A;  1WF9 A;  2N9K A;  4DHZ B;  3K9P B;  3AE6 B;  2WDR B;  3ABV B;  3A4S C;  3IG3 A;  1HA5 A;  2K1F A;  2W55 A;  1WZ3 A;  3HIZ A;  2WLB A;  4WQM A;  3IT6 B;  3VUW A;  4AJY B;  1XCT L;  1EF1 A;  2EMS A;  4IDI A;  3QIJ A;  1G6J A;  1FNV A;  2G4D B;  2IZV B;  1E7V A;  1V49 A;  1T5X D;  2KWU B;  2J0J A;  3PRP B;  2GBM A;  4JE3 B;  4ZRJ A;  2JZ3 B;  5LXI B;  3P4Q B;  4TQ0 A;  1Z5S B;  5D6J B;  1CQV A;  4YXD B;  2JYE A;  2LGD A;  2KTR A;  5DPW A;  2ZW1 A;  3PGE A;  2BYE A;  3B0A A;  4FN2 A;  3C8Y A;  4KZC A;  2A4Z A;  1F2R C;  4DXA B;  4JWS C;  4MGK E;  2BF8 B;  5D7G A;  2L05 A;  1E8W A;  2FUH B;  2WNM A;  3VHT C;  2QIE B;  2ZNV B;  3PT2 B;  2FCM A;  4II2 B;  2WXJ A;  3GB1 A;  2KDE B;  2V3P A;  2M19 A;  3DBL B;  4M01 A;  1D4B A;  3BVZ A;  1RFK A;  2KVZ A;  2D11 A;  2MEK A;  4DDG D;  2J4X A;  2ZCC A;  2C5L C;  3IAM 1;  2ICI A;  3DBH I;  4RFB A;  5BMI A;  5FKA C;  2DHZ A;  2MJD A;  2VH1 A;  1F9J A;  1GOZ A;  4JPS A;  1FIQ A;  2K3U A;  1WRI A;  2KC2 A;  3WAM A;  1J7A A;  2H89 B;  4TKN A;  3Q3J A;  4ZDV A;  1EM7 A;  2NTT A;  3RNE C;  2YVC A;  4KIK B;  1WGD A;  2UYZ B;  3AEF B;  3DWM A;  2KO3 A; 
#chains in the Genus database with same CATH homology
 3FC4 A;  1SE4 A;  2GRI A;  2K22 A;  3P63 A;  1F77 A;  2JX5 A;  3KQ4 A;  2AQ1 B;  2DYO A;  3FIL B;  5BMH A;  1M4V A;  1IGC A;  3P4P B;  1EWC A;  2MJ3 A;  2K5P A;  1QOG A;  2KAC A;  2DYM A;  4RGN A;  1I4P A;  2WXM A;  1BXT A;  3VRA B;  1B9R A;  1NVI D;  3BVG A;  2GI9 A;  2WXH A;  1PYW D;  3NVV A;  1L0X B;  1SBB B;  4USA A;  3AE2 B;  1FRD A;  1L4Z B;  3BZD B;  3T3O A;  1N62 A;  1PGB A;  2LGI A;  2BB6 A;  4AS1 A;  3MJ5 A;  1JAL A;  1XLQ A;  3HVD A;  1WSP A;  4XWW A;  4KX6 B;  1IUE A;  3SFD B;  1JQ4 A;  4XDD A;  2QIL A;  2G1E A;  1YN4 A;  4IOI E;  2EKI A;  3SEB A;  5C2T B;  1TY2 A;  4O1N A;  2LHD A;  4L1B A;  3HVZ A;  1B1Z A;  1SF0 A;  3LB8 C;  1SIJ A;  3ZJV A;  1EU3 A;  2Z8L A;  3AV8 A;  2W82 A;  1I4G A;  3BYT B;  3PZ8 A;  4MM3 B;  1JWS D;  1DOI A;  1E10 A;  1SE3 A;  1C76 A;  2IGG A;  4D2K A;  3NZ3 A;  4XWT A;  1I4R A;  1VZ6 A;  1N61 A;  4P6V F;  1YN3 A;  2RMM A;  2WP9 B;  2WXL A;  3IAS 1;  2PLP A;  1GPX A;  1YNT E;  1V1P A;  2FE8 A;  2OED A;  1F2R I;  3BK1 A;  3MP9 A;  3KWL A;  1TKG A;  2WDQ B;  2BT6 A;  4YTM B;  2DBY A;  2G9H D;  3KLS X;  2H88 B;  4RGT A;  2BBC A;  4A9A A;  2BTE A;  4ZHO A;  1FXA A;  1NEN B;  2JQR B;  2IPK D;  5D3I B;  1QIL A;  1TKY A;  2JSV X;  1YJI A;  3AEG B;  3U2S C;  5EE0 A;  1MI0 A;  3AB5 A;  4H2A A;  4IKG A;  2ZW0 A;  2IGH A;  1D5X C;  2LUM A;  2FBW B;  1ESF A;  4OZB A;  2ACZ B;  3PO0 A;  4WAF A;  1C79 A;  1ET6 A;  4WUR A;  3U7Z A;  4KGT A;  3GS2 A;  2N9L A;  4NAW B;  1KRH A;  1JWA D;  1BML C;  1QOB A;  1UUP A;  2WS3 B;  3R2T A;  2RDG A;  3DWG C;  3ETR A;  1L0V B;  1RM6 C;  4RNA A;  1GB4 A;  1K50 A;  3NVW A;  3AE5 B;  3RPF C;  3TEW A;  1VZ8 A;  1K52 A;  4XDC A;  4ZYS A;  5BYQ A;  1C9F A;  4ZOH C;  1HZ5 A;  2I38 A;  2L83 A;  1E9M A;  1STE A;  1TS5 A;  4CQN A;  4JWU C;  1ZXH A;  1D5Z C;  2R61 A;  4LK0 M;  3Q8C A;  1FMA D;  1IBX B;  4OHJ A;  2E3T A;  2WXI A;  1XLP A;  1ZE3 D;  4YSZ B;  3U4E G;  1JRO A;  1QKZ A;  4GDL B;  2KAJ A;  3AEB B;  1SEB D;  1EU4 A;  1JRP A;  3P4R B;  1QLB B;  2HDE A;  1IGD A;  3AE7 B;  2WXG A;  3WCQ A;  2L32 A;  1FO4 A;  1ZUD 2;  4HRS A;  2SEB D;  5TSS A;  1WGK A;  2WXQ A;  2JZP A;  3BK2 A;  3AH7 A;  1PUT A;  5E6J A;  1MVK A;  4ITK A;  1DOY A;  4RGO S;  1VZ7 A;  1KH0 A;  2Q5W D;  3UI3 A;  2Y5C A;  3N9Y C;  3W5U B;  1NI3 A;  4A8X C;  2WU2 B;  4HKQ A;  1SJE D;  1MHX A;  1HQR D;  3TUO A;  4ZHP A;  1TYG B;  2BS2 B;  1FNW A;  4ARC A;  2ONQ A;  1QF6 A;  2IDY A;  2WXP A;  5HI1 A;  2OHF A;  4M0W A;  3O13 A;  1J7B A;  1WYG A;  1GAQ B;  2LEK A;  4LLG M;  3NVZ A;  2XN9 C;  3BVM A;  1KLU D;  1N5X A;  2K9X A;  4L2Y A;  2M56 B;  4HEA 1;  4AQ7 A;  3SR6 A;  2PTL A;  4N6E B;  4FXC A;  2WXN A;  1TY0 A;  2KDM A;  2J42 A;  2HTM E;  3URY A;  4NZL B;  2N7J A;  3AE3 B;  4WIP A;  2BS3 B;  4R3D A;  1F0Z A;  1P7F A;  1K53 A;  1SJH D;  3P42 A;  3LYY A;  2AX5 A;  1ZDV A;  2M0A A;  2CU3 A;  1TS4 A;  3J9C A;  4YSX B;  3BII D;  1MPE A;  3BWU D;  5G5G A;  2DLB A;  2QMT A;  1YN5 A;  2IJ0 A;  3TEY A;  2FUG 1;  3AM9 A;  4A55 A;  1E6E B;  4KGR A;  3PZ7 A;  5EE3 A;  1L6U A;  1VR9 A;  4PT5 A;  1FXI A;  2Y5P A;  3KWV A;  2J52 A;  1FM0 D;  4ARI A;  4UDU C;  3FAH A;  2TSS A;  5FR3 A;  5HG2 A;  2BS4 B;  5BYR A;  1DGJ A;  1JWB D;  3ZYY X;  1I4H A;  1C4P A;  1SB3 C;  3B2F A;  1AW7 A;  5LNK 1;  3E56 A;  2YEP B;  5GXG B;  4N58 A;  3MFG A;  3VR8 B;  3W5V B;  1YQ4 B;  4MAC A;  4GLS C;  1Y56 A;  1LO5 D;  3W9C B;  2AQ3 B;  2DWQ A;  5H8Y E;  2CJO A;  4TSS A;  4DQO C;  1CZP A;  4KKI A;  3VR9 B;  2EEL A;  3I57 A;  1XO3 A;  2J53 A;  1QOA A;  1C4A A;  3EUB 2;  2V4I B;  4RGM A;  1FCL A;  2VZK B;  3B9J A;  3ZQ4 A;  3P4S B;  3IXS A;  3LXF A;  3HRD D;  1QOF A;  3VRB B;  3VQI A;  1JW9 D;  4ZRQ A;  3AE9 B;  3V3X A;  2INP E;  3NUH B;  1ZXI A;  3AE4 B;  4WWM A;  1L6V A;  1V8C A;  3RFZ B;  1K51 A;  3GP7 A;  4LTU A;  1D5M C;  1L4D B;  1SSN A;  2N0S B;  2AQ2 B;  3H8H A;  3CWI A;  1KFY B;  1V1P B;  4C80 A;  3Q8F A;  1PFD A;  3TEZ A;  1JCK B;  4J3O D;  3R2I A;  2I2Y A;  2RPV A;  1NYR A;  2W3R A;  4B0M A;  4N59 A;  4OW0 A;  1WXQ A;  2CJN A;  2X38 A;  1KLG D;  2BB5 A;  4TMA B;  1AN8 A;  2WXF A;  4YWG G;  4YTP B;  3P1M A;  3ZGZ A;  1UNS A;  3TSS A;  3Q69 A;  5HHD G;  1FRR A;  3AED B;  1NEK B;  1MHH E;  1TKE A;  4NAM A;  1DYQ A;  2WDV B;  1PGX A;  1HEZ E;  4HJG E;  3T3N A;  3ZJU A;  2KMM A;  4OVZ A;  2PMV A;  1PDX A;  2JXT A;  1Q10 A;  1ZPS A;  1V1O A;  1BUI C;  3MHZ A;  1OQQ A;  4RCO A;  1N63 A;  1E0Z A;  1FD6 A;  4JX1 C;  3NS1 A;  5AUI A;  3V05 A;  1AYF A;  1FEH A;  1N5W A;  2IGD A;  1D6E C;  1KTK A;  1VLB A;  3AE1 B;  4RF1 A;  1HZ6 A;  3L4P A;  1YMH E;  5G5H A;  2N9K A;  3SFE B;  3AE6 B;  1UWM A;  2WDR B;  3ABV B;  1C77 A;  4KKJ A;  2V0G A;  1HA5 A;  1ENF A;  1TS3 A;  4DXF A;  2W55 A;  2YEP F;  2PKO A;  4YTN B;  1GB1 A;  1JWU D;  3Q8E A;  1N60 A;  1OQR A;  1FNU A;  2WLB A;  4WQM A;  1AWD A;  1QQR A;  3IT6 B;  1XCT L;  4P16 A;  1I4Q A;  3Q8B A;  1R7S A;  1EWY C;  4HRO A;  4IDI A;  1XEE A;  3CIR B;  2B76 B;  1P7E A;  1V97 A;  1FNV A;  3EGR A;  1ZOY B;  2BW2 A;  1T5X D;  1I7H A;  4C7Z A;  2MH7 A;  3EA6 A;  1TJE A;  2NTS A;  1WWT A;  4YSY B;  2KWD A;  4JE3 B;  1E7P B;  2RDH A;  3AE8 B;  1TZO A;  3AN1 A;  3BYY B;  3U52 E;  4A6Q A;  2QEJ C;  2L52 A;  1XXG A;  5EE1 A;  1UWX A;  2PW9 A;  3P4Q B;  4US9 A;  4TQ0 A;  1C78 A;  1ET9 A;  4RH6 A;  3MC0 B;  5BYS A;  4EE2 A;  3AEA B;  2INN E;  3AEC B;  5EE9 A;  1CQV A;  1SE2 A;  1I4X A;  2LFI A;  5C3J B;  2GB1 A;  5T8I A;  4B0E A;  4OZA A;  1ZP0 B;  3ZJT A;  4YXD B;  3TEX A;  2LJI A;  2K0P A;  2JYE A;  2ON8 A;  2QJL A;  1XCQ L;  1IBX A;  1VJK A;  1VDV A;  2ZW1 A;  3W2D A;  3B2G A;  1YQ3 B;  5AUK A;  4C56 C;  3C8Y A;  1T6B X;  2L1A A;  2NMQ A;  2SAK A;  4XE0 A;  1F2R C;  4JWS C;  1XLN A;  2WXR A;  5FK9 C;  5D7G A;  2E6X A;  4GDK B;  2D5G A;  2JU6 X;  3I9V 1;  4MH8 A;  1L0Y B;  4MT5 A;  4Q2J A;  5BMG A;  2WNM A;  3W1S A;  1QT9 A;  5MPO A;  1DOX A;  2KQ4 X;  1NYQ A;  2QIE B;  4TQ1 A;  1L5P A;  3OWE B;  1J7C A;  1VRA B;  1TS2 A;  1FFV A;  5H92 C;  4NJC A;  4C7Y A;  2PVO D;  4REZ A;  1FFU A;  2WXJ A;  3FIL A;  3GB1 A;  4OZC A;  2WQY B;  2V3P A;  2WXO A;  1RYJ A;  2LHE A;  2M19 A;  3R8B A;  1D4B A;  2VZK D;  4DXG A;  3Q8A A;  3BVZ A;  4YT0 B;  1C4C A;  1RFK A;  2LMC A;  5D3D A;  1JWM D;  4WH4 A;  2W54 A;  1JML A;  2MJE A;  2MEK A;  3HUI A;  4KGS A;  2J4X A;  4US8 A;  1PGA A;  3IAM 1;  1T3Q A;  2JWU A;  1XF5 L;  3AMZ A;  2BYT A;  1UGJ A;  2ICI A;  1ZDX A;  1A70 A;  4RFB A;  5JXV A;  5BMI A;  1CK1 A;  5FKA C;  5HFY A;  2MJD A;  2KN4 A;  1GOZ A;  2WU5 B;  2JYT A;  4A90 A;  4JPS A;  1FIQ A;  2WXK A;  2K3U A;  1YJJ A;  3IT4 B;  3NVY A;  2W3S A;  1OFF A;  1WRI A;  3E9S A;  2PIA A;  2PVG C;  2XNA C;  1KF6 B;  4ZRP A;  3AEE B;  2QSD A;  1ACC A;  1J7A A;  2H89 B;  5I4D A;  2V3N A;  4HKZ E;  1ROE A;  1CJE A;  4L23 A;  1EM7 A;  1RWS A;  2NTT A;  3NRZ A;  4RF0 A;  1XLO A;  1SXT A;  3AEF B;  3DWM A;  1FCC C;  2Y3A A;  1HXY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...