1AWJA

Intramolecular itk-proline complex, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
77
structure length
77
Chain Sequence
b'KKPLPPTPEDNRRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ITK
molecule tags Transferase
source organism Mus musculus
publication title Regulatory intramolecular association in a tyrosine kinase of the Tec family.
pubmed doi rcsb
total genus 5
structure length 77
sequence length 77
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awjA00
2RN8A 1WXUA 1NM7A 4F14A 1YCSB 2C0OA 4Y92A 4AG2C 2YT6A 2GBQA 2YUNA 1JU5C 1M8MA 2FO0A 4JPBW 2LX7A 4A63B 1UE9A 2BZYA 2RQWA 1QLYA 1PKSA 4LUEA 4AFZC 1RUWA 4RTUA 1A0NB 4J9EA 3EG2A 2DNUA 4OMOA 2DL4A 3H0FA 1UJ0A 3VS6A 1I07A 1KFZA 4F17A 4QT7A 1X27A 1YP5A 2KEAA 4AFUC 1LCKA 2CSQA 1OPKA 2L3QA 1M30A 1SPKA 3UA6A 1AVZC 4ESRA 2J6OA 2F2VA 1UFFA 2GNCA 2O31A 1VYVA 2J05A 2E5KA 2DM1A 5L23A 1SHFA 2LP5A 3R6NA 4AFSC 4M4ZA 1W70A 2QDLA 2FG0A 2HCKA 1QCFA 2A08A 3NMZC 1AOJA 1MV0B 2L3SA 2F2XA 2LNHB 1H8KA 2F2WA 2K2MA 1WYXA 2LJ3A 2GGRA 1I1JA 3H41A 2DL3A 2EVRA 1K1ZA 1HSQA 4RTWA 3VRZA 1WXBA 4RTZA 3SEMA 1AZGB 4LNPA 1NLPC 1K0SA 1QKXA 2AZSA 2HDAA 2RQRA 1UG1A 1TUCA 2H8HA 1KJWA 3QWYA 2KT8A 2PNIA 1GCQA 3QWXX 5I22A 1CKBA 4ORZA 1M3AA 4RTVA 1JEGA 4OMNA 2BZXA 3U23A 2FPFA 2DL5A 3VS1A 1AWXA 1YWOA 2J06A 1WXTA 2ECZA 1GRIA 2KYMA 2BTTA 3SHWA 1X6BA 3PVQA 2EW3A 3M0UA 1WIEA 2L3PA 3H0IA 2AKLA 3NHNA 2HSPA 3M0TA 2K6DA 2MCNA 3I5SA 1JQQA 2JMCA 4GLMA 3M0RA 1M27C 4OMMA 1AWWA 2EYXA 1OV3A 3TVTA 1T0HA 4J9HA 1JO8A 2CUDA 3VS5A 2LQNA 2JW4A 3GBQA 5ECAA 1S1NA 2LJ1A 1RLQC 1GFDA 1I0CA 3LH5A 5GJVB 3VS3A 1UDLA 1VYTA 3C0CA 3TSWA 4OMQA 1JXOA 2D8HA 2YDLA 2MOXA 1PWTA 4ZNXA 5FWBA 4IIMA 2DJQA 1WX6A 2DYBA 3VRYA 1HJDA 3PE0A 2ED1A 2KT1A 2DA9A 3ZL7C 2L0AA 1IO6A 1SSHA 1WLPB 1AWJA 2P4RA 2KYBA 1KSWA 2FRYA 1G83A 2J7IA 1YN8A 1NYFA 1K76A 2KRMA 2LQWA 2D8JA 2C0IA 4JJDA 1X6GA 1MUZA 5IHIA 2DRMA 2LMJA 2DF6A 2X3XD 1PHTA 1EFNA 1UUEA 1X43A 2AK5A 2GQIA 1ARKA 2RQTA 1ZX6A 2GTOA 3I9QA 1UHFA 2AZVA 2KXDA 4AFQC 2JT4A 2RQVA 4OMPA 1SEMA 2KRNA 3RBBB 2M51A 2KXCA 2VWFA 1VA7A 2J6FA 5I11A 2A36A 1U06A 2JM9A 1AD5A 3NPFA 2EBPA 1Z9QA 3IQLA 2PZ1A 1UHCA 1B07A 1T0JA 1N5ZA 3VS4A 1NLOC 1E6HA 3RNJA 2CREA 1AZEA 1W1FA 4J9CA 2EKHA 2I0NA 1X69A 3REBB 2EGCA 3EG1A 3I35A 1K4US 2FPDA 2K3BA 2ENMA 2MIOA 3A98A 2OI3A 2FRWA 3EHQA 1X2QA 3M0SA 3UA7A 2JM8A 2FEIA 2SEMA 5IHKA 1RI9A 2JS2A 4AG1C 1XOVA 1RLPC 2EYWA 2RNAA 5IHNA 2K79A 5FWCA 2ESWA 1GCQC 3NGPA 1GCPA 1K9AA 4FSSA 1PNJA 1M3CA 2OJ2A 2RQUA 4JZ4A 1PRLC 1FMKA 2L2PA 2FPEA 1YNZA 5HCKA 1W6XA 2DX1A 2C0TA 2GTJA 3VS0A 2KE9A 1YWPA 2CT4A 4DEXA 2CUBA 1B3QA 2CDTA 1WI7A 2DL7A 2RMOA 1E7OA 1VYUA 4R0KA 4LUDA 2LCSA 3REAB 1T3LA 2G6FX 4LE9A 2XMFA 2DVJA 3EGUA 2EYZA 4Z88A 1FYNA 4JZ3A 2A28A 1OEBA 2DILA 3ULRB 3EG0A 1Y57A 1TUDA 3H0HA 3EG3A 2CH4W 3FJ5A 4JJCA 2W10A 4CC2A 1SHGA 2O9VA 4IIOA 4J9DA 2JMAA 2DE0X 2DL8A 4HXJA 1K0XA 1BBZA 2RPNA 4X1VA 4KRTA 2KRSA 1PKTA 2YSQA 5IXBA 3UF4A 1MV3A 2K9GA 2EPDA 2KBTA 2DBMA 2J6KA 2KROA 1GBQA 1UECA 1SRLA 1ZUYA 2O2OA 5EC7A 1AWOA 2JXBA 2BZ8A 4HVWA 3M0QA 4OMLA 2D1XA 3M0PA 2HEQA 2LZ6B 1BB9A 2NUZA 1Y0MA 3CQTA 4HVVA 4J9GA 2DBKA 5FW9A 4DEYA 2AKKA 2CT3A 1QWFA 3VS2A 1UJYA 1WDXA 2X3WD 2B86A 4CC3A 2DRKA 3I5RA 1V1CA 1M3BA 2EYYA 4RUGA 1GL5A 2O88A 2M0YA 1QWEA 5IXFA 5GJWB 4RTXA 2EGAA 2EQIA 2ROTA 1QKWA 1ZSGA 2HBWA 2O9SA 1U5SA 1ZUUA 4J9IA 2W0ZA 1GFCA 4GBQA 2EGEA 4EIKA 1ZUKA 1Z9ZA 2RF0A 1OPLA 2K7AA 1ABOA 1AEYA 1H92A 1CKAA 3EHRA 3UATA 1H3HA 4J9FA 2KR3A 2V1QA 4Z89A 1J3TA 2JTEA 4E6RA 2ABLA 3TSZA 1UTIA 4JJBA 1NEBA 1BK2A 5IH2A 3O5ZA 1WFWA 1OOTA 3JV3A 4F16A 2CSIA 2A37A 1KIKA 1PRMC 2VVKA 1UGVA 2KGTA 2DLPA 2LJ0A 2OAWA 1NEGA 2DMOA 2CH4A 3VS7A 4D8KA 1ZLMA 2JS0A 1TG0A 1E6GA 1CSKA 3KFVA 1ABQA 2NWMA 2ED0A 4CC4B 1U3OA 4K11A 4HCKA 2ROLA 2YUQA 2IIMA 1NG2A 1JXMA 4LN2A 1WA7A 4RTYA 1NYGA 1G2BA 3THKA 4CC7A 1ZBJA 2V1RA 2VKNA 4D8DA 1GBRA 2YUPA 1X2KA 2D0NA 1T3SA 4J9BA 4RTTA 1HD3A 2PTKA 2YUOA 4Z8AA 1SRMA 4HVUA 2SRCA 2KNBB 1BU1A 3PVLA 4WCIA
chains in the Genus database with same CATH superfamily
2RN8A 5GAMf 1QVFS 2K5IA 4F14A 5KCOA 3OYDA 3VU3C 2C0OA 3CCLA 2GBQA 4LDUA 4MMKA 1JU5C 1M8MA 2LVMA 1UE9A 1JRIA 4E7SA 1XQHA 5GAMh 4M78A 3QZ9B 4L5GA 1ACMB 1RL2A 1QVGA 2M1HA 1KFZA 4F17A 4QT7A 1BI3A 2FZGB 1X27A 3A8OB 2KEAA 2PVDB 2DTHA 1D09B 1M30A 5CKBA 3UA6A 1AVZC 2J6OA 2OTJQ 1OI1A 1WQWA 1O75A 2J05A 2QG9B 1KD1R 4PJMA 1WHMA 2E3HA 2QYZA 2HD0A 1QCFA 4C8QC 2A08A 2V26A 4QQDA 4ELYC 3A5ZB 4IUUA 1TWBA 2L3SA 4N0AC 3LLRA 1VQ6Q 1IGUA 2K2MA 3JCMX 1WYXA 1KK7A 3H41A 1WZOA 1M90R 1MGQA 2EVRA 1VQLA 1KC8U 4RTWA 3CCEA 3GNFB 5KYUA 3CC2T 3CC4T 1QVFA 1K0SA 2E41A 4R55A 2HDAA 3CCRA 3QO3A 4M7AB 4WTOB 1MNDA 2CZ7B 5D6XA 1VQKT 4ZTJA 2DETA 1WNLA 4OMNA 1ZA2B 1AWXA 1YWOA 1WXTA 2ECZA 1YJWQ 5CO7A 3P8BB 3RMQA 1I4K1 1X6BA 4LDWA 2BIVA 2LNVA 3S3OA 3M0TA 1QQJA 2RK1A 2WSCE 4F04B 1JQQA 2NUPB 5CK9A 2LT1A 2RA2A 1FMVA 3RESA 4J9HA 1R77A 2JW4A 3GBQA 4M7DD 4YTLA 1OZ2A 4M7DF 5LJ5f 3DB4A 3RUXA 5GJVB 1Q7YU 1KQ1A 2E6ZA 3CD6Q 1VQNT 3JCMJ 4B9XA 3OSSC 2YLBA 3M5AA 1MHNA 5KYXA 3CBPA 1IHVA 3CXCS 1WJRA 2D8HA 2YDLA 2HQXA 4ZNXA 4Y28E 4IIMA 4PNOA 2DXUA 4CI0C 4M75B 3PMIA 2O01E 3ZL7C 2BKDN 1VQ5Q 1Q82R 3PIPA 3KXTA 2QA4Q 1Y96B 1K9MU 5DY9A 1S72A 3CCEQ 2OTLQ 2HL5C 2LQWA 5GANd 5HKCA 1X6GA 1MUZA 2ZPFB 2DRMA 4C5EA 2HSEB 1Q95G 2X3XD 3G6ET 1EFNA 4AT1B 3HL8A 3JCMV 2GFAA 2E12A 3I9QA 3SWNC 2KXDA 1DJ7B 4ELZC 2JT4A 1D0YA 4XTVA 3CD6A 3OW2S 3PNWC 3EFSA 2ZCFB 1VA7A 3OYIA 3NPFA 1BCMA 2EBPA 1Z9QA 1WHGA 3IQLA 2IPOB 3C12A 4EMHA 2PZ1A 4N4HA 3P8DA 2X35A 4EMGA 4FIBA 4DBFA 1QP2A 1E6HA 2YWWA 1AZEA 1W1FA 1N6AA 1YBYA 1R0BG 2DKGA 5KH6A 3ZEHA 2K3BA 2ENMA 4KBMB 2V8IA 3AT1B 3QUIA 2JVVA 3EGXA 3CC7Q 5GANf 2FEIA 3CC2A 4KH0B 2LC4A 2EYWA 5IAYA 1KC8R 4PLLA 1HXDA 2CP2A 3CD6T 1SG5A 1M3CA 3E19A 2LQ8A 4JZ4A 3EFOB 2ZZDA 4OGEA 5HCKA 2EKOA 5AT1B 2GTJA 3CCLT 4XTZA 1YWPA 5LJ3h 2CUBA 1B3QA 2MI6A 3L2VA 2CDTA 1NZ9A 5KYWB 4R0KA 2QASA 3META 1T3LA 1WJSA 3M4GA 1WJQA 2CP0A 3EGUA 2MF2A 2F5TX 1BKBA 2DILA 2LT4A 3ULRB 2E3IA 1ZBXA 3MP8A 3H0HA 4FYYB 2CH4W 2KAFA 1PG5B 1UB4A 3SB2A 2LTOA 4E2FB 2EQKA 4AMCA 1VQNA 2DL8A 1U1TA 2OTJA 1TTHB 1N8RC 2QEXT 2QGFB 3TU4K 3CPFA 3I55Q 2KRSA 1FWZA 2YSQA 3M59A 2X4WA 1WHLA 4B6MA 2H3JA 4KGVB 4C92D 1N9RA 3HRTA 3OYCA 1V76A 1ZUYA 2FYKA 1SRLA 2WSFE 5EC7A 3SDZA 2BZ8A 3HTRA 4HVWA 3M0QA 4OMLA 1YJ9A 3CMAQ 1M1KR 2E64A 3F70A 2KDSA 3M4YA 2DBKA 1MNEA 4MMLA 1YHQT 5J39A 2X3WD 3OBYA 3WVEB 1VQKA 2L3RA 3CCRT 2QTVA 3EFOA 3E9GA 3I5RA 5KYYB 4M7DG 4E7IA 2EYYA 2DZ9A 2K5FA 1GL5A 2LDMA 2RHUA 3BFMA 3CCET 3QZ5B 2KVQG 1QWEA 2PQWA 2NUTA 4RTXA 4BACA 4M77G 3FJPA 2HBWA 4PL6A 3OS1A 4M75F 3JCMW 5GAOm 4QQ6A 4J9IA 5LJ5j 3J7AF 1GFCA 2EGEA 3CBOA 3G71Q 2QQAA 3HRUA 2CZ6B 1M1KC 1VQ6T 4C8QF 4JJNK 1YJNT 2KR3A 1VQMQ 2V1QA 2CP5A 4M78F 4DBHA 1LNXA 1UTIA 2XHCA 3JCMd 4JJBA 4FYWB 3GNGA 1BK2A 3JCMP 1OOTA 2CSIA 4Z02A 4PLIA 3CCQQ 1UGVA 2DLPA 1K73C 2RI5A 2K5LA 2EFIA 2E5QA 3OW2P 4J6WA 1G3YA 1YITT 2RHIA 4RKUE 1ABQA 2NWMA 1Y96A 1UGPB 1NPPA 1OU9A 4MDWA 2FHDA 4HCKA 3JB9H 1QCOA 5CIUA 3V7RA 2YUQA 2RI2A 2PVGB 4LN2A 4C92C 4X9CA 1NJIR 1WA7A 2VUBA 1M9SA 3THKA 4VUBA 1GBRA 2YUPA 3CEYA 2D0NA 2YUOA 2VXFA 4HVUA 2L5QA 2KNBB 1D0ZA 3A8GB 1BU1A 4WCIA 2QDYB 5GMKm 3OS0A 3G6EQ 3VUBA 1YCSB 4JUVA 4X34A 3JB9F 4ZN3A 4WF2A 1RAHB 1NE8A 3T9NA 1RACB 2LX7A 2ZGWA 3S6WA 2RHYA 3LX7A 4J7IA 2RB6A 2OAUA 4BE0A 5CQYA 4HT8A 3V7SA 3QJ6A 4X9DA 4LUEA 1PCXA 2Y4XA 4AFZC 1ZSZB 4J9EA 2QQBA 1K9MC 2GCXA 3L2WA 1UEBA 2LCLA 2RO0A 3H0FA 4C8QE 2OTJT 1YP5A 4NOYA 3L2ZA 1LCKA 3CCQA 1OX8A 2XKOC 3QKJA 3QDFA 5LL6S 4II1A 5GMKe 1SKUB 3ZFJA 3G4ST 2DPPB 3M56A 1BCOA 2LP5A 3R6NA 5FROA 1W70A 2M16A 5LJ3d 2HKQB 2HCKA 3PMTA 2RHZA 3JCMb 2QGGA 4DOWA 1Q81R 1IXDA 1MV0B 2JOYA 2F2XA 1XNIA 2GF7A 2LNHB 3QJYA 5GAN6 1H8KA 2JN0A 4DA4A 2JZ2A 5CKDA 4R56A 3MPUB 4P5NA 3X28B 4DQ2A 2VV5A 2EIFA 1VIFA 4LNPA 4FM4B 1KHIA 1QKXA 1PSEA 4KULA 3Q1JA 3X24B 3JCMe 2CKKA 3PTAA 4V2SA 1KJWA 4JRKA 2I2LA 1QP3A 3CCMQ 4F7UB 5I22A 2LQKA 5LJ3j 1TUGB 4RTVA 1JEGA 2BZXA 3U23A 3M57A 3VS1A 4OMFB 2EJFA 3DB3A 2EW3A 1AT1B 3H0IA 3NHNA 3OMGA 1PD1A 2HSPA 4XTUA 2X51A 4M77D 3V8LA 2RM4A 5LJ3f 4FW1A 4GLMA 5KYXB 5CVIA 4OMMA 4J6YA 2EYXA 2HMAA 1JO8A 1VQ5A 1H3ZA 4MZMA 1Q86U 2LJ1A 1RLQC 4FYVB 1GFDA 5I2MA 3LH5A 2XU8A 2PVOB 2ZPGB 1G3TA 3GPLA 3G7ZA 1M2OA 3RKYA 2P4TA 4QQGA 1JXOA 2EAYA 1PWTA 2MOXA 2WACA 2DJQA 2DYBA 3RDVA 3VRYA 1S72T 3VUZA 3PE0A 8AT1B 2DIGA 3RIRA 5DLQE 2KT1A 2DA9A 3LYIA 4RCBA 1IO6A 1WLPB 1SSHA 1AWJA 4N4IA 1KSWA 4GLKA 1G83A 1YN8A 1NYFA 3OW2A 1I5OB 2KRMA 2VXEA 4JJDA 3CCJQ 1AHJB 2MWOA 2CYZB 3OSVA 5FU7C 4A4HA 1X43A 2AK5A 4PJOD 2P0PA 1M1KU 2RQTA 4LDYA 2VYTA 2FZKB 2GTOA 4XTXA 2LX9A 2RQVA 2ZAEA 4PFPA 1YIJT 3PIOA 4XTYA 1Q7YC 3HHTB 5I11A 2A36A 2JM9A 5KE3A 1JBMA 1UHCA 1B07A 2M9UA 4FCYA 1T0JA 3OS2A 5GAMe 2FB7A 1KQ2A 3OMCA 1F1BB 4ZTFA 3EGDA 4OB1B 4A4FA 4TVRA 5J26A 2I0NA 3I35A 1YI2T 1U1SA 4J8OA 3BW1A 2FRWA 3UPUA 1X2QA 3UA7A 4FW2A 2SEMA 4ATOA 4D6WA 4FSXA 3JB9I 1XOVA 2RNAA 4PJOB 1OULA 4JS4A 2K79A 3NGPA 1GCPA 4FSSA 3SWNA 3FC3A 2G3RA 3LGFA 3M55A 4BE1A 2L2PA 1YNZA 1K73U 1W6XA 1WPYA 4O5VA 2KE9A 4C92F 4M77F 2VASA 3VJPA 3CMEA 4C0ZA 2LCSA 1ZQ1A 2XMFA 2QA4A 5LJ5e 4DOVA 2YXYA 1FYNA 1K73R 2F5KA 2XG8D 2Y90A 4HCZA 4C8QD 3LW5E 2MK5A 3OYGA 4CC2A 1SHGA 2O9VA 4J9DA 4C5IA 4M75D 1K0XA 1VIEA 2FL7A 1BBZA 3C94A 3CCUT 4A4KA 2M0OA 3QYHB 4QKUA 4PJOC 4QW2A 1VQ8Q 3I56T 1PKTA 2GQVA 1K8AU 3WVDB 1MV3A 1G3WA 1G8XA 3JCMc 1OU8A 4JS5A 2PU9B 2DO3A 4L59A 1I5LA 4L6V5 2RK2A 2JXBA 2D1XA 2MPXC 1YFNA 3M0PA 5KYYA 5C0MA 1WHJA 3MJXA 3CMAA 2LZ6B 1BB9A 5GMKi 2NUZA 1Y0MA 4J9GA 1FX7A 5FW9A 3JCMf 4DEYA 3VS2A 4M78B 1EZZB 3MP6A 3CPWS 1ZSZC 3X25B 5CR2A 1IHWA 1RAGB 1M1FA 4BDYA 2M0YA 4JLIA 1X01A 4XU0A 4M7AD 2EQIA 4JRIA 1RAEB 4BY6C 4EMKC 1ZSGA 2O9SA 2DD5A 5A0LA 1U5SA 3CCUQ 4XAXB 2W0ZA 2IG0A 3DLMA 4GBQA 4C5HA 5A0DA 1M8VA 3PT9A 1Q86R 2K7AA 5EG2A 3EG9B 1H92A 3EHRA 5CQXA 3CXCP 4Z89A 2CP7A 1NEBA 2XIDA 1WFWA 1RAIB 2A37A 2DYIA 3OS5A 2VVKA 2DEUA 2LJ0A 2M02A 2DMOA 2CH4A 5FU6B 3D7SB 3BY7A 1X75C 1TG0A 4KH1B 2DFUA 2A7YA 1E6GA 3CC2Q 5CKHA 5GAN4 1U3OA 3CC7A 4M7DE 2A0FB 2D0QB 2ROLA 4E7JA 1TOVA 2E65A 3CCST 4PKCC 5KE2A 4KGZB 1JXMA 3J81E 4KGXB 2KMTA 4RTYA 3MEWA 1NYGA 2X4XA 3JRZA 2V1RA 4D8DA 2MMPA 3NFCA 3JAME 3L42A 1T3SA 1HD3A 3S3NA 2NUPA 2PUKB 3QHSA 4XU2A 3OQ5A 2QA4T 4KUDK 1WQ7A 1WXUA 1NM7A 1N8RR 1UGQB 1G3SA 3HPWA 4HCCA 3OYLA 4Y92A 2NYSA 1EX4A 3LWHA 4A63B 3RKWA 2BZYA 4A4EA 2HQHA 3MP1A 1PKSA 4M75A 1RUWA 4RTUA 1A0NB 1I8FA 2E70A 1IZ6A 3EG2A 2OTLA 1W2BA 2JNGA 4OP0A 3CMEQ 1G5VA 1YJWT 4M77A 3SFMA 4C92A 1Q82C 4PJOA 4AFUC 2CSQA 2L3QA 1VQPQ 1VQOT 5L23A 1P92A 2QTXA 3M9QA 4AFSC 1VQKQ 2FG0A 3CCMA 3JB9J 3NMZC 3G71T 4KT0E 4OB2B 5LJ5d 4RG2A 1QMCA 1VQMT 1VQ4T 2LJ3A 2GGRA 2X4JA 2K2VA 1VQPT 1B7TA 3CCVT 1H641 2CP6A 1VQ4Q 1D0XA 1VQ9T 1QVPA 3OYNA 2KK4A 1FXXA 4RTZA 3SEMA 3BDLA 4IUQA 4M77E 5KYNA 2AZSA 1TUCA 1M2VA 2PNIA 1CKBA 1M3AA 1VQNQ 4XQ3A 4IUVA 2RJDA 2FPFA 2DL5A 4BI3A 2COZA 1WHHA 4C0DB 3GOXA 3RERA 1NPRA 1GRIA 1NJIU 3FDRA 3SHWA 4BB7A 2QQSA 3CMAT 3PVQA 3M0UA 2L3PA 3ER0A 1VQOQ 2MCNA 3I5SA 3M0RA 2R58A 3LWIA 2HKNA 4M77B 4ANJA 3TVTA 1T0HA 2KY9A 2Z0WA 2CUDA 2E4HA 3I55T 2QK0A 4DBQA 2R5AA 4OF1A 4C0GA 1I0CA 4FT2A 4IUPA 3JCMh 1UDLA 1RABB 1MMAA 1VYTA 5A0GA 3QIIA 3TSWA 2DAQA 4Q5WA 2E6NA 2IVWA 7AT1B 4OMQA 2YHTA 5HY6A 4PJOE 5FWBA 1N27A 1WX6A 1HJDA 1OYXA 2KI7A 4BI8B 4UC4A 2ED1A 2R5MA 3KUFA 1LVKA 2P4RA 2KYBA 2B8AA 2XDDA 3EG9A 2BUDA 4QVDA 1K76A 4MDXA 2D8JA 1TS9A 5AYFA 5IHIA 2DTOA 2HAXA 3ME9A 1X6OA 1PHTA 1UUEA 2L89A 4RMOA 5GAMd 5GAMg 1ZX6A 1PD0A 1M2VB 3MHXA 2AZVA 3A1PA 1Q81U 3CCLQ 4IURA 1SEMA 2HBPA 3SD4A 2M51A 2J6FA 1KD1C 4ME7A 4IKFA 1YHQQ 4J83A 1N5ZA 3VS4A 4M75C 1VQ7A 4EMKB 3RNJA 1YI2A 3OYYA 3CXCA 3S3MA 3TEEA 4A53A 4M7DC 2FVUA 4J9CA 3R6OA 2A3LA 1VQOA 3V7CA 1IB8A 3REBB 2EGCA 1K4US 3A8MB 1VQ7T 1WGSA 2MIOA 5GAMj 3A98A 2ATCB 3CCQT 4JRQA 4M7AA 5IHKA 3HFOA 4HA8A 3JB9D 1YITQ 1RI9A 1VQ9A 2JS2A 4AG1C 5HK3A 1RLPC 1JB0E 5IHNA 3CCJT 3HP9A 2DXCA 1GCQC 5FWCA 3JB9G 1Y07A 3BE3A 1RAAB 1OX9A 5GMKj 4BDZA 1K8AC 1PNJA 1VQ4A 4HCBA 1FMKA 4N0AA 2FPEA 4ZGJB 1BI2A 3CC4Q 3V8KA 3VS0A 1M4ZA 2K3YA 5C6SA 2E1HA 4JLGA 3WXMB 3REAB 1PM3A 2G6FX 4LE9A 2C06A 2EYZA 3CCSQ 6AT1B 4JZ3A 4JDSA 1OEBA 1Y57A 1TUDA 1D1AA 4LXCA 5GAN5 4PK4A 4C92B 2EWNA 1YJ9Q 1KD1U 1YJWA 2Y4YA 4NS5A 1VQ8T 2MYSA 2MWPA 4HXJA 2QEXQ 1JJ2A 4PJOG 3NTIA 2OTLT 4A4GA 1OQKA 1K8AR 2VC8A 4EMKA 3I56Q 1D3BB 1JJ2P 5IXBA 3UF4A 3I55A 4E7HA 4E7ZA 2XDBA 3NTHA 1D1CA 2EPDA 2KBTA 1I81A 1VQLQ 2KROA 4M7AF 1GBQA 3HRSA 5CAIA 4MZPA 1XTDA 2DZCA 2JJ9A 2ZPBB 5GAOl 2VGMA 3EH2A 3OYKA 3CQTA 4F7UF 3GIBA 2P0QA 1QVGS 2P0KA 1WDXA 5LJ3e 4CC3A 4M77C 3NTKA 1M3BA 4RCCA 4E47A 5L8RE 1C6VX 2ZPIB 5KCHA 2HQEA 2O88A 5M9OA 5IXFA 3G4SQ 3EFRA 3AHUA 3CCVA 3CC7T 2JUFA 4F7UE 1QKWA 4XK8E 2LRQA 1HK9A 2RHXA 4C8QA 4NL3A 3N5BB 2DEQA 1VQMA 3LGLA 2ZPEB 4OGCA 1Z9ZA 2RF0A 1ABOA 1AEYA 1CKAA 3G71A 2EJ9A 3UATA 5GAN2 1ZA1B 1N8RU 4J9FA 3HKSA 1J3TA 4E6RA 2ABLA 3TQ7P 3L1AA 5IH2A 3G4SA 1KHCA 3HFNA 1PRMC 3A8LB 2KGTA 1IGQA 3VS7A 2HZYA 5KYWA 2F1LA 4D8KA 3GP8A 1W4SA 1ZHIA 2JS0A 2YRCA 3OYMA 1CSKA 4NL2A 1FMWA 3JSCA 4F7UA 4CC4B 4K11A 3QG1A 1LPLA 3CCUA 2IIMA 2WSEE 1SF9A 2EYQA 3TREA 5IT9E 2QI2A 1GXIE 4CC7A 2XICA 2X9HA 2VKNA 1PSFA 1X2KA 5DLOA 3VYHB 2DERA 3EH1A 4PFZA 1S72Q 2K57A 2VGNA 4J9BA 4J7FA 4Z8AA 2RJCA 1SRMA 3QYGB 1LOJA 2SRCA 3PVLA 1NJIC 3H8ZA 3DKMA 1YJNQ 3L2RA 3V8JA 1BYMA 3UWNA 2XK0A 4AG2C 2K3XA 2YT6A 3L2UA 2XD0A 5FU7B 4HT9A 2YUNA 2FO0A 4JPBW 2QXFA 3LH0A 1KG1A 1HYOA 5GAN7 3CCSA 2COWA 3GF5A 3X26B 2RQWA 1QLYA 4LD6A 4C92E 2DNUA 4OMOA 2DK3A 5I2SA 2DL4A 4MZTA 3KBGA 1UJ0A 3VS6A 1I07A 1VQ8A 4OVAA 5GMKl 4M78E 2QQ9A 4BUGA 1O9SA 1OPKA 1SPKA 2DTIA 4ESRA 2F2VA 3L2QA 1UFFA 5CCAA 5LJ5h 2GNCA 2V8KA 3MKDA 1K9MR 4LD9K 4FL6A 2O31A 1Q81C 1VYVA 2E5KA 2DM1A 3QSUA 1SHFA 2JTMA 4M4ZA 1VQ9Q 1NBEB 2CZ0B 2CGHA 2DXBA 2QDLA 4ZGEB 3CMET 3RKXA 3CCRQ 1W2BS 2CS7A 4LDXA 1TH7A 3OYAA 4N4GA 5D6WA 1AOJA 2EQMA 1Y71A 2FZCB 3EAEA 4HKEA 1Q7YR 2F2WA 4XTWA 3MCAB 1I1JA 4FU6A 2DL3A 2YLCA 1R8OB 4PJLA 3C4SA 3EGDB 1K1ZA 2L8DA 3E2UA 2DVEA 3CCJA 1PC0A 1HSQA 4B9WA 3VRZA 1WXBA 5HK0A 1TXQA 5I21A 5CKFA 2GFUA 1AZGB 3URGA 1RI0A 1NLPC 3GLXA 2RQRA 1UG1A 1M1GA 2H8HA 3QWYA 2KT8A 1GCQA 1QCNA 3QWXX 4ZGDB 2O4XA 1D3BA 3M58A 4ORZA 2COYA 4KUIA 5FU6C 3HSBA 2J06A 2D6FA 2KYMA 3QPHA 2BTTA 4ZN1A 5IN1A 1WIEA 4M7DB 8ATCB 2AKLA 1YJ9T 2OX7A 2AIRB 2K6DA 4J5YA 2JMCA 1M27C 1QW1A 1AWWA 1OV3A 1UGSB 4EDUA 3VS5A 2CZ1B 2AT1B 2LQNA 4OB3B 3I56A 5ECAA 5DM7R 1S1NA 1M90U 1VQ5T 3VKIA 3PFSA 2KQWA 3VS3A 2QEXA 3C0CA 3OYHA 5FRMA 1Q82U 2NLUA 5FRNA 4LDVA 1YIJQ 1EIFA 3FIFA 4RG8A 3OY9A 1ZSZA 3C95A 2L0AA 5D6YA 4M78C 2E10A 2FRYA 2J7IA 2JTFA 1MMNA 3MEUA 2ZPHB 2YRVA 2C0IA 4A54A 2LMJA 2DF6A 4FYXB 4BD3A 3CC4A 5D7UA 4M75E 1B34B 2GQIA 3FRNA 1ARKA 3JCMQ 1VQLT 1R0CB 3JCMg 1UHFA 3FLGA 4PJOF 4AFQC 2HL3A 4OMPA 1KC8C 2KRNA 3RBBB 3VYGA 3FB9A 2KXCA 2VWFA 4CRIA 1KQSA 1U06A 1AD5A 1YITA 1VUBA 2DXTA 1KQSP 4C0FA 3J80E 2RI3A 4M7AG 2F69A 1NLOC 2D9TA 4E7KA 2CREA 3A8HB 3VV0A 3QDRB 1U8RA 2EKHA 1Q86C 1X69A 2XDPA 3CBMA 3OYFA 3EG1A 2FPDA 1YI2Q 5GAOn 1VQ7Q 1D1BA 3FEOA 1VQ6A 2OI3A 3EHQA 2BE9B 1YCYA 3M0SA 4F7UG 1VOMA 2JM8A 1MMGA 5J3BA 5GANh 3OYBA 1C1AA 2ESWA 1YIJA 4M7AE 3RR6A 2DIQA 3CPWA 1K9AA 1VQPA 2YRDA 2KSSA 2OJ2A 4PJJA 1XJWB 2RQUA 3EGXB 3CPWP 1PRLC 1BI0A 4C92G 3H6ZA 3G6EA 2DX1A 2C0TA 1TU0B 2RD1A 3INZA 3MEAA 2CT4A 4DEXA 1QVGP 2EJGA 1WI7A 2DL7A 2RMOA 1E7OA 5GAOr 1VYUA 1LJOA 3CCMT 4LUDA 4M75G 2DD4A 5GMKh 4PFOA 1B34A 4EPCA 2DVJA 2X4YA 2XI9A 4O6JA 4Z88A 1IRXA 4M78G 2A28A 3EG0A 2HNIA 4C8QG 3EG3A 1BIAA 3ZBDA 3FJ5A 2EQUA 4JJCA 2W10A 4OB0B 3H9NA 4M78D 3CCVQ 4IIOA 9ATCB 5KYUB 1SSFA 4C0DC 1JJ2S 2JMAA 2DE0X 3BDUA 3P8HA 2RPNA 4X1VA 5A2QE 2VB6A 4KRTA 4DBRA 1C0MA 3X20B 3MO8A 1M90C 2K9GA 1BI1A 1KQSS 3O8VA 3QBYA 5LJ3g 2DBMA 5GAN8 2J6KA 1RADB 1UECA 1AWOA 2O2OA 2RH2A 2R57A 3UDCA 4JRPA 2HEQA 2DJZA 4C5GA 3OBWA 5GAN3 4HVVA 1W2BP 2AKKA 2CT3A 1QWFA 1UJYA 4PJNA 1N9SA 2B86A 1WHKA 3DLLA 2BE7D 3G1JA 3UT1A 4E7LA 2DRKA 4C8QB 5GAOq 5GAOp 1V1CA 2O4XB 4QVCA 2H3EB 4RUGA 3E1SA 2EQJA 2QAZA 2AHJB 5GJWB 4BE2A 3OYEA 2RJFA 3PGGA 2EGAA 2ROTA 4M7DA 3TCJA 1ZUUA 2LCCA 3QXEB 4FT4A 4EIKA 1ZUKA 1OPLA 4M7AC 5LJ5g 2NUTB 4J6XA 1H3HA 1RAFB 2JTEA 3SWNB 3TSZA 2PUOB 1TSFA 3O5ZA 4XU1A 3JV3A 4IUTA 2QQRA 1Y7XA 4F16A 1YJNA 1QVFP 1UGRB 1KIKA 2P84A 1IREB 5GANg 2OAWA 1NEGA 2CP3A 2MAMA 1BIBA 1ZLMA 1M5Q1 1V29B 3OB9A 3KFVA 2ED0A 2K4YA 3ASKA 3E9FA 5CKEA 1OZ3A 4BY6B 1NG2A 3M53A 4BI4A 1G2BA 3OA6A 1ZBJA 3MEVA 3RMSA 3OYJA 4RTTA 3M54A 1YHQA 4Y91A 2PTKA 4QVZA 4GY5A 4XU3A 5GANj 2RJEA 2V8JA 5GANe 1MMDA 5FLXE
chains in the Genus database with same CATH topology
2RN8A 1WXUA 1NM7A 4F14A 1YCSB 2C0OA 4Y92A 4AG2C 2YT6A 2GBQA 2YUNA 1JU5C 1M8MA 2FO0A 4JPBW 2LX7A 4A63B 1UE9A 2BZYA 2RQWA 1QLYA 1PKSA 4LUEA 4AFZC 1RUWA 4RTUA 1A0NB 4J9EA 3EG2A 2DNUA 4OMOA 2DL4A 3H0FA 1UJ0A 3VS6A 1I07A 1KFZA 4F17A 4QT7A 1X27A 1YP5A 2KEAA 4AFUC 1LCKA 2CSQA 1OPKA 2L3QA 1M30A 1SPKA 3UA6A 1AVZC 4ESRA 2J6OA 2F2VA 1UFFA 2GNCA 2O31A 1VYVA 2J05A 2E5KA 2DM1A 5L23A 1SHFA 2LP5A 3R6NA 4AFSC 4M4ZA 1W70A 2QDLA 2FG0A 2HCKA 1QCFA 2A08A 3NMZC 1AOJA 1MV0B 2L3SA 2F2XA 2LNHB 1H8KA 2F2WA 2K2MA 1WYXA 2LJ3A 2GGRA 1I1JA 3H41A 2DL3A 2EVRA 1K1ZA 1HSQA 4RTWA 3VRZA 1WXBA 4RTZA 3SEMA 1AZGB 4LNPA 1NLPC 1K0SA 1QKXA 2AZSA 2HDAA 2RQRA 1UG1A 1TUCA 2H8HA 1KJWA 3QWYA 2KT8A 2PNIA 1GCQA 3QWXX 5I22A 1CKBA 4ORZA 1M3AA 4RTVA 1JEGA 4OMNA 2BZXA 3U23A 2FPFA 2DL5A 3VS1A 1AWXA 1YWOA 2J06A 1WXTA 2ECZA 1GRIA 2KYMA 2BTTA 3SHWA 1X6BA 3PVQA 2EW3A 3M0UA 1WIEA 2L3PA 3H0IA 2AKLA 3NHNA 2HSPA 3M0TA 2K6DA 2MCNA 3I5SA 1JQQA 2JMCA 4GLMA 3M0RA 1M27C 4OMMA 1AWWA 2EYXA 1OV3A 3TVTA 1T0HA 4J9HA 1JO8A 2CUDA 3VS5A 2LQNA 2JW4A 3GBQA 5ECAA 1S1NA 2LJ1A 1RLQC 1GFDA 1I0CA 3LH5A 5GJVB 3VS3A 1UDLA 1VYTA 3C0CA 3TSWA 4OMQA 1JXOA 2D8HA 2YDLA 2MOXA 1PWTA 4ZNXA 5FWBA 4IIMA 2DJQA 1WX6A 2DYBA 3VRYA 1HJDA 3PE0A 2ED1A 2KT1A 2DA9A 3ZL7C 2L0AA 1IO6A 1SSHA 1WLPB 1AWJA 2P4RA 2KYBA 1KSWA 2FRYA 1G83A 2J7IA 1YN8A 1NYFA 1K76A 2KRMA 2LQWA 2D8JA 2C0IA 4JJDA 1X6GA 1MUZA 5IHIA 2DRMA 2LMJA 2DF6A 2X3XD 1PHTA 1EFNA 1UUEA 1X43A 2AK5A 2GQIA 1ARKA 2RQTA 1ZX6A 2GTOA 3I9QA 1UHFA 2AZVA 2KXDA 4AFQC 2JT4A 2RQVA 4OMPA 1SEMA 2KRNA 3RBBB 2M51A 2KXCA 2VWFA 1VA7A 2J6FA 5I11A 2A36A 1U06A 2JM9A 1AD5A 3NPFA 2EBPA 1Z9QA 3IQLA 2PZ1A 1UHCA 1B07A 1T0JA 1N5ZA 3VS4A 1NLOC 1E6HA 3RNJA 2CREA 1AZEA 1W1FA 4J9CA 2EKHA 2I0NA 1X69A 3REBB 2EGCA 3EG1A 3I35A 1K4US 2FPDA 2K3BA 2ENMA 2MIOA 3A98A 2OI3A 2FRWA 3EHQA 1X2QA 3M0SA 3UA7A 2JM8A 2FEIA 2SEMA 5IHKA 1RI9A 2JS2A 4AG1C 1XOVA 1RLPC 2EYWA 2RNAA 5IHNA 2K79A 5FWCA 2ESWA 1GCQC 3NGPA 1GCPA 1K9AA 4FSSA 1PNJA 1M3CA 2OJ2A 2RQUA 4JZ4A 1PRLC 1FMKA 2L2PA 2FPEA 1YNZA 5HCKA 1W6XA 2DX1A 2C0TA 2GTJA 3VS0A 2KE9A 1YWPA 2CT4A 4DEXA 2CUBA 1B3QA 2CDTA 1WI7A 2DL7A 2RMOA 1E7OA 1VYUA 4R0KA 4LUDA 2LCSA 3REAB 1T3LA 2G6FX 4LE9A 2XMFA 2DVJA 3EGUA 2EYZA 4Z88A 1FYNA 4JZ3A 2A28A 1OEBA 2DILA 3ULRB 3EG0A 1Y57A 1TUDA 3H0HA 3EG3A 2CH4W 3FJ5A 4JJCA 2W10A 4CC2A 1SHGA 2O9VA 4IIOA 4J9DA 2JMAA 2DE0X 2DL8A 4HXJA 1K0XA 1BBZA 2RPNA 4X1VA 4KRTA 2KRSA 1PKTA 2YSQA 5IXBA 3UF4A 1MV3A 2K9GA 2EPDA 2KBTA 2DBMA 2J6KA 2KROA 1GBQA 1UECA 1SRLA 1ZUYA 2O2OA 5EC7A 1AWOA 2JXBA 2BZ8A 4HVWA 3M0QA 4OMLA 2D1XA 3M0PA 2HEQA 2LZ6B 1BB9A 2NUZA 1Y0MA 3CQTA 4HVVA 4J9GA 2DBKA 5FW9A 4DEYA 2AKKA 2CT3A 1QWFA 3VS2A 1UJYA 1WDXA 2X3WD 2B86A 4CC3A 2DRKA 3I5RA 1V1CA 1M3BA 2EYYA 4RUGA 1GL5A 2O88A 2M0YA 1QWEA 5IXFA 5GJWB 4RTXA 2EGAA 2EQIA 2ROTA 1QKWA 1ZSGA 2HBWA 2O9SA 1U5SA 1ZUUA 4J9IA 2W0ZA 1GFCA 4GBQA 2EGEA 4EIKA 1ZUKA 1Z9ZA 2RF0A 1OPLA 2K7AA 1ABOA 1AEYA 1H92A 1CKAA 3EHRA 3UATA 1H3HA 4J9FA 2KR3A 2V1QA 4Z89A 1J3TA 2JTEA 4E6RA 2ABLA 3TSZA 1UTIA 4JJBA 1NEBA 1BK2A 5IH2A 3O5ZA 1WFWA 1OOTA 3JV3A 4F16A 2CSIA 2A37A 1KIKA 1PRMC 2VVKA 1UGVA 2KGTA 2DLPA 2LJ0A 2OAWA 1NEGA 2DMOA 2CH4A 3VS7A 4D8KA 1ZLMA 2JS0A 1TG0A 1E6GA 1CSKA 3KFVA 1ABQA 2NWMA 2ED0A 4CC4B 1U3OA 4K11A 4HCKA 2ROLA 2YUQA 2IIMA 1NG2A 1JXMA 4LN2A 1WA7A 4RTYA 1NYGA 1G2BA 3THKA 4CC7A 1ZBJA 2V1RA 2VKNA 4D8DA 1GBRA 2YUPA 1X2KA 2D0NA 1T3SA 4J9BA 4RTTA 1HD3A 2PTKA 2YUOA 4Z8AA 1SRMA 4HVUA 2SRCA 2KNBB 1BU1A 3PVLA 4WCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RN8 A;  1WXU A;  1NM7 A;  4F14 A;  1YCS B;  2C0O A;  4Y92 A;  4AG2 C;  2YT6 A;  2GBQ A;  2YUN A;  1JU5 C;  1M8M A;  2FO0 A;  4JPB W;  2LX7 A;  4A63 B;  1UE9 A;  2BZY A;  2RQW A;  1QLY A;  1PKS A;  4LUE A;  4AFZ C;  1RUW A;  4RTU A;  1A0N B;  4J9E A;  3EG2 A;  2DNU A;  4OMO A;  2DL4 A;  3H0F A;  1UJ0 A;  3VS6 A;  1I07 A;  1KFZ A;  4F17 A;  4QT7 A;  1X27 A;  1YP5 A;  2KEA A;  4AFU C;  1LCK A;  2CSQ A;  1OPK A;  2L3Q A;  1M30 A;  1SPK A;  3UA6 A;  1AVZ C;  4ESR A;  2J6O A;  2F2V A;  1UFF A;  2GNC A;  2O31 A;  1VYV A;  2J05 A;  2E5K A;  2DM1 A;  5L23 A;  1SHF A;  2LP5 A;  3R6N A;  4AFS C;  4M4Z A;  1W70 A;  2QDL A;  2FG0 A;  2HCK A;  1QCF A;  2A08 A;  3NMZ C;  1AOJ A;  1MV0 B;  2L3S A;  2F2X A;  2LNH B;  1H8K A;  2F2W A;  2K2M A;  1WYX A;  2LJ3 A;  2GGR A;  1I1J A;  3H41 A;  2DL3 A;  2EVR A;  1K1Z A;  1HSQ A;  4RTW A;  3VRZ A;  1WXB A;  4RTZ A;  3SEM A;  1AZG B;  4LNP A;  1NLP C;  1K0S A;  1QKX A;  2AZS A;  2HDA A;  2RQR A;  1UG1 A;  1TUC A;  2H8H A;  1KJW A;  3QWY A;  2KT8 A;  2PNI A;  1GCQ A;  3QWX X;  5I22 A;  1CKB A;  4ORZ A;  1M3A A;  4RTV A;  1JEG A;  4OMN A;  2BZX A;  3U23 A;  2FPF A;  2DL5 A;  3VS1 A;  1AWX A;  1YWO A;  2J06 A;  1WXT A;  2ECZ A;  1GRI A;  2KYM A;  2BTT A;  3SHW A;  1X6B A;  3PVQ A;  2EW3 A;  3M0U A;  1WIE A;  2L3P A;  3H0I A;  2AKL A;  3NHN A;  2HSP A;  3M0T A;  2K6D A;  2MCN A;  3I5S A;  1JQQ A;  2JMC A;  4GLM A;  3M0R A;  1M27 C;  4OMM A;  1AWW A;  2EYX A;  1OV3 A;  3TVT A;  1T0H A;  4J9H A;  1JO8 A;  2CUD A;  3VS5 A;  2LQN A;  2JW4 A;  3GBQ A;  5ECA A;  1S1N A;  2LJ1 A;  1RLQ C;  1GFD A;  1I0C A;  3LH5 A;  5GJV B;  3VS3 A;  1UDL A;  1VYT A;  3C0C A;  3TSW A;  4OMQ A;  1JXO A;  2D8H A;  2YDL A;  2MOX A;  1PWT A;  4ZNX A;  5FWB A;  4IIM A;  2DJQ A;  1WX6 A;  2DYB A;  3VRY A;  1HJD A;  3PE0 A;  2ED1 A;  2KT1 A;  2DA9 A;  3ZL7 C;  2L0A A;  1IO6 A;  1SSH A;  1WLP B;  1AWJ A;  2P4R A;  2KYB A;  1KSW A;  2FRY A;  1G83 A;  2J7I A;  1YN8 A;  1NYF A;  1K76 A;  2KRM A;  2LQW A;  2D8J A;  2C0I A;  4JJD A;  1X6G A;  1MUZ A;  5IHI A;  2DRM A;  2LMJ A;  2DF6 A;  2X3X D;  1PHT A;  1EFN A;  1UUE A;  1X43 A;  2AK5 A;  2GQI A;  1ARK A;  2RQT A;  1ZX6 A;  2GTO A;  3I9Q A;  1UHF A;  2AZV A;  2KXD A;  4AFQ C;  2JT4 A;  2RQV A;  4OMP A;  1SEM A;  2KRN A;  3RBB B;  2M51 A;  2KXC A;  2VWF A;  1VA7 A;  2J6F A;  5I11 A;  2A36 A;  1U06 A;  2JM9 A;  1AD5 A;  3NPF A;  2EBP A;  1Z9Q A;  3IQL A;  2PZ1 A;  1UHC A;  1B07 A;  1T0J A;  1N5Z A;  3VS4 A;  1NLO C;  1E6H A;  3RNJ A;  2CRE A;  1AZE A;  1W1F A;  4J9C A;  2EKH A;  2I0N A;  1X69 A;  3REB B;  2EGC A;  3EG1 A;  3I35 A;  1K4U S;  2FPD A;  2K3B A;  2ENM A;  2MIO A;  3A98 A;  2OI3 A;  2FRW A;  3EHQ A;  1X2Q A;  3M0S A;  3UA7 A;  2JM8 A;  2FEI A;  2SEM A;  5IHK A;  1RI9 A;  2JS2 A;  4AG1 C;  1XOV A;  1RLP C;  2EYW A;  2RNA A;  5IHN A;  2K79 A;  5FWC A;  2ESW A;  1GCQ C;  3NGP A;  1GCP A;  1K9A A;  4FSS A;  1PNJ A;  1M3C A;  2OJ2 A;  2RQU A;  4JZ4 A;  1PRL C;  1FMK A;  2L2P A;  2FPE A;  1YNZ A;  5HCK A;  1W6X A;  2DX1 A;  2C0T A;  2GTJ A;  3VS0 A;  2KE9 A;  1YWP A;  2CT4 A;  4DEX A;  2CUB A;  1B3Q A;  2CDT A;  1WI7 A;  2DL7 A;  2RMO A;  1E7O A;  1VYU A;  4R0K A;  4LUD A;  2LCS A;  3REA B;  1T3L A;  2G6F X;  4LE9 A;  2XMF A;  2DVJ A;  3EGU A;  2EYZ A;  4Z88 A;  1FYN A;  4JZ3 A;  2A28 A;  1OEB A;  2DIL A;  3ULR B;  3EG0 A;  1Y57 A;  1TUD A;  3H0H A;  3EG3 A;  2CH4 W;  3FJ5 A;  4JJC A;  2W10 A;  4CC2 A;  1SHG A;  2O9V A;  4IIO A;  4J9D A;  2JMA A;  2DE0 X;  2DL8 A;  4HXJ A;  1K0X A;  1BBZ A;  2RPN A;  4X1V A;  4KRT A;  2KRS A;  1PKT A;  2YSQ A;  5IXB A;  3UF4 A;  1MV3 A;  2K9G A;  2EPD A;  2KBT A;  2DBM A;  2J6K A;  2KRO A;  1GBQ A;  1UEC A;  1SRL A;  1ZUY A;  2O2O A;  5EC7 A;  1AWO A;  2JXB A;  2BZ8 A;  4HVW A;  3M0Q A;  4OML A;  2D1X A;  3M0P A;  2HEQ A;  2LZ6 B;  1BB9 A;  2NUZ A;  1Y0M A;  3CQT A;  4HVV A;  4J9G A;  2DBK A;  5FW9 A;  4DEY A;  2AKK A;  2CT3 A;  1QWF A;  3VS2 A;  1UJY A;  1WDX A;  2X3W D;  2B86 A;  4CC3 A;  2DRK A;  3I5R A;  1V1C A;  1M3B A;  2EYY A;  4RUG A;  1GL5 A;  2O88 A;  2M0Y A;  1QWE A;  5IXF A;  5GJW B;  4RTX A;  2EGA A;  2EQI A;  2ROT A;  1QKW A;  1ZSG A;  2HBW A;  2O9S A;  1U5S A;  1ZUU A;  4J9I A;  2W0Z A;  1GFC A;  4GBQ A;  2EGE A;  4EIK A;  1ZUK A;  1Z9Z A;  2RF0 A;  1OPL A;  2K7A A;  1ABO A;  1AEY A;  1H92 A;  1CKA A;  3EHR A;  3UAT A;  1H3H A;  4J9F A;  2KR3 A;  2V1Q A;  4Z89 A;  1J3T A;  2JTE A;  4E6R A;  2ABL A;  3TSZ A;  1UTI A;  4JJB A;  1NEB A;  1BK2 A;  5IH2 A;  3O5Z A;  1WFW A;  1OOT A;  3JV3 A;  4F16 A;  2CSI A;  2A37 A;  1KIK A;  1PRM C;  2VVK A;  1UGV A;  2KGT A;  2DLP A;  2LJ0 A;  2OAW A;  1NEG A;  2DMO A;  2CH4 A;  3VS7 A;  4D8K A;  1ZLM A;  2JS0 A;  1TG0 A;  1E6G A;  1CSK A;  3KFV A;  1ABQ A;  2NWM A;  2ED0 A;  4CC4 B;  1U3O A;  4K11 A;  4HCK A;  2ROL A;  2YUQ A;  2IIM A;  1NG2 A;  1JXM A;  4LN2 A;  1WA7 A;  4RTY A;  1NYG A;  1G2B A;  3THK A;  4CC7 A;  1ZBJ A;  2V1R A;  2VKN A;  4D8D A;  1GBR A;  2YUP A;  1X2K A;  2D0N A;  1T3S A;  4J9B A;  4RTT A;  1HD3 A;  2PTK A;  2YUO A;  4Z8A A;  1SRM A;  4HVU A;  2SRC A;  2KNB B;  1BU1 A;  3PVL A;  4WCI A; 
#chains in the Genus database with same CATH topology
 2RN8 A;  5GAM f;  1QVF S;  2K5I A;  4F14 A;  5KCO A;  3OYD A;  3VU3 C;  2C0O A;  3CCL A;  2GBQ A;  4LDU A;  4MMK A;  1JU5 C;  1M8M A;  2LVM A;  1UE9 A;  1JRI A;  4E7S A;  1XQH A;  5GAM h;  4M78 A;  3QZ9 B;  4L5G A;  1ACM B;  1RL2 A;  1QVG A;  2M1H A;  1KFZ A;  4F17 A;  4QT7 A;  1BI3 A;  2FZG B;  1X27 A;  3A8O B;  2KEA A;  2PVD B;  2DTH A;  1D09 B;  1M30 A;  5CKB A;  3UA6 A;  1AVZ C;  2J6O A;  2OTJ Q;  1OI1 A;  1WQW A;  1O75 A;  2J05 A;  2QG9 B;  1KD1 R;  4PJM A;  1WHM A;  2E3H A;  2QYZ A;  2HD0 A;  1QCF A;  4C8Q C;  2A08 A;  2V26 A;  4QQD A;  4ELY C;  3A5Z B;  4IUU A;  1TWB A;  2L3S A;  4N0A C;  3LLR A;  1VQ6 Q;  1IGU A;  2K2M A;  3JCM X;  1WYX A;  1KK7 A;  3H41 A;  1WZO A;  1M90 R;  1MGQ A;  2EVR A;  1VQL A;  1KC8 U;  4RTW A;  3CCE A;  3GNF B;  5KYU A;  3CC2 T;  3CC4 T;  1QVF A;  1K0S A;  2E41 A;  4R55 A;  2HDA A;  3CCR A;  3QO3 A;  4M7A B;  4WTO B;  1MND A;  2CZ7 B;  5D6X A;  1VQK T;  4ZTJ A;  2DET A;  1WNL A;  4OMN A;  1ZA2 B;  1AWX A;  1YWO A;  1WXT A;  2ECZ A;  1YJW Q;  5CO7 A;  3P8B B;  3RMQ A;  1I4K 1;  1X6B A;  4LDW A;  2BIV A;  2LNV A;  3S3O A;  3M0T A;  1QQJ A;  2RK1 A;  2WSC E;  4F04 B;  1JQQ A;  2NUP B;  5CK9 A;  2LT1 A;  2RA2 A;  1FMV A;  3RES A;  4J9H A;  1R77 A;  2JW4 A;  3GBQ A;  4M7D D;  4YTL A;  1OZ2 A;  4M7D F;  5LJ5 f;  3DB4 A;  3RUX A;  5GJV B;  1Q7Y U;  1KQ1 A;  2E6Z A;  3CD6 Q;  1VQN T;  3JCM J;  4B9X A;  3OSS C;  2YLB A;  3M5A A;  1MHN A;  5KYX A;  3CBP A;  1IHV A;  3CXC S;  1WJR A;  2D8H A;  2YDL A;  2HQX A;  4ZNX A;  4Y28 E;  4IIM A;  4PNO A;  2DXU A;  4CI0 C;  4M75 B;  3PMI A;  2O01 E;  3ZL7 C;  2BKD N;  1VQ5 Q;  1Q82 R;  3PIP A;  3KXT A;  2QA4 Q;  1Y96 B;  1K9M U;  5DY9 A;  1S72 A;  3CCE Q;  2OTL Q;  2HL5 C;  2LQW A;  5GAN d;  5HKC A;  1X6G A;  1MUZ A;  2ZPF B;  2DRM A;  4C5E A;  2HSE B;  1Q95 G;  2X3X D;  3G6E T;  1EFN A;  4AT1 B;  3HL8 A;  3JCM V;  2GFA A;  2E12 A;  3I9Q A;  3SWN C;  2KXD A;  1DJ7 B;  4ELZ C;  2JT4 A;  1D0Y A;  4XTV A;  3CD6 A;  3OW2 S;  3PNW C;  3EFS A;  2ZCF B;  1VA7 A;  3OYI A;  3NPF A;  1BCM A;  2EBP A;  1Z9Q A;  1WHG A;  3IQL A;  2IPO B;  3C12 A;  4EMH A;  2PZ1 A;  4N4H A;  3P8D A;  2X35 A;  4EMG A;  4FIB A;  4DBF A;  1QP2 A;  1E6H A;  2YWW A;  1AZE A;  1W1F A;  1N6A A;  1YBY A;  1R0B G;  2DKG A;  5KH6 A;  3ZEH A;  2K3B A;  2ENM A;  4KBM B;  2V8I A;  3AT1 B;  3QUI A;  2JVV A;  3EGX A;  3CC7 Q;  5GAN f;  2FEI A;  3CC2 A;  4KH0 B;  2LC4 A;  2EYW A;  5IAY A;  1KC8 R;  4PLL A;  1HXD A;  2CP2 A;  3CD6 T;  1SG5 A;  1M3C A;  3E19 A;  2LQ8 A;  4JZ4 A;  3EFO B;  2ZZD A;  4OGE A;  5HCK A;  2EKO A;  5AT1 B;  2GTJ A;  3CCL T;  4XTZ A;  1YWP A;  5LJ3 h;  2CUB A;  1B3Q A;  2MI6 A;  3L2V A;  2CDT A;  1NZ9 A;  5KYW B;  4R0K A;  2QAS A;  3MET A;  1T3L A;  1WJS A;  3M4G A;  1WJQ A;  2CP0 A;  3EGU A;  2MF2 A;  2F5T X;  1BKB A;  2DIL A;  2LT4 A;  3ULR B;  2E3I A;  1ZBX A;  3MP8 A;  3H0H A;  4FYY B;  2CH4 W;  2KAF A;  1PG5 B;  1UB4 A;  3SB2 A;  2LTO A;  4E2F B;  2EQK A;  4AMC A;  1VQN A;  2DL8 A;  1U1T A;  2OTJ A;  1TTH B;  1N8R C;  2QEX T;  2QGF B;  3TU4 K;  3CPF A;  3I55 Q;  2KRS A;  1FWZ A;  2YSQ A;  3M59 A;  2X4W A;  1WHL A;  4B6M A;  2H3J A;  4KGV B;  4C92 D;  1N9R A;  3HRT A;  3OYC A;  1V76 A;  1ZUY A;  2FYK A;  1SRL A;  2WSF E;  5EC7 A;  3SDZ A;  2BZ8 A;  3HTR A;  4HVW A;  3M0Q A;  4OML A;  1YJ9 A;  3CMA Q;  1M1K R;  2E64 A;  3F70 A;  2KDS A;  3M4Y A;  2DBK A;  1MNE A;  4MML A;  1YHQ T;  5J39 A;  2X3W D;  3OBY A;  3WVE B;  1VQK A;  2L3R A;  3CCR T;  2QTV A;  3EFO A;  3E9G A;  3I5R A;  5KYY B;  4M7D G;  4E7I A;  2EYY A;  2DZ9 A;  2K5F A;  1GL5 A;  2LDM A;  2RHU A;  3BFM A;  3CCE T;  3QZ5 B;  2KVQ G;  1QWE A;  2PQW A;  2NUT A;  4RTX A;  4BAC A;  4M77 G;  3FJP A;  2HBW A;  4PL6 A;  3OS1 A;  4M75 F;  3JCM W;  5GAO m;  4QQ6 A;  4J9I A;  5LJ5 j;  3J7A F;  1GFC A;  2EGE A;  3CBO A;  3G71 Q;  2QQA A;  3HRU A;  2CZ6 B;  1M1K C;  1VQ6 T;  4C8Q F;  4JJN K;  1YJN T;  2KR3 A;  1VQM Q;  2V1Q A;  2CP5 A;  4M78 F;  4DBH A;  1LNX A;  1UTI A;  2XHC A;  3JCM d;  4JJB A;  4FYW B;  3GNG A;  1BK2 A;  3JCM P;  1OOT A;  2CSI A;  4Z02 A;  4PLI A;  3CCQ Q;  1UGV A;  2DLP A;  1K73 C;  2RI5 A;  2K5L A;  2EFI A;  2E5Q A;  3OW2 P;  4J6W A;  1G3Y A;  1YIT T;  2RHI A;  4RKU E;  1ABQ A;  2NWM A;  1Y96 A;  1UGP B;  1NPP A;  1OU9 A;  4MDW A;  2FHD A;  4HCK A;  3JB9 H;  1QCO A;  5CIU A;  3V7R A;  2YUQ A;  2RI2 A;  2PVG B;  4LN2 A;  4C92 C;  4X9C A;  1NJI R;  1WA7 A;  2VUB A;  1M9S A;  3THK A;  4VUB A;  1GBR A;  2YUP A;  3CEY A;  2D0N A;  2YUO A;  2VXF A;  4HVU A;  2L5Q A;  2KNB B;  1D0Z A;  3A8G B;  1BU1 A;  4WCI A;  2QDY B;  5GMK m;  3OS0 A;  3G6E Q;  3VUB A;  1YCS B;  4JUV A;  4X34 A;  3JB9 F;  4ZN3 A;  4WF2 A;  1RAH B;  1NE8 A;  3T9N A;  1RAC B;  2LX7 A;  2ZGW A;  3S6W A;  2RHY A;  3LX7 A;  4J7I A;  2RB6 A;  2OAU A;  4BE0 A;  5CQY A;  4HT8 A;  3V7S A;  3QJ6 A;  4X9D A;  4LUE A;  1PCX A;  2Y4X A;  4AFZ C;  1ZSZ B;  4J9E A;  2QQB A;  1K9M C;  2GCX A;  3L2W A;  1UEB A;  2LCL A;  2RO0 A;  3H0F A;  4C8Q E;  2OTJ T;  1YP5 A;  4NOY A;  3L2Z A;  1LCK A;  3CCQ A;  1OX8 A;  2XKO C;  3QKJ A;  3QDF A;  5LL6 S;  4II1 A;  5GMK e;  1SKU B;  3ZFJ A;  3G4S T;  2DPP B;  3M56 A;  1BCO A;  2LP5 A;  3R6N A;  5FRO A;  1W70 A;  2M16 A;  5LJ3 d;  2HKQ B;  2HCK A;  3PMT A;  2RHZ A;  3JCM b;  2QGG A;  4DOW A;  1Q81 R;  1IXD A;  1MV0 B;  2JOY A;  2F2X A;  1XNI A;  2GF7 A;  2LNH B;  3QJY A;  5GAN 6;  1H8K A;  2JN0 A;  4DA4 A;  2JZ2 A;  5CKD A;  4R56 A;  3MPU B;  4P5N A;  3X28 B;  4DQ2 A;  2VV5 A;  2EIF A;  1VIF A;  4LNP A;  4FM4 B;  1KHI A;  1QKX A;  1PSE A;  4KUL A;  3Q1J A;  3X24 B;  3JCM e;  2CKK A;  3PTA A;  4V2S A;  1KJW A;  4JRK A;  2I2L A;  1QP3 A;  3CCM Q;  4F7U B;  5I22 A;  2LQK A;  5LJ3 j;  1TUG B;  4RTV A;  1JEG A;  2BZX A;  3U23 A;  3M57 A;  3VS1 A;  4OMF B;  2EJF A;  3DB3 A;  2EW3 A;  1AT1 B;  3H0I A;  3NHN A;  3OMG A;  1PD1 A;  2HSP A;  4XTU A;  2X51 A;  4M77 D;  3V8L A;  2RM4 A;  5LJ3 f;  4FW1 A;  4GLM A;  5KYX B;  5CVI A;  4OMM A;  4J6Y A;  2EYX A;  2HMA A;  1JO8 A;  1VQ5 A;  1H3Z A;  4MZM A;  1Q86 U;  2LJ1 A;  1RLQ C;  4FYV B;  1GFD A;  5I2M A;  3LH5 A;  2XU8 A;  2PVO B;  2ZPG B;  1G3T A;  3GPL A;  3G7Z A;  1M2O A;  3RKY A;  2P4T A;  4QQG A;  1JXO A;  2EAY A;  1PWT A;  2MOX A;  2WAC A;  2DJQ A;  2DYB A;  3RDV A;  3VRY A;  1S72 T;  3VUZ A;  3PE0 A;  8AT1 B;  2DIG A;  3RIR A;  5DLQ E;  2KT1 A;  2DA9 A;  3LYI A;  4RCB A;  1IO6 A;  1WLP B;  1SSH A;  1AWJ A;  4N4I A;  1KSW A;  4GLK A;  1G83 A;  1YN8 A;  1NYF A;  3OW2 A;  1I5O B;  2KRM A;  2VXE A;  4JJD A;  3CCJ Q;  1AHJ B;  2MWO A;  2CYZ B;  3OSV A;  5FU7 C;  4A4H A;  1X43 A;  2AK5 A;  4PJO D;  2P0P A;  1M1K U;  2RQT A;  4LDY A;  2VYT A;  2FZK B;  2GTO A;  4XTX A;  2LX9 A;  2RQV A;  2ZAE A;  4PFP A;  1YIJ T;  3PIO A;  4XTY A;  1Q7Y C;  3HHT B;  5I11 A;  2A36 A;  2JM9 A;  5KE3 A;  1JBM A;  1UHC A;  1B07 A;  2M9U A;  4FCY A;  1T0J A;  3OS2 A;  5GAM e;  2FB7 A;  1KQ2 A;  3OMC A;  1F1B B;  4ZTF A;  3EGD A;  4OB1 B;  4A4F A;  4TVR A;  5J26 A;  2I0N A;  3I35 A;  1YI2 T;  1U1S A;  4J8O A;  3BW1 A;  2FRW A;  3UPU A;  1X2Q A;  3UA7 A;  4FW2 A;  2SEM A;  4ATO A;  4D6W A;  4FSX A;  3JB9 I;  1XOV A;  2RNA A;  4PJO B;  1OUL A;  4JS4 A;  2K79 A;  3NGP A;  1GCP A;  4FSS A;  3SWN A;  3FC3 A;  2G3R A;  3LGF A;  3M55 A;  4BE1 A;  2L2P A;  1YNZ A;  1K73 U;  1W6X A;  1WPY A;  4O5V A;  2KE9 A;  4C92 F;  4M77 F;  2VAS A;  3VJP A;  3CME A;  4C0Z A;  2LCS A;  1ZQ1 A;  2XMF A;  2QA4 A;  5LJ5 e;  4DOV A;  2YXY A;  1FYN A;  1K73 R;  2F5K A;  2XG8 D;  2Y90 A;  4HCZ A;  4C8Q D;  3LW5 E;  2MK5 A;  3OYG A;  4CC2 A;  1SHG A;  2O9V A;  4J9D A;  4C5I A;  4M75 D;  1K0X A;  1VIE A;  2FL7 A;  1BBZ A;  3C94 A;  3CCU T;  4A4K A;  2M0O A;  3QYH B;  4QKU A;  4PJO C;  4QW2 A;  1VQ8 Q;  3I56 T;  1PKT A;  2GQV A;  1K8A U;  3WVD B;  1MV3 A;  1G3W A;  1G8X A;  3JCM c;  1OU8 A;  4JS5 A;  2PU9 B;  2DO3 A;  4L59 A;  1I5L A;  4L6V 5;  2RK2 A;  2JXB A;  2D1X A;  2MPX C;  1YFN A;  3M0P A;  5KYY A;  5C0M A;  1WHJ A;  3MJX A;  3CMA A;  2LZ6 B;  1BB9 A;  5GMK i;  2NUZ A;  1Y0M A;  4J9G A;  1FX7 A;  5FW9 A;  3JCM f;  4DEY A;  3VS2 A;  4M78 B;  1EZZ B;  3MP6 A;  3CPW S;  1ZSZ C;  3X25 B;  5CR2 A;  1IHW A;  1RAG B;  1M1F A;  4BDY A;  2M0Y A;  4JLI A;  1X01 A;  4XU0 A;  4M7A D;  2EQI A;  4JRI A;  1RAE B;  4BY6 C;  4EMK C;  1ZSG A;  2O9S A;  2DD5 A;  5A0L A;  1U5S A;  3CCU Q;  4XAX B;  2W0Z A;  2IG0 A;  3DLM A;  4GBQ A;  4C5H A;  5A0D A;  1M8V A;  3PT9 A;  1Q86 R;  2K7A A;  5EG2 A;  3EG9 B;  1H92 A;  3EHR A;  5CQX A;  3CXC P;  4Z89 A;  2CP7 A;  1NEB A;  2XID A;  1WFW A;  1RAI B;  2A37 A;  2DYI A;  3OS5 A;  2VVK A;  2DEU A;  2LJ0 A;  2M02 A;  2DMO A;  2CH4 A;  5FU6 B;  3D7S B;  3BY7 A;  1X75 C;  1TG0 A;  4KH1 B;  2DFU A;  2A7Y A;  1E6G A;  3CC2 Q;  5CKH A;  5GAN 4;  1U3O A;  3CC7 A;  4M7D E;  2A0F B;  2D0Q B;  2ROL A;  4E7J A;  1TOV A;  2E65 A;  3CCS T;  4PKC C;  5KE2 A;  4KGZ B;  1JXM A;  3J81 E;  4KGX B;  2KMT A;  4RTY A;  3MEW A;  1NYG A;  2X4X A;  3JRZ A;  2V1R A;  4D8D A;  2MMP A;  3NFC A;  3JAM E;  3L42 A;  1T3S A;  1HD3 A;  3S3N A;  2NUP A;  2PUK B;  3QHS A;  4XU2 A;  3OQ5 A;  2QA4 T;  4KUD K;  1WQ7 A;  1WXU A;  1NM7 A;  1N8R R;  1UGQ B;  1G3S A;  3HPW A;  4HCC A;  3OYL A;  4Y92 A;  2NYS A;  1EX4 A;  3LWH A;  4A63 B;  3RKW A;  2BZY A;  4A4E A;  2HQH A;  3MP1 A;  1PKS A;  4M75 A;  1RUW A;  4RTU A;  1A0N B;  1I8F A;  2E70 A;  1IZ6 A;  3EG2 A;  2OTL A;  1W2B A;  2JNG A;  4OP0 A;  3CME Q;  1G5V A;  1YJW T;  4M77 A;  3SFM A;  4C92 A;  1Q82 C;  4PJO A;  4AFU C;  2CSQ A;  2L3Q A;  1VQP Q;  1VQO T;  5L23 A;  1P92 A;  2QTX A;  3M9Q A;  4AFS C;  1VQK Q;  2FG0 A;  3CCM A;  3JB9 J;  3NMZ C;  3G71 T;  4KT0 E;  4OB2 B;  5LJ5 d;  4RG2 A;  1QMC A;  1VQM T;  1VQ4 T;  2LJ3 A;  2GGR A;  2X4J A;  2K2V A;  1VQP T;  1B7T A;  3CCV T;  1H64 1;  2CP6 A;  1VQ4 Q;  1D0X A;  1VQ9 T;  1QVP A;  3OYN A;  2KK4 A;  1FXX A;  4RTZ A;  3SEM A;  3BDL A;  4IUQ A;  4M77 E;  5KYN A;  2AZS A;  1TUC A;  1M2V A;  2PNI A;  1CKB A;  1M3A A;  1VQN Q;  4XQ3 A;  4IUV A;  2RJD A;  2FPF A;  2DL5 A;  4BI3 A;  2COZ A;  1WHH A;  4C0D B;  3GOX A;  3RER A;  1NPR A;  1GRI A;  1NJI U;  3FDR A;  3SHW A;  4BB7 A;  2QQS A;  3CMA T;  3PVQ A;  3M0U A;  2L3P A;  3ER0 A;  1VQO Q;  2MCN A;  3I5S A;  3M0R A;  2R58 A;  3LWI A;  2HKN A;  4M77 B;  4ANJ A;  3TVT A;  1T0H A;  2KY9 A;  2Z0W A;  2CUD A;  2E4H A;  3I55 T;  2QK0 A;  4DBQ A;  2R5A A;  4OF1 A;  4C0G A;  1I0C A;  4FT2 A;  4IUP A;  3JCM h;  1UDL A;  1RAB B;  1MMA A;  1VYT A;  5A0G A;  3QII A;  3TSW A;  2DAQ A;  4Q5W A;  2E6N A;  2IVW A;  7AT1 B;  4OMQ A;  2YHT A;  5HY6 A;  4PJO E;  5FWB A;  1N27 A;  1WX6 A;  1HJD A;  1OYX A;  2KI7 A;  4BI8 B;  4UC4 A;  2ED1 A;  2R5M A;  3KUF A;  1LVK A;  2P4R A;  2KYB A;  2B8A A;  2XDD A;  3EG9 A;  2BUD A;  4QVD A;  1K76 A;  4MDX A;  2D8J A;  1TS9 A;  5AYF A;  5IHI A;  2DTO A;  2HAX A;  3ME9 A;  1X6O A;  1PHT A;  1UUE A;  2L89 A;  4RMO A;  5GAM d;  5GAM g;  1ZX6 A;  1PD0 A;  1M2V B;  3MHX A;  2AZV A;  3A1P A;  1Q81 U;  3CCL Q;  4IUR A;  1SEM A;  2HBP A;  3SD4 A;  2M51 A;  2J6F A;  1KD1 C;  4ME7 A;  4IKF A;  1YHQ Q;  4J83 A;  1N5Z A;  3VS4 A;  4M75 C;  1VQ7 A;  4EMK B;  3RNJ A;  1YI2 A;  3OYY A;  3CXC A;  3S3M A;  3TEE A;  4A53 A;  4M7D C;  2FVU A;  4J9C A;  3R6O A;  2A3L A;  1VQO A;  3V7C A;  1IB8 A;  3REB B;  2EGC A;  1K4U S;  3A8M B;  1VQ7 T;  1WGS A;  2MIO A;  5GAM j;  3A98 A;  2ATC B;  3CCQ T;  4JRQ A;  4M7A A;  5IHK A;  3HFO A;  4HA8 A;  3JB9 D;  1YIT Q;  1RI9 A;  1VQ9 A;  2JS2 A;  4AG1 C;  5HK3 A;  1RLP C;  1JB0 E;  5IHN A;  3CCJ T;  3HP9 A;  2DXC A;  1GCQ C;  5FWC A;  3JB9 G;  1Y07 A;  3BE3 A;  1RAA B;  1OX9 A;  5GMK j;  4BDZ A;  1K8A C;  1PNJ A;  1VQ4 A;  4HCB A;  1FMK A;  4N0A A;  2FPE A;  4ZGJ B;  1BI2 A;  3CC4 Q;  3V8K A;  3VS0 A;  1M4Z A;  2K3Y A;  5C6S A;  2E1H A;  4JLG A;  3WXM B;  3REA B;  1PM3 A;  2G6F X;  4LE9 A;  2C06 A;  2EYZ A;  3CCS Q;  6AT1 B;  4JZ3 A;  4JDS A;  1OEB A;  1Y57 A;  1TUD A;  1D1A A;  4LXC A;  5GAN 5;  4PK4 A;  4C92 B;  2EWN A;  1YJ9 Q;  1KD1 U;  1YJW A;  2Y4Y A;  4NS5 A;  1VQ8 T;  2MYS A;  2MWP A;  4HXJ A;  2QEX Q;  1JJ2 A;  4PJO G;  3NTI A;  2OTL T;  4A4G A;  1OQK A;  1K8A R;  2VC8 A;  4EMK A;  3I56 Q;  1D3B B;  1JJ2 P;  5IXB A;  3UF4 A;  3I55 A;  4E7H A;  4E7Z A;  2XDB A;  3NTH A;  1D1C A;  2EPD A;  2KBT A;  1I81 A;  1VQL Q;  2KRO A;  4M7A F;  1GBQ A;  3HRS A;  5CAI A;  4MZP A;  1XTD A;  2DZC A;  2JJ9 A;  2ZPB B;  5GAO l;  2VGM A;  3EH2 A;  3OYK A;  3CQT A;  4F7U F;  3GIB A;  2P0Q A;  1QVG S;  2P0K A;  1WDX A;  5LJ3 e;  4CC3 A;  4M77 C;  3NTK A;  1M3B A;  4RCC A;  4E47 A;  5L8R E;  1C6V X;  2ZPI B;  5KCH A;  2HQE A;  2O88 A;  5M9O A;  5IXF A;  3G4S Q;  3EFR A;  3AHU A;  3CCV A;  3CC7 T;  2JUF A;  4F7U E;  1QKW A;  4XK8 E;  2LRQ A;  1HK9 A;  2RHX A;  4C8Q A;  4NL3 A;  3N5B B;  2DEQ A;  1VQM A;  3LGL A;  2ZPE B;  4OGC A;  1Z9Z A;  2RF0 A;  1ABO A;  1AEY A;  1CKA A;  3G71 A;  2EJ9 A;  3UAT A;  5GAN 2;  1ZA1 B;  1N8R U;  4J9F A;  3HKS A;  1J3T A;  4E6R A;  2ABL A;  3TQ7 P;  3L1A A;  5IH2 A;  3G4S A;  1KHC A;  3HFN A;  1PRM C;  3A8L B;  2KGT A;  1IGQ A;  3VS7 A;  2HZY A;  5KYW A;  2F1L A;  4D8K A;  3GP8 A;  1W4S A;  1ZHI A;  2JS0 A;  2YRC A;  3OYM A;  1CSK A;  4NL2 A;  1FMW A;  3JSC A;  4F7U A;  4CC4 B;  4K11 A;  3QG1 A;  1LPL A;  3CCU A;  2IIM A;  2WSE E;  1SF9 A;  2EYQ A;  3TRE A;  5IT9 E;  2QI2 A;  1GXI E;  4CC7 A;  2XIC A;  2X9H A;  2VKN A;  1PSF A;  1X2K A;  5DLO A;  3VYH B;  2DER A;  3EH1 A;  4PFZ A;  1S72 Q;  2K57 A;  2VGN A;  4J9B A;  4J7F A;  4Z8A A;  2RJC A;  1SRM A;  3QYG B;  1LOJ A;  2SRC A;  3PVL A;  1NJI C;  3H8Z A;  3DKM A;  1YJN Q;  3L2R A;  3V8J A;  1BYM A;  3UWN A;  2XK0 A;  4AG2 C;  2K3X A;  2YT6 A;  3L2U A;  2XD0 A;  5FU7 B;  4HT9 A;  2YUN A;  2FO0 A;  4JPB W;  2QXF A;  3LH0 A;  1KG1 A;  1HYO A;  5GAN 7;  3CCS A;  2COW A;  3GF5 A;  3X26 B;  2RQW A;  1QLY A;  4LD6 A;  4C92 E;  2DNU A;  4OMO A;  2DK3 A;  5I2S A;  2DL4 A;  4MZT A;  3KBG A;  1UJ0 A;  3VS6 A;  1I07 A;  1VQ8 A;  4OVA A;  5GMK l;  4M78 E;  2QQ9 A;  4BUG A;  1O9S A;  1OPK A;  1SPK A;  2DTI A;  4ESR A;  2F2V A;  3L2Q A;  1UFF A;  5CCA A;  5LJ5 h;  2GNC A;  2V8K A;  3MKD A;  1K9M R;  4LD9 K;  4FL6 A;  2O31 A;  1Q81 C;  1VYV A;  2E5K A;  2DM1 A;  3QSU A;  1SHF A;  2JTM A;  4M4Z A;  1VQ9 Q;  1NBE B;  2CZ0 B;  2CGH A;  2DXB A;  2QDL A;  4ZGE B;  3CME T;  3RKX A;  3CCR Q;  1W2B S;  2CS7 A;  4LDX A;  1TH7 A;  3OYA A;  4N4G A;  5D6W A;  1AOJ A;  2EQM A;  1Y71 A;  2FZC B;  3EAE A;  4HKE A;  1Q7Y R;  2F2W A;  4XTW A;  3MCA B;  1I1J A;  4FU6 A;  2DL3 A;  2YLC A;  1R8O B;  4PJL A;  3C4S A;  3EGD B;  1K1Z A;  2L8D A;  3E2U A;  2DVE A;  3CCJ A;  1PC0 A;  1HSQ A;  4B9W A;  3VRZ A;  1WXB A;  5HK0 A;  1TXQ A;  5I21 A;  5CKF A;  2GFU A;  1AZG B;  3URG A;  1RI0 A;  1NLP C;  3GLX A;  2RQR A;  1UG1 A;  1M1G A;  2H8H A;  3QWY A;  2KT8 A;  1GCQ A;  1QCN A;  3QWX X;  4ZGD B;  2O4X A;  1D3B A;  3M58 A;  4ORZ A;  2COY A;  4KUI A;  5FU6 C;  3HSB A;  2J06 A;  2D6F A;  2KYM A;  3QPH A;  2BTT A;  4ZN1 A;  5IN1 A;  1WIE A;  4M7D B;  8ATC B;  2AKL A;  1YJ9 T;  2OX7 A;  2AIR B;  2K6D A;  4J5Y A;  2JMC A;  1M27 C;  1QW1 A;  1AWW A;  1OV3 A;  1UGS B;  4EDU A;  3VS5 A;  2CZ1 B;  2AT1 B;  2LQN A;  4OB3 B;  3I56 A;  5ECA A;  5DM7 R;  1S1N A;  1M90 U;  1VQ5 T;  3VKI A;  3PFS A;  2KQW A;  3VS3 A;  2QEX A;  3C0C A;  3OYH A;  5FRM A;  1Q82 U;  2NLU A;  5FRN A;  4LDV A;  1YIJ Q;  1EIF A;  3FIF A;  4RG8 A;  3OY9 A;  1ZSZ A;  3C95 A;  2L0A A;  5D6Y A;  4M78 C;  2E10 A;  2FRY A;  2J7I A;  2JTF A;  1MMN A;  3MEU A;  2ZPH B;  2YRV A;  2C0I A;  4A54 A;  2LMJ A;  2DF6 A;  4FYX B;  4BD3 A;  3CC4 A;  5D7U A;  4M75 E;  1B34 B;  2GQI A;  3FRN A;  1ARK A;  3JCM Q;  1VQL T;  1R0C B;  3JCM g;  1UHF A;  3FLG A;  4PJO F;  4AFQ C;  2HL3 A;  4OMP A;  1KC8 C;  2KRN A;  3RBB B;  3VYG A;  3FB9 A;  2KXC A;  2VWF A;  4CRI A;  1KQS A;  1U06 A;  1AD5 A;  1YIT A;  1VUB A;  2DXT A;  1KQS P;  4C0F A;  3J80 E;  2RI3 A;  4M7A G;  2F69 A;  1NLO C;  2D9T A;  4E7K A;  2CRE A;  3A8H B;  3VV0 A;  3QDR B;  1U8R A;  2EKH A;  1Q86 C;  1X69 A;  2XDP A;  3CBM A;  3OYF A;  3EG1 A;  2FPD A;  1YI2 Q;  5GAO n;  1VQ7 Q;  1D1B A;  3FEO A;  1VQ6 A;  2OI3 A;  3EHQ A;  2BE9 B;  1YCY A;  3M0S A;  4F7U G;  1VOM A;  2JM8 A;  1MMG A;  5J3B A;  5GAN h;  3OYB A;  1C1A A;  2ESW A;  1YIJ A;  4M7A E;  3RR6 A;  2DIQ A;  3CPW A;  1K9A A;  1VQP A;  2YRD A;  2KSS A;  2OJ2 A;  4PJJ A;  1XJW B;  2RQU A;  3EGX B;  3CPW P;  1PRL C;  1BI0 A;  4C92 G;  3H6Z A;  3G6E A;  2DX1 A;  2C0T A;  1TU0 B;  2RD1 A;  3INZ A;  3MEA A;  2CT4 A;  4DEX A;  1QVG P;  2EJG A;  1WI7 A;  2DL7 A;  2RMO A;  1E7O A;  5GAO r;  1VYU A;  1LJO A;  3CCM T;  4LUD A;  4M75 G;  2DD4 A;  5GMK h;  4PFO A;  1B34 A;  4EPC A;  2DVJ A;  2X4Y A;  2XI9 A;  4O6J A;  4Z88 A;  1IRX A;  4M78 G;  2A28 A;  3EG0 A;  2HNI A;  4C8Q G;  3EG3 A;  1BIA A;  3ZBD A;  3FJ5 A;  2EQU A;  4JJC A;  2W10 A;  4OB0 B;  3H9N A;  4M78 D;  3CCV Q;  4IIO A;  9ATC B;  5KYU B;  1SSF A;  4C0D C;  1JJ2 S;  2JMA A;  2DE0 X;  3BDU A;  3P8H A;  2RPN A;  4X1V A;  5A2Q E;  2VB6 A;  4KRT A;  4DBR A;  1C0M A;  3X20 B;  3MO8 A;  1M90 C;  2K9G A;  1BI1 A;  1KQS S;  3O8V A;  3QBY A;  5LJ3 g;  2DBM A;  5GAN 8;  2J6K A;  1RAD B;  1UEC A;  1AWO A;  2O2O A;  2RH2 A;  2R57 A;  3UDC A;  4JRP A;  2HEQ A;  2DJZ A;  4C5G A;  3OBW A;  5GAN 3;  4HVV A;  1W2B P;  2AKK A;  2CT3 A;  1QWF A;  1UJY A;  4PJN A;  1N9S A;  2B86 A;  1WHK A;  3DLL A;  2BE7 D;  3G1J A;  3UT1 A;  4E7L A;  2DRK A;  4C8Q B;  5GAO q;  5GAO p;  1V1C A;  2O4X B;  4QVC A;  2H3E B;  4RUG A;  3E1S A;  2EQJ A;  2QAZ A;  2AHJ B;  5GJW B;  4BE2 A;  3OYE A;  2RJF A;  3PGG A;  2EGA A;  2ROT A;  4M7D A;  3TCJ A;  1ZUU A;  2LCC A;  3QXE B;  4FT4 A;  4EIK A;  1ZUK A;  1OPL A;  4M7A C;  5LJ5 g;  2NUT B;  4J6X A;  1H3H A;  1RAF B;  2JTE A;  3SWN B;  3TSZ A;  2PUO B;  1TSF A;  3O5Z A;  4XU1 A;  3JV3 A;  4IUT A;  2QQR A;  1Y7X A;  4F16 A;  1YJN A;  1QVF P;  1UGR B;  1KIK A;  2P84 A;  1IRE B;  5GAN g;  2OAW A;  1NEG A;  2CP3 A;  2MAM A;  1BIB A;  1ZLM A;  1M5Q 1;  1V29 B;  3OB9 A;  3KFV A;  2ED0 A;  2K4Y A;  3ASK A;  3E9F A;  5CKE A;  1OZ3 A;  4BY6 B;  1NG2 A;  3M53 A;  4BI4 A;  1G2B A;  3OA6 A;  1ZBJ A;  3MEV A;  3RMS A;  3OYJ A;  4RTT A;  3M54 A;  1YHQ A;  4Y91 A;  2PTK A;  4QVZ A;  4GY5 A;  4XU3 A;  5GAN j;  2RJE A;  2V8J A;  5GAN e;  1MMD A;  5FLX E; 
#chains in the Genus database with same CATH homology
 2RN8 A;  1WXU A;  1NM7 A;  4F14 A;  1YCS B;  2C0O A;  4Y92 A;  4AG2 C;  2YT6 A;  2GBQ A;  2YUN A;  1JU5 C;  1M8M A;  2FO0 A;  4JPB W;  2LX7 A;  4A63 B;  1UE9 A;  2BZY A;  2RQW A;  1QLY A;  1PKS A;  4LUE A;  4AFZ C;  1RUW A;  4RTU A;  1A0N B;  4J9E A;  3EG2 A;  2DNU A;  4OMO A;  2DL4 A;  3H0F A;  1UJ0 A;  3VS6 A;  1I07 A;  1KFZ A;  4F17 A;  4QT7 A;  1X27 A;  1YP5 A;  2KEA A;  4AFU C;  1LCK A;  2CSQ A;  1OPK A;  2L3Q A;  1M30 A;  1SPK A;  3UA6 A;  1AVZ C;  4ESR A;  2J6O A;  2F2V A;  1UFF A;  2GNC A;  2O31 A;  1VYV A;  2J05 A;  2E5K A;  2DM1 A;  5L23 A;  1SHF A;  2LP5 A;  3R6N A;  4AFS C;  4M4Z A;  1W70 A;  2QDL A;  2FG0 A;  2HCK A;  1QCF A;  2A08 A;  3NMZ C;  1AOJ A;  1MV0 B;  2L3S A;  2F2X A;  2LNH B;  1H8K A;  2F2W A;  2K2M A;  1WYX A;  2LJ3 A;  2GGR A;  1I1J A;  3H41 A;  2DL3 A;  2EVR A;  1K1Z A;  1HSQ A;  4RTW A;  3VRZ A;  1WXB A;  4RTZ A;  3SEM A;  1AZG B;  4LNP A;  1NLP C;  1K0S A;  1QKX A;  2AZS A;  2HDA A;  2RQR A;  1UG1 A;  1TUC A;  2H8H A;  1KJW A;  3QWY A;  2KT8 A;  2PNI A;  1GCQ A;  3QWX X;  5I22 A;  1CKB A;  4ORZ A;  1M3A A;  4RTV A;  1JEG A;  4OMN A;  2BZX A;  3U23 A;  2FPF A;  2DL5 A;  3VS1 A;  1AWX A;  1YWO A;  2J06 A;  1WXT A;  2ECZ A;  1GRI A;  2KYM A;  2BTT A;  3SHW A;  1X6B A;  3PVQ A;  2EW3 A;  3M0U A;  1WIE A;  2L3P A;  3H0I A;  2AKL A;  3NHN A;  2HSP A;  3M0T A;  2K6D A;  2MCN A;  3I5S A;  1JQQ A;  2JMC A;  4GLM A;  3M0R A;  1M27 C;  4OMM A;  1AWW A;  2EYX A;  1OV3 A;  3TVT A;  1T0H A;  4J9H A;  1JO8 A;  2CUD A;  3VS5 A;  2LQN A;  2JW4 A;  3GBQ A;  5ECA A;  1S1N A;  2LJ1 A;  1RLQ C;  1GFD A;  1I0C A;  3LH5 A;  5GJV B;  3VS3 A;  1UDL A;  1VYT A;  3C0C A;  3TSW A;  4OMQ A;  1JXO A;  2D8H A;  2YDL A;  2MOX A;  1PWT A;  4ZNX A;  5FWB A;  4IIM A;  2DJQ A;  1WX6 A;  2DYB A;  3VRY A;  1HJD A;  3PE0 A;  2ED1 A;  2KT1 A;  2DA9 A;  3ZL7 C;  2L0A A;  1IO6 A;  1SSH A;  1WLP B;  1AWJ A;  2P4R A;  2KYB A;  1KSW A;  2FRY A;  1G83 A;  2J7I A;  1YN8 A;  1NYF A;  1K76 A;  2KRM A;  2LQW A;  2D8J A;  2C0I A;  4JJD A;  1X6G A;  1MUZ A;  5IHI A;  2DRM A;  2LMJ A;  2DF6 A;  2X3X D;  1PHT A;  1EFN A;  1UUE A;  1X43 A;  2AK5 A;  2GQI A;  1ARK A;  2RQT A;  1ZX6 A;  2GTO A;  3I9Q A;  1UHF A;  2AZV A;  2KXD A;  4AFQ C;  2JT4 A;  2RQV A;  4OMP A;  1SEM A;  2KRN A;  3RBB B;  2M51 A;  2KXC A;  2VWF A;  1VA7 A;  2J6F A;  5I11 A;  2A36 A;  1U06 A;  2JM9 A;  1AD5 A;  3NPF A;  2EBP A;  1Z9Q A;  3IQL A;  2PZ1 A;  1UHC A;  1B07 A;  1T0J A;  1N5Z A;  3VS4 A;  1NLO C;  1E6H A;  3RNJ A;  2CRE A;  1AZE A;  1W1F A;  4J9C A;  2EKH A;  2I0N A;  1X69 A;  3REB B;  2EGC A;  3EG1 A;  3I35 A;  1K4U S;  2FPD A;  2K3B A;  2ENM A;  2MIO A;  3A98 A;  2OI3 A;  2FRW A;  3EHQ A;  1X2Q A;  3M0S A;  3UA7 A;  2JM8 A;  2FEI A;  2SEM A;  5IHK A;  1RI9 A;  2JS2 A;  4AG1 C;  1XOV A;  1RLP C;  2EYW A;  2RNA A;  5IHN A;  2K79 A;  5FWC A;  2ESW A;  1GCQ C;  3NGP A;  1GCP A;  1K9A A;  4FSS A;  1PNJ A;  1M3C A;  2OJ2 A;  2RQU A;  4JZ4 A;  1PRL C;  1FMK A;  2L2P A;  2FPE A;  1YNZ A;  5HCK A;  1W6X A;  2DX1 A;  2C0T A;  2GTJ A;  3VS0 A;  2KE9 A;  1YWP A;  2CT4 A;  4DEX A;  2CUB A;  1B3Q A;  2CDT A;  1WI7 A;  2DL7 A;  2RMO A;  1E7O A;  1VYU A;  4R0K A;  4LUD A;  2LCS A;  3REA B;  1T3L A;  2G6F X;  4LE9 A;  2XMF A;  2DVJ A;  3EGU A;  2EYZ A;  4Z88 A;  1FYN A;  4JZ3 A;  2A28 A;  1OEB A;  2DIL A;  3ULR B;  3EG0 A;  1Y57 A;  1TUD A;  3H0H A;  3EG3 A;  2CH4 W;  3FJ5 A;  4JJC A;  2W10 A;  4CC2 A;  1SHG A;  2O9V A;  4IIO A;  4J9D A;  2JMA A;  2DE0 X;  2DL8 A;  4HXJ A;  1K0X A;  1BBZ A;  2RPN A;  4X1V A;  4KRT A;  2KRS A;  1PKT A;  2YSQ A;  5IXB A;  3UF4 A;  1MV3 A;  2K9G A;  2EPD A;  2KBT A;  2DBM A;  2J6K A;  2KRO A;  1GBQ A;  1UEC A;  1SRL A;  1ZUY A;  2O2O A;  5EC7 A;  1AWO A;  2JXB A;  2BZ8 A;  4HVW A;  3M0Q A;  4OML A;  2D1X A;  3M0P A;  2HEQ A;  2LZ6 B;  1BB9 A;  2NUZ A;  1Y0M A;  3CQT A;  4HVV A;  4J9G A;  2DBK A;  5FW9 A;  4DEY A;  2AKK A;  2CT3 A;  1QWF A;  3VS2 A;  1UJY A;  1WDX A;  2X3W D;  2B86 A;  4CC3 A;  2DRK A;  3I5R A;  1V1C A;  1M3B A;  2EYY A;  4RUG A;  1GL5 A;  2O88 A;  2M0Y A;  1QWE A;  5IXF A;  5GJW B;  4RTX A;  2EGA A;  2EQI A;  2ROT A;  1QKW A;  1ZSG A;  2HBW A;  2O9S A;  1U5S A;  1ZUU A;  4J9I A;  2W0Z A;  1GFC A;  4GBQ A;  2EGE A;  4EIK A;  1ZUK A;  1Z9Z A;  2RF0 A;  1OPL A;  2K7A A;  1ABO A;  1AEY A;  1H92 A;  1CKA A;  3EHR A;  3UAT A;  1H3H A;  4J9F A;  2KR3 A;  2V1Q A;  4Z89 A;  1J3T A;  2JTE A;  4E6R A;  2ABL A;  3TSZ A;  1UTI A;  4JJB A;  1NEB A;  1BK2 A;  5IH2 A;  3O5Z A;  1WFW A;  1OOT A;  3JV3 A;  4F16 A;  2CSI A;  2A37 A;  1KIK A;  1PRM C;  2VVK A;  1UGV A;  2KGT A;  2DLP A;  2LJ0 A;  2OAW A;  1NEG A;  2DMO A;  2CH4 A;  3VS7 A;  4D8K A;  1ZLM A;  2JS0 A;  1TG0 A;  1E6G A;  1CSK A;  3KFV A;  1ABQ A;  2NWM A;  2ED0 A;  4CC4 B;  1U3O A;  4K11 A;  4HCK A;  2ROL A;  2YUQ A;  2IIM A;  1NG2 A;  1JXM A;  4LN2 A;  1WA7 A;  4RTY A;  1NYG A;  1G2B A;  3THK A;  4CC7 A;  1ZBJ A;  2V1R A;  2VKN A;  4D8D A;  1GBR A;  2YUP A;  1X2K A;  2D0N A;  1T3S A;  4J9B A;  4RTT A;  1HD3 A;  2PTK A;  2YUO A;  4Z8A A;  1SRM A;  4HVU A;  2SRC A;  2KNB B;  1BU1 A;  3PVL A;  4WCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...