1AWJA

Intramolecular itk-proline complex, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
77
structure length
77
Chain Sequence
KKPLPPTPEDNRRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulatory intramolecular association in a tyrosine kinase of the Tec family.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords ITK
total genus 5
structure length 77
sequence length 77
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1awjA00
2GTOA 1NG2A 1BU1A 4GLMA 1YN8A 3PE0A 5IH2A 1KJWA 2F2WA 2OAWA 4HXJA 1MV3A 1PKSA 3I5RA 1KSWA 4CC2A 1M3AA 3EG1A 4JJCA 3REAB 2KBTA 1OV3A 1K76A 4RTUA 4ZNXA 2JM9A 1RLQC 3VS1A 3H0FA 3A98A 2E5KA 2MOXA 1AOJA 4RTYA 1AD5A 2LJ1A 1I1JA 1JO8A 4LUEA 1MV0B 2O88A 1HJDA 2KXCA 4D8DA 1GCQC 3ULRB 1B3QA 1V1CA 1QKXA 4HCKA 2CT3A 2RQTA 4RUGA 2EKHA 2DL3A 2J7IA 3EGUA 1SHGA 2JMCA 1TG0A 4OMQA 1ABQA 4ESRA 4LUDA 3ZL7C 1AWWA 4A63B 1QKWA 1X43A 3M0SA 2F2VA 1K0XA 1NYFA 4OMPA 1X69A 3VS7A 1QCFA 1TUDA 1VA7A 2LQNA 2FO0A 1ZUKA 1MUZA 1OPLA 4HVUA 2RQRA 3UA7A 1H92A 1GCPA 2J6KA 2EGAA 1T0JA 4FSSA 1JQQA 2EGCA 2J6OA 2MCNA 2L3SA 3I35A 1OEBA 1ZSGA 1AZEA 3LH5A 1NLPC 2EGEA 1M8MA 2KT8A 5GJVB 1UHCA 2EQIA 4JJDA 2DL7A 4J9BA 4EIKA 2D8JA 4JZ4A 2KXDA 2LQWA 2KNBB 1SSHA 1UTIA 4J9EA 5IHKA 4GBQA 1U3OA 1M27C 2K2MA 2LMJA 4OMLA 1E6GA 2DL4A 2SRCA 1YNZA 2GGRA 1AVZC 1PKTA 1B07A 2BZYA 5FWBA 3EG0A 2YUQA 3QWYA 3UA6A 2JTEA 2EPDA 3THKA 1SPKA 4CC3A 2KRSA 3NHNA 1UUEA 2EYZA 4J9DA 2CT4A 1PNJA 3M0TA 2IIMA 3EHRA 3QWXX 1X6GA 2GTJA 1UHFA 4OMMA 2YSQA 1Z9ZA 4CC7A 5ECAA 1W70A 1G83A 2JS0A 2BZ8A 1M3BA 3I5SA 1GBQA 1RI9A 2LP5A 2KT1A 5I11A 5FWCA 1K0SA 1JXOA 2C0IA 1CSKA 1NLOC 2K9GA 4RTVA 2ROLA 3TSZA 4CC4B 4AG1C 4RTXA 3FJ5A 4RTZA 2PTKA 3M0QA 4LN2A 1FYNA 1YP5A 1Y0MA 3UATA 1SHFA 3M0UA 1UG1A 1KIKA 4AG2C 4Y92A 1U06A 1X27A 2AKKA 2KE9A 4HVVA 2JS2A 1Y57A 2L2PA 2A28A 1H8KA 2DF6A 4F17A 4DEYA 1PWTA 2M51A 2CSQA 2LX7A 2ENMA 1HSQA 1QWEA 5IHNA 2X3WD 3VRYA 3H0HA 4RTTA 2FPEA 2YUPA 3REBB 2RNAA 3U23A 1NEBA 1BB9A 1ZBJA 2I0NA 2DL8A 1M3CA 2V1RA 3PVLA 4AFSC 2CUBA 1CKBA 2GBQA 2JMAA 2LNHB 1EFNA 2SEMA 2FPDA 4F14A 2OI3A 1ARKA 3I9QA 1GL5A 2DYBA 2LCSA 2LJ0A 3R6NA 2LZ6B 5FW9A 3M0PA 1WLPB 2EVRA 3SEMA 2DBKA 2CSIA 5IXFA 2HCKA 2ECZA 1KFZA 4QT7A 2P4RA 2RN8A 2AZSA 1AEYA 3NMZC 2RMOA 3O5ZA 2JW4A 2VWFA 3VS5A 2ROTA 2CH4W 1ZUYA 2J06A 4R0KA 4Z88A 2G6FX 1WIEA 1Z9QA 2O31A 2V1QA 2HSPA 1JEGA 2PNIA 3JV3A 1BK2A 1WXTA 3VS4A 3H0IA 3RNJA 2DLPA 4LNPA 2K6DA 2J05A 2JXBA 2D8HA 2JM8A 4J9GA 2RQVA 4RTWA 1X2QA 2M0YA 2FRWA 2D1XA 2EW3A 1LCKA 2K79A 4X1VA 1UDLA 2W0ZA 3TSWA 2CREA 2PZ1A 2DNUA 2VVKA 1SRLA 1YCSB 2A37A 2JT4A 2QDLA 1W1FA 4Z89A 1QWFA 2KYBA 2AK5A 2KEAA 4D8KA 4IIMA 2RQUA 1GFDA 3NPFA 1IO6A 4JZ3A 5IXBA 4IIOA 1GFCA 2FPFA 2ESWA 3VS6A 1J3TA 2DJQA 1K1ZA 2NWMA 1CKAA 1I07A 2KROA 4OMNA 2EYWA 1WDXA 4JPBW 1PRMC 3VS2A 1A0NB 1AWXA 2DA9A 2EYXA 4K11A 3GBQA 1AWJA 1GCQA 1WI7A 2YUNA 1UJ0A 1UE9A 1AWOA 2HDAA 3UF4A 5EC7A 2L3PA 3IQLA 1RLPC 1BBZA 4LE9A 2ED0A 1M30A 2RF0A 1ZUUA 2RQWA 3H41A 1E6HA 4OMOA 2HEQA 2H8HA 4HVWA 2C0TA 2KRNA 5IHIA 3SHWA 1GBRA 1ZLMA 2GNCA 1WFWA 3EG3A 2CH4A 1OOTA 2ABLA 2KGTA 1PRLC 4JJBA 2KRMA 1JU5C 5GJWB 1OPKA 2F2XA 2NUZA 1N5ZA 4Z8AA 4J9IA 5HCKA 1X2KA 1FMKA 2DM1A 3CQTA 4F16A 1WXBA 1WA7A 2DRKA 2C0OA 2KYMA 1WX6A 2EYYA 1RUWA 4E6RA 2AZVA 1UECA 3C0CA 2AKLA 4AFUC 2EBPA 4DEXA 4AFQC 3NGPA 3VS0A 2DVJA 2CDTA 3PVQA 2O9SA 4WCIA 2YT6A 2A36A 1NM7A 1H3HA 2YUOA 1PHTA 3EG2A 1HD3A 1K4US 4AFZC 2X3XD 2RPNA 2B86A 1NYGA 1VYTA 2DL5A 2BTTA 2O9VA 1WXUA 1VYUA 2ED1A 1SEMA 1JXMA 1QLYA 2D0NA 2K7AA 2A08A 1G2BA 1WYXA 2YDLA 3VS3A 1UGVA 2O2OA 4M4ZA 5L23A 2DE0X 2BZXA 2CUDA 2DBMA 3KFVA 1XOVA 2MIOA 4J9FA 2L3QA 1U5SA 2FG0A 1VYVA 2OJ2A 1YWOA 2K3BA 2DMOA 3TVTA 2HBWA 2GQIA 1UJYA 3M0RA 1ZX6A 1S1NA 4J9CA 1SRMA 2DX1A 2VKNA 4J9HA 1X6BA 1T3SA 1K9AA 1YWPA 1UFFA 2DRMA 5I22A 1AZGB 2FEIA 4KRTA 1T0HA 2KR3A 1I0CA 2J6FA 2W10A 3EHQA 1T3LA 1ABOA 2LJ3A 1TUCA 4ORZA 1NEGA 3RBBB 3VRZA 2XMFA 1GRIA 1W6XA 2DILA 2L0AA 1E7OA 2FRYA
chains in the Genus database with same CATH superfamily
1BU1A 3CMET 1BYMA 3QXEB 4CC2A 5C6SA 1ZQ1A 4PL6A 4C92F 2YRVA 1OZ3A 2VASA 3SWNA 4RTUA 3BW1A 1RLQC 3MEUA 2IVWA 3OS2A 3A98A 2E5KA 1QQJA 1YI2T 3UDCA 1GCQC 4OF1A 1B3QA 1G8XA 3CBPA 3CCJT 2RM4A 1VQ7T 2ZGWA 4RUGA 2QXFA 2EKHA 4DA4A 2OTLT 2JMCA 4LUDA 3WXMB 8AT1B 2FZKB 3S6WA 3HL8A 2XU8A 3SWNB 3A5ZB 4M75A 4OMPA 1M2VA 1QCFA 3OYEA 4M78B 4B9XA 2LQNA 4M7AB 1I5LA 3OB9A 1NJIR 3HKSA 3JB9D 1VQNT 2EGCA 3MPUB 2MCNA 1MNDA 1QVGA 3FJPA 5DLOA 2RHZA 5GANd 4ANJA 1M8MA 2DPPB 3OYMA 4JDSA 3OSSC 5GAMf 3CCVQ 4JJDA 5LJ5f 4EIKA 3EFSA 3G71T 4M7DB 5FLXE 1OI1A 2YHTA 5FRNA 1H641 1X6OA 1PG5B 4IUQA 1BIBA 2KNBB 1SSHA 4M77F 3G4SQ 1OU8A 1YJNA 4GBQA 4ELYC 2F1LA 2HNIA 3JCMb 1Q82C 1YIJT 3RDVA 4D6WA 2DL4A 3EG9A 1TS9A 1UGPB 2BZYA 3EG0A 5I2MA 1XTDA 4HT8A 3THKA 1SPKA 1N8RC 1G3WA 4CC3A 2KRSA 3NHNA 2V26A 2EYZA 4J9DA 4M75D 5GANe 1Q7YR 1YIJA 1M1GA 1N9SA 2HAXA 3HFOA 3M0TA 2FZCB 3G1JA 4PJMA 3QWXX 4M78G 1X6GA 3I56Q 1HYOA 3MJXA 4OMMA 4C0DC 4CC7A 1G83A 4FL6A 2JS0A 5J39A 4HCCA 2D0QB 2KT1A 1VQ7Q 5I11A 2ZZDA 1XNIA 1K0SA 2LTOA 1NLOC 4RG8A 3PIOA 4RTVA 3JCMV 4LD9K 1D1AA 1RL2A 1VQOA 2CKKA 4TVRA 3JCMh 2EJFA 2VGMA 1UG1A 1KIKA 1IREB 1WQWA 2DZ9A 1M8VA 3G6EA 5LJ3g 2F69A 4LD6A 4FYXB 5CVIA 2E6NA 3CCEA 2KDSA 4N4GA 4E47A 3CMAT 2YUPA 3M4YA 3O8VA 4KH1B 1K9MU 3U23A 1BB9A 2V1RA 4AFSC 1VQLA 3PVLA 2QA4T 4QVDA 3UT1A 2R5AA 2LNHB 1EFNA 2RHUA 2SEMA 5GMKl 2YLCA 9ATCB 1IRXA 1ARKA 3CCQA 2QA4A 3V7RA 4OMFB 2LJ0A 4FYWB 1VQ8T 4M7AA 2LZ6B 1TH7A 3A8LB 1IXDA 4PK4A 2EVRA 3DB3A 4F7UF 2X4JA 4QQGA 1LNXA 4B9WA 4MZPA 3CXCA 3NMZC 2RMOA 3S3OA 2J06A 5FU6B 3OA6A 1WIEA 2LCLA 2WACA 4JS5A 1MNEA 4XU1A 1W2BS 3H0IA 1RI0A 2DLPA 1NBEB 2K6DA 1C0MA 4PFZA 3CC4T 1WHJA 2DKGA 4NOYA 4J9GA 3GLXA 1UGQB 3CCUQ 3E19A 2FRWA 2MWOA 4KGZB 4MZMA 2EW3A 4XU3A 3AHUA 1UDLA 2W0ZA 3JCMW 5GAMh 5GAMd 2COWA 2LRQA 3V8KA 2DTOA 4MDWA 2DTHA 3RKYA 4WTOB 4Z89A 2KYBA 4M7DC 2KEAA 4R55A 1GFDA 4JZ3A 4C5HA 1IHWA 4IUUA 2EYQA 2DJQA 2JJ9A 3JCMX 1WJRA 5GAOm 2NWMA 3R6OA 1M5Q1 2KROA 4OMNA 3JB9J 4AMCA 4JPBW 4EMKB 1PRMC 1KC8R 2DTIA 3QYGB 2DA9A 2M16A 3G71A 4RG2A 3CCVA 2EYXA 4K11A 1UE9A 5M9OA 3C4SA 1M90R 2V8JA 1PD0A 3M57A 3OQ5A 2P0KA 2IPOB 4A54A 1VIFA 1SF9A 1ZUUA 5D7UA 2H8HA 2QGGA 3MHXA 4HVWA 2C0TA 3OYBA 1GBRA 1VQLQ 4II1A 4C5GA 5KYYA 1VQKT 4DQ2A 2R58A 3EG3A 3MCAB 2CH4A 1KQSP 2KGTA 2FB7A 1FMWA 2NUZA 4Z8AA 4A53A 4IUTA 1VQKA 5HCKA 1KK7A 3L2ZA 3X26B 3QHSA 1X2KA 3GIBA 3QKJA 4C8QC 1K73U 1WX6A 1QCNA 1WNLA 2FVUA 4E7KA 1UECA 4AFUC 4OP0A 1R0BG 1RABB 1R0CB 5FU7B 2CDTA 3PVQA 2O9SA 3PGGA 4WCIA 3CCQQ 4PFOA 2YUOA 1RAEB 1TXQA 3CMAQ 1PHTA 5J3BA 4QQDA 3JAME 1K4US 3A1PA 2X3XD 3QZ5B 2RPNA 4X9CA 2B86A 3PNWC 4J6XA 3CC2A 2CP2A 3OMGA 4C0GA 4YTLA 3OYFA 1VQPA 1D0XA 3OYHA 2DJZA 2RK2A 4F7UB 2EQMA 3CC7Q 4KBMB 1M2OA 2ED1A 2MAMA 1QLYA 1VQNA 2JZ2A 1EIFA 2CP3A 2O2OA 1I8FA 5A0GA 4PJOA 2DE0X 4OGCA 1Q95G 2OX7A 2MIOA 5KCHA 4C5EA 1VYVA 2OJ2A 1YWOA 1VQ6A 2K3BA 4PJNA 5KCOA 3CCMA 3VU3C 4M7AG 1X6BA 4F7UE 1SSFA 5KE2A 1UFFA 3Q1JA 5I22A 1MMGA 2L5QA 2KR3A 1KC8U 4EMKA 1PSEA 3VYGA 1Y7XA 2J6FA 1LOJA 3CCJA 1C1AA 4C8QD 1TUCA 4KULA 2COYA 3VRZA 3EFRA 3CPWS 4CRIA 1W6XA 1LVKA 3LGFA 1JBMA 2FRYA 3CCSA 2PVDB 4BY6B 2GTOA 1Y96B 1YN8A 1KJWA 2QEXT 5I21A 1X01A 1D0ZA 1PKSA 2QDYB 1M3AA 3EG1A 3CCLA 1F1BB 3KXTA 3REAB 1IB8A 2KBTA 2C06A 1OV3A 1K76A 4RKUE 4IKFA 1MMAA 4Z02A 2JM9A 3JCMJ 2V8IA 4OGEA 4Y28E 2CP5A 1AOJA 4RTYA 1AD5A 2LJ1A 1MV0B 3VJPA 2E1HA 4E7SA 3ULRB 2ZAEA 3E9GA 1QKXA 4C92E 1VOMA 4O5VA 1M90U 1YJ9T 2RQTA 3EH1A 3L42A 2X51A 3EGUA 3TU4K 1SHGA 2RI5A 5J26A 3NTKA 4FSXA 4PJLA 2MF2A 2QQRA 3CCEQ 3M0SA 5DY9A 3VS7A 1Q86R 4N0AC 4C92B 3CEYA 1VA7A 1RADB 4MMLA 3RESA 1MUZA 4HVUA 3UA7A 3KUFA 1Q81R 2JN0A 2J6KA 2I2LA 3UPUA 1OEBA 1AZEA 3OYAA 3LH5A 3QBYA 1NLPC 2KSSA 3GNFB 3OYKA 4C8QG 2MYSA 2AHJB 3E1SA 4XU0A 3QSUA 3OMCA 1Y07A 2QQ9A 4BE0A 3OW2S 2MI6A 3QDRB 2JNGA 3OBYA 2JTFA 2KXDA 5GAOr 4PJOD 2XK0A 2P0PA 1UTIA 4J9EA 1VQ4T 1KD1C 2DXBA 3OSVA 5D6XA 3RMQA 2LMJA 4JRIA 1BI1A 4M7DF 1AVZC 1PKTA 1B07A 5FWBA 3QWYA 2YUQA 2LC4A 4M7DD 1PM3A 2QQBA 2B8AA 2ZPHB 2NUPB 1UUEA 3EFOA 2IIMA 4FIBA 3I55A 4JUVA 2GQVA 2YSQA 4IUVA 3CCLT 2EIFA 1M3BA 2AIRB 1GBQA 2DO3A 2LCCA 2EAYA 3H6ZA 1JXOA 2C0IA 1I81A 4XTVA 3FJ5A 4RTZA 3TCJA 3QUIA 4LN2A 3M5AA 1FYNA 5KYUB 4M7AC 3UATA 4Q5WA 2EQUA 2JS2A 1Y57A 1VQ5T 4HT9A 3PIPA 4M78A 4C92A 4XTZA 3X24B 4DEYA 2L8DA 1PWTA 1M2VB 4PJOG 5CQYA 1QWEA 3MP1A 4BACA 2E3IA 2X3WD 3VRYA 1V76A 4NS5A 2K5IA 2RNAA 2VUBA 1NEBA 3FRNA 4HA8A 2IG0A 3OYCA 2JMAA 4BE2A 4QQ6A 2FPDA 3PT9A 1IGUA 3D7SB 1WPYA 2DYBA 2DXUA 3SDZA 5CKBA 3JCMP 1NJIU 3R6NA 2VXFA 2RJDA 2VYTA 3CCQT 1BI3A 2K3YA 4QVCA 1OYXA 4C5IA 4EMHA 3MKDA 3SEMA 2FL7A 4M75F 1YJNT 4QT7A 1AEYA 1VQ6Q 2JW4A 1NE8A 5GAN8 2VWFA 3BY7A 2ROTA 1VQ5A 4R0KA 5GAN5 2RJEA 1VQ9A 3NTIA 4PJOB 2PNIA 1BK2A 5C0MA 1Q82R 4EDUA 3A8MB 3HRUA 2J05A 3F70A 3OYLA 4M75C 3A8HB 2P84A 2JXBA 1N8RR 2JM8A 1X2QA 4ELZC 3RERA 3OYNA 1QMCA 5LJ3f 1VQ7A 3G4SA 1TUGB 3TSWA 3I55T 2CP7A 1VQ6T 1YCSB 2JT4A 4E7HA 3FC3A 5CO7A 1WGSA 5L8RE 8ATCB 5GMKm 2HL3A 2RD1A 1QWFA 2JUFA 1JRIA 1VQMT 3FEOA 5GAN6 1G3SA 4D8KA 3JCMQ 2VV5A 4M77C 2K5FA 1GFCA 3SWNC 2FPFA 1N6AA 1M1KU 2PUOB 2DD4A 1K1ZA 2GFAA 1OQKA 2YWWA 1A0NB 1AWXA 4F7UG 3CCVT 3CCMQ 1AWJA 1PCXA 1WI7A 2RI2A 2YUNA 1AWOA 3UF4A 5GMKi 4FT2A 1G3YA 4KH0B 2L3PA 1BBZA 2DFUA 2XHCA 5LJ5g 4PKCC 2NUTB 2ED0A 3MEWA 4OMOA 5LJ3h 7AT1B 5IHIA 4XK8E 3FLGA 2RA2A 2XI9A 3JSCA 2XDDA 2RI3A 3DLLA 4M77A 2ABLA 1PRLC 4JJBA 1KQ2A 1JU5C 2ZCFB 5GJWB 2QYZA 3BFMA 1N5ZA 5GAN2 5GAMg 2LX9A 2QQAA 3M59A 1FMKA 2DM1A 4FT4A 4F04B 5AYFA 4PJJA 1WA7A 2C0OA 4LDXA 1KHCA 1Q86C 3CCLQ 4M77E 1S72Q 3M56A 3PMIA 2HQEA 3RR6A 4DEXA 1Q81C 5GAOl 3NGPA 4E7JA 2HMAA 3OY9A 4LXCA 1Q7YC 3CXCS 1K73C 2H3JA 3HSBA 3JB9I 1H3HA 3EG2A 1HD3A 2QEXA 4FM4B 1MGQA 3L2QA 1NYGA 4P5NA 1VQ4Q 4XQ3A 1VUBA 3CBMA 3LGLA 1VYTA 2DL5A 3KBGA 2E65A 4L6V5 1VYUA 5KYXA 1VQOQ 4M75E 1K8AU 2HD0A 5GANj 2DD5A 2D6FA 1SEMA 3HRTA 2K7AA 3S3MA 2A08A 2LQ8A 3T9NA 1UB4A 3PFSA 3HP9A 1R77A 2JVVA 2CUDA 1YI2Q 1XOVA 1YFNA 4J9FA 3CCUT 2CP0A 2HBWA 2VC8A 2GQIA 1ZX6A 1SRMA 2VKNA 4J9HA 1T3SA 4J5YA 1K9AA 4KT0E 2XG8D 1TU0B 3JCMe 2CS7A 1JJ2P 4X34A 3OYYA 3ZFJA 1T0HA 4KUDK 3V8JA 1VQ9T 1AT1B 1M90C 3CC4A 3P8DA 4JLIA 4OB3B 2E4HA 1NEGA 5LL6S 3CCUA 2DEUA 5HKCA 3V7SA 1DJ7B 2Z0WA 4E2FB 3VV0A 1NG2A 3MEAA 2MK5A 4GLMA 3ASKA 3PE0A 5IH2A 3NTHA 5I2SA 1FWZA 3M55A 1KSWA 3TEEA 2EJGA 1WQ7A 1RACB 1RAAB 1B34B 2RB6A 3UWNA 2QQSA 1MMNA 4FU6A 1IZ6A 3H0FA 3VS1A 2M9UA 1YHQQ 4LDWA 1JO8A 2Y90A 2BE7D 2KXCA 4D8DA 1N9RA 4WF2A 1WZOA 1Q82U 1V1CA 2BUDA 2YLBA 5GANg 1Y96A 4L5GA 2QA4Q 4BDYA 1K9MR 3CCSQ 1NPRA 1ABQA 4ESRA 3ZL7C 4A63B 3M54A 4PLLA 4A4KA 4M77B 5CAIA 3CCMT 2F2VA 4ZN3A 2RJFA 1X69A 1TUDA 2E41A 2HQXA 1QVGS 5HK3A 1SKUB 4A4HA 2FO0A 1OPLA 1H92A 2K2VA 1GCPA 4V2SA 3FIFA 2L3SA 1ZSGA 4E7IA 2DXTA 3QJYA 2HL5C 5EG2A 2K5LA 3HRSA 2D8JA 2VXEA 3J80E 1KC8C 3LLRA 3I55Q 1JB0E 3GNGA 4DOWA 3JCMd 1M27C 2BIVA 2K2MA 4OMLA 1E6GA 1MHNA 1YNZA 5KE3A 3MEVA 2GGRA 3UA6A 1VQ4A 4L59A 2CP6A 5LJ5j 1TWBA 2CT4A 2QI2A 2L3RA 4C8QA 2JTMA 3EHRA 2NYSA 5GAN4 1UHFA 1Z9ZA 1VQMA 5ECAA 4EMGA 2XKOC 3OYDA 4ZN1A 2BZ8A 4HKEA 3DLMA 4J6WA 4JRPA 4M78E 3L2UA 2QASA 4M7AE 3A8GB 1CSKA 2K9GA 5D6YA 3MP6A 3LH0A 4RTXA 4FW1A 2VB6A 2PTKA 1O75A 3INZA 4JJNK 4M7DG 1HK9A 1QCOA 1Y0MA 1SHFA 3M0UA 5LJ3e 4AG2C 4Y92A 4HVVA 2KE9A 1K9MC 2L2PA 2A28A 4C8QE 3LW5E 4F17A 2CZ7B 2M51A 2ZPIB 2CSQA 2LX7A 2ENMA 1HSQA 2DAQA 1Y71A 3ME9A 3URGA 1H3ZA 3VUZA 4QVZA 4E7ZA 3H0HA 4RTTA 2DXCA 2FPEA 4PJOF 1VQ8A 1VQKQ 1U1TA 1M3CA 5CR2A 2HQHA 3X28B 1CKBA 4C8QB 1V29B 2GBQA 4M77D 4PFPA 4XTYA 2RH2A 3X25B 1K8AC 1GL5A 2CYZB 2X35A 4AT1B 2E12A 2DIQA 5FW9A 4PJOE 5A0LA 2NLUA 3M0PA 1WJQA 4MMKA 4C0FA 1VQPQ 3G7ZA 2DBKA 3EGXA 2HCKA 2ECZA 5KYNA 2CZ6B 2RN8A 1TTHB 2WSEE 2QTVA 3O5ZA 4XU2A 3CMEA 3G6ET 3X20B 4M75G 4NL2A 2RHIA 4Z88A 1WHMA 3SB2A 2G6FX 3CPFA 2O31A 5LJ5h 4DBHA 2HSPA 3NFCA 3JV3A 1P92A 1D3BB 1WXTA 5D6WA 2H3EB 3VS4A 1U1SA 1W4SA 3CD6Q 2K57A 4EMKC 4R56A 2Y4XA 4M7AF 2X4YA 3RKWA 4ZGJB 1U8RA 3QYHB 2RQVA 2O4XB 1W2BA 3VKIA 2D1XA 1D09B 5KYUA 1G3TA 1LCKA 2GCXA 2DIGA 2KMTA 2CREA 2PZ1A 2VVKA 1SRLA 1Q7YU 1BI2A 3N5BB 5CKEA 2G3RA 5LJ5d 2QDLA 1RAGB 2M1HA 1S72T 2HBPA 3DB4A 5GMKe 4ZGEB 2JOYA 1QVFS 1YJ9A 2OAUA 1IO6A 3P8HA 2CGHA 5IXBA 4IIOA 3LWHA 1TOVA 2PQWA 2ESWA 2V8KA 3VS6A 3EGDB 2E64A 4HCBA 4RCCA 2EYWA 3VS2A 3CMAA 1YJ9Q 1OULA 2MPXC 2NUPA 2LT1A 2KK4A 2RHXA 3GBQA 1YBYA 1GCQA 2RHYA 5KH6A 1W2BP 4J83A 3IQLA 1RLPC 3GPLA 1M1KC 3SD4A 5FU6C 3META 4M78D 2RQWA 4LDVA 3H41A 1E6HA 4PLIA 2HEQA 3JRZA 2MMPA 2KRNA 3SHWA 1BI0A 3RIRA 1ZLMA 3VUBA 2GNCA 2ATCB 2GF7A 2VGNA 1B34A 1WFWA 3OYIA 2EFIA 2F5TX 3JCMf 1OPKA 4B6MA 3G6EQ 1JJ2A 4C8QF 1YITT 2E10A 2HSEB 1QVFA 2OTJT 2LT4A 4F16A 3C94A 1WHGA 4E6RA 2O4XA 3AT1B 2AZVA 1FMVA 2ZPEB 4M78F 4ME7A 3BE3A 5GANh 2E6ZA 3VS0A 4M75B 1OZ2A 2EJ9A 1EX4A 5KYWB 2A36A 1RAHB 3H9NA 1QP3A 3CC2T 2P4TA 4JS4A 2XIDA 4JLGA 3C95A 4E7LA 2PUKB 4GLKA 2XDBA 2XDPA 1ZA1B 3CD6A 1JXMA 2D0NA 6AT1B 1RAIB 2YDLA 1YIJQ 3VS3A 1UGVA 1WHHA 3OYJA 2OTJA 4KGVB 5L23A 1TSFA 2BZXA 2DBMA 2RK1A 2L3QA 3CC7T 2FG0A 2HKQB 2FHDA 2DMOA 4UC4A 1S1NA 3RKXA 4A4FA 4DOVA 4N0AA 4DBQA 2DVEA 3S3NA 1AZGB 2FEIA 2PVGB 4RMOA 1YITA 1ZBXA 2LVMA 3EHQA 1T3LA 4FYVB 1WHKA 3TREA 2LJ3A 4XTUA 4QW2A 1MMDA 3JCMc 1AHJB 4XTXA 4BI4A 3RBBB 1YI2A 3CC7A 1D3BA 2EQKA 1K73R 2P0QA 3P8BB 1GRIA 2PVOB 2CZ0B 2DILA 4FW2A 2QAZA 2COZA 1VQ8Q 2F2WA 2OAWA 4HXJA 5IN1A 1MV3A 3I5RA 4JJCA 3GP8A 4F7UA 4ZNXA 1EZZB 2KY9A 2PU9B 4BY6C 2DERA 1BIAA 1S72A 2MOXA 1WHLA 1XQHA 1G5VA 1YCYA 3JCMg 1I1JA 4LUEA 5GMKj 2FYKA 2O88A 1HJDA 4MZTA 1O9SA 4MDXA 3M9QA 3EAEA 3QPHA 3HHTB 3LYIA 4HCKA 2CT3A 2LQKA 2DL3A 2J7IA 3HFNA 1TG0A 4OMQA 4DBFA 2DYIA 1PC0A 1AWWA 2HZYA 3BDUA 3OW2A 1QKWA 1X43A 1PSFA 1K0XA 2X4WA 1NYFA 1VQMQ 2OTJQ 3M4GA 2MWPA 3LX7A 1ZUKA 2RQRA 3J7AF 2EGAA 1T0JA 4IURA 4FSSA 1JQQA 2X4XA 3SFMA 2J6OA 3I35A 4M78C 3QIIA 2YXYA 2EGEA 2KT8A 5CIUA 1UHCA 2EQIA 5GJVB 1X75C 1KD1U 2QTXA 3J81E 2E70A 4PNOA 2DL7A 4J9BA 2BE9B 3CCRT 5CKDA 3CPWP 3V8LA 4JZ4A 1YJWT 1OU9A 3OBWA 1KQSS 2HKNA 2LQWA 1YITQ 2AT1B 1BCMA 5IHKA 3OW2P 1IGQA 2ZPFB 1U3OA 4N4IA 1N27A 2ZPGB 3OS5A 1UGSB 5GAOp 2SRCA 2EWNA 1JJ2S 1RAFB 3OS1A 3RMSA 3VYHB 5CKFA 2JTEA 2EPDA 1YJNQ 4JRKA 1QP2A 1PNJA 2YRCA 2EKOA 1WJSA 4LDUA 1QW1A 1QVGP 3CCET 4ZTFA 2XICA 3A8OB 2GTJA 3G4ST 1W70A 1C6VX 1N8RU 2M0OA 3I5SA 3BDLA 1RI9A 2LP5A 1YJWQ 1NZ9A 3CPWA 1NPPA 3CCRA 3V7CA 3QDFA 1ZHIA 2M02A 5FWCA 5CKHA 3FB9A 5GAN3 5KYXB 2ROLA 3TSZA 3ZEHA 4CC4B 4AG1C 4J8OA 3M0QA 1YP5A 4CI0C 1Q81U 1VQNQ 1U06A 1X27A 2AKKA 4M77G 2OTLQ 5CQXA 4BD3A 4BUGA 1H8KA 2DF6A 5KYWA 1VQOT 2L89A 1Q86U 2XD0A 2RO0A 2KI7A 4VUBA 5A0DA 3CMEQ 4FCYA 4BB7A 5IHNA 4BI3A 2KVQG 5A2QE 3REBB 4EPCA 1ZBJA 2DL8A 2KQWA 2I0NA 5LJ5e 3L2WA 1QVPA 2CUBA 4XTWA 5GAMj 3EFOB 3GF5A 3JB9G 2ZPBB 4F14A 2OI3A 2K4YA 3I9QA 5CK9A 2Y4YA 2LCSA 3LWIA 3OS0A 4HCZA 1OX9A 3PTAA 4OB0B 4XAXB 1KQ1A 4C0DB 5LJ3d 3JB9F 1WLPB 1D0YA 3PMTA 2CSIA 5IXFA 1UGRB 1LJOA 3L1AA 5GAMe 5GANf 1KFZA 2P4RA 2AZSA 4PJOC 2WSFE 1OX8A 3VS5A 2CH4W 1ZUYA 1NJIC 4BI8B 4JRQA 2V1QA 1Z9QA 1JEGA 3H8ZA 2R5MA 2X9HA 5FRMA 4C0ZA 5IT9E 1I5OB 3RNJA 5HK0A 4LNPA 3CC4Q 2RJCA 5FU7C 2D8HA 4RTWA 1QVFP 2M0YA 4KUIA 4DBRA 3WVEB 2K79A 4X1VA 5GAN7 3G71Q 2DNUA 2A3LA 4J6YA 2E5QA 2A37A 4ATOA 3CXCP 5FROA 2LDMA 2OTLA 1W1FA 1D1BA 2AK5A 4BDZA 2A0FB 4IIMA 2R57A 2RQUA 5GMKh 3NPFA 1VQ9Q 3GOXA 4KGXB 3EGXB 5IAYA 1J3TA 2CZ1B 2FZGB 4NL3A 1I4K1 1CKAA 1I07A 1HXDA 1WDXA 2EQJA 4BE1A 4O6JA 1YJWA 3HTRA 3CBOA 1UEBA 4LDYA 1FX7A 3CC2Q 4X9DA 1UJ0A 2HDAA 1KD1R 3E2UA 3MP8A 5EC7A 4QKUA 4LE9A 1B7TA 4A4GA 5GAOn 4C92D 1M30A 2RF0A 2LNVA 3MO8A 3QZ9B 1PD1A 1IHVA 2QK0A 1LPLA 1K8AR 3M53A 5KYYB 1OOTA 3OYGA 2DEQA 3TQ7P 2KRMA 2F2XA 1BCOA 4OB1B 4A4EA 4J9IA 4OVAA 4GY5A 2E3HA 1ACMB 1BKBA 3CQTA 1WXBA 3EG9B 2DRKA 2YRDA 2KYMA 2EYYA 1RUWA 3EH2A 1D1CA 3QO3A 1ZSZC 3WVDB 3C12A 4ZTJA 5LJ3j 2DK3A 3C0CA 2AKLA 2EBPA 2D9TA 4AFQC 4M7DA 1GXIE 4IUPA 2DVJA 3ZBDA 3JB9H 3I56A 1YHQA 5HY6A 2BKDN 4FYYB 2K3XA 2YT6A 1NM7A 1KQSA 1YHQT 3I56T 2QG9B 3QJ6A 1FXXA 4AFZC 3L2VA 4M7AD 3CCST 1KG1A 3ER0A 4C92C 2O9VA 1WXUA 1R8OB 4M7DE 3EGDA 2F5KA 2KAFA 4ZGDB 3CCRQ 1G2BA 1WYXA 1ZSZA 3L2RA 1M9SA 4M4ZA 3QG1A 2DETA 3KFVA 4RCBA 4C92G 1M4ZA 1VQLT 5CCAA 1U5SA 1XJWB 2DZCA 1VIEA 2QGFB 5DLQE 3TVTA 2NUTA 1UJYA 3RUXA 3M0RA 1VQ5Q 4J9CA 3CCJQ 4J7FA 2DX1A 4OB2B 1M1FA 1YWPA 2DRMA 1KHIA 3FDRA 3M58A 5DM7R 2QEXQ 4KRTA 1I0CA 2O01E 2WSCE 1ZA2B 3HPWA 2W10A 1ZSZB 4N4HA 5AT1B 1ABOA 1M1KR 3CD6T 2A7YA 1SG5A 4J7IA 4ORZA 2XMFA 3DKMA 5GAOq 4Y91A 1VQPT 2GFUA 2L0AA 1E7OA 2BTTA 3E9FA
chains in the Genus database with same CATH topology
2GTOA 1NG2A 1BU1A 4GLMA 1YN8A 3PE0A 5IH2A 1KJWA 2F2WA 2OAWA 4HXJA 1MV3A 1PKSA 3I5RA 1KSWA 4CC2A 1M3AA 3EG1A 4JJCA 3REAB 2KBTA 1OV3A 1K76A 4RTUA 4ZNXA 2JM9A 1RLQC 3VS1A 3H0FA 3A98A 2E5KA 2MOXA 1AOJA 4RTYA 1AD5A 2LJ1A 1I1JA 1JO8A 4LUEA 1MV0B 2O88A 1HJDA 2KXCA 4D8DA 1GCQC 3ULRB 1B3QA 1V1CA 1QKXA 4HCKA 2CT3A 2RQTA 4RUGA 2EKHA 2DL3A 2J7IA 3EGUA 1SHGA 2JMCA 1TG0A 4OMQA 1ABQA 4ESRA 4LUDA 3ZL7C 1AWWA 4A63B 1QKWA 1X43A 3M0SA 2F2VA 1K0XA 1NYFA 4OMPA 1X69A 3VS7A 1QCFA 1TUDA 1VA7A 2LQNA 2FO0A 1ZUKA 1MUZA 1OPLA 4HVUA 2RQRA 3UA7A 1H92A 1GCPA 2J6KA 2EGAA 1T0JA 4FSSA 1JQQA 2EGCA 2J6OA 2MCNA 2L3SA 3I35A 1OEBA 1ZSGA 1AZEA 3LH5A 1NLPC 2EGEA 1M8MA 2KT8A 5GJVB 1UHCA 2EQIA 4JJDA 2DL7A 4J9BA 4EIKA 2D8JA 4JZ4A 2KXDA 2LQWA 2KNBB 1SSHA 1UTIA 4J9EA 5IHKA 4GBQA 1U3OA 1M27C 2K2MA 2LMJA 4OMLA 1E6GA 2DL4A 2SRCA 1YNZA 2GGRA 1AVZC 1PKTA 1B07A 2BZYA 5FWBA 3EG0A 2YUQA 3QWYA 3UA6A 2JTEA 2EPDA 3THKA 1SPKA 4CC3A 2KRSA 3NHNA 1UUEA 2EYZA 4J9DA 2CT4A 1PNJA 3M0TA 2IIMA 3EHRA 3QWXX 1X6GA 2GTJA 1UHFA 4OMMA 2YSQA 1Z9ZA 4CC7A 5ECAA 1W70A 1G83A 2JS0A 2BZ8A 1M3BA 3I5SA 1GBQA 1RI9A 2LP5A 2KT1A 5I11A 5FWCA 1K0SA 1JXOA 2C0IA 1CSKA 1NLOC 2K9GA 4RTVA 2ROLA 3TSZA 4CC4B 4AG1C 4RTXA 3FJ5A 4RTZA 2PTKA 3M0QA 4LN2A 1FYNA 1YP5A 1Y0MA 3UATA 1SHFA 3M0UA 1UG1A 1KIKA 4AG2C 4Y92A 1U06A 1X27A 2AKKA 2KE9A 4HVVA 2JS2A 1Y57A 2L2PA 2A28A 1H8KA 2DF6A 4F17A 4DEYA 1PWTA 2M51A 2CSQA 2LX7A 2ENMA 1HSQA 1QWEA 5IHNA 2X3WD 3VRYA 3H0HA 4RTTA 2FPEA 2YUPA 3REBB 2RNAA 3U23A 1NEBA 1BB9A 1ZBJA 2I0NA 2DL8A 1M3CA 2V1RA 3PVLA 4AFSC 2CUBA 1CKBA 2GBQA 2JMAA 2LNHB 1EFNA 2SEMA 2FPDA 4F14A 2OI3A 1ARKA 3I9QA 1GL5A 2DYBA 2LCSA 2LJ0A 3R6NA 2LZ6B 5FW9A 3M0PA 1WLPB 2EVRA 3SEMA 2DBKA 2CSIA 5IXFA 2HCKA 2ECZA 1KFZA 4QT7A 2P4RA 2RN8A 2AZSA 1AEYA 3NMZC 2RMOA 3O5ZA 2JW4A 2VWFA 3VS5A 2ROTA 2CH4W 1ZUYA 2J06A 4R0KA 4Z88A 2G6FX 1WIEA 1Z9QA 2O31A 2V1QA 2HSPA 1JEGA 2PNIA 3JV3A 1BK2A 1WXTA 3VS4A 3H0IA 3RNJA 2DLPA 4LNPA 2K6DA 2J05A 2JXBA 2D8HA 2JM8A 4J9GA 2RQVA 4RTWA 1X2QA 2M0YA 2FRWA 2D1XA 2EW3A 1LCKA 2K79A 4X1VA 1UDLA 2W0ZA 3TSWA 2CREA 2PZ1A 2DNUA 2VVKA 1SRLA 1YCSB 2A37A 2JT4A 2QDLA 1W1FA 4Z89A 1QWFA 2KYBA 2AK5A 2KEAA 4D8KA 4IIMA 2RQUA 1GFDA 3NPFA 1IO6A 4JZ3A 5IXBA 4IIOA 1GFCA 2FPFA 2ESWA 3VS6A 1J3TA 2DJQA 1K1ZA 2NWMA 1CKAA 1I07A 2KROA 4OMNA 2EYWA 1WDXA 4JPBW 1PRMC 3VS2A 1A0NB 1AWXA 2DA9A 2EYXA 4K11A 3GBQA 1AWJA 1GCQA 1WI7A 2YUNA 1UJ0A 1UE9A 1AWOA 2HDAA 3UF4A 5EC7A 2L3PA 3IQLA 1RLPC 1BBZA 4LE9A 2ED0A 1M30A 2RF0A 1ZUUA 2RQWA 3H41A 1E6HA 4OMOA 2HEQA 2H8HA 4HVWA 2C0TA 2KRNA 5IHIA 3SHWA 1GBRA 1ZLMA 2GNCA 1WFWA 3EG3A 2CH4A 1OOTA 2ABLA 2KGTA 1PRLC 4JJBA 2KRMA 1JU5C 5GJWB 1OPKA 2F2XA 2NUZA 1N5ZA 4Z8AA 4J9IA 5HCKA 1X2KA 1FMKA 2DM1A 3CQTA 4F16A 1WXBA 1WA7A 2DRKA 2C0OA 2KYMA 1WX6A 2EYYA 1RUWA 4E6RA 2AZVA 1UECA 3C0CA 2AKLA 4AFUC 2EBPA 4DEXA 4AFQC 3NGPA 3VS0A 2DVJA 2CDTA 3PVQA 2O9SA 4WCIA 2YT6A 2A36A 1NM7A 1H3HA 2YUOA 1PHTA 3EG2A 1HD3A 1K4US 4AFZC 2X3XD 2RPNA 2B86A 1NYGA 1VYTA 2DL5A 2BTTA 2O9VA 1WXUA 1VYUA 2ED1A 1SEMA 1JXMA 1QLYA 2D0NA 2K7AA 2A08A 1G2BA 1WYXA 2YDLA 3VS3A 1UGVA 2O2OA 4M4ZA 5L23A 2DE0X 2BZXA 2CUDA 2DBMA 3KFVA 1XOVA 2MIOA 4J9FA 2L3QA 1U5SA 2FG0A 1VYVA 2OJ2A 1YWOA 2K3BA 2DMOA 3TVTA 2HBWA 2GQIA 1UJYA 3M0RA 1ZX6A 1S1NA 4J9CA 1SRMA 2DX1A 2VKNA 4J9HA 1X6BA 1T3SA 1K9AA 1YWPA 1UFFA 2DRMA 5I22A 1AZGB 2FEIA 4KRTA 1T0HA 2KR3A 1I0CA 2J6FA 2W10A 3EHQA 1T3LA 1ABOA 2LJ3A 1TUCA 4ORZA 1NEGA 3RBBB 3VRZA 2XMFA 1GRIA 1W6XA 2DILA 2L0AA 1E7OA 2FRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTO A;  1NG2 A;  1BU1 A;  4GLM A;  1YN8 A;  3PE0 A;  5IH2 A;  1KJW A;  2F2W A;  2OAW A;  4HXJ A;  1MV3 A;  1PKS A;  3I5R A;  1KSW A;  4CC2 A;  1M3A A;  3EG1 A;  4JJC A;  3REA B;  2KBT A;  1OV3 A;  1K76 A;  4RTU A;  4ZNX A;  2JM9 A;  1RLQ C;  3VS1 A;  3H0F A;  3A98 A;  2E5K A;  2MOX A;  1AOJ A;  4RTY A;  1AD5 A;  2LJ1 A;  1I1J A;  1JO8 A;  4LUE A;  1MV0 B;  2O88 A;  1HJD A;  2KXC A;  4D8D A;  1GCQ C;  3ULR B;  1B3Q A;  1V1C A;  1QKX A;  4HCK A;  2CT3 A;  2RQT A;  4RUG A;  2EKH A;  2DL3 A;  2J7I A;  3EGU A;  1SHG A;  2JMC A;  1TG0 A;  4OMQ A;  1ABQ A;  4ESR A;  4LUD A;  3ZL7 C;  1AWW A;  4A63 B;  1QKW A;  1X43 A;  3M0S A;  2F2V A;  1K0X A;  1NYF A;  4OMP A;  1X69 A;  3VS7 A;  1QCF A;  1TUD A;  1VA7 A;  2LQN A;  2FO0 A;  1ZUK A;  1MUZ A;  1OPL A;  4HVU A;  2RQR A;  3UA7 A;  1H92 A;  1GCP A;  2J6K A;  2EGA A;  1T0J A;  4FSS A;  1JQQ A;  2EGC A;  2J6O A;  2MCN A;  2L3S A;  3I35 A;  1OEB A;  1ZSG A;  1AZE A;  3LH5 A;  1NLP C;  2EGE A;  1M8M A;  2KT8 A;  5GJV B;  1UHC A;  2EQI A;  4JJD A;  2DL7 A;  4J9B A;  4EIK A;  2D8J A;  4JZ4 A;  2KXD A;  2LQW A;  2KNB B;  1SSH A;  1UTI A;  4J9E A;  5IHK A;  4GBQ A;  1U3O A;  1M27 C;  2K2M A;  2LMJ A;  4OML A;  1E6G A;  2DL4 A;  2SRC A;  1YNZ A;  2GGR A;  1AVZ C;  1PKT A;  1B07 A;  2BZY A;  5FWB A;  3EG0 A;  2YUQ A;  3QWY A;  3UA6 A;  2JTE A;  2EPD A;  3THK A;  1SPK A;  4CC3 A;  2KRS A;  3NHN A;  1UUE A;  2EYZ A;  4J9D A;  2CT4 A;  1PNJ A;  3M0T A;  2IIM A;  3EHR A;  3QWX X;  1X6G A;  2GTJ A;  1UHF A;  4OMM A;  2YSQ A;  1Z9Z A;  4CC7 A;  5ECA A;  1W70 A;  1G83 A;  2JS0 A;  2BZ8 A;  1M3B A;  3I5S A;  1GBQ A;  1RI9 A;  2LP5 A;  2KT1 A;  5I11 A;  5FWC A;  1K0S A;  1JXO A;  2C0I A;  1CSK A;  1NLO C;  2K9G A;  4RTV A;  2ROL A;  3TSZ A;  4CC4 B;  4AG1 C;  4RTX A;  3FJ5 A;  4RTZ A;  2PTK A;  3M0Q A;  4LN2 A;  1FYN A;  1YP5 A;  1Y0M A;  3UAT A;  1SHF A;  3M0U A;  1UG1 A;  1KIK A;  4AG2 C;  4Y92 A;  1U06 A;  1X27 A;  2AKK A;  2KE9 A;  4HVV A;  2JS2 A;  1Y57 A;  2L2P A;  2A28 A;  1H8K A;  2DF6 A;  4F17 A;  4DEY A;  1PWT A;  2M51 A;  2CSQ A;  2LX7 A;  2ENM A;  1HSQ A;  1QWE A;  5IHN A;  2X3W D;  3VRY A;  3H0H A;  4RTT A;  2FPE A;  2YUP A;  3REB B;  2RNA A;  3U23 A;  1NEB A;  1BB9 A;  1ZBJ A;  2I0N A;  2DL8 A;  1M3C A;  2V1R A;  3PVL A;  4AFS C;  2CUB A;  1CKB A;  2GBQ A;  2JMA A;  2LNH B;  1EFN A;  2SEM A;  2FPD A;  4F14 A;  2OI3 A;  1ARK A;  3I9Q A;  1GL5 A;  2DYB A;  2LCS A;  2LJ0 A;  3R6N A;  2LZ6 B;  5FW9 A;  3M0P A;  1WLP B;  2EVR A;  3SEM A;  2DBK A;  2CSI A;  5IXF A;  2HCK A;  2ECZ A;  1KFZ A;  4QT7 A;  2P4R A;  2RN8 A;  2AZS A;  1AEY A;  3NMZ C;  2RMO A;  3O5Z A;  2JW4 A;  2VWF A;  3VS5 A;  2ROT A;  2CH4 W;  1ZUY A;  2J06 A;  4R0K A;  4Z88 A;  2G6F X;  1WIE A;  1Z9Q A;  2O31 A;  2V1Q A;  2HSP A;  1JEG A;  2PNI A;  3JV3 A;  1BK2 A;  1WXT A;  3VS4 A;  3H0I A;  3RNJ A;  2DLP A;  4LNP A;  2K6D A;  2J05 A;  2JXB A;  2D8H A;  2JM8 A;  4J9G A;  2RQV A;  4RTW A;  1X2Q A;  2M0Y A;  2FRW A;  2D1X A;  2EW3 A;  1LCK A;  2K79 A;  4X1V A;  1UDL A;  2W0Z A;  3TSW A;  2CRE A;  2PZ1 A;  2DNU A;  2VVK A;  1SRL A;  1YCS B;  2A37 A;  2JT4 A;  2QDL A;  1W1F A;  4Z89 A;  1QWF A;  2KYB A;  2AK5 A;  2KEA A;  4D8K A;  4IIM A;  2RQU A;  1GFD A;  3NPF A;  1IO6 A;  4JZ3 A;  5IXB A;  4IIO A;  1GFC A;  2FPF A;  2ESW A;  3VS6 A;  1J3T A;  2DJQ A;  1K1Z A;  2NWM A;  1CKA A;  1I07 A;  2KRO A;  4OMN A;  2EYW A;  1WDX A;  4JPB W;  1PRM C;  3VS2 A;  1A0N B;  1AWX A;  2DA9 A;  2EYX A;  4K11 A;  3GBQ A;  1AWJ A;  1GCQ A;  1WI7 A;  2YUN A;  1UJ0 A;  1UE9 A;  1AWO A;  2HDA A;  3UF4 A;  5EC7 A;  2L3P A;  3IQL A;  1RLP C;  1BBZ A;  4LE9 A;  2ED0 A;  1M30 A;  2RF0 A;  1ZUU A;  2RQW A;  3H41 A;  1E6H A;  4OMO A;  2HEQ A;  2H8H A;  4HVW A;  2C0T A;  2KRN A;  5IHI A;  3SHW A;  1GBR A;  1ZLM A;  2GNC A;  1WFW A;  3EG3 A;  2CH4 A;  1OOT A;  2ABL A;  2KGT A;  1PRL C;  4JJB A;  2KRM A;  1JU5 C;  5GJW B;  1OPK A;  2F2X A;  2NUZ A;  1N5Z A;  4Z8A A;  4J9I A;  5HCK A;  1X2K A;  1FMK A;  2DM1 A;  3CQT A;  4F16 A;  1WXB A;  1WA7 A;  2DRK A;  2C0O A;  2KYM A;  1WX6 A;  2EYY A;  1RUW A;  4E6R A;  2AZV A;  1UEC A;  3C0C A;  2AKL A;  4AFU C;  2EBP A;  4DEX A;  4AFQ C;  3NGP A;  3VS0 A;  2DVJ A;  2CDT A;  3PVQ A;  2O9S A;  4WCI A;  2YT6 A;  2A36 A;  1NM7 A;  1H3H A;  2YUO A;  1PHT A;  3EG2 A;  1HD3 A;  1K4U S;  4AFZ C;  2X3X D;  2RPN A;  2B86 A;  1NYG A;  1VYT A;  2DL5 A;  2BTT A;  2O9V A;  1WXU A;  1VYU A;  2ED1 A;  1SEM A;  1JXM A;  1QLY A;  2D0N A;  2K7A A;  2A08 A;  1G2B A;  1WYX A;  2YDL A;  3VS3 A;  1UGV A;  2O2O A;  4M4Z A;  5L23 A;  2DE0 X;  2BZX A;  2CUD A;  2DBM A;  3KFV A;  1XOV A;  2MIO A;  4J9F A;  2L3Q A;  1U5S A;  2FG0 A;  1VYV A;  2OJ2 A;  1YWO A;  2K3B A;  2DMO A;  3TVT A;  2HBW A;  2GQI A;  1UJY A;  3M0R A;  1ZX6 A;  1S1N A;  4J9C A;  1SRM A;  2DX1 A;  2VKN A;  4J9H A;  1X6B A;  1T3S A;  1K9A A;  1YWP A;  1UFF A;  2DRM A;  5I22 A;  1AZG B;  2FEI A;  4KRT A;  1T0H A;  2KR3 A;  1I0C A;  2J6F A;  2W10 A;  3EHQ A;  1T3L A;  1ABO A;  2LJ3 A;  1TUC A;  4ORZ A;  1NEG A;  3RBB B;  3VRZ A;  2XMF A;  1GRI A;  1W6X A;  2DIL A;  2L0A A;  1E7O A;  2FRY A; 
#chains in the Genus database with same CATH topology
 1BU1 A;  3CME T;  1BYM A;  3QXE B;  4CC2 A;  5C6S A;  1ZQ1 A;  4PL6 A;  4C92 F;  2YRV A;  1OZ3 A;  2VAS A;  3SWN A;  4RTU A;  3BW1 A;  1RLQ C;  3MEU A;  2IVW A;  3OS2 A;  3A98 A;  2E5K A;  1QQJ A;  1YI2 T;  3UDC A;  1GCQ C;  4OF1 A;  1B3Q A;  1G8X A;  3CBP A;  3CCJ T;  2RM4 A;  1VQ7 T;  2ZGW A;  4RUG A;  2QXF A;  2EKH A;  4DA4 A;  2OTL T;  2JMC A;  4LUD A;  3WXM B;  8AT1 B;  2FZK B;  3S6W A;  3HL8 A;  2XU8 A;  3SWN B;  3A5Z B;  4M75 A;  4OMP A;  1M2V A;  1QCF A;  3OYE A;  4M78 B;  4B9X A;  2LQN A;  4M7A B;  1I5L A;  3OB9 A;  1NJI R;  3HKS A;  3JB9 D;  1VQN T;  2EGC A;  3MPU B;  2MCN A;  1MND A;  1QVG A;  3FJP A;  5DLO A;  2RHZ A;  5GAN d;  4ANJ A;  1M8M A;  2DPP B;  3OYM A;  4JDS A;  3OSS C;  5GAM f;  3CCV Q;  4JJD A;  5LJ5 f;  4EIK A;  3EFS A;  3G71 T;  4M7D B;  5FLX E;  1OI1 A;  2YHT A;  5FRN A;  1H64 1;  1X6O A;  1PG5 B;  4IUQ A;  1BIB A;  2KNB B;  1SSH A;  4M77 F;  3G4S Q;  1OU8 A;  1YJN A;  4GBQ A;  4ELY C;  2F1L A;  2HNI A;  3JCM b;  1Q82 C;  1YIJ T;  3RDV A;  4D6W A;  2DL4 A;  3EG9 A;  1TS9 A;  1UGP B;  2BZY A;  3EG0 A;  5I2M A;  1XTD A;  4HT8 A;  3THK A;  1SPK A;  1N8R C;  1G3W A;  4CC3 A;  2KRS A;  3NHN A;  2V26 A;  2EYZ A;  4J9D A;  4M75 D;  5GAN e;  1Q7Y R;  1YIJ A;  1M1G A;  1N9S A;  2HAX A;  3HFO A;  3M0T A;  2FZC B;  3G1J A;  4PJM A;  3QWX X;  4M78 G;  1X6G A;  3I56 Q;  1HYO A;  3MJX A;  4OMM A;  4C0D C;  4CC7 A;  1G83 A;  4FL6 A;  2JS0 A;  5J39 A;  4HCC A;  2D0Q B;  2KT1 A;  1VQ7 Q;  5I11 A;  2ZZD A;  1XNI A;  1K0S A;  2LTO A;  1NLO C;  4RG8 A;  3PIO A;  4RTV A;  3JCM V;  4LD9 K;  1D1A A;  1RL2 A;  1VQO A;  2CKK A;  4TVR A;  3JCM h;  2EJF A;  2VGM A;  1UG1 A;  1KIK A;  1IRE B;  1WQW A;  2DZ9 A;  1M8V A;  3G6E A;  5LJ3 g;  2F69 A;  4LD6 A;  4FYX B;  5CVI A;  2E6N A;  3CCE A;  2KDS A;  4N4G A;  4E47 A;  3CMA T;  2YUP A;  3M4Y A;  3O8V A;  4KH1 B;  1K9M U;  3U23 A;  1BB9 A;  2V1R A;  4AFS C;  1VQL A;  3PVL A;  2QA4 T;  4QVD A;  3UT1 A;  2R5A A;  2LNH B;  1EFN A;  2RHU A;  2SEM A;  5GMK l;  2YLC A;  9ATC B;  1IRX A;  1ARK A;  3CCQ A;  2QA4 A;  3V7R A;  4OMF B;  2LJ0 A;  4FYW B;  1VQ8 T;  4M7A A;  2LZ6 B;  1TH7 A;  3A8L B;  1IXD A;  4PK4 A;  2EVR A;  3DB3 A;  4F7U F;  2X4J A;  4QQG A;  1LNX A;  4B9W A;  4MZP A;  3CXC A;  3NMZ C;  2RMO A;  3S3O A;  2J06 A;  5FU6 B;  3OA6 A;  1WIE A;  2LCL A;  2WAC A;  4JS5 A;  1MNE A;  4XU1 A;  1W2B S;  3H0I A;  1RI0 A;  2DLP A;  1NBE B;  2K6D A;  1C0M A;  4PFZ A;  3CC4 T;  1WHJ A;  2DKG A;  4NOY A;  4J9G A;  3GLX A;  1UGQ B;  3CCU Q;  3E19 A;  2FRW A;  2MWO A;  4KGZ B;  4MZM A;  2EW3 A;  4XU3 A;  3AHU A;  1UDL A;  2W0Z A;  3JCM W;  5GAM h;  5GAM d;  2COW A;  2LRQ A;  3V8K A;  2DTO A;  4MDW A;  2DTH A;  3RKY A;  4WTO B;  4Z89 A;  2KYB A;  4M7D C;  2KEA A;  4R55 A;  1GFD A;  4JZ3 A;  4C5H A;  1IHW A;  4IUU A;  2EYQ A;  2DJQ A;  2JJ9 A;  3JCM X;  1WJR A;  5GAO m;  2NWM A;  3R6O A;  1M5Q 1;  2KRO A;  4OMN A;  3JB9 J;  4AMC A;  4JPB W;  4EMK B;  1PRM C;  1KC8 R;  2DTI A;  3QYG B;  2DA9 A;  2M16 A;  3G71 A;  4RG2 A;  3CCV A;  2EYX A;  4K11 A;  1UE9 A;  5M9O A;  3C4S A;  1M90 R;  2V8J A;  1PD0 A;  3M57 A;  3OQ5 A;  2P0K A;  2IPO B;  4A54 A;  1VIF A;  1SF9 A;  1ZUU A;  5D7U A;  2H8H A;  2QGG A;  3MHX A;  4HVW A;  2C0T A;  3OYB A;  1GBR A;  1VQL Q;  4II1 A;  4C5G A;  5KYY A;  1VQK T;  4DQ2 A;  2R58 A;  3EG3 A;  3MCA B;  2CH4 A;  1KQS P;  2KGT A;  2FB7 A;  1FMW A;  2NUZ A;  4Z8A A;  4A53 A;  4IUT A;  1VQK A;  5HCK A;  1KK7 A;  3L2Z A;  3X26 B;  3QHS A;  1X2K A;  3GIB A;  3QKJ A;  4C8Q C;  1K73 U;  1WX6 A;  1QCN A;  1WNL A;  2FVU A;  4E7K A;  1UEC A;  4AFU C;  4OP0 A;  1R0B G;  1RAB B;  1R0C B;  5FU7 B;  2CDT A;  3PVQ A;  2O9S A;  3PGG A;  4WCI A;  3CCQ Q;  4PFO A;  2YUO A;  1RAE B;  1TXQ A;  3CMA Q;  1PHT A;  5J3B A;  4QQD A;  3JAM E;  1K4U S;  3A1P A;  2X3X D;  3QZ5 B;  2RPN A;  4X9C A;  2B86 A;  3PNW C;  4J6X A;  3CC2 A;  2CP2 A;  3OMG A;  4C0G A;  4YTL A;  3OYF A;  1VQP A;  1D0X A;  3OYH A;  2DJZ A;  2RK2 A;  4F7U B;  2EQM A;  3CC7 Q;  4KBM B;  1M2O A;  2ED1 A;  2MAM A;  1QLY A;  1VQN A;  2JZ2 A;  1EIF A;  2CP3 A;  2O2O A;  1I8F A;  5A0G A;  4PJO A;  2DE0 X;  4OGC A;  1Q95 G;  2OX7 A;  2MIO A;  5KCH A;  4C5E A;  1VYV A;  2OJ2 A;  1YWO A;  1VQ6 A;  2K3B A;  4PJN A;  5KCO A;  3CCM A;  3VU3 C;  4M7A G;  1X6B A;  4F7U E;  1SSF A;  5KE2 A;  1UFF A;  3Q1J A;  5I22 A;  1MMG A;  2L5Q A;  2KR3 A;  1KC8 U;  4EMK A;  1PSE A;  3VYG A;  1Y7X A;  2J6F A;  1LOJ A;  3CCJ A;  1C1A A;  4C8Q D;  1TUC A;  4KUL A;  2COY A;  3VRZ A;  3EFR A;  3CPW S;  4CRI A;  1W6X A;  1LVK A;  3LGF A;  1JBM A;  2FRY A;  3CCS A;  2PVD B;  4BY6 B;  2GTO A;  1Y96 B;  1YN8 A;  1KJW A;  2QEX T;  5I21 A;  1X01 A;  1D0Z A;  1PKS A;  2QDY B;  1M3A A;  3EG1 A;  3CCL A;  1F1B B;  3KXT A;  3REA B;  1IB8 A;  2KBT A;  2C06 A;  1OV3 A;  1K76 A;  4RKU E;  4IKF A;  1MMA A;  4Z02 A;  2JM9 A;  3JCM J;  2V8I A;  4OGE A;  4Y28 E;  2CP5 A;  1AOJ A;  4RTY A;  1AD5 A;  2LJ1 A;  1MV0 B;  3VJP A;  2E1H A;  4E7S A;  3ULR B;  2ZAE A;  3E9G A;  1QKX A;  4C92 E;  1VOM A;  4O5V A;  1M90 U;  1YJ9 T;  2RQT A;  3EH1 A;  3L42 A;  2X51 A;  3EGU A;  3TU4 K;  1SHG A;  2RI5 A;  5J26 A;  3NTK A;  4FSX A;  4PJL A;  2MF2 A;  2QQR A;  3CCE Q;  3M0S A;  5DY9 A;  3VS7 A;  1Q86 R;  4N0A C;  4C92 B;  3CEY A;  1VA7 A;  1RAD B;  4MML A;  3RES A;  1MUZ A;  4HVU A;  3UA7 A;  3KUF A;  1Q81 R;  2JN0 A;  2J6K A;  2I2L A;  3UPU A;  1OEB A;  1AZE A;  3OYA A;  3LH5 A;  3QBY A;  1NLP C;  2KSS A;  3GNF B;  3OYK A;  4C8Q G;  2MYS A;  2AHJ B;  3E1S A;  4XU0 A;  3QSU A;  3OMC A;  1Y07 A;  2QQ9 A;  4BE0 A;  3OW2 S;  2MI6 A;  3QDR B;  2JNG A;  3OBY A;  2JTF A;  2KXD A;  5GAO r;  4PJO D;  2XK0 A;  2P0P A;  1UTI A;  4J9E A;  1VQ4 T;  1KD1 C;  2DXB A;  3OSV A;  5D6X A;  3RMQ A;  2LMJ A;  4JRI A;  1BI1 A;  4M7D F;  1AVZ C;  1PKT A;  1B07 A;  5FWB A;  3QWY A;  2YUQ A;  2LC4 A;  4M7D D;  1PM3 A;  2QQB A;  2B8A A;  2ZPH B;  2NUP B;  1UUE A;  3EFO A;  2IIM A;  4FIB A;  3I55 A;  4JUV A;  2GQV A;  2YSQ A;  4IUV A;  3CCL T;  2EIF A;  1M3B A;  2AIR B;  1GBQ A;  2DO3 A;  2LCC A;  2EAY A;  3H6Z A;  1JXO A;  2C0I A;  1I81 A;  4XTV A;  3FJ5 A;  4RTZ A;  3TCJ A;  3QUI A;  4LN2 A;  3M5A A;  1FYN A;  5KYU B;  4M7A C;  3UAT A;  4Q5W A;  2EQU A;  2JS2 A;  1Y57 A;  1VQ5 T;  4HT9 A;  3PIP A;  4M78 A;  4C92 A;  4XTZ A;  3X24 B;  4DEY A;  2L8D A;  1PWT A;  1M2V B;  4PJO G;  5CQY A;  1QWE A;  3MP1 A;  4BAC A;  2E3I A;  2X3W D;  3VRY A;  1V76 A;  4NS5 A;  2K5I A;  2RNA A;  2VUB A;  1NEB A;  3FRN A;  4HA8 A;  2IG0 A;  3OYC A;  2JMA A;  4BE2 A;  4QQ6 A;  2FPD A;  3PT9 A;  1IGU A;  3D7S B;  1WPY A;  2DYB A;  2DXU A;  3SDZ A;  5CKB A;  3JCM P;  1NJI U;  3R6N A;  2VXF A;  2RJD A;  2VYT A;  3CCQ T;  1BI3 A;  2K3Y A;  4QVC A;  1OYX A;  4C5I A;  4EMH A;  3MKD A;  3SEM A;  2FL7 A;  4M75 F;  1YJN T;  4QT7 A;  1AEY A;  1VQ6 Q;  2JW4 A;  1NE8 A;  5GAN 8;  2VWF A;  3BY7 A;  2ROT A;  1VQ5 A;  4R0K A;  5GAN 5;  2RJE A;  1VQ9 A;  3NTI A;  4PJO B;  2PNI A;  1BK2 A;  5C0M A;  1Q82 R;  4EDU A;  3A8M B;  3HRU A;  2J05 A;  3F70 A;  3OYL A;  4M75 C;  3A8H B;  2P84 A;  2JXB A;  1N8R R;  2JM8 A;  1X2Q A;  4ELZ C;  3RER A;  3OYN A;  1QMC A;  5LJ3 f;  1VQ7 A;  3G4S A;  1TUG B;  3TSW A;  3I55 T;  2CP7 A;  1VQ6 T;  1YCS B;  2JT4 A;  4E7H A;  3FC3 A;  5CO7 A;  1WGS A;  5L8R E;  8ATC B;  5GMK m;  2HL3 A;  2RD1 A;  1QWF A;  2JUF A;  1JRI A;  1VQM T;  3FEO A;  5GAN 6;  1G3S A;  4D8K A;  3JCM Q;  2VV5 A;  4M77 C;  2K5F A;  1GFC A;  3SWN C;  2FPF A;  1N6A A;  1M1K U;  2PUO B;  2DD4 A;  1K1Z A;  2GFA A;  1OQK A;  2YWW A;  1A0N B;  1AWX A;  4F7U G;  3CCV T;  3CCM Q;  1AWJ A;  1PCX A;  1WI7 A;  2RI2 A;  2YUN A;  1AWO A;  3UF4 A;  5GMK i;  4FT2 A;  1G3Y A;  4KH0 B;  2L3P A;  1BBZ A;  2DFU A;  2XHC A;  5LJ5 g;  4PKC C;  2NUT B;  2ED0 A;  3MEW A;  4OMO A;  5LJ3 h;  7AT1 B;  5IHI A;  4XK8 E;  3FLG A;  2RA2 A;  2XI9 A;  3JSC A;  2XDD A;  2RI3 A;  3DLL A;  4M77 A;  2ABL A;  1PRL C;  4JJB A;  1KQ2 A;  1JU5 C;  2ZCF B;  5GJW B;  2QYZ A;  3BFM A;  1N5Z A;  5GAN 2;  5GAM g;  2LX9 A;  2QQA A;  3M59 A;  1FMK A;  2DM1 A;  4FT4 A;  4F04 B;  5AYF A;  4PJJ A;  1WA7 A;  2C0O A;  4LDX A;  1KHC A;  1Q86 C;  3CCL Q;  4M77 E;  1S72 Q;  3M56 A;  3PMI A;  2HQE A;  3RR6 A;  4DEX A;  1Q81 C;  5GAO l;  3NGP A;  4E7J A;  2HMA A;  3OY9 A;  4LXC A;  1Q7Y C;  3CXC S;  1K73 C;  2H3J A;  3HSB A;  3JB9 I;  1H3H A;  3EG2 A;  1HD3 A;  2QEX A;  4FM4 B;  1MGQ A;  3L2Q A;  1NYG A;  4P5N A;  1VQ4 Q;  4XQ3 A;  1VUB A;  3CBM A;  3LGL A;  1VYT A;  2DL5 A;  3KBG A;  2E65 A;  4L6V 5;  1VYU A;  5KYX A;  1VQO Q;  4M75 E;  1K8A U;  2HD0 A;  5GAN j;  2DD5 A;  2D6F A;  1SEM A;  3HRT A;  2K7A A;  3S3M A;  2A08 A;  2LQ8 A;  3T9N A;  1UB4 A;  3PFS A;  3HP9 A;  1R77 A;  2JVV A;  2CUD A;  1YI2 Q;  1XOV A;  1YFN A;  4J9F A;  3CCU T;  2CP0 A;  2HBW A;  2VC8 A;  2GQI A;  1ZX6 A;  1SRM A;  2VKN A;  4J9H A;  1T3S A;  4J5Y A;  1K9A A;  4KT0 E;  2XG8 D;  1TU0 B;  3JCM e;  2CS7 A;  1JJ2 P;  4X34 A;  3OYY A;  3ZFJ A;  1T0H A;  4KUD K;  3V8J A;  1VQ9 T;  1AT1 B;  1M90 C;  3CC4 A;  3P8D A;  4JLI A;  4OB3 B;  2E4H A;  1NEG A;  5LL6 S;  3CCU A;  2DEU A;  5HKC A;  3V7S A;  1DJ7 B;  2Z0W A;  4E2F B;  3VV0 A;  1NG2 A;  3MEA A;  2MK5 A;  4GLM A;  3ASK A;  3PE0 A;  5IH2 A;  3NTH A;  5I2S A;  1FWZ A;  3M55 A;  1KSW A;  3TEE A;  2EJG A;  1WQ7 A;  1RAC B;  1RAA B;  1B34 B;  2RB6 A;  3UWN A;  2QQS A;  1MMN A;  4FU6 A;  1IZ6 A;  3H0F A;  3VS1 A;  2M9U A;  1YHQ Q;  4LDW A;  1JO8 A;  2Y90 A;  2BE7 D;  2KXC A;  4D8D A;  1N9R A;  4WF2 A;  1WZO A;  1Q82 U;  1V1C A;  2BUD A;  2YLB A;  5GAN g;  1Y96 A;  4L5G A;  2QA4 Q;  4BDY A;  1K9M R;  3CCS Q;  1NPR A;  1ABQ A;  4ESR A;  3ZL7 C;  4A63 B;  3M54 A;  4PLL A;  4A4K A;  4M77 B;  5CAI A;  3CCM T;  2F2V A;  4ZN3 A;  2RJF A;  1X69 A;  1TUD A;  2E41 A;  2HQX A;  1QVG S;  5HK3 A;  1SKU B;  4A4H A;  2FO0 A;  1OPL A;  1H92 A;  2K2V A;  1GCP A;  4V2S A;  3FIF A;  2L3S A;  1ZSG A;  4E7I A;  2DXT A;  3QJY A;  2HL5 C;  5EG2 A;  2K5L A;  3HRS A;  2D8J A;  2VXE A;  3J80 E;  1KC8 C;  3LLR A;  3I55 Q;  1JB0 E;  3GNG A;  4DOW A;  3JCM d;  1M27 C;  2BIV A;  2K2M A;  4OML A;  1E6G A;  1MHN A;  1YNZ A;  5KE3 A;  3MEV A;  2GGR A;  3UA6 A;  1VQ4 A;  4L59 A;  2CP6 A;  5LJ5 j;  1TWB A;  2CT4 A;  2QI2 A;  2L3R A;  4C8Q A;  2JTM A;  3EHR A;  2NYS A;  5GAN 4;  1UHF A;  1Z9Z A;  1VQM A;  5ECA A;  4EMG A;  2XKO C;  3OYD A;  4ZN1 A;  2BZ8 A;  4HKE A;  3DLM A;  4J6W A;  4JRP A;  4M78 E;  3L2U A;  2QAS A;  4M7A E;  3A8G B;  1CSK A;  2K9G A;  5D6Y A;  3MP6 A;  3LH0 A;  4RTX A;  4FW1 A;  2VB6 A;  2PTK A;  1O75 A;  3INZ A;  4JJN K;  4M7D G;  1HK9 A;  1QCO A;  1Y0M A;  1SHF A;  3M0U A;  5LJ3 e;  4AG2 C;  4Y92 A;  4HVV A;  2KE9 A;  1K9M C;  2L2P A;  2A28 A;  4C8Q E;  3LW5 E;  4F17 A;  2CZ7 B;  2M51 A;  2ZPI B;  2CSQ A;  2LX7 A;  2ENM A;  1HSQ A;  2DAQ A;  1Y71 A;  3ME9 A;  3URG A;  1H3Z A;  3VUZ A;  4QVZ A;  4E7Z A;  3H0H A;  4RTT A;  2DXC A;  2FPE A;  4PJO F;  1VQ8 A;  1VQK Q;  1U1T A;  1M3C A;  5CR2 A;  2HQH A;  3X28 B;  1CKB A;  4C8Q B;  1V29 B;  2GBQ A;  4M77 D;  4PFP A;  4XTY A;  2RH2 A;  3X25 B;  1K8A C;  1GL5 A;  2CYZ B;  2X35 A;  4AT1 B;  2E12 A;  2DIQ A;  5FW9 A;  4PJO E;  5A0L A;  2NLU A;  3M0P A;  1WJQ A;  4MMK A;  4C0F A;  1VQP Q;  3G7Z A;  2DBK A;  3EGX A;  2HCK A;  2ECZ A;  5KYN A;  2CZ6 B;  2RN8 A;  1TTH B;  2WSE E;  2QTV A;  3O5Z A;  4XU2 A;  3CME A;  3G6E T;  3X20 B;  4M75 G;  4NL2 A;  2RHI A;  4Z88 A;  1WHM A;  3SB2 A;  2G6F X;  3CPF A;  2O31 A;  5LJ5 h;  4DBH A;  2HSP A;  3NFC A;  3JV3 A;  1P92 A;  1D3B B;  1WXT A;  5D6W A;  2H3E B;  3VS4 A;  1U1S A;  1W4S A;  3CD6 Q;  2K57 A;  4EMK C;  4R56 A;  2Y4X A;  4M7A F;  2X4Y A;  3RKW A;  4ZGJ B;  1U8R A;  3QYH B;  2RQV A;  2O4X B;  1W2B A;  3VKI A;  2D1X A;  1D09 B;  5KYU A;  1G3T A;  1LCK A;  2GCX A;  2DIG A;  2KMT A;  2CRE A;  2PZ1 A;  2VVK A;  1SRL A;  1Q7Y U;  1BI2 A;  3N5B B;  5CKE A;  2G3R A;  5LJ5 d;  2QDL A;  1RAG B;  2M1H A;  1S72 T;  2HBP A;  3DB4 A;  5GMK e;  4ZGE B;  2JOY A;  1QVF S;  1YJ9 A;  2OAU A;  1IO6 A;  3P8H A;  2CGH A;  5IXB A;  4IIO A;  3LWH A;  1TOV A;  2PQW A;  2ESW A;  2V8K A;  3VS6 A;  3EGD B;  2E64 A;  4HCB A;  4RCC A;  2EYW A;  3VS2 A;  3CMA A;  1YJ9 Q;  1OUL A;  2MPX C;  2NUP A;  2LT1 A;  2KK4 A;  2RHX A;  3GBQ A;  1YBY A;  1GCQ A;  2RHY A;  5KH6 A;  1W2B P;  4J83 A;  3IQL A;  1RLP C;  3GPL A;  1M1K C;  3SD4 A;  5FU6 C;  3MET A;  4M78 D;  2RQW A;  4LDV A;  3H41 A;  1E6H A;  4PLI A;  2HEQ A;  3JRZ A;  2MMP A;  2KRN A;  3SHW A;  1BI0 A;  3RIR A;  1ZLM A;  3VUB A;  2GNC A;  2ATC B;  2GF7 A;  2VGN A;  1B34 A;  1WFW A;  3OYI A;  2EFI A;  2F5T X;  3JCM f;  1OPK A;  4B6M A;  3G6E Q;  1JJ2 A;  4C8Q F;  1YIT T;  2E10 A;  2HSE B;  1QVF A;  2OTJ T;  2LT4 A;  4F16 A;  3C94 A;  1WHG A;  4E6R A;  2O4X A;  3AT1 B;  2AZV A;  1FMV A;  2ZPE B;  4M78 F;  4ME7 A;  3BE3 A;  5GAN h;  2E6Z A;  3VS0 A;  4M75 B;  1OZ2 A;  2EJ9 A;  1EX4 A;  5KYW B;  2A36 A;  1RAH B;  3H9N A;  1QP3 A;  3CC2 T;  2P4T A;  4JS4 A;  2XID A;  4JLG A;  3C95 A;  4E7L A;  2PUK B;  4GLK A;  2XDB A;  2XDP A;  1ZA1 B;  3CD6 A;  1JXM A;  2D0N A;  6AT1 B;  1RAI B;  2YDL A;  1YIJ Q;  3VS3 A;  1UGV A;  1WHH A;  3OYJ A;  2OTJ A;  4KGV B;  5L23 A;  1TSF A;  2BZX A;  2DBM A;  2RK1 A;  2L3Q A;  3CC7 T;  2FG0 A;  2HKQ B;  2FHD A;  2DMO A;  4UC4 A;  1S1N A;  3RKX A;  4A4F A;  4DOV A;  4N0A A;  4DBQ A;  2DVE A;  3S3N A;  1AZG B;  2FEI A;  2PVG B;  4RMO A;  1YIT A;  1ZBX A;  2LVM A;  3EHQ A;  1T3L A;  4FYV B;  1WHK A;  3TRE A;  2LJ3 A;  4XTU A;  4QW2 A;  1MMD A;  3JCM c;  1AHJ B;  4XTX A;  4BI4 A;  3RBB B;  1YI2 A;  3CC7 A;  1D3B A;  2EQK A;  1K73 R;  2P0Q A;  3P8B B;  1GRI A;  2PVO B;  2CZ0 B;  2DIL A;  4FW2 A;  2QAZ A;  2COZ A;  1VQ8 Q;  2F2W A;  2OAW A;  4HXJ A;  5IN1 A;  1MV3 A;  3I5R A;  4JJC A;  3GP8 A;  4F7U A;  4ZNX A;  1EZZ B;  2KY9 A;  2PU9 B;  4BY6 C;  2DER A;  1BIA A;  1S72 A;  2MOX A;  1WHL A;  1XQH A;  1G5V A;  1YCY A;  3JCM g;  1I1J A;  4LUE A;  5GMK j;  2FYK A;  2O88 A;  1HJD A;  4MZT A;  1O9S A;  4MDX A;  3M9Q A;  3EAE A;  3QPH A;  3HHT B;  3LYI A;  4HCK A;  2CT3 A;  2LQK A;  2DL3 A;  2J7I A;  3HFN A;  1TG0 A;  4OMQ A;  4DBF A;  2DYI A;  1PC0 A;  1AWW A;  2HZY A;  3BDU A;  3OW2 A;  1QKW A;  1X43 A;  1PSF A;  1K0X A;  2X4W A;  1NYF A;  1VQM Q;  2OTJ Q;  3M4G A;  2MWP A;  3LX7 A;  1ZUK A;  2RQR A;  3J7A F;  2EGA A;  1T0J A;  4IUR A;  4FSS A;  1JQQ A;  2X4X A;  3SFM A;  2J6O A;  3I35 A;  4M78 C;  3QII A;  2YXY A;  2EGE A;  2KT8 A;  5CIU A;  1UHC A;  2EQI A;  5GJV B;  1X75 C;  1KD1 U;  2QTX A;  3J81 E;  2E70 A;  4PNO A;  2DL7 A;  4J9B A;  2BE9 B;  3CCR T;  5CKD A;  3CPW P;  3V8L A;  4JZ4 A;  1YJW T;  1OU9 A;  3OBW A;  1KQS S;  2HKN A;  2LQW A;  1YIT Q;  2AT1 B;  1BCM A;  5IHK A;  3OW2 P;  1IGQ A;  2ZPF B;  1U3O A;  4N4I A;  1N27 A;  2ZPG B;  3OS5 A;  1UGS B;  5GAO p;  2SRC A;  2EWN A;  1JJ2 S;  1RAF B;  3OS1 A;  3RMS A;  3VYH B;  5CKF A;  2JTE A;  2EPD A;  1YJN Q;  4JRK A;  1QP2 A;  1PNJ A;  2YRC A;  2EKO A;  1WJS A;  4LDU A;  1QW1 A;  1QVG P;  3CCE T;  4ZTF A;  2XIC A;  3A8O B;  2GTJ A;  3G4S T;  1W70 A;  1C6V X;  1N8R U;  2M0O A;  3I5S A;  3BDL A;  1RI9 A;  2LP5 A;  1YJW Q;  1NZ9 A;  3CPW A;  1NPP A;  3CCR A;  3V7C A;  3QDF A;  1ZHI A;  2M02 A;  5FWC A;  5CKH A;  3FB9 A;  5GAN 3;  5KYX B;  2ROL A;  3TSZ A;  3ZEH A;  4CC4 B;  4AG1 C;  4J8O A;  3M0Q A;  1YP5 A;  4CI0 C;  1Q81 U;  1VQN Q;  1U06 A;  1X27 A;  2AKK A;  4M77 G;  2OTL Q;  5CQX A;  4BD3 A;  4BUG A;  1H8K A;  2DF6 A;  5KYW A;  1VQO T;  2L89 A;  1Q86 U;  2XD0 A;  2RO0 A;  2KI7 A;  4VUB A;  5A0D A;  3CME Q;  4FCY A;  4BB7 A;  5IHN A;  4BI3 A;  2KVQ G;  5A2Q E;  3REB B;  4EPC A;  1ZBJ A;  2DL8 A;  2KQW A;  2I0N A;  5LJ5 e;  3L2W A;  1QVP A;  2CUB A;  4XTW A;  5GAM j;  3EFO B;  3GF5 A;  3JB9 G;  2ZPB B;  4F14 A;  2OI3 A;  2K4Y A;  3I9Q A;  5CK9 A;  2Y4Y A;  2LCS A;  3LWI A;  3OS0 A;  4HCZ A;  1OX9 A;  3PTA A;  4OB0 B;  4XAX B;  1KQ1 A;  4C0D B;  5LJ3 d;  3JB9 F;  1WLP B;  1D0Y A;  3PMT A;  2CSI A;  5IXF A;  1UGR B;  1LJO A;  3L1A A;  5GAM e;  5GAN f;  1KFZ A;  2P4R A;  2AZS A;  4PJO C;  2WSF E;  1OX8 A;  3VS5 A;  2CH4 W;  1ZUY A;  1NJI C;  4BI8 B;  4JRQ A;  2V1Q A;  1Z9Q A;  1JEG A;  3H8Z A;  2R5M A;  2X9H A;  5FRM A;  4C0Z A;  5IT9 E;  1I5O B;  3RNJ A;  5HK0 A;  4LNP A;  3CC4 Q;  2RJC A;  5FU7 C;  2D8H A;  4RTW A;  1QVF P;  2M0Y A;  4KUI A;  4DBR A;  3WVE B;  2K79 A;  4X1V A;  5GAN 7;  3G71 Q;  2DNU A;  2A3L A;  4J6Y A;  2E5Q A;  2A37 A;  4ATO A;  3CXC P;  5FRO A;  2LDM A;  2OTL A;  1W1F A;  1D1B A;  2AK5 A;  4BDZ A;  2A0F B;  4IIM A;  2R57 A;  2RQU A;  5GMK h;  3NPF A;  1VQ9 Q;  3GOX A;  4KGX B;  3EGX B;  5IAY A;  1J3T A;  2CZ1 B;  2FZG B;  4NL3 A;  1I4K 1;  1CKA A;  1I07 A;  1HXD A;  1WDX A;  2EQJ A;  4BE1 A;  4O6J A;  1YJW A;  3HTR A;  3CBO A;  1UEB A;  4LDY A;  1FX7 A;  3CC2 Q;  4X9D A;  1UJ0 A;  2HDA A;  1KD1 R;  3E2U A;  3MP8 A;  5EC7 A;  4QKU A;  4LE9 A;  1B7T A;  4A4G A;  5GAO n;  4C92 D;  1M30 A;  2RF0 A;  2LNV A;  3MO8 A;  3QZ9 B;  1PD1 A;  1IHV A;  2QK0 A;  1LPL A;  1K8A R;  3M53 A;  5KYY B;  1OOT A;  3OYG A;  2DEQ A;  3TQ7 P;  2KRM A;  2F2X A;  1BCO A;  4OB1 B;  4A4E A;  4J9I A;  4OVA A;  4GY5 A;  2E3H A;  1ACM B;  1BKB A;  3CQT A;  1WXB A;  3EG9 B;  2DRK A;  2YRD A;  2KYM A;  2EYY A;  1RUW A;  3EH2 A;  1D1C A;  3QO3 A;  1ZSZ C;  3WVD B;  3C12 A;  4ZTJ A;  5LJ3 j;  2DK3 A;  3C0C A;  2AKL A;  2EBP A;  2D9T A;  4AFQ C;  4M7D A;  1GXI E;  4IUP A;  2DVJ A;  3ZBD A;  3JB9 H;  3I56 A;  1YHQ A;  5HY6 A;  2BKD N;  4FYY B;  2K3X A;  2YT6 A;  1NM7 A;  1KQS A;  1YHQ T;  3I56 T;  2QG9 B;  3QJ6 A;  1FXX A;  4AFZ C;  3L2V A;  4M7A D;  3CCS T;  1KG1 A;  3ER0 A;  4C92 C;  2O9V A;  1WXU A;  1R8O B;  4M7D E;  3EGD A;  2F5K A;  2KAF A;  4ZGD B;  3CCR Q;  1G2B A;  1WYX A;  1ZSZ A;  3L2R A;  1M9S A;  4M4Z A;  3QG1 A;  2DET A;  3KFV A;  4RCB A;  4C92 G;  1M4Z A;  1VQL T;  5CCA A;  1U5S A;  1XJW B;  2DZC A;  1VIE A;  2QGF B;  5DLQ E;  3TVT A;  2NUT A;  1UJY A;  3RUX A;  3M0R A;  1VQ5 Q;  4J9C A;  3CCJ Q;  4J7F A;  2DX1 A;  4OB2 B;  1M1F A;  1YWP A;  2DRM A;  1KHI A;  3FDR A;  3M58 A;  5DM7 R;  2QEX Q;  4KRT A;  1I0C A;  2O01 E;  2WSC E;  1ZA2 B;  3HPW A;  2W10 A;  1ZSZ B;  4N4H A;  5AT1 B;  1ABO A;  1M1K R;  3CD6 T;  2A7Y A;  1SG5 A;  4J7I A;  4ORZ A;  2XMF A;  3DKM A;  5GAO q;  4Y91 A;  1VQP T;  2GFU A;  2L0A A;  1E7O A;  2BTT A;  3E9F A; 
#chains in the Genus database with same CATH homology
 2GTO A;  1NG2 A;  1BU1 A;  4GLM A;  1YN8 A;  3PE0 A;  5IH2 A;  1KJW A;  2F2W A;  2OAW A;  4HXJ A;  1MV3 A;  1PKS A;  3I5R A;  1KSW A;  4CC2 A;  1M3A A;  3EG1 A;  4JJC A;  3REA B;  2KBT A;  1OV3 A;  1K76 A;  4RTU A;  4ZNX A;  2JM9 A;  1RLQ C;  3VS1 A;  3H0F A;  3A98 A;  2E5K A;  2MOX A;  1AOJ A;  4RTY A;  1AD5 A;  2LJ1 A;  1I1J A;  1JO8 A;  4LUE A;  1MV0 B;  2O88 A;  1HJD A;  2KXC A;  4D8D A;  1GCQ C;  3ULR B;  1B3Q A;  1V1C A;  1QKX A;  4HCK A;  2CT3 A;  2RQT A;  4RUG A;  2EKH A;  2DL3 A;  2J7I A;  3EGU A;  1SHG A;  2JMC A;  1TG0 A;  4OMQ A;  1ABQ A;  4ESR A;  4LUD A;  3ZL7 C;  1AWW A;  4A63 B;  1QKW A;  1X43 A;  3M0S A;  2F2V A;  1K0X A;  1NYF A;  4OMP A;  1X69 A;  3VS7 A;  1QCF A;  1TUD A;  1VA7 A;  2LQN A;  2FO0 A;  1ZUK A;  1MUZ A;  1OPL A;  4HVU A;  2RQR A;  3UA7 A;  1H92 A;  1GCP A;  2J6K A;  2EGA A;  1T0J A;  4FSS A;  1JQQ A;  2EGC A;  2J6O A;  2MCN A;  2L3S A;  3I35 A;  1OEB A;  1ZSG A;  1AZE A;  3LH5 A;  1NLP C;  2EGE A;  1M8M A;  2KT8 A;  5GJV B;  1UHC A;  2EQI A;  4JJD A;  2DL7 A;  4J9B A;  4EIK A;  2D8J A;  4JZ4 A;  2KXD A;  2LQW A;  2KNB B;  1SSH A;  1UTI A;  4J9E A;  5IHK A;  4GBQ A;  1U3O A;  1M27 C;  2K2M A;  2LMJ A;  4OML A;  1E6G A;  2DL4 A;  2SRC A;  1YNZ A;  2GGR A;  1AVZ C;  1PKT A;  1B07 A;  2BZY A;  5FWB A;  3EG0 A;  2YUQ A;  3QWY A;  3UA6 A;  2JTE A;  2EPD A;  3THK A;  1SPK A;  4CC3 A;  2KRS A;  3NHN A;  1UUE A;  2EYZ A;  4J9D A;  2CT4 A;  1PNJ A;  3M0T A;  2IIM A;  3EHR A;  3QWX X;  1X6G A;  2GTJ A;  1UHF A;  4OMM A;  2YSQ A;  1Z9Z A;  4CC7 A;  5ECA A;  1W70 A;  1G83 A;  2JS0 A;  2BZ8 A;  1M3B A;  3I5S A;  1GBQ A;  1RI9 A;  2LP5 A;  2KT1 A;  5I11 A;  5FWC A;  1K0S A;  1JXO A;  2C0I A;  1CSK A;  1NLO C;  2K9G A;  4RTV A;  2ROL A;  3TSZ A;  4CC4 B;  4AG1 C;  4RTX A;  3FJ5 A;  4RTZ A;  2PTK A;  3M0Q A;  4LN2 A;  1FYN A;  1YP5 A;  1Y0M A;  3UAT A;  1SHF A;  3M0U A;  1UG1 A;  1KIK A;  4AG2 C;  4Y92 A;  1U06 A;  1X27 A;  2AKK A;  2KE9 A;  4HVV A;  2JS2 A;  1Y57 A;  2L2P A;  2A28 A;  1H8K A;  2DF6 A;  4F17 A;  4DEY A;  1PWT A;  2M51 A;  2CSQ A;  2LX7 A;  2ENM A;  1HSQ A;  1QWE A;  5IHN A;  2X3W D;  3VRY A;  3H0H A;  4RTT A;  2FPE A;  2YUP A;  3REB B;  2RNA A;  3U23 A;  1NEB A;  1BB9 A;  1ZBJ A;  2I0N A;  2DL8 A;  1M3C A;  2V1R A;  3PVL A;  4AFS C;  2CUB A;  1CKB A;  2GBQ A;  2JMA A;  2LNH B;  1EFN A;  2SEM A;  2FPD A;  4F14 A;  2OI3 A;  1ARK A;  3I9Q A;  1GL5 A;  2DYB A;  2LCS A;  2LJ0 A;  3R6N A;  2LZ6 B;  5FW9 A;  3M0P A;  1WLP B;  2EVR A;  3SEM A;  2DBK A;  2CSI A;  5IXF A;  2HCK A;  2ECZ A;  1KFZ A;  4QT7 A;  2P4R A;  2RN8 A;  2AZS A;  1AEY A;  3NMZ C;  2RMO A;  3O5Z A;  2JW4 A;  2VWF A;  3VS5 A;  2ROT A;  2CH4 W;  1ZUY A;  2J06 A;  4R0K A;  4Z88 A;  2G6F X;  1WIE A;  1Z9Q A;  2O31 A;  2V1Q A;  2HSP A;  1JEG A;  2PNI A;  3JV3 A;  1BK2 A;  1WXT A;  3VS4 A;  3H0I A;  3RNJ A;  2DLP A;  4LNP A;  2K6D A;  2J05 A;  2JXB A;  2D8H A;  2JM8 A;  4J9G A;  2RQV A;  4RTW A;  1X2Q A;  2M0Y A;  2FRW A;  2D1X A;  2EW3 A;  1LCK A;  2K79 A;  4X1V A;  1UDL A;  2W0Z A;  3TSW A;  2CRE A;  2PZ1 A;  2DNU A;  2VVK A;  1SRL A;  1YCS B;  2A37 A;  2JT4 A;  2QDL A;  1W1F A;  4Z89 A;  1QWF A;  2KYB A;  2AK5 A;  2KEA A;  4D8K A;  4IIM A;  2RQU A;  1GFD A;  3NPF A;  1IO6 A;  4JZ3 A;  5IXB A;  4IIO A;  1GFC A;  2FPF A;  2ESW A;  3VS6 A;  1J3T A;  2DJQ A;  1K1Z A;  2NWM A;  1CKA A;  1I07 A;  2KRO A;  4OMN A;  2EYW A;  1WDX A;  4JPB W;  1PRM C;  3VS2 A;  1A0N B;  1AWX A;  2DA9 A;  2EYX A;  4K11 A;  3GBQ A;  1AWJ A;  1GCQ A;  1WI7 A;  2YUN A;  1UJ0 A;  1UE9 A;  1AWO A;  2HDA A;  3UF4 A;  5EC7 A;  2L3P A;  3IQL A;  1RLP C;  1BBZ A;  4LE9 A;  2ED0 A;  1M30 A;  2RF0 A;  1ZUU A;  2RQW A;  3H41 A;  1E6H A;  4OMO A;  2HEQ A;  2H8H A;  4HVW A;  2C0T A;  2KRN A;  5IHI A;  3SHW A;  1GBR A;  1ZLM A;  2GNC A;  1WFW A;  3EG3 A;  2CH4 A;  1OOT A;  2ABL A;  2KGT A;  1PRL C;  4JJB A;  2KRM A;  1JU5 C;  5GJW B;  1OPK A;  2F2X A;  2NUZ A;  1N5Z A;  4Z8A A;  4J9I A;  5HCK A;  1X2K A;  1FMK A;  2DM1 A;  3CQT A;  4F16 A;  1WXB A;  1WA7 A;  2DRK A;  2C0O A;  2KYM A;  1WX6 A;  2EYY A;  1RUW A;  4E6R A;  2AZV A;  1UEC A;  3C0C A;  2AKL A;  4AFU C;  2EBP A;  4DEX A;  4AFQ C;  3NGP A;  3VS0 A;  2DVJ A;  2CDT A;  3PVQ A;  2O9S A;  4WCI A;  2YT6 A;  2A36 A;  1NM7 A;  1H3H A;  2YUO A;  1PHT A;  3EG2 A;  1HD3 A;  1K4U S;  4AFZ C;  2X3X D;  2RPN A;  2B86 A;  1NYG A;  1VYT A;  2DL5 A;  2BTT A;  2O9V A;  1WXU A;  1VYU A;  2ED1 A;  1SEM A;  1JXM A;  1QLY A;  2D0N A;  2K7A A;  2A08 A;  1G2B A;  1WYX A;  2YDL A;  3VS3 A;  1UGV A;  2O2O A;  4M4Z A;  5L23 A;  2DE0 X;  2BZX A;  2CUD A;  2DBM A;  3KFV A;  1XOV A;  2MIO A;  4J9F A;  2L3Q A;  1U5S A;  2FG0 A;  1VYV A;  2OJ2 A;  1YWO A;  2K3B A;  2DMO A;  3TVT A;  2HBW A;  2GQI A;  1UJY A;  3M0R A;  1ZX6 A;  1S1N A;  4J9C A;  1SRM A;  2DX1 A;  2VKN A;  4J9H A;  1X6B A;  1T3S A;  1K9A A;  1YWP A;  1UFF A;  2DRM A;  5I22 A;  1AZG B;  2FEI A;  4KRT A;  1T0H A;  2KR3 A;  1I0C A;  2J6F A;  2W10 A;  3EHQ A;  1T3L A;  1ABO A;  2LJ3 A;  1TUC A;  4ORZ A;  1NEG A;  3RBB B;  3VRZ A;  2XMF A;  1GRI A;  1W6X A;  2DIL A;  2L0A A;  1E7O A;  2FRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...