1AXSB

Mature oxy-cope catalytic antibody with hapten
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
QVQLLESGAELMKPGASVKISCKATGYTFSSFWIEWVKQRPGHGLEWIGEILPGSGGTHYNEKFKGKATFTADKSSNTAYMQLSSLTSEDSAVYYCARGHSYYFYDGDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXY-COPE CATALYTIC ANTIBODY
publication title The interplay between binding energy and catalysis in the evolution of a catalytic antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Catalytic antibody
total genus 41
structure length 221
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 1997-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1axsB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1axsB02
3QP3A 5DVKA 5FF6B 2C9AA 5IROA 2R1YB 4S1DD 3D9AL 2HFFA 1MI5D 4MMXC 3T2OA 2DYPB 4YAQA 1RUAH 1E6OL 3FQTA 3F7YB 1FCCA 1FO0B 1S7UA 3N85H 4QXWA 3BZFA 3P11L 3HZKA 5F72S 1IKFL 4P2QB 4LKCB 1OLZA 4PPTA 3MCKB 3RTQB 3C8DA 3P4NA 4K71B 3HNVH 4LL9A 3B43A 3DTXB 1A64A 5MHSD 2AV7B 3FQXB 4WFED 1KPRA 4DVBA 4O51B 1AJ7H 2B2XH 5JHDD 2YKLH 4X98B 2ITCA 4GW4B 3CXDH 4MQXC 5IFHH 1RY7B 3MRRB 1P84K 4PJDA 3QNZB 2R1XB 5ESAA 3QUXC 2AERT 3SKNB 4J4PA 2XTJB 3X13B 4HUUB 1HQ4A 2K7QA 1BJ8A 1CXLA 5AZ2H 3VGEA 2VXUH 5IVZB 2KKQA 4H5SA 3B9KB 3ULUE 3RL1B 2PYFB 3TBWB 2PYEB 1AIFA 1AR2A 5K59F 4LNVA 2NNAA 5D6CA 3BO8B 2BSTB 1QFUH 4DZBA 2C7UB 2E6PA 5CD3B 5IJVA 3CPLA 5HVHC 4TULH 3GJFB 2JELH 1KNOA 3VXMA 5C0CA 2EEAA 4ELMA 5MHSE 1S7QB 2XWTB 2HJLA 5KVFL 2GITB 3K8LA 3VFUB 1JJUA 4JFXB 5JHDE 1Z6JT 5D2NB 4UTAL 3QUZB 3IU4L 2R2BA 5GS1A 3D18B 5GJSH 4RBPK 3AU1B 3QRGL 4ZTOH 2HH0H 1JGVH 2X9XA 4JM2D 3QDMB 5ESQB 1JWSA 4EDWL 2DMCA 3VFNA 1LP9B 3O2VL 3L3GA 4M6NL 3TCLA 2D03L 2GY5A 4J1UB 3CGTA 1VFBB 3ULVD 1CL7I 1MFBH 4E5XB 1UEMA 4MXQD 1JGUH 5LG1A 3T0DA 4N8VB 3KS0H 2OMNA 4WV1A 3BT2L 3I75B 3WYRA 4HCRL 2DQHL 4LF3A 1J87A 1RMFL 2NXZD 1JZ7A 2C3VB 1YDPA 3LOWA 5CBAA 4ZO6A 3O11A 1JPGB 4CMMA 3P77A 4U2YA 1IL1A 2DKMA 1JZ3A 1U6AH 3LZFH 1WBYA 1F3JA 4O2EB 4OJFL 4F37F 5D9SA 3QWRA 3RA7L 1YY8B 4OUOA 1AH1A 2R69L 1T1ZA 1SJEB 1IT9L 2KPNA 1FC2D 2X4RB 3ULVE 3KYKH 4H0IA 3ARDA 1J05A 3WIFB 3G5XA 1T0PB 3ZE1E 1U8PB 5T33L 3FL7A 2C1OA 3MRLA 4KJWD 3W11C 2EDFA 5HGHA 2P43B 2ZUVA 2YN5A 3TT3H 5EG6C 2QTEA 1UJ3C 5D2LF 5LAXA 1KCUH 4DQOH 2GQHA 3WO3B 4HIIB 4MLIA 1BQLH 1RHHB 3KPMB 2IQ9H 3HPLB 3RU8H 1A7QH 1XT5A 4LLDB 4IOFD 1BQHG 3MLWL 3I9GL 4JHBA 1PZ5A 1FNAA 2VDKH 3ES6A 4O58H 4GMTL 4OLZH 3P4OA 1NGYB 5C0NC 2HWZH 2NY0C 4UAOB 4NZUH 1OW0C 3IGAA 5J9PB 1B2WL 5L2JA 1AXTL 2HG5A 1RV6X 3QEHA 4OZ4B 4QCIA 4DN4H 1TIUA 5J3HC 5L88H 4Y88A 5GXBB 2OI9B 5DHYA 3RX7A 4DKAA 5KSAD 3NH7H 4LSVH 4LEXL 3TBSB 2FX9H 5EU3B 4NQCE 4RAHA 2ZJSH 4M7JL 1KUMA 5IHZB 4WDIA 1H3WM 2F15A 4EUPH 4ZO9A 4APQB 4X7EC 3GUTB 1CDJA 3MV7E 2KBGA 4MD0A 2QBWA 3HAEG 1MCKA 2E8YA 5E8PA 2NY1D 2YXFA 4LRNL 4EJ1C 3WN5A 1J86A 1KF9B 4PD4J 2DIJA 1D9KC 3GGWB 4C55A 3MUGB 3FFCA 3SDAC 1YMMB 3I84A 2X4PB 2AK4B 2WBKA 2GCYA 3VD5A 2VN7A 1A1OA 4GW5B 5J13B 3EYQD 3GSNA 3MLSL 3RZCD 2YUVA 4LCWD 2G60H 4KKLC 3OTTA 1CGYA 1C7TA 2E9WA 1ZANH 1NBZB 4OIBA 3N1PC 2MOVA 2F19H 1RIHL 4UIMA 4R8WH 5DJAA 3ULUL 4Y5VB 5FUOL 3WUZA 2R56L 2X89D 5IESH 3WE6A 4M7ZB 4R7DB 3AS0A 1HHJA 3KPLA 5HDBE 3SDYL 3L3KB 3EOBB 4Z77A 3QJHB 3RY4A 4PGCA 5L9DH 1MF2H 4M1CD 1KC5H 4JFYA 4R2GB 4KKCD 5CILH 5A2LH 2AJXL 3QH3B 2YWZA 1CL7L 2DM7A 2NCMA 5IB3B 3ARUA 4OD2B 4E0RA 3RDTA 5EC1B 4X6EA 5BVJB 5I66A 3HNSL 1MJ8H 1FFQA 4GG8A 2ID5A 2YUWA 4L4TB 4RRPA 4WTWA 2AJVH 3GBMH 3OKOA 1UM5L 2DQCH 3V95A 3P30H 5C0RH 3EKCA 3EO1A 2ZP0T 4PV8B 1NCCH 4NQSA 5D7IB 3JV5A 3GDBA 3M1BA 1V3LA 4N90E 3MLRL 1MY7A 5I17B 3E6HB 2J1KA 1X5HA 1Q72H 2DB8A 1YZZA 3CX2A 3N50A 3TV3L 3J7HA 3UTTE 1QNZL 2CLZB 3UPCA 2VXQL 5E1AA 3PG2A 4LMQI 5BRZB 2OBGA 1XGPA 4LPYA 1T1YB 3TO4D 1JZ5A 5E4IA 3VCLA 5I0DA 2HN7A 5C09D 4F33B 5E99H 3VWKB 2BNQE 5JORB 4Y5YA 5BMFH 3LKOB 4HIHB 1HSBB 4HLJA 3TZVA 4HV8A 3UAJC 5GZNC 4HF5L 4W81A 4F7TB 1M71B 1CT8A 5EO1B 3H42L 3O4LD 5ENWB 4OZHF 3QHZL 3MYJB 4OLVH 3SO5A 2AXGA 1TJGH 3MODH 1BLNA 2JIXD 5E2JA 4KRMB 4FXLA 4W4OA 2Q8BH 5EU7C 4FXGA 3C8HA 2XZZA 1BFVH 4XNMA 3B5TA 5F21B 3CCHB 5TH2B 4Z7VB 2G5BA 4HGWB 1UWEL 1NLBH 5EZIL 1FNEB 4JHAL 3FN0H 3BKJH 3LD8B 4JJHA 1RIVH 4I2XE 3FO2A 2D0HA 2I9TB 2X5PA 2ZG1A 5C09E 5EIQA 2FLRT 3HA0A 3NIDF 3A6BH 1JNLH 4KTEL 2DIBA 1EERB 3JSSA 5TDNB 3QCTH 1JNHB 3HUJB 1EV2E 1CTNA 3SDXF 1ITBB 4PJBF 5GGUB 3EYUH 4P2OC 1G7MB 3IJYB 3KG5A 4F7PA 2VC2L 2A6DA 3BP4B 4G8IB 4QXUL 4F8TA 4QHMA 4R4FL 1Z9SA 3V6ZA 1FYTA 4U6HB 2P5WD 5JDJA 3ZHKA 4YK4C 4H26A 1ZVHA 2EIDA 3M8OL 1T83A 2GK2A 4YBLC 5CJQL 1J0YA 5AG9A 4JDTL 3ELAT 5IHUL 1U3HB 5BO1H 1JHTB 5HYSG 4QHLB 4YDVA 4ISVB 1HNGA 4XMLL 2BNRB 5IROC 5C07D 3L5JA 3VXTA 5C6TL 2XZQH 1IVLA 3VXOA 4ZAKD 3PQYD 3O3EA 3DUSA 3W39A 3X11A 4OF3A 4M03A 5J12B 5CEYA 3GMOB 2HT2D 1H3PH 1AR1D 4RX4D 2P5EA 5LQBL 1FN4A 4G9DA 4LHJB 3SDCC 4AM0B 2KZWA 3FO0H 5IMLB 2BVUA 3O2WL 3BMVA 1SMAA 3QI9D 4XPGL 5F97E 4LEOA 5DURB 5DK3A 4I3SL 1MCEA 1TPXC 2BOCB 3GSRB 5CD5C 5J1TC 5CP3A 1S9WB 2ATPB 2O61B 3RP1A 4RMSA 1AD9B 2W91A 1S9VA 4MNGA 2IPUG 3MXWH 5DSCA 5H35B 3UMTA 5IGXL 4D0BA 1MFDH 1QACA 4C56D 5JW3L 1NMAL 3RWHA 4I1NB 3S3SA 4KY1H 3ZSTA 1RZJL 3QIUA 2BVPB 5KTEL 1JGDA 4ZUUA 1J8HA 1EXUB 4G9FA 5C07E 4ZFOL 5CINL 5DEFA 1XGQB 5T1KD 3S37X 3FCTA 1MY5A 2OJEA 3OHXA 3S34H 4AH2A 2DTML 4CVWA 4LLWB 4R26L 1OCWH 3WS3A 3MBEB 4F37K 1DL7H 5A43C 4NOFA 3WS6A 3VXUB 1J1PH 2OP4L 1P4BL 4I3RL 2X4NA 3RWDA 5D7LA 4X5XB 2R1WA 3QUYD 2DLTA 3STZB 3ILPB 1KXTB 3EDEA 3VFMB 2H41A 1T0MA 4HFUL 3ECBA 1IEAA 1WWBX 2FB4L 4PJAA 1A02N 5HHME 4Y2DD 1Q9KA 5TPWL 3LS5H 5EOTB 4C56E 3WNPA 2D7OA 4ETYA 1YEIH 3UYRL 4M43L 4XTRD 2VZVA 4M1DH 5KVEL 4J2XA 1N3NB 2JB6B 1WTGT 5FUCE 2GUOA 4I0PB 4XGZA 4Y19A 2X1QA 4XCEA 4QTHA 4FXKB 4JFHD 1C5BL 3WLWC 4H88L 2Q7NA 1TCRA 4TVPD 2CUHA 3R06A 1UXSA 2NXYC 4OIIH 2Q8AL 4NFCA 4QRTB 5CMAA 4YBQD 2R9HD 1UEYA 12E8H 1I9IL 1QSFB 4S1SH 3ARFA 4ENED 5EOCL 4MWFA 4RAUA 5HGBA 3O81A 3P0VL 4MAYD 4N0UE 4ZXBC 1AE6L 1CG9B 3IDYB 4WV1C 1HZHH 3VI3E 5FYLH 4XPHL 4UT6L 2CO6B 2CDEB 4ZPTB 3BH8B 4J3WA 4LGRB 4YDIH 2XWBB 5IOPA 1NFKA 3DI3B 1ETZB 1U8OA 5EWIH 2WBJB 4PB9H 4JB9L 4NRXA 2AW2A 1BVZA 4W6YB 2CRMA 1ZA3B 2DI9A 4ZS6C 3SKJL 4CAGA 1AGDB 5JIPA 4RAVB 4JFHE 3LEVL 1GZPB 3R4DA 3MRKB 4HJJH 1EBPA 1A0QL 5IIEB 5DD6B 2OM5A 3GMRB 5CSZB 1IILE 3O6FD 4ZUSB 2DQGL 1B0GA 3EGSA 1DQDL 5DMGD 4F58H 1DLHB 3AUVA 4PREA 3ARDC 4FTVB 2EKSB 2CIKA 3H6JA 5H94A 1FLRH 1J18A 2EDEA 3DUUB 5I0ZA 5IMMA 4HPYL 3BSZL 3U0WH 4PGEA 2BVOA 5F1NA 1HXMA 4QRRE 3MOAH 4UIKL 4MJIB 4UNUA 2UZXB 5E56A 5FM5M 3QDJD 4RIRB 5EZLB 4GKSB 3ZDXE 4GXVL 4DEPB 2BY0A 1FZMA 3W5NA 1EIBA 5SWSD 1YQ2A 5E00A 1PSKH 1JZ4A 2QADB 2AXFA 4YEFA 2VQ1A 4RMWA 2VISB 4I18B 4NQDD 4HK0B 3BJLA 3D0LA 1MQ8A 5IFAH 3T1FA 2UVEA 2PTUA 3REVB 3QQ9D 4L5FH 5I71C 3GI8H 3CLFL 2A0LD 3ZE0F 4X5WB 3A0OA 3QEQB 1QRND 4HKJA 3HAEB 1Y6MR 5D2LB 1LEGA 2DQJL 3LV3A 5GIRA 3NFPA 3FB6B 5GGTH 2X4TA 3PP4L 4OAWA 3P73B 3QJFB 2IH3A 4U0RC 3WSQH 1ZHBB 3QPXL 5I8CA 3CFKA 3MRPB 5B39A 3BRDA 5L0QC 1OWWA 2EDBA 4L9LA 3DMMC 4TVPH 1WWAX 3W2DH 4K2UL 1IAII 3QDJE 1NKOA 3BGMB 2VN4A 2Y1VA 3CVHA 3WN5C 4PJXF 1LO4L 1N2RA 5SWSE 2OR8A 3B2VH 4P4KA 4PRBA 5FAAA 2A83A 1E4KC 5DQJA 1P7QD 1KJ3L 5DJCB 1OAYH 4NQDE 2DI7A 2Z91B 5D7KD 3VFOA 3UTZB 1ZGLM 5I9QC 5A16B 1GGCL 2O93L 4CJ1A 2VIRA 3W9EB 4X6DA 2AXJA 1QRNE 4GRMB 5EN2B 2VOTA 3CFCH 3QUXB 3BMWA 4KUZH 3KWWB 1IGIH 5F3HA 3SCMD 5F1IB 4KWUA 2RBLA 5CBEB 1RJYB 4ESKA 2VABA 1A6WH 5C0BD 4ODUB 3MROB 5DFVC 2ZOKB 3LEXB 2FJGA 1A1MB 4NKOB 4KTYA 4FQXA 3BN9C 4BKLB 5HVHB 4KRPC 1LE5B 2XQBH 1RJLA 5FHBL 2C3GA 4XP9L 1OAUH 1R3JB 3OZ9L 1PG7X 5D7KE 2VAJA 4PJ8A 5C8JA 3HFMH 1DR9A 1LD9B 4P2RD 5DMKB 2H26B 1GXEA 2X70B 1YEKL 4PY8I 5HDLA 1A6TB 2M2DA 1QSEB 4KHTL 4MX7A 2VYRE 4MXVE 3WIIL 4YXHL 2PNDA 2J8UF 3L6FA 5EIIB 2YBRB 2BNUA 2ILLA 1MWAB 4U1MA 1Q9LA 3HZYB 4HKBA 2GSIA 1E4XI 3DARA 5C0AA 1DANT 5C0BE 3C6LD 3TGXA 1KB9J 2B5IC 4M62L 3UBXA 4JN1L 5E5UB 1VENA 4ZG1A 1U8MB 2A9NH 3NN8A 1KCVL 2I9LA 4HFWB 2EXWD 3KPSB 3Q48A 1MIEL 5IVOA 1CK0L 2FR4B 2X4SA 1KLGB 1CGSH 5I1HL 2YN3A 3PGFH 3FO1A 2BVYA 2OR9L 4KXZI 5LBSL 1RZGB 4PY7B 1B6UA 1JI1A 4G7VL 4Z8FL 4P2RE 5I1JL 1MCIA 3RFZC 2X9WA 2PO6D 4FQJL 1R5VA 3B3IB 1OP3K 5F7WC 1ND0B 3BN3B 4W4OC 1MJ7L 3DBXA 1RK1A 1P4LA 1NPUA 5ANME 2G2RB 1YNKL 3RVWD 1NH6A 1Q0YH 1O7SA 5ALBL 3AM8A 2PW1A 2A74A 3P9LA 2BCKB 1G6RB 4XAKD 4GKZB 4Y4KD 4FS0A 1MNUH 1U95B 4OTXL 4OZHB 4KQ4H 4HKXB 1PLGH 4ELKB 3FTGB 3N9GL 5ALCH 1EFXD 2IBGA 4HUNB 4PV9A 1MLCA 2J8OA 4ODWA 4URTB 2RCSH 2AK1H 4U1HA 4KUCD 3LQAH 4XT1C 3OAZK 3H9SE 5GRZA 32C2B 4XVUC 1F4AA 1UJ3B 4PRHD 1Y6KR 4XNXH 4RGOH 5JNYB 4YIQA 4IRZL 1WT5A 1DJSA 1U2CA 4LPXA 4P23A 1T04A 1G7IA 4DVRH 5HYSB 1IAIL 4JZNB 1UM4H 1HYSD 2DYPD 3KPNB 3KLAB 3LCYA 1XCQA 3IF1A 1T83C 3JWDC 2J7LA 4PJFE 1LDPH 1OP5H 3G9AB 4UT7H 1JHKH 2Z8WC 4P2QD 1ZGLP 2JK5A 3BDXA 2FGZA 3BP5B 3RTQD 3V79C 4PLKC 2HTKC 4LARH 4H1LH 1BJ1H 1PX3A 3QXTA 4NKDB 5FCUL 1MI5A 2FZ3B 2ZCKL 5D5MF 5F7FA 4OQTA 1W0WB 2MKWA 3LY6A 2HTLC 4V1DB 1YEDA 1TQBC 4K8RD 1DQQA 3ROOB 2H8PA 2XQYG 3TIEA 4Q0XL 4PRHE 3DXAB 3ZKNC 4DGVL 4FQLL 1F00I 3DECA 3AGVA 4BYHA 1HYRC 2ERJC 3SDAB 2XTJD 5JLZB 4PS4L 5AZEH 4AT6B 1GGUA 1OHQA 4NSKB 4JLRB 1MHPH 4YHZH 2EDJA 2FD6L 2IANE 3B9KD 3IDJA 5IMKB 5JW4M 1KTDB 4KI5D 3SPVB 5DRWB 1AXIB 1G0DA 4NHUB 2NYYD 2CIIB 5ICYB 1VFOA 2I24N 5JHDA 1RZIB 2Y5EA 3M17A 1HXYB 4M6MH 3DURA 1KIRA 2CXGA 4HC1L 1J10A 5DD0L 4XVTH 1CLCA 1OB1B 1NCDH 4CADA 4RISH 4JO2L 4NM4H 4YBHA 4NM8L 2AXHA 2IH1B 1JV5A 1SMOA 3IFLL 4PJIF 4LKXA 5FO8B 4TRPL 3SGDH 3QUZD 1E4XL 2J8HA 5FA4A 5E8DH 3VFGH 4DAGL 3BZEA 4YQXH 3DV4B 3SBWC 2VWEC 1XF2B 3O6LH 2XTJE 4KROC 3QDMD 1MFCL 4M48L 3NABH 5AUMB 2J4WL 3SOBH 3FZUC 1XEDA 3CSYA 1GIGH 4KI5E 2FWOA 4R96A 3IFNH 4Q9RH 2PYEE 1J5OH 1KLUB 4WGWB 1PYWB 3OSKA 3HZVB 1DEEA 4XP1L 3K3QA 2NY5C 5ERWB 1JIBA 3IAQA 3CSBA 2D7TL 4EUPA 1T3FA 5DZLA 2BERA 3O3BA 4RNRB 3IXAA 5FB8B 4D9LL 4RRPG 4H0GA 4WU7B 3P9WB 4JM2A 3HC3L 1EVTC 2FHCA 4KK9C 1SY6L 1LK3H 5E2UH 2VLRE 5CEZH 3MFFB 3V7AE 5D2NE 3ARFC 1BPVA 4KV5F 4NWTH 1JHLL 3T0EA 3P11H 3QAZB 1IKFH 2V9RA 1PKQA 4HD9A 3D3VB 4IOIA 4OLYH 3AMLA 3VXNA 5JQ6H 1CFNA 2ZUUA 4HGMA 1OF2B 4RMTA 1F97A 4XBPA 3S96A 3QDME 5DQ9A 4YEEA 1Y6NR 2X4UA 1A9BA 1FNGA 1G7JA 1HI6B 4R3SA 5IWLA 5HHOA 1KBGH 1PW3A 4LOUD 1XR8A 5F9OL 1ZT1B 4HXBL 4HEME 4BSVB 1C5CL 1NCBL 3FN3A 3ZE2E 3A6CL 3F5WA 5TQ2H 4QRQA 2AQ1A 3U9PH 4XH2B 2PTTA 3JVGC 4F9LA 4JQVA 2P47B 3BPCA 1Z2KA 3S37H 1LO5A 2EEBA 5E24E 2ZUQC 4AIZB 5EO0A 4NUJA 1X5GA 4R0LA 1JN6A 5D1ZC 1H0DA 2EYTB 2RAMA 2IPKB 3HB3C 5EDXA 4OD3H 4YHYC 4PJ7B 1KYOJ 3MRNB 4HIXH 3JWOC 3ULSA 2UYLB 4ZTPH 4UB0L 5BXFB 1I7RA 3GJFH 4XMPL 4PJ5B 3WLBA 1OAZL 1MJUH 1MUJB 4P2OB 1OTUC 4PJ9C 3X17A 3DVGA 3MRIB 5IEHB 3GSOA 3CX5J 1UH2A 5IQ7H 2ARJB 3IXTA 4UV7L 4OSUL 3V5HA 3IU4H 3MLUL 4HS6A 2UZYB 4YK4B 4APQD 1UA6H 2AJZA 3QRGH 4YBLB 1G1YA 2NY2C 3NAAH 4FMKA 3TVMB 3DYMA 3DGGB 4M6NH 4WHDA 1MRFL 4HIJA 2XZCH 2W07A 4HS8L 1GH7A 4CDGC 4OB5H 1YMMD 3CFIC 3X12B 1S7VA 2AK4D 4WNQA 5KSAA 2OQJA 1S7UB 2R0LH 4LNRA 2AV1A 4PJEF 4YR6A 1BZ7B 5T3ZD 4UINL 2ZSVB 1JYWA 2FEDC 3SDCB 3CDFA 3K2UL 4L9LC 4UOW0 5JO5B 2CXKA 3FOMA 3BAEL 1NEUA 4Y16C 1EHXA 1NLDL 4LPVA 2XKSA 2EYSA 4NCC2 3ZDZE 3OKDA 2J2ZA 4WY7H 1A6AA 3I6GB 3QIBC 1IBGH 1MPAH 4YNYB 4NBYB 2DKSA 2FRGP 2ZKHL 3IKKA 1F5WA 3U4EA 5DYOA 1LMKA 2AAVA 5GGQL 4HAFA 3RA7H 3EJZD 2N7BA 2EICA 4EXKA 4LCWA 2EDXA 4R2GD 2AJYH 1CD1B 5TE7L 3T2QA 4WIQA 4KJPC 4P59H 2VZ1A 3TCXA 3QPQD 3O0RH 1C1EH 1HQ4B 1OARH 2DQIL 3E8UH 4P5TB 4NO3A 1ZHNA 2QEJA 4LP5A 2CGRH 3GNML 3MRFA 4K8RL 4OGAD 3WBDA 4L4TD 2X89A 3QQ3A 4UI2A 4UTBL 3IDNB 2F5AL 1JZ6A 1CFBA 2QSQA 2ZOLA 1X7QB 4F57L 1QVOB 1WBXB 1D5ZB 4JFDB 4TSCL 4WFHE 1J0IA 3VXMB 2Z4QB 4XCFL 3VH8B 4ELMB 6CGTA 1OY3B 3RNKA 1CIDA 1KTLA 5EUOB 5JMOC 4M7LH 4NT6B 1JYVA 1JCKA 5BRZD 1A2YB 5I8OL 2W0FB 3GSVA 4BK4A 2VZOA 3ARGB 4XZUA 1EO8H 2QHRH 3SE4A 1A1NB 2NZIA 1G9ML 3VWKD 5IKCA 1AC6A 3CU1A 4NPYA 2FL5A 2HLAB 3BIKA 1FIGL 5D70H 2FGWH 3VJ6A 2NXYB 4OCYL 5DUBB 5F9DC 4P3CL 3L9RA 5KZCB 4RBPH 1RSFA 3L3GB 3FT4B 4HWUA 5I76B 4M7JH 5SWQA 4JDVA 5EFIB 1BFTA 3TO4A 1Z5LA 3QB7C 2WW8A 4I2XA 5D7IE 5I8EB 4PRNA 3HRPA 1D5XA 2OL3H 3OKNA 4ZXBB 5LKNA 4NRYA 4WV1B 5C09A 1TETH 2Y72A 4LRNH 4LF3B 2A1WL 5HYJA 3U79A 1HQRB 3P0YL 5HDQH 4EI6A 2HVKA 2J8UB 2HT3D 3IDIB 3DJ9A 4XPAH 2WQ8A 3IKCA 4MJ4A 5BRZE 1T7VA 2J5LB 1LK2B 5E2TL 1T1XB 3O11B 1QBLL 2YPLE 4X4XB 4CN1A 5KSBE 3O4LA 3PWLB 1UWGH 1IL1B 4OCXL 5T3ZH 4KGJA 4KH2A 2EDNA 4ORZC 2JIXA 4B7LA 3FO9B 4WCYL 1KXQE 5CZVH 3F62A 2MPAL 2ICWB 1I8KB 1T1ZB 3U7WH 4H25B 3S5LA 2P1YA 2ENSA 1JRHI 1A4JA 2R0KL 3ARDB 3TBTA 3SDYH 1UXWA 4Q9CA 2EE2A 5HTSA 3NCJL 1NGXB 4Z7UA 4CVZB 2CMRH 1ORSA 1MCRA 1T6WA 2A73A 4ONOA 4XHJD 4O5LH 4GAFB 1S5HA 5D96C 3DRTA 1DSFH 3BVNA 5IW6B 4P9HL 4Z7VE 3BKCH 4HWZA 1PG7H 1Y0LA 1MQKL 5GS2D 5KSUB 3RWCA 5I30L 1U3HD 2COQA 3GB7A 1KJ2L 1S7TA 4J6RH 4P23C 4OD1L 2BNRD 5FOBA 4X6CA 3K4DA 4NNXA 4WU5B 4I4WB 2GJZA 2P5WA 5EBMB 3T0VA 5FYJD 1DVFC 1OLLA 3FKUS 3U36A 5I71B 5L2JB 2HG5B 5MERA 3RWFA 3NCEB 5DURD 4OZGE 1UKSA 3PHSA 4Q97A 2VXQH 5F3BA 1XF4B 4OBSA 2NW3A 5DHYB 5C07A 1NC2D 2P49B 2E7LA 4U0RB 1N64L 1JBJA 5HI5C 4CUCA 4ZAKA 1NSNL 1X5LA 3PQYA 1JP5A 4GUPB 3H7BA 5E4EC 2J88L 3P9MA 4RX4A 4MGXA 3E6FB 3DMMB 1KB5L 1HOCA 3ARXA 1JGEA 3WN5B 3BD3A 3QI9A 2GHWB 1IGCH 3S35X 5BZDB 3GMLA 1NANH 2BNRE 3NPSB 2JKXA 4JVUA 1GOGA 1FPTH 5B39G 1FL3B 2WUCL 3BKML 4ZNEA 2YPKB 1AHWA 1IEHA 1K3ZA 5I9QB 3G6JE 4JKKA 1B0RB 1QA9A 1F6AA 4JFZH 1WZMA 1IM3B 3GSNB 2DD8L 3MBED 5D5MB 5FYJE 5ID0B 1SJHB 5GRYA 4C56A 3RWJB 4V2BA 3VXUD 4CL7A 3CLEL 4EKXA 1EHLL 2IEPA 2Z31C 5EZIH 5CEXB 3A67L 4W6WB 4UIMB 2B20A 3BRGC 3GSQB 1DQLL 5T1KA 1DCLA 3WE6B 3BRFA 4XVJL 2P8PA 3L7FA 5DTFB 2ZWLT 3RQ3A 2F8VA 5CP7B 5DRXA 4I8DA 1H3XA 4GAYB 5GRVK 4TUOB 1EEZB 4POZD 4I0PD 3OGCA 3QUMB 4JRYB 5JHLL 5HI4C 1AFVH 4KRPB 4OM1H 1RJZA 1RUPL 3QUYA 4N0UA 5BQ7A 3FQWB 1WFTA 5DUML 3T8XB 3VA2C 2D9CA 3FB5B 7CGTA 1C08A 1DN0A 3UYOD 4NZTL 4RGNC 1IM9B 1CS6A 3DVFA 1KIQA 4CVXA 4MJ2A 4Y2DA 35C8H 4H8WC 4PJIB 1QSFD 5GGTA 3CDYA 5D71H 1A9EA 3KLDA 3CFJB 2YD5A 2I5YL 1QR4A 1QUNA 2Q76A 1IQDB 2VH5L 2YWYA 4X7FC 4M93C 4XWOD 4PLOB 2XXCB 5IBLD 1CD8A 4G80A 3NCCB 1EAJA 1RURH 2WBJD 5I1KL 3V4UH 3S7GA 4XWGL 4I9WE 3VXRB 4OT1L 4Z7WE 4MHHG 4XP4L 4HJGA 2AJSL 2AEIT 2B5IB 3DVNA 3F8UB 4TTDD 1A7PH 3T0EC 1ZAGA 2NZ9D 5K59E 1JRHL 4IHOA 4MDJB 3S98A 3VE0B 4XPGH 4MAYA 2FHBA 4QNPF 4RFOL 3KYOA 3C6SA 4WENB 1MJJA 2XN9A 4XI5D 5AYUH 3ZKXC 2NXZC 2EE3A 5L2KB 4IMKA 1GGBL 5GS0L 3ROLB 1TCMA 1FORL 3HCVA 4FTVD 4DCQB 2QSCL 4DKFL 5IGXH 5DS8B 2KQNA 4MCYB 4MJ5A 2EH7L 1A7BA 3VRLF 4F9LC 4JQVC 4XNMB 1XF5A 3KHQA 2LAGB 3GI9L 3O6FA 4MJID 25C8H 5DJ2A 4F7CB 4LLYB 2V17L 3PWUB 3ALWA 3SGEI 1UQSA 4PG2A 1RZ8A 4R26H 1Z9LA 5FHAL 1N4XL 4CDHA 2NR6C 3I85A 5ICXB 5B8CA 2XWJA 2WNGA 2QADD 5DEGA 4ALAH 4GSDL 2Z92A 2OP4H 2XI9A 1XZ0A 3TPUA 5KN5B 2MQCA 4I3RH 1R6VA 4N9GA 4PD4K 4S2SB 1Q94B 4ORGA 5FKAB 1DUYB 3DYOA 1RVFL 1S9YB 4LSPH 2IALA 3QEQD 4R6UA 1HILA 4KMTL 3QDJA 2FB4H 2APTA 4FTVE 4QKXB 4F7PB 4PUBL 5SWSA 5BJTA 2YSSB 4ZS7H 5MENB 4JFOB 5MEPA 3CFDA 4M7LT 4B7IA 4KPHL 3PIQB 4MJIE 2BDNL 5DRZA 1A21A 1RUML 1AI1H 2VITB 1O7VA 2Q8AH 3EJJX 1HINH 4QF1B 4G7YL 5DUPH 2ZSWB 5HXMA 1P1ZA 5DK2A 4ZFGL 3KPPB 1J12A 3W39B 3X11B 5KSAC 3ESUF 3KJ6L 2LVCA 5CEYB 3CK0L 4BFGA 1GRWA 1YNLH 2IGFL 1TQBB 5FCSH 4NWUH 1DQTA 4OCMC 4DN3H 4TUJA 3MR9A 3QEQE 4MQXD 4F7EA 2DJ4A 3O3AA 1K4DB 3QUXD 4OF6A 2ERJB 2HJFA 1XF1A 4FZEL 3HI1B 1S9VB 4HT1H 4NQXB 1V05A 1WFUA 4CW1B 3GSWA 4HKZB 1P7QA 2SEBB 1HHIB 5KOVC 3LEVH 4WI9A 4PJEB 1Q9WA 4JY6A 2R4SH 4POUB 4GQ9H 3UJTL 3OX8A 1N0LA 1J8HB 4KZDL 1FVEA 4XC1L 1DQDH 3BJ91 2CK0L 4X4ZA 5JA9A 3H3PL 2GK0A 3IDMB 1WCBB 4WUKH 4CNIA 1LNUA 5TE6H 3OF6D 4OCSL 1FBIH 4LLAA 3DROA 5IP4A 5C0GB 2CLVA 5GHWH 1MAJA 5C0BA 3IJHB 4AL8H 4QRSB 2BSRB 2FJHA 1LO0L 1K2DB 1SM3H 3RWDB 4NBZB 1QSED 2R1WB 4KKCC 3HR5A 4NQUA 3QFDB 4KROB 2VXVH 4JGUA 4ZOEA 2R23A 3AFLA 4M5YH 3GBNH 1ZHKB 1FFOB 3V7MA 3WHXA 1CVSC 1ZEAH 3SE3C 4XNQA 2V6HA 2HFEB 4LRIC 1M6OB 4XCYA 4H1LA 2YK1L 2GFBA 2PETA 4FFYH 4GRLC 3CLFH 3KPSD 1PDKA 4UDTA 1UXSB 4HPOL 3WFEL 4ZSOE 2VLJB 5CJBA 2DQJH 3NCFB 5H8DA 3ZYOA 4Z0XA 1YEJH 4H0HB 5C7XH 2PN5A 1IGTB 3OKEB 4Z0BL 1YMHA 3LHPL 1X5AA 4ZUVB 3C6LA 1FNSH 5DJYA 4EUPG 3S88L 4GRWB 1WCQA 2VDQH 3LIZH 3GMNA 2CKBB 2X1WL 4OCWH 2GY7B 3RPIB 2EIZB 4XCCL 2E7HA 4JZJA 3UO1L 1CU4L 3BWUC 4U6TA 4N0YL 1ZVSA 2DQFA 2ESVB 4UUJA 4K07A 3TLRA 2LFGA 4K94L 1C16A 4FN0A 1Q0XH 2YUXA 3MA9L 2ORBH 1KSRA 4XPBL 1KEML 3ILQD 2Q20A 1QSVA 1V8HA 4NO5A 2DM3A 5JQHC 3PGCA 2PO6A 1R3KB 3DSFH 3MJ8B 4LSQH 4NCDA 1BOGB 2R39A 4ONHB 1U8LA 3BX7C 3ETBF 2FO4B 3VWJC 4K7FA 1G7HA 3W11D 3G5YA 2F58H 1YY9D 5A40E 3HG1B 2ZUQB 4PJFA 1FVCB 3OR6A 1F11B 3T4YA 4PREB 5IEKB 3F7VB 5D1ZB 4Y4KA 2CIKB 1U8KB 4JRXB 5E6ZA 4HWEH 3BH9B 4XCNB 4YHYB 2EDTA 5HD8C 1OT1A 1MHEB 2VXTL 1M7DB 1EFXA 5DK0A 5C0ND 1QBBA 3FRUA 3VGFA 4XNUL 4D3CL 4G43A 3WDJA 1ADQH 5BV7B 5C0DB 3EIFA 3UEZA 1NCWL 4DGIL 1JPTH 3OZ9H 4FNLL 4M8QA 4PJ9B 3MJ9L 4PRHA 3U9UA 5J3HD 4NO0B 1WZ1H 5FF6A 3Q6FB 1DN2A 3U7YL 2R1YA 1WIUA 4ZDHB 3D69B 3SGJC 1M7XA 1VCAA 2VXSL 4YC2B 4V1DD 1QPXA 4FQHB 1LE9B 1VEPA 3F7YA 5FYJU 1I1AB 3AAZB 1FO0A 4Z7OF 3WIIH 2NY2B 4S11A 1FSKC 1OAKH 1U91A 4P2QA 4LKCA 3QXVA 3DXAD 1MWAH 4YJZL 3FB7A 3T0XA 5GIRB 4CJ0A 2E7LC 3MCKA 3SDAD 3RTQA 4JHZA 3VFVB 3UC0H 3KXFB 4Q2ZA 4N0RA 4JN1H 1GVIA 1JGLH 3DTXA 2HT2C 2AV7A 3BW9B 2ZCHL 1A5FL 4ZO8A 5T1MB 1JNJA 4L9LB 3FQXA 4GQPH 1RUQH 1CK0H 5IVNA 4HQQL 2XNAB 4YHIB 1CGWA 4KKLD 4O51A 4Y16B 3CVHB 5I1HH 3QI9C 4GW4A 4X98A 1AQDB 5TE4H 1SBSL 1YJDC 4G6JL 5GJTL 3DETC 3MRRA 2C4XA 4EBQL 4PRBB 3QNZA 3MOBH 3QIBB 4WFGD 2R1XA 1I85C 3SKNA 1JZ8A 3X13A 4HUUA 4P4RA 1OTSD 4YHKL 2EECA 4FQJH 3VFOB 4PJDF 2VR9A 4JR9H 4V1DE 5A2JH 5IVZA 3B9KA 1LO3L 4Z7QF 2YD7A 2PYFA 3RL1A 2QQNL 4X6DB 3W0WB 2HP4A 1ZS8A 1EA9C 5ALBH 1KG0B 2VKWA 1X6NA 2JJVA 2BSTA 1UKTA 2UWEB 3I3EA 1W72L 2C7UA 5CD3A 1UZ6E 1G6RH 1PEZA 1YN6B 3GJFA 1QEWB 3N9GH 1S7QA 2NTSP 2XWTA 1VERA 3STLB 3SY0B 2GITA 3VFUA 5CWSB 4JFXA 3V4PL 4XAWL 3VRIA 5D2NA 2XZAL 3QUZA 4OGXL 5DVMA 2CO7B 3IRPX 3D18A 3ARBB 2NY7H 1DDHB 4QY8A 2WMPA 4WFGE 3AU1A 1H8SA 1U3JA 4BZ1L 5JPNB 4LSUL 4YPGB 2VAAB 5HYQB 3QDMA 2KQMA 5C8JB 5ESQA 2I07B 4FFVC 1LP9A 4EIGB 3IYLW 4J1UA 4BSJA 5E95B 3TJHC 1VFBA 1OPGH 1WK0A 4IJ3C 4YHOL 4XTRC 3B9EA 4LAQL 4E5XA 3D3VD 4K3DH 1IAKB 4MX7B 4N8VA 1VADB 1KCRL 1MVFA 2X1PA 4O00A 1YEFL 3QWOB 2AEQL 5INDB 3BP6B 3I75A 5D7JC 2BNUB 3Q2CA 4U1MB 2VL5B 1MAML 2GSIB 3MLZL 4FZ8H 4H20H 4UOJA 3SDDA 3PL6C 4MA1C 3FT3B 3EDJA 2R9HC 4BQ6A 1IC7L 1D6EB 2AEPL 3MV11 3T2NL 5ITBL 5DZNA 1JPGA 1GHFL 1CIUA 4MNQB 3O45B 4I77L 4WI3A 3JUYA 3S35H 1CDUA 3BE1L 4Q0XH 4FQ1H 2FNBA 3D85A 3E2HC 4FQLH 4O2EA 5BS0A 4P48A 1LGVA 1YY8A 4PS4H 1H3UA 1SJEA 1JTOA 5KVDH 3M07A 1UYWL 4U1KB 5DRNB 5I74C 2X4RA 4NKIH 5GSRB 5H2BB 2AGJL 1ZTXH 4MVBC 4XXDB 1RZKL 3D3VE 2WAHA 1NAMB 5CUSH 1U8PA 1V7NL 1QD0A 3L1OH 4HC1H 4G8GB 5DD0H 2PW1B 4DW2L 4DUVA 1HDMB 4XVSL 1ZKAA 2BHUA 4PJ5D 4JZOB 3WXVL 2VSCA 3MBXH 3G5ZB 1YPZA 4P2OD 4N1HB 4PG2C 4RFEB 5SX5K 1D5MB 5DMGC 4Y7MA 5IJKA 3EOTL 1RHHA 4UT9L 3KPMA 2H2PC 3HPLA 1N0XH 4LLDA 3SHSA 3DYPA 3RUGB 5HSFA 4BQBA 5EU7E 4MQTB 3NA9L 1WIPA 5DLML 1BAFH 3S5LG 3TH2T 4LQFL 3V0WL 5D96B 1NGYA 2A2QT 1KN2L 1J0ZA 1LHZA 1UENA 8FABB 3FONB 4G3YH 3TVMD 5J9PA 1VGEL 4GAGL 4P23B 3RI5F 3OAZH 5BVPL 1MAKA 4OZ4A 4PGDB 4PJ7E 2DWDB 5FGCE 5FYKE 4PB0H 4HG4J 4Y4FA 4MQ7B 1CQKA 2A6KB 5K9QI 4M4RA 3TBSA 1I3RB 5EU3A 3IF1B 3MGOB 2UVFA 5IHZA 2P46B 1L7TL 3WV0A 1OAQL 3SDCD 1DVFB 5JOFB 2NX5B 4D9QD 3GUTA 2XRAL 2JJSC 2PKDA 4PJ5E 4L8SC 2OL3A 3GMMA 3OAYK 2A0LC 5MP6H 3HC3H 1I7TB 2ATKB 4YHLH 5CD5D 2BY1A 1MCPH 3UROR 3ARVA 1QLEH 2WV3A 3GGWA 3BD5A 3MUGA 4JPKL 3W81A 5CSBA 1FZJB 1YMMA 3E1F1 3C5SB 2X4PA 5E4EB 2AK4A 1AKJB 3QCVH 1KPUB 4M1GL 1F42A 4GW5A 4JFEE 1F4WL 3DX8B 2JCCB 4LPWA 4GG6F 1CFVH 1YUHA 4Y1AB 4N0FB 1NDGA 4WO4B 5DHVB 3ZTNH 4P5TD 2W65B 2DOCA 4LAJH 3ZT5A 1NBZA 2BVQB 4Y5VA 4JKPL 4A6YL 3A6CH 5EOCJ 2XA3A 3Q0HA 3RY6C 4QGTA 4D9QE 4R7DA 5J6GB 3L3KA 3EOBA 4AK1A 3M17B 1LWRA 4PGJA 3HMXL 4LIQE 2Z31B 1MSPA 2E6QA 3LQAC 4JFDD 3QH3A 4X7SL 3C60A 2BXYA 5IB3A 1KB9K 3VXMD 1F4HA 2BK8A 1X5ZA 3MYZA 5KOMC 3BPLC 3QISA 4JAMB 2HRPL 4L4TA 1TLKA 4CGTA 1P2CB 4G6KL 5FA4B 1UKQA 3ARGD 1E6JL 5M7QA 1WICA 4PV8A 5D7IA 3WLWD 1OAZH 1KULA 4ZYKB 1G7LB 4NQEB 5I17A 2VDOH 2Z8SA 4UOW1 5FEBA 3E6HA 3GHEH 2NXYD 5KZCD 2D3VA 4JN2B 3QDAA 1QO3B 2WUBH 4RGNB 2CLZA 4R90L 5BRZA 3UPAA 2V2TB 1OM3L 1UC6A 2R2HB 3V8OA 4LCUB 3AY4C 1T3FB 2W92A 4ZXBD 3O3BB 4F33A 5MEOB 3VWKA 4M93B 5C0CE 3VXME 3MRDB 1OTTC 3QQ4B 1MRFH 4ELME 4MB5A 1RULL 1HSBA 1A6UL 5EUOE 1FL6B 3JUZA 1BM3L 3BGAA 4K7PX 5I15H 4F7TA 3CDGA 1M71A 5EO1A 1QHOA 4ZS6D 5ENWA 3EDKA 3T0EB 5C08B 3MYJA 1IC4L 4IOIB 4ZMAT 1CE1H 5AG8A 2JJWA 1XAUA 3LMJH 4BQ8A 1ACYH 1NMCC 4LIQH 4UDUB 1A9BB 4JO4H 4BJLA 1LO2L 4QRPB 3ZKXB 5CCKL 5EA0L 3CCHA 5TH2A 4Z7VA 4HGWA 5HHOB 4DKEH 1KPVB 2DJSA 1FNEA 3ARDD 2OZ4H 3LN5B 2NMSA 1CDBA 2I9TA 3ZDYF 3WJJA 2DQEL 4CMHC 4YX2L 4QEGA 5TE7H 3BPCB 2XACC 7FABH 1ZWIB 1YNTB 4KAQL 3NACH 5TDNA 4WFFE 4KU1A 1JNHA 3CH1B 5BZWB 5ID1B 3HUJA 4N8CL 1H5BC 1GOFA 2E3VA 4KVNL 2R2EA 1G7MA 1B4JL 4BQCA 3IJYA 3C09B 3LPGA 3IJSA 3BP4A 2AI0H 4G8IA 4HDIA 3WFZA 2GJ6B 4NZJA 4AIOA 4ONFL 4U6HA 1EAPB 2ED8A 1N5YL 3GM0A 3UTSB 1BGXH 1A7NL 5D6DA 5FYKL 5A2FA 5AD0B 1AQKL 1U3HA 1JHTA 5HHXH 4QHLA 1A4KB 5D8JL 1C7SA 2VR4A 4ISVA 3PP3K 2BNRA 2HFGH 1I1YB 5EOQH 3TBYB 4LPUA 4U05A 4B41A 5DR5L 4GT7A 5IB4B 3OAUH 4HS6B 5DC0A 4NZRH 3GMOA 2AJZB 3QSKB 3DMMD 4AM0A 3MXVL 5A2KH 5IMLA 3KPTA 3I3BA 2LVEA 4O4YL 3BGFC 3QO1B 1ZV5A 3D2UB 5K9JL 1WFOA 2BRRL 2BOCA 3GSRA 3E3QC 3LQZB 1S9WA 2ATPA 2O61A 1NC2A 3A6OA 1AD9A 1TJHH 3I6LD 4K71C 4KKBC 4OLUL 4TSBL 4KZEL 1GGIH 1P69B 3U2SB 5H35A 4GKNB 1D5IH 3JTSB 4ODSH 4TNVK 4JE4B 2G9HB 1KEGL 4L8CB 1P4IH 1ZA6B 2BVPA 3L3OB 1HCVA 1IGYB 2EC8A 1EXUA 1SYVB 3I6KB 4JHWL 4OKVA 2IPTL 4JVWA 1XGQA 3QEGH 1F4XH 3QR2A 3T3MF 3U4EB 4WCYH 4LLWA 5DYOB 2W9DL 4M5ZH 1NGQH 3Q5OA 3V6OA 4Z78B 1FFPB 1A22B 5DFVD 1MRCL 2MPAH 2NYYC 1MCLA 3GHBL 4JRYD 3VXUA 4FQ2L 3BN9D 1GOHA 4KRPD 3FFCE 4KMQA 4X5XA 3RZWA 3STZA 1ZHNB 3ILPA 4OM0L 3VFMA 4W70A 2BFVL 3MRFB 5GRUH 4X4YB 3U0PB 1VFAB 3GKWL 2C3XA 3GEWB 1IM9D 3QQ3B 1QLFB 2DWEB 5MI0C 5EOTA 1RZFL 5JR1H 1N3NA 2JB6A 4PJAF 4I0PA 5C70A 3PV7A 4NYLA 5I30H 1BBDL 3AMKA 4FXKA 3QFJB 3FAWA 4OD1H 1LEIB 1OSPL 4JG0L 1AY1H 1QTYT 1VDGA 2DQTL 3PXJA 4QRTA 3VXRD 3LH2H 1N7ML 4XNYL 3WD5L 2Y06H 1YEHH 2DLHA 5I1CH 3C5JA 1QSFA 4JRYE 2XFXA 1P6FA 4GRLB 1JE6A 3NCBB 4U1JB 2MCPL 4NJ9L 3RI5K 4MYWB 2W0LA 1CG9A 1X4ZA 1DP0A 4JFPB 5EO9B 2CDEA 3BH8A 4IM8A 2XWBA 3SDDC 1KYOK 4QXGL 1CXFA 5L2KD 1N64H 1ETZA 4H1LG 4IDJL 2FATH 1F3DJ 2EEDA 2WBJA 1CF8L 4J3OC 4JDVB 1BWMA 1IQWL 1DBAH 1ZA3A 4PRPB 4L4VB 1BZQK 1KB5H 1AGDA 3I2CL 2ARJQ 2CRIA 4RAVA 1G7PB 2RFXB 1GZPA 3MRKA 3ZKQD 5HYJB 1OWRM 5IIEA 3S36L 5DD6A 3GMRA 5CSZA 1TQCC 4WW1A 3CX5K 4IOSD 3BKMH 3IKCB 2XY1A 1EGJH 1S5IH 1DLHA 4FTVA 2DD8H 2EKSA 3O6KH 1SEQH 1YQVL 3DUUA 5CKAA 1B6DA 4K3EH 3GIVB 3VWJB 4WW2C 3NZHL 1UB6B 5HJ3B 1T5XB 2R0WL 4K3GA 1DQLH 4ODVL 1ZOXA 1CLOL 4RIRA 4XVJH 5EZLA 4GKSA 2WIIB 3TBTB 2V5YA 3AXLB 1B0WA 3L7EB 5MEND 4U3XA 2VISA 1HHGB 4HK0A 1EUTA 3BVNB 5CZKA 3QG7L 2X4QB 1XGTB 4PG9B 1CDIA 3REVA 5DUMH 2EDYA 3UX9B 2OSLB 2P7TB 4OZIF 4M00A 1T0NB 2GSGB 3QEQA 4PY8J 3WFBL 3HAEA 1RU9L 1X44A 5FOBB 5D2LA 5HHVH 5EZOH 3D39B 4Y4FC 1MVUB 4PLKD 2HTKD 4F7MB 1S7SB 3P73A 3QJFA 4KK6C 1ZHBA 5J0BA 1JPFB 1QKZL 2X9YA 2I5YH 3MRPA 4GMSL 5L8JB 2B4CH 43C9B 5J7CC 2VH5H 1F2QA 3U36B 2E5EA 1FSKB 2H45A 3WNLA 3BGMA 1QOKA 3ZKND 2F54B 2NW3B 4XWGH 2O5XL 3K80A 3U83A 5L7XL 2GAZB 1EFQA 5SWZB 2MHAB 5MENE 2B8OT 5JPMB 3H7BB 5DJCA 1IAIM 3VU2A 1Z0MA 1BMGA 2Z91A 4OCNC 1CI5A 3UTZA 5A16A 4RFOH 1GL4B 1NMBL 3QI9B 4TYUA 2IFFL 4RFNC 1CICC 4GRMA 5EN2A 1GGBH 4HJ0C 4U1IB 1VESA 3GIZH 3QUXA 1YYLH 3KWWA 5BW7A 1KFAL 5C9KA 3ULUC 5F1IA 1XH3A 4PJCB 3O8XC 1MREL 2HKFL 2P5EE 3ZYIA 1EDQA 4DJMA 3G5VB 5GRXG 1RJYA 3OR7B 5DJXB 5F7HA 4ODUA 3IFOB 1IEBB 1RAMA 2OJZL 3SN6N 1E27A 3GI9H 1R0AL 3LEXA 4LHUB 4XPTL 1A1MA 4NKOA 4G5ZL 4EQ2A 2WWKT 4BKLA 3C60C 4PJGF 3U4AA 4AEHH 3WXWH 4KROD 1ADQA 1LE5A 4MNGE 4ONGH 5D1XC 3GSNL 3FZUD 2EH8L 4IS6B 2P8PB 1R3JA 4YZFE 3UZEA 2DLFL 1BZ9B 3OF6A 4Z7NE 1MFNA 5GSVB 1FLTX 1LD9A 1MRDL 4RMRA 4D0CA 5DMKA 5J06A 1J8HE 1Z0NA 2H26A 3WFCH 1YEGH 5L8LB 3QZWB 1QSEA 5F96L 2VLJD 1HEZB 4M8VA 1YC8A 3ZL4L 3UYPA 2YBRA 4KK9D 3ZHDA 2FX8L 4TSAL 1MWAA 4NKMB 3HZYA 4KGLA 4BFEA 4C57C 4CVXB 4U1LB 1CD0A 1ZLWH 3ARPA 4IJ3B 1NGZB 4J3SA 1TZIB 1A9EB 3JWDH 5D7LE 1X5YA 2V2XB 2VWEE 1U8MA 5FGSA 3LS4L 4ZNCD 1FAIL 3KPSA 4G7YH 2GYSA 5D7JB 5J4MA 2FR4A 1R24B 3WL9B 1KLGA 2ESVD 4MA7L 3L5WB 1KENL 3CMOL 3PL6B 4JG1H 4MA1B 1T03H 1DBKH 1UCBH 4WTXA 2O5YH 4Y19E 1RZGA 4N8VG 4PY7A 3KYNB 4LLUB 3MA7B 4RA0C 3B3IA 4NNPH 1ND0A 4OFVA 4OLXH 4WW2F 3MFGB 2BY3A 1RK0B 3E2HB 5ISZB 1G7QB 2G2RA 4LP4A 2XN9B 1WC7B 2FX7H 2WANA 4JFQB 3ZTJH 2ZPKH 3HG1D 4LCCC 2R4RL 2BCKA 3CU7A 5KAQG 1G6RA 3LD8C 4GKZA 5D1ZD 2Y07L 3O6MH 4PRIB 4JRXD 3HB3D 3MLVH 1U95A 4GRWE 1CVRA 2LABA 4RQQB 2F8XC 2N56A 4OZHA 3O2DL 5HGAB 4HKXA 4EIZC 3IVKB 4ELKA 3UJTH 3FTGA 2X09A 2VDRH 2BOBB 2XYCA 3TYFA 3K74B 4ZFZB 1HHKB 2ESVE 3D25B 3KGRA 4HWBH 5LWYL 32C2A 3H9YA 5C1MB 2CJUH 5C92A 1UJ3A 4X9FA 4PJ9D 1FGNH 5JNYA 4NO0D 3BPNB 4GAJL 1DBMH 4HHAB 2ZNWA 2R0ZL 2R8SL 1A6ZB 5HYSA 2Z92B 1CGTA 4JZNA 1Z3GL 1BD2B 1LO0H 4PRDB 3RVUC 3KPNA 3KLAA 3ARWA 1I1AD 4K9EL 4QHKI 1K3IA 2NY2D 2J12B 3HG1E 1OW0A 2ADGA 2MKLC 1KXVC 4K23L 4BZ2L 4JRXE 3BP5A 1L7IL 3QCUH 1UVQA 1NAKH 4PJBA 2CDGB 3EFDL 3KXFD 1Q1JH 1NGPH 1FQ9C 4TUKH 2FZ3A 1W0WA 3AREC 4V1DA 2Z8RA 2VLKB 4PIRF 2OTWB 3EO9L 4FQCH 4L8SB 5IUSA 3MLYL 4Y16D 2EIBA 2R29L 5EC2B 3ROOA 1KELH 4UV4L 3GJEA 2OK0H 1PKOA 3DXAA 3LHPH 2X6MA 3QIBD 4TOYL 3ULUF 1HCFX 5IV2B 3SDAA 4OBRA 4AT6A 4NSKA 1INEH 2I27N 4JLRA 4L3CA 5IMKA 2CKBH 4XCCH 3VMOA 1KTDA 4LVEA 3SPVA 3UJJH 2JLLA 5DRWA 1CU4H 4NHUA 3W0WD 5D7SL 4CBPA 2CIIA 5ICYA 1QFPA 1RZIA 3LDBC 4JQIH 4KJPD 3TH3T 4KKAC 1HXYA 4Q6YA 5GPRA 3K0WA 1OB1A 3KXFE 3SKOB 3KYAA 1G6VK 2WP3O 1VFMA 2MTPA 4JQXC 2IH1A 3V6OC 1Y18B 5I1IL 2Z35B 3SQOH 2V2WB 2VZSA 2DQDH 2UV3A 3L3IB 4M6OL 3JTTA 3ET9F 3DV4A 3ARBD 5F7KC 5T5NG 4YXKH 2EC9U 2N4IA 5LGHL 5C0FB 1JPSH 4NHCH 3F7QA 3BPLB 5AUMA 3BEVB 4XXCA 2BJMH 3DROB 3JXAA 3MMEB 5CGMA 2Y4SA 1RFDL 2M26A 2C3HA 4X6DE 5TF1L 1ZHLB 1KLUA 3W0WE 4XNUH 1PYWA 3HZVA 5BV7H 1J11A 2UWEE 4MA8L 3EYSL 4Y89A 5EPMB 4BELD 3OJDB 3MJ9H 2QQQA 5E5RB 4RNRA 3F65A 4HBCL 3R1GL 5FB8A 4MCZA 4Y8DC 5DWUL 3VXQB 4IRSA 3F6IA 1BVLB 2VXSH 2NY6C 3T2PA 3NMEA 4XCYB 3X14A 3MFFA 1K8DA 4MNQD 5L6YH 3B4NA 1IGFH 4KRLB 3FHQA 4UDTB 3NTCL 1T22B 3D3VA 1DBBL 4HUWA 1OF2A 3ULVF 1OAXL 1J1XL 1FHGA 5DD5L 4YE4H 4EVNB 4F3FB 5EORH 5E8EB 4L3EB 3ZE1F 5DQDL 1HI6A 1MLBA 4LU5L 4EDXB 1ZT1A 1LILA 2UZIL 2NZ9C 4BSVA 3BHBB 5F7MC 1CFSB 3RHWF 3H2WA 1U9KA 4LASL 1MCFA 4XH2A 1NMCB 4G8GD 2DQFB 4X8JB 5C0AE 2EE6A 2XKNB 4LVHC 1C16B 4YHKH 1NJ9B 1CBVL 4MD5B 1MHCB 2XICA 4AMKH 3BKYH 4MNQE 1HK6A 5GRJL 5F9WB 1W0VB 5FK9B 4LBEB 2IPKA 3VRJB 5CJ5A 2QQNH 3GFUA 3LPWA 1RUKL 2FSEA 3K2MC 4XC3L 5DJDB 1GZQB 2UYLA 3LEYH 1G7HB 1W72H 1IFHL 2P44B 5BXFA 5D1QC 2VSDA 1LEKB 4PJ5A 4C58B 1H5BB 4P23D 3Q6GL 1MUJA 1QG3A 4P2OA 4AEEA 1I3GL 3MRIA 5IEHA 4BSWB 3VXSB 3I50L 3ZKMC 5IBTL 5F9AC 3KLHC 2ARJA 2B1HL 1V7MH 3UBXI 1CXEA 4OGXH 2BMKA 4XP5L 1I3VA 3KPQB 1DVFD 2NX5D 3FQNA 5TF0A 1RQ5A 4G6FB 3TVMA 4XBEH 2O5ZH 4X99B 3JWOL 3DGGA 2P8MB 3QA3B 4PLJC 5HI5D 4J3VA 4BH7A 4OI8A 5EUKB 3RUGE 3X12A 1FH5H 1AKJD 5EBWA 1BZ7A 5TFSH 1A3QA 2ZSVA 5I18H 3SDCA 5HHQB 1YEFH 5JO5A 1U91B 4WEBL 1OL0A 4AG4H 3MLZH 3BGFB 3FB7B 4OZIB 4Y1AD 5E2VL 4WO4D 1F45A 4UQ2B 2DI8A 4Q6IC 2CLRB 3I6GA 4Q2ZB 4F80A 2AEPH 4U6YB 5ITBH 2HKHL 1GHFH 3OPZL 3MGTB 4YNYA 2DBLH 5IVXB 3BE1H 2OZ4A 1NEZG 4GH7B 4HAGA 3MCLH 3NFSH 4MXWL 3PUCA 1DQML 3BZ4B 2W0PA 1DLFL 1I8LA 2Z31D 1DFBL 1CD1A 3X3GL 5C3TA 4PJXA 5BW7C 4P4RB 1MI5E 4P5TA 5H37H 2FDBP 4I13B 2AGJH 2IWGA 1U3ZA 1UZ8B 1YEEL 3CVHL 1NAMH 3AROA 1V7NH 4YDJB 3IDNA 1ZS8B 2JCCE 4YUEH 4PJHB 2AABH 4PFEA 5HI4D 3GK8H 4OFIA 1X7QA 3VGDA 2O26U 4Y1AE 2XG4A 1QVOA 1WBXA 1KCSL 4HUXB 4NQED 2OXHA 1D5ZA 4S1QH 4JFDA 1C8PA 5I6XC 1A3LL 2B1AL 2Z4QA 1FFNB 3VH8A 5C2BL 2I60L 4RGND 4WFEE 1I9JH 5EUOA 2HVJB 2XA8L 4DZ8B 2E27H 3LRSB 4M61B 4NT6A 5E6YA 5MI0B 4PGZA 4F2MB 1A2YA 2NTFB 3VRIB 2W0FA 5B4MD 4YDKL 3ARGA 1IC5H 5INCB 3RIAF 1A1NA 4FP8L 4QY8B 1NDMB 1XGRB 2H32B 1T20B 2HLAA 1XGYH 5K9KA 4PJGB 5DUBA 3QXAB 1N5AB 1Z9OA 3RBGA 1PQZB 3FT4A 2OR7A 5I76A 5DMYA 5T1DL 4JPVL 5EFIA 4KHXL 3T0ED 1A14L 5C08D 3VGBA 2XRAH 5F7EL 5I8EA 2AVGA 3CUPA 4KVCH 3BD4A 4ZXBA 4XX1G 3VGGA 1BX2B 2DLIA 3D1MC 1HQRA 4QRPD 3SDDB 3RBSA 1H3TA 4RGNE 2J8UA 5KS9F 3IDIA 1RUAL 5HHOD 4D0DB 1LK2A 1T1XA 4G8EB 4X4XA 3N85L 5LXGH 5TGBA 3PWLA 3FJTA 5B38B 3HI6L 1S3KH 3C2AL 3B2UC 3PF2A 3D85B 3FO9A 4HK3J 4HX1B 1A7RH 5BS0B 5HYFA 1MFEH 1WZLA 1R5WB 1TQCB 5GISH 1I1FB 5DHVH 5DFTA 2ICWA 5K93A 1I8KA 2ZUXA 3HNVL 1FRGH 3R0MA 4H25A 4A6YH 3LKPB 2NR6D 3T0EE 5C08E 3ILQC 1PKQE 1AJ7L 4U1NB 3V0AC 1ONQB 2DDQH 2GJ6D 2PUQT 4J8RB 5IFHL 2QQKL 4MQSB 4CVZA 1NGXA 1ITCA 1IZKA 2ADJA 3DWTA 4WW2B 3UTSD 3BUYB 5IW6A 3S9DB 3AS3A 1YY9C 5AZ2L 5HHOE 5CJOH 3W9DB 1YPZB 2VXUL 5KSUA 5LVEA 5ADPH 3JWNC 3NPZB 2HRPH 4ZODA 2I25N 4G6AC 5E6IC 1BVKA 1JPST 5IW1B 5SX5H 2A38A 1QFUL 1D5BA 2E6JA 2UUDK 5I19L 4WU5A 4I4WA 4TULL 5EBMA 5FIEA 1OGAB 2JELL 1URLA 3X3FL 5I1AA 1EBAA 1R3HB 4YHPB 3KHOA 3D2UD 1S7XA 4ERSH 4QGYA 1XF4A 4R90H 4Y4FB 5FECB 2Q7YA 1S7WB 1OM3H 1ZLUK 2GJ6E 2W59A 4H8WH 3NVQA 3RVTD 1NGWA 4GUPA 4ZTOL 2HH0L 1JGVL 3UTSE 3U1SL 4POYA 3E6FA 2OL3B 3DMMA 3ESVF 3GMMB 3MQIA 15C8L 2EDDA 1T4KB 2FO1A 4X4MA 3FB8B 3G04B 1FJ1B 4LCIH 4ETQB 4W68A 5BZDA 4MLSA 1Q9OB 3MACH 4K3JH 4RWYH 5HGGS 3BP7B 3OAYH 1MFBL 1UM6L 1WWWX 1FL3A 1LQSR 1E4KA 3BYTA 1TTUA 2YPKA 1VPOH 1IC4H 1EGJA 1A8JH 1EH9A 3V5DB 4PTTB 1B0RA 5D5MA 4Y4HC 1IM3A 5ID0A 1FV1B 1QRKA 1JYXA 3BWAB 1SJHA 3WNOA 3RWJA 4RFNB 1LO2H 1CICB 5CCKH 1YUHB 4QOKB 3VFRB 1NDGB 4FFZL 4OQTL 5JUEL 4AENB 5CEXA 3WMSA 3O8XB 2YD9A 1OTSC 2WQRA 3GSQA 3L3HB 4OZFH 4OCLC 3RHWK 2YRLA 5DTFA 1KJMB 5IR1B 3L3JB 3B8YA 5CP7A 3QIWC 1I9EA 2X41A 4GAYA 4YHNB 2AJ3B 1EEZA 4TUOA 1UADC 3QUMA 4JRYA 4OFYD 3C60B 3QFJD 4XP6H 1R3IH 3C08H 1MCNA 2JB5L 4KVNH 5D1XB 3QHFH 3FQWA 1EJOH 2F74B 3T8XA 4XXCC 3FB5A 5LCVH 4TPRH 1A6VH 2MNUA 3EFFB 1A47A 4ONFH 3HE7B 1IM9A 3VI3F 4FQQB 1NBVH 5TJWK 4LCWE 4PJIA 4K3HA 2DN7A 3TT3L 3RAJH 2H9GB 3TFKD 4GRLD 3CFJA 3WUWB 3OB0K 2ZG3A 1A7NH 3WIHH 1KCUL 1IQDA 5F1OB 1BEYH 3HMWL 1BQLL 1A7QL 4HH8A 3TH4T 2J6EH 4IRSC 1KACB 4P5MB 2VDKL 4O58L 4OLZL 3VXRA 1JL8A 2HWZL 4X80L 2ED7A 3N1FC 4NZUL 4PRPD 4L4VD 2G75B 3R8QA 3QAZC 1MCCA 3VE0A 4MDJA 3QFJE 5HYJD 4O4YH 4DN4L 5L88L 1PX4A 2FEEI 3K4AA 3O2DA 3IRZA 3NH7L 4LSVL 2NPLX 3HLAB 1CFTB 2ZJSL 5L2KA 4TSBH 3CDGB 3RWGB 1A6PA 4NGHL 3OMZA 5KANG 4OLWL 3ROLA 4DCQA 1TVDA 2HAZA 1T1WA 4W6XB 5DS8A 4MCYA 4QYOB 4C83B 3VWJD 3ZDXF 5B3JE 4MS8C 4LCCB 3ULVL 4F7CA 4LLYA 3PWUA 2W9DH 4KK5C 4PRPE 4L4VE 4KJQD 1U2HA 1SVZA 5ICXA 2G60L 1CLYL 1HKLH 5HD8D 3GHBH 3V4VH 5HYJE 1WF5A 4Y5XC 5IB1B 1KJVA 1V3JA 3WNMA 5KN5A 1ZANL 5GGRB 1ROWA 4O2FA 4S2SA 2F19L 1Q94A 4R8WL 5FKAA 3FQUB 5HDOA 1DUYA 4EOWH 4U1GC 1S9YA 3CSPA 4J3TA 3O4LE 2R2EB 3AS2A 3IJSB 3D39D 4ODHH 4RDQF 4HDIB 5L9DL 3IS1X 3D0VB 1KC5L 2YSSA 1KLFA 1ZVYA 5MENA 4N5EC 4JFOA 1WEJH 1FL5B 5KW9H 2MSPA 3PIQA 3UPRB 1OSPH 3TVMC 1MJ8L 5FYLD 2VITA 1IGMH 2F54D 4LSRH 4QF1A 3GBML 3U7AA 2ZSWA 2BXZA 4NQCB 3VG0H 3QULB 4XNYH 2DQCL 1J0JA 3UJIH 6FABL 3TBVB 5C0RL 4Z7UE 2Q86B 1NCCL 5SWZD 3MV7B 3RIAK 3KPPA 1JFQH 4TQEL 4AJ0A 3PP3H 4MNHB 3AREB 1Q72L 2Y36H 5JIHA 1NCTA 1NEZB 3MJ7B 3IU3B 3DETD 1SEBB 2GKIA 1CF8H 1K4DA 4P57A 1IQWH 4JANB 1FFRA 1WWCA 4X6CE 1NC2B 4YHMH 1YECL 2YD2A 5KJRH 4X6FB 3HI1A 2P5WE 3BESR 4NQXA 43CAB 1KCLA 4CW1A 4HKZA 3I2CH 2SEBA 2KUTA 3MLXH 5EU4B 1HHIA 4HXAL 4PJEA 5IMOB 5FYLE 4JGJA 5JXEC 4LHUD 1I8LC 3LDBB 2F54E 4RSVA 1I9RH 3O3UN 4NCC1 3AB0C 2B39A 4ZFOB 4E41B 2Y5TB 4OKVB 3QQNA 2Q6WB 4C54A 4HWBA 4P5TC 4OLVL 3ORJA 1G84A 1TJGL 4XPFH 3MODL 5E94B 5SWZE 3PQYE 1VKXB 4CU8A 2PXYC 3IDMA 5CLTA 3ARRA 4LFHG 5T3XD 1WCBA 4TNWF 4AQ1B 1CLZH 2Q8BL 1YQVH 5FGRA 5C0GA 1BFVL 2BC4B 4MXVF 3GSXA 3IJHA 2RGSA 4QRSA 2BSRA 2QQLL 1K2DA 4ZPVB 3FN0L 3BKJL 3SBWA 1I8IB 1WLHA 5D72L 4ZNEE 1RIVL 3QFDA 4WI5A 4PJCE 1F58H 1B90A 1ZHKA 4FFVD 1FFOA 1JNLL 2FEEL 3QXUA 3TJHD 1FE8L 2HFEA 3TYGL 5JXAH 3ARGC 3QCTL 1M6OA 3WJLC 3QG7H 1MCOH 4NYLB 3EYUL 3UTTB 1P7KB 5ELIA 2E9IA 5D7JD 3WFBH 2VLJA 4JREC 3GSUB 3PL6D 4Z6AT 2RHEA 4GW1B 5T3XE 4FMFA 5F71A 1P9MC 5DFWH 1IGTA 2NY6B 1QKZH 3OKEA 1FNFA 1G1CA 3C5JB 2BNQB 4GMSH 5E7FA 4ZUVA 4GLRH 2XFXB 2A9ML 5C9JB 1B88A 5BO1L 1ZMYA 2CKBA 3RPIA 2EIZA 2BZDA 5JMRA 2EZ0C 2XZQL 4MSWB 2F53B 2XN9D 5ISZD 4IMLB 1X9QA 4RCAA 1JZ2A 2ESVA 3PGDB 2J5LC 3P4MB 1H3PL 1J1OL 1UB5B 4PRID 1T5WA 1VEMA 4EI5C 2CKNA 3FO0L 4MVBD 5GZOC 2RIKA 4X0KB 2FBJH 1R3KA 3EBAA 4TVPE 3MJ8A 1BOGA 1YJDH 2EE9A 3JVGA 4ONHA 4WW1B 5FDYA 2FO4A 1WTLA 3AS1A 4PP1C 2YC1B 2W38A 4JCMA 4LVHB 3HG1A 3MXWL 3TJEH 3LKSB 1FVCA 4XMKH 5KS9B 1F11A 5EU5A 1BBJB 4OGYL 5IEKA 3F7VA 1HH9B 1MFDL 5D1ZA 3HKFA 1U8KA 1XCTB 1K4CB 2H2PD 4JRXA 4B0MM 4PTUB 3WDIA 3VFPB 3BH9A 4XCNA 4KY1L 1N6VA 1BD2D 4QHUA 1R0AH 1MHEA 4XPTH 2MWCA 1G9NH 1M7DA 1CTOA 2XN9E 3EJYC 1KN4H 4PGBB 5D1QB 5C0DA 3S34L 3GRWH 3O41B 3LN9A 2EH8H 3BDYL 1OCWL 1FNLA 4PRIE 3K81A 4BZYA 4PJ9A 4YFLF 2FYYB 5T3XH 3TO2B 1EVUA 4NO0A 3Q6FA 1J1PL 3Q1SH 4ZDHA 1QBML 1WVZA 3D69A 2X44D 5E9DB 1ZLVK 5LGKA 3UP1A 4LSTH 3OQ3B 2V7NA 4FQHA 2VLKD 3FT2B 1LE9A 1I1AA 3AAZA 5F96H 4U7MA 4OGZA 1ZLSH 1ORQB 2FX8H 1OQXA 2NLJB 3LS5L 1YEIL 3O3DB 4M1DL 1SJXA 3TWCH 3BDBA 1BD2E 1SJVA 3VFVA 3KXFA 3MO1B 4ZOCA 3B6SB 1TZGH 5ACZA 3BW9A 5T1MA 2P8LB 2IADB 3ME0A 5GGVL 3MJGX 4OIIL 1CDGA 5CGTA 2XNAA 4YHIA 1F2XK 4QWWD 4MA7H 5DXWA 4Y16A 4LVOB 1AQDA 3C87A 1TNNA 3NPSC 12E8L 4Q6IB 1NFDF 4GO6B 3QIBA 4S1SL 4WVRA 3V6FB 3PDDA 2E7BA 4WHCA 2X1XR 3DIFA 3RVVC 2GTWB 4U1SB 1HZHL 1MEXL 3PJSB 2VLKE 3OJVC 2Y6SC 4YDIL 3Q3GB 5DMIH 4N5UA 4LLQB 4UILH 2YOCA 3W0WA 5EWIL 1RIUH 5I73C 1KG0A 4Q9QL 2UWEA 2ICEB 4KI5F 2F5BH 3T3PE 1YN6A 1XH3B 4N1CA 4JO1H 3NIFF 3MUZ1 4QTIH 1QEWA 1I7UB 4HJJL 4JY4B 3STLA 3SY0A 1TITA 2GIYA 4GXUM 3ISWA 1E27B 5CWSA 3RNQA 5LWYH 3TT1H 3HZMB 4F58L 3ARBA 1DDHA 5HHMB 5I6XB 1DANU 2D0FA 5JPNA 5DMJB 4YPGA 3K1DA 2VAAA 3OKKA 2R8SH 1FLRL 3ZZ1A 3KAAA 4M02A 4YWGH 5HYQA 1Z3GH 1JYNA 4L9DA 3U0WL 2I07A 1C5DA 4OV5B 1BF2A 4D0CB 4K9EH 2X2YA 4DGYH 4NO2B 5E2WL 4P9MH 4Z9KB 2XXMB 4Z76B 2B4CC 4P0DA 3VH8G 1IAKA 4K23H 4HMEA 1VADA 1FP5A 1OTTD 2YMXL 1I7ZB 4I0CC 3QWOA 5INDA 3BP6A 3EFDH 2VL5A 1CXHA 4L3ED 5EZJA 4PBXA 3ZE2F 4DTGH 1MIMH 3FT3A 3T3ME 2YPVH 3CDCA 5IFAL 2V5RA 2VE6B 1D6EA 1L0QA 1TVBB 4MNQA 4L5FL 3EO9H 4NN6C 3O45A 1KTRL 2R29H 3K8MA 1T21B 5GGTL 3WSQL 3H9HB 3QHTC 4IIQB 1U58A 5E8OB 3KR3L 4HBQA 1M05B 4U1KA 5DRNA 2X05A 2HT4D 4TVPL 4P49A 5GSRA 4QO1A 5H2BA 2H3NB 3WHE0 4XXDA 1NAMA 3UZQA 4CVUA 3V2AR 3B2VL 1I3UA 4G8GA 5GGSB 4DFHA 1HDMA 4L3EE 5ECJE 5IK3B 3QO0A 4JZOA 4FFWC 4U2ZA 3G5ZA 3GMQB 3KDMA 1ERNA 2E8ZA 4RFEA 1D5MA 4JPIB 3VXSD 4CKVX 1GC1L 2EXYC 1VHPA 4FRWA 4QRRB 1H9VA 1ZT4A 3DSNA 3ZMRA 1XR9A 4NP4H 4M6OH 3TYFB 3RX5A 3RUGA 1QLRA 4AEIL 1PD6A 3TF7C 1RD6A 3E0GA 8FABA 3FONA 1FGVH 4G6FD 3FMGH 4TNWK 3IDUA 5F6IC 2APVA 1A6WL 4NDMB 1RFDH 5E6IB 4PGDA 2DWDA 1ZGLA 5TF1H 2BVTA 3MRGB 4MQ7A 3U46B 2A6KA 5CEZD 4MA8H 1I3RA 1OP9A 3ZDZF 2XQBL 3MGOA 3HPJB 1DVFA 5JOFA 2NX5A 2ADGB 5DI8B 4MAUH 1V3MA 4XAKE 1W8NA 3HFML 4M3JA 3SDXB 1I7TA 1UVQB 2ATKA 4PJBB 5J1AB 2DL2A 3OWEA 5IM7B 4LSDA 3VXSE 5ETUB 4KKBD 5JW4R 4S1RH 1FZJA 3K7UA 1X5IA 3C5SA 2X7LB 3KPRB 2VLLB 5ABDE 1AKJA 4CU6A 1KPUA 1NUDA 4KQ3H 2YXMA 1S78C 3DX8A 2JCCA 3GJEB 4F9PA 1DUZA 2NY4B 1GAFH 4Y1AA 4N0FA 2VDLL 4WO4A 5DHVA 4BA8A 5ESVB 4CN4A 2W65A 3WO4C 3R0NA 3LKQB 3VFTA 5DVOA 5CEZE 2BVQA 2A9NL 1R3LA 4L3CB 2BSSB 1U8IB 4Y4HB 4LASH 1OVZA 3SKUD 1CGSL 1NCAH 4P2QE 3HTLX 5J6GA 3MJ6A 1EMTH 2EDLA 4QT5B 3PGFL 4Y2OA 4YFLI 1GJIA 2Z31A 1NL0H 2FH6A 3E3QE 5DVNA 1MFAH 2YA0A 4DUXA 1IGJB 2YA1A 5IVXE 4HS3B 1RUKH 4JAMA 4XC3H 3S6CA 1Q0YL 3DI2B 1HIMH 1P2CA 3QIWB 1U8NB 4JM4L 2DM2A 3JTTB 4G8FB 3KVQA 4G6ML 1EEYB 3V52L 4ZYKA 1G7LA 4NQEA 4C4KT 3ARZA 4KQ4L 1PLGL 5D7IF 3I50H 5ALCL 4JN2A 1T89A 3U4BH 1QO3A 2B1HH 2WP3T 2AK1L 1KT2B 1N59B 4M7KL 5SX4I 3LQAL 4AY0A 4PJHE 2XTLA 2V2TA 2R2HA 4WJ5B 3VI4E 3RVXC 4LCUA 2WINA 4XNXL 2Y7QB 1U8QB 2GT9B 4U7KA 5MEOA 1EZVX 4MCZB 1F90L 1HWHB 1K6QL 3MRDA 4DVRL 2YZ8A 5KSBF 1UM4L 3SDDD 3QQ4A 3PWPB 2VERN 3MLTB 4IRSB 3D9AH 4OLEA 1MCDA 2A6IB 1J9CT 1FL6A 3OG4B 3X14B 1E6OH 1K8DB 3MC0A 1JWMB 1BREA 1LDPL 4FABL 5HPMB 4A2MA 1JHKL 5C08A 1B9ZA 1AP2A 4ZUWB 3D85D 4HUWB 3VXPB 1RJCA 5BS0D 4PJGE 3QDHA 3QG6B 4UDUA 1LP9E 4QRPA 2HKHH 1MLBB 1XGUB 3RY5A 1KPVA 3UDWA 4ODXB 4BFIB 1BFSA 3LN5A 5ANMB 5J56B 4Z7VF 2VRAA 5DDHB 4R7NB 1DQMH 3LSOB 5FGBC 4YGAB 1S8DB 3WCYA 1J7VR 1DLFH 4JVPA 1T2QL 1ZWIA 1YNTA 5AZEL 4L8DB 3V0VA 3T0WA 1MHPL 5BZWA 4YHZL 3CH1A 5ID1A 1S9XB 2IBBA 4DWHA 2FSEB 4N1EA 2GJ6A 4Y5XB 3H9SB 2AKRB 4Y8AA 3H0TB 4OZGF 5BS0E 1EAPA 4XVTL 1FC1A 1KCSH 1NCDL 4JO3L 1OGAD 3VD4A 5BV7C 4RISL 3UTSA 1QFWI 4NM4L 1SYSB 4U1GB 4R4ND 3V9FA 3WIHA 3U82B 5AD0A 5F7UA 5KVFH 3D6GA 1A4KA 2J6EA 2QHLA 3GM8A 4GBXC 4Y4FD 4S10A 4WHTB 1FZKB 1I1YA 4EZMA 3TBYA 5E8DL 3VFGL 4YQXL 4KK6D 4YDKH 4UTAH 2VZUA 5IB4A 5ILTL 2BMKB 4YC2C 3VGHA 3FQNB 3PV6B 4NRZB 3RKDD 1I1AC 5HYIA 2CD0A 1MH5B 3LKNB 5KVGL 2H32H 3NABL 4O2CB 1X5XA 1YPZE 3SOBL 1X5KA 5FA3A 4EDWH 3O2VH 2JJTC 3QO1A 3IFNL 2D03H 3G6JF 1J5OL 4Q9RL 3D2UA 4BH7B 3LQZA 5E5MA 2OTUA 4LCYB 5F7EH 5EBWB 5F6HI 4BQ9A 1OGAE 3U2SA 3LKRB 5LGJB 3BT2H 4GKNA 1Z9MA 3JTSA 4HCRH 2DQHH 3CFEA 2G9HA 4L8CA 1CICD 1RMFH 1ZA6A 1LK3L 4QOKD 5E2UL 1OSZA 4HJ0D 2DS4A 3L3OA 5CEZL 1IGYA 1L6ZA 2IANB 1JK8B 1SYVA 1QZ1A 3I6KA 1FO0L 3ULUD 4NWTL 3O8XD 4XBGB 4OLYL 4M9PA 5JQ6L 3HI6H 3C2AH 4X83A 3G08B 3MRQA 4Z78A 1FFPA 4OJFH 2QKIA 2IF7A 1ZSDB 3ZO0A 3ZTJG 2BX5A 2R69H 3H3BC 3AB0B 2YEZB 1IT9H 5HVGB 3C60D 1KBGL 3HN3A 4PJXB 4NOBA 4WWKC 5IHBA 1YMME 5D1XD 3S4SB 1NFDB 2AK4E 1J0KA 2PXYB 5IF0B 5TQ2L 2EDQA 4X4YA 5T3ZE 1VFAA 3U0PA 3U9PL 2QQKH 3HE7D 5T33H 1QLFA 2DWEA 4NUGL 3S37L 2ED9A 3RRQA 4KJYB 4QOKE 5C0EB 3IB4A 4OFYA 4Z7WF 3ARBC 5IQ9B 3QFJA 4UU9B 5E8NB 4OD3L 1LEIA 1XMWA 2VB5A 3PHOB 4ZFFB 3EAKA 2ADIB 3MLWH 2EO9A 3I9GH 4GS7C 4HIXL 4V2CB 4ZTPL 4DK3A 3SE3A 4GMTH 5I19H 2V7HB 4LRIA 1D3CA 3X3FH 3QUKB 2DQUL 1MJUL 1B2WH 4GRLA 2YUZA 1AXTH 4U1JA 5K9KB 3B9VA 4JREB 2VLRB 5IQ7L 3MRJB 1QYGL 1FYHB 2VL4A 4JFPA 5EO9A 5GGRY 3KNBA 5ITFB 4PR5B 4RWHA 4L4TE 4LEXH 3O9WD 4ZOAA 2YHGA 1UA6L 1AGEB 2FECL 3L3DB 5I16B 5DD1L 3U1SH 4PRPA 4L4VA 3NAAL 2H2SC 3CUPB 15C8H 4XNZC 3WKML 1FAKT 1G7PA 2RFXA 4KKNA 1FZOB 2BRQA 2XZCL 3JV4B 4OB5L 1UM6H 3EYOB 2R0LL 4MJ6B 2ENYA 1FCGA 4FOMA 5TGBB 4EI5B 1QFWL 2D4DA 2IAMC 3MLSH 1RZKC 3K1KC 2APXA 5CKGA 3HC0A 3IETA 4U3HA 4WY7L 2BSED 4FFZH 4OQTH 1L9MA 3GIVA 5E1HB 3VWJA 5JUEH 2C26A 1UB6A 1IBGL 1RIHH 1T5XA 5HJ3A 1MPAL 3ULUH 5I1LB 4YPJA 1F13A 4OV6F 5FUOH 1HSAB 2R56H 4N0CC 3C9NB 5AYQA 2WIIA 3AXLA 4GFTB 5CZXC 3RVUD 2AJYL 3L7EA 2ADJB 2H6PB 1HHGA 2AJXH 4OFKA 4P59L 5IT2L 2FJFB 1C1EL 1CL7H 3O0RL 1OARL 2A77L 2BVEA 3E8UL 4I5BB 1QFOA 2X4QA 1XGTA 4PG9A 1JTTA 2JB5H 2CGRL 2FBOJ 1KJ2B 2OSLA 2P7TA 3HNSH 1T0NA 2GSGA 2IQAB 4NQCD 1H3VA 1NANI 1BVKB 4A2LA 5IG7B 1UM5H 3D39A 5MEQA 2Y23A 1G0XA 3S8WA 1MVUA 1GCFA 3MV7D 1D5BB 3FOLB 3SGJA 4F7MA 1S7SA 5FDWB 1JPFA 4U6XB 3ARED 3MLRH 1IJ9A 5I1AB 3EZ8A 4Z18A 1U93B 3HMWH 3HUJE 43C9A 4NZDA 2L7UA 2UUDH 1M1SA 3TV3H 1QNZH 4M7LL 1S9KC 3OGOE 2VJXA 1S7XB 1YYML 2F54A 3PWNA 4NQTA 4U3CA 5F89B 2Q7YB 2MCG1 1CWVA 3HS0B 4X80H 4AYFA 1JWUB 1EO8L 2GAZA 3CNKA 2QHRL 1CGUA 1NGWB 2MHAA 5SWZA 2NQCA 5M95B 5JPMA 1NBQA 1ZLUH 5D70L 2FGWL 1KB5B 5HVFB 3OV6A 3SKMA 3TIDB 4P2CG 4F9PC 2WWKO 5AWNL 3SJVB 4KKAD 4E41D 4HF5H 2HMID 4QHNB 4WO4C 1EZVY 1TMCB 3H42H 4U1IA 1I85A 2Q3ZA 4NGHH 3QHZH 4OLWH 1N8ZB 2XG5A 2FIKB 2OL3L 4PJCA 3ARSA 3G5VA 1TETL 3OR7A 5DJXA 3AC0A 5HDQL 3IFOA 1IEBA 1IAOB 5IB5B 4XPAL 4JJ5B 5I73B 1AGFB 3ULVH 4LHUA 3KYMB 1UWEH 4P46C 4JHAH 4HZLA 4IRJA 4GG6A 1UWGL 4NFDA 5GQBA 5T3ZL 4UZGA 2VDPL 3GRWA 3ABZA 5K9OB 4IS6A 1CLYH 4Q74A 5HI3C 3TM6A 3BQUC 5CZVL 1BOYA 1CYGA 3WNKA 1TVHB 1AO7A 1EJ6A 4N90D 1BZ9A 4KTEH 5EU6A 5GSVA 3EO0B 1AXSB 2V9TA 3U7WL 2DBJA 1MCSA 4L8BB 4E41E 3PNWB 3UTTD 5JIIA 3QZWA 3RKPA 5HHNB 2JF1A 1ZLWK 1HEZA 2F8OA 2VC2H 4QHKJ 4X9BA 4QXUH 1T89C 3CJJA 4R4FH 5DA4A 3V6OE 4NKMA 2CMRL 2NY6D 4U1LA 4O5LL 2BNQD 3QNXB 1DSFL 5SV4A 3VXUE 1NGZA 4LMQE 3BKCL 5B4MC 1TZIA 3LVEA 3M8OH 1PG7L 4EN3C 3MV8A 5CJQH 3J8F7 3HNTL 4JDTH 2V2XA 3OKYA 5IHUH 4L29A 4J6RL 2D31B 1U41A 4XMLH 2F53D 3T65B 3OB0H 5D7JA 5C6TH 1R24A 6FABH 3WL9A 3JZ7A 3D5OF 1BWWA 3L5WA 3PL6A 4UQ3A 4TQEH 3B9DA 5LQBH 1XIWC 4GKOA 3KYNA 4LLUA 4NN6B 1CDCA 3MA7A 2NW2B 3O2WH 3NFNA 1FDLL 3CXHJ 4I3SH 1WAAF 1JNNL 1RK0A 2YPLB 4XX1E 5ISZA 3T77B 1G7QA 1WC7A 4WEMB 5KSBB 4JFQA 1YECH 2YD6A 1MCWW 5DJ6B 2A6JB 1WIOA 2OXGA 3QNYB 2LTQB 4NC1C 3UDWC 5C6WH 1QSFE 5DT1L 1T1WB 4PRIA 3BXNB 4HXAH 3VG9C 2IC2A 1NMAH 4RQQA 5JW3H 5HGAA 1IGCL 1RZJH 3IVKA 5KTEH 2BOBA 1FPTL 2F53E 1YN7A 4ZFZA 5T1LB 5CINH 1HHKA 4OUUB 5D1QD 3D25A 5H37G 2XT1B 5GGVY 3WFHB 3F58L 2DTMH 1J0HA 4JFZL 3BIAX 3MRBB 2YD4A 1UG9A 2VQTA 3ZKMD 3C09C 4HHAA 4NQVB 2QR0B 3KLHD 1A6ZA 1BD2A 1KJVB 1P4BH 4PRDA 1C12B 1HH6B 2QQLH 5E9DD 4OIAA 4P5KB 4O2FB 1VA9A 3QDGB 4JGMA 4X9GA 4I48B 5D72H 4HFUH 3MRHB 1IZJA 5KS9E 3HC4L 5F6IB 1ES0B 4I0KA