1AXYA

Erythrina corallodendron lectin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Erythrina corallodendron lectin and of its complexes with mono- and disaccharides.
pubmed doi rcsb
molecule tags Lectin
molecule keywords LECTIN
total genus 49
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1axyA00
1AXZA 1DQ2A 3L2YA 1N3PA 2WNEA 2VW1A 3M3QA 1V6IA 1QF3A 4JC1A 1AXYA 2DVDA 3HMYA 4CRQA 3VUOA 4BMBA 5JOZA 3A4UA 3RSJA 5DUVA 4R9CA 4Q8LA 1FX5A 1UZZA 4DS0A 1LGNA 1RINA 1VLNA 5E89A 4YZ2A 4FPYA 4FQ4A 1LECA 1JOJA 1R1ZA 3FLRA 1V6JA 3O0XA 3IN9A 4AGRA 5GZCA 3SNMA 1DYPA 1OKQA 4GWNA 4OZXA 3HN1A 1LEMA 3ILNA 4XBNA 1ULGA 3SITA 4ZKTB 1DHKB 1LENA 2GNDA 2A7AA 1ENSA 3VKNA 1N3OA 1HKDA 3U4XA 2D6LX 3KQRA 4KBBA 4YGCA 1W6OA 4M3CB 5EWSA 1QOTA 2ENRA 3RMYA 3VKOA 4Q8KA 1A3KA 4DQAA 5JOYA 3WV6A 5KXBA 1N1TA 3AZWA 3OY8A 4NO4A 4YGEA 5T55A 4XDQA 3WUCA 1YIFA 4FPKA 2VW2A 1FV2A 3SH5A 5DZFA 4BLJA 1ULCA 3ZXFA 1VALA 4Y26A 1RITA 2VH9A 2WT0A 1QDCA 3R4SA 3O12A 2ZHKA 4Y20B 2CWMA 1WW7A 2W39A 2GN3A 1UAIA 2EALA 4Y22B 3WHTA 1HQWA 2WKKA 3LSDA 3AZVA 3NV1A 3QCWA 3W58A 3BOPA 1WW5A 1JXNA 2ZBJA 3WDYA 4C1XA 3VKFC 2ARBA 3MW2A 3D5OA 1GICA 4Y1XA 4HANA 1ULFA 3AXEA 2YY1A 1AX0A 2A71A 2ZGKA 3B00A 4YGBA 5L73A 1AZDA 2DU1A 4BOWA 2P2KA 2ZMLA 4GXLA 1LHUA 2EXJA 3AYAA 4I30A 2ZHMA 3MW4A 5JLVA 2GNBA 3PVEA 1Q8SA 1SFYA 2OUJA 4Y1YA 1F9KA 1W6QA 1WLDA 4YGDA 1W6NA 2R1DA 1C4RA 3WCRA 2KM2A 1MVQA 1SLBA 1FATA 4UW3A 1DBNA 4YW3A 5T52A 3WG3A 2DUOA 2ZMKA 1H9WA 2JE7A 4ASMB 1JBCA 2TEPA 4K1ZA 4XILA 3SISA 3ZYRA 1CONA 2FMDA 4CTEA 5GZGA 3M2MA 4ITCA 2VW0A 4GALA 1MZ5A 2A3XA 4P9XA 5CB7A 3R4UA 1LOBA 1C1FA 1C57A 3M1HA 1SLIA 4Q1PA 1LHWA 1UX6A 1SLCA 5GLTA 1HDKA 1Q8PA 2EXHA 1V6MA 2WLQA 4XYXA 1YYNA 1VIWB 2YXSA 3MEPA 4SLIA 4YM3A 1Q8QA 1GNHA 2OVUA 2NMNA 4Q2FA 4PBPA 3TB0A 1W6MA 2WSUA 3T1LA 2P3JA 1IS4A 4R9DA 5DZGA 3WDTA 1BKZA 2D6OX 1LOFC 2WQZC 1Z78A 1XQNA 3FLTA 1TEIA 1KDKA 1URXA 4Y20A 4XZPA 4Y1UA 4U2AA 1S1AA 4Q26A 4UW5A 5CNAA 1MS5A 5E8AA 4WV8A 5GZDA 5F9TA 1Z0HA 2AH2A 2AREA 3OPZA 1S0CA 2ZGMA 1F31A 3MW3A 1JN2P 4FP2A 3N35A 2D7FA 5DUUA 1BXHA 1ENQA 1SCRA 1LU2A 3M3CA 5T5LA 3V0BB 5GLWA 3O5SA 2AYHA 1HQLA 2EXKA 5CBLA 1VAVA 1MS8A 1NXD1 3WUDA 4XTPA 4JRAA 1LGCA 2JKBA 1KJRA 4XIOA 3T2TA 1DFQA 2DUPA 5GLVA 2ZACA 2ZGOA 3NV4A 1UMZA 4LBMA 3ASIA 5GLUA 5H9QA 4DFSA 1MR5A 2DV9A 2E7QA 1DQ0A 4Q1RA 2XB6C 3ZSLA 1IOAA 1YO8A 2Q5TA 3AP4A 2GMPA 3O0VA 4WZFA 5GJ6A 3WG1A 4XJ9A 1LOCA 5GM0A 3ATGA 2ZABA 5GALA 4H55A 1MS4A 1SLLA 1QKQA 2E6VA 2ZHNA 3ZSJA 1RIRA 1G9DA 2CNAA 1WUVA 2W68A 1IKPA 4YZ5A 1FAYA 3N7JA 2DVBA 2ZAAA 1DQ6A 2NMOA 2A70A 4TZDA 3GNEA 2DUQA 3POSA 4AGVA 3AZZA 3DGTA 4FPJA 3ZYPA 1KDMA 3ZXLA 4YG6A 4Q27A 2XG3A 3AP7A 2OUHA 3AP5A 1B09A 4YLZA 3RMXA 4C1WA 4BMEA 3BIWE 4YZ1A 3OJBA 4FPLA 3MPPG 4P14A 1GYKA 1MVEA 1JHNA 2YV8A 2ZZJA 2YROA 1UL9A 1SBEA 3IKWA 2JJ6A 3AJYA 3JUUA 5IK4A 3C2UA 1AVBA 3ZSKA 3VKMA 1G9FA 3OYWA 2PHUA 2LTNA 5F5QA 4LBNA 2ARXA 4FPCA 2HYKA 4IQPA 3AJZA 3POWA 3POYA 1GANA 1CN1A 1LOGA 1ULDA 3FFZA 2V5YA 1BQPA 2NN8A 2YMZA 1LESA 1CESA 3WOGA 1I1EA 1WW6A 2GALA 4MYEA 3VV1A 4ATFA 3WDUA 4LBQA 1QDOA 2FHRA 4PF5A 1DZQA 1DQ1A 1LGBA 4PBOA 4DPNA 1W0OA 3BTAA 1W6NB 5T50A 2PHFA 3ZPYA 1W6MB 2P3KA 3B9CA 4YFWA 5T5PA 2ZHLA 4XBLA 5EYXA 1Q8OA 1ULEA 2PHRA 3UJQA 3OBRA 1BZWA 1OQ1A 5DXDA 3NV2A 2H0BA 1G9CA 1S0IA 1ONAA 3O0WA 3SH3A 3WNXA 2NP0A 1FNYA 1X50A 5E88A 1O4YA 1SBDA 1MACA 2ZKNA 3N3HA 1U0AA 4M00A 1PZ9A 3WHUA 4CZSA 2SLIA 3V64A 2NZ9A 4FOWA 1DQ4A 4FPFA 5BYNA 2EIGA 2GMEA 4K1YA 5DUXA 2BQPA 4W65A 4ZXKA 4XIKA 5JMCA 2A6XA 2WSVA 2E7TA 5CA6A 2R49A 4XMIA 2ZGQA 3PVNA 2E53A 4XOGA 3SH4A 1G9BA 3QLQA 1WLCA 5IT6A 4R9BA 4XJAA 2JE9A 1KRIA 1GNZA 3WLUA 1LOEA 2UURA 1YI7A 3V0BA 2GNMA 4YW5A 1UPSA 4WVVA 2DVGA 2DTYA 4XBQA 4BLIA 1I3HA 1G86A 2AGSA 1MZ6A 1MS3A 4TYSA 1CQ9A 2UWCA 3GALA 1GZWA 3PJQA 2DVAA 4YM1A 1S0JA 5AVAA 2WT2A 3RQ0A 1S0DA 3HR9A 4NOTA 4YW4A 1Q56A 1WCSA 2EF6A 2R0HA 4ISQA 1DYKA 2JECA 3AK0A 4XJWA 4GA9A 2C5DA 3WCSA 2ZGRA 3WVJA 3ZXEA 4BM8A 2DTWA 3ENRA 1CPMA 1QMJA 1DQ5A 2D3PA 2ZGSA 4R9AA 1A78A 2D3RA 4Y24A 2EAKA 1JYIA 4LBQD 3NV3A 4WVWA 1IS5A 1F5FA 3ZVXA 3JU9A 3WDVA 4XTMA 5H9PA 3WG4A 3KM5A 3FBYA 2W52A 4LBOA 3BODA 1YRZA 2JDZA 4YG3A 5DZEA 3A0KA 2A5ZA 4ISRA 5KXCA 5JDBA 1G8WA 4FOYA 3V65A 4FOVA 1BYHA 2RHPA 3IMNA 1ENRA 1SLAA 4YG0A 4FPGA 1SBFA 2PHWA 4YFZA 4FPEA 1SLTA 5SV8A 1QNYA 2A3WA 3IPVB 2P37A 1GSLA 1DGLA 1LODA 1GKBA 3LCPA 1WD4A 5HCFA 2GN7A 4AVTA 1S0BA 3D4KA 5HCBA 3N7KA 1PZ8A 1FNZA 3Q9OA 1MS0A 1ZA4A 3USUA 4AVVA 3I4IA 4K21A 3D6EA 3LSEA 4AYUA 2VU9A 4D69A 3DUIA 4P9WA 5GZFA 2PHTA 2UWAA 4P9YA 1GZWB 1HLCA 1W6PB 5EYYA 4DRVA 2D6NA 2ZGLA 1V6KA 1AX2A 3ZXKA 2WJSA 1DIWA 3WZ1A 1D2SA 2A3YA 1JYCA 1QNWA 1S0FA 1FV3A 4YW1A 5IK5A 1LHOA 3NWKA 5IK7A 5FRAA 4YZ4A 1Y7BA 5EXOA 2ZGPA 1KQRA 2AR6A 2WT1A 2ES3A 2ERFA 1LHNA 3M3OA 3V0AB 2D6KA 4FPHA 2UWBA 2VUAA 1KITA 3IM0A 5JVVA 5T5OA 3WDXA 3OBTA 2G4IA 2NM1A 2UU8A 3T1MA 1G7YA 4Y22A 5KXDA 1S0EA 4XHXA 1DLLA 3W59A 1H30A 1O4ZA 2VY0A 4AVSA 5T54A 2ZGUA 4RA0A 3B69A 4LBKA 1G9AA 1AX1A 5H9SA 1S0GA 1W0PA 4YM2A 3OYWB 1V00A 3PMEA 1LTEA 1FYUA 2EXIA 4LBLA 3RS6A 2A75A 1KJLA 3IPVA 1N1VA 4GKXA 2R1BA 3FUQA 1V6LA 4M3CF 3M3EA 4BPZA 4FPOB 5CAZA 4FQZA 1W6QB 5IK8A 3RRDA 2CYFA 2NYYA 4PCRA 5T5JA 5DG2A 4AGGA 3APBA 1C1LA 4K20A 1V6OA 1AXKA 1J1TA 1WBLA 2LALA 1APNA 2D3SA 4FP3A 5HCAA 1GLHA 3I8TA 3AX4A 4LBQB 4PQ9A 4XJUA 3H0OA 1ZM1A 2D6MA 4XHBA 4ATEA 3UJOA 4M01A 1W6PA 2B7YA 1V6NA 4AWDA 4RL7A 4XJ8A 3ILRA 1Q8VA 3ILFA 2A6WA 1GBGA 2A6YA 1JW6A 3PVOA 3RG0A 2W08A 1LOFA 3AP9A 1GZCA 3OGGA 4XE9A 1LHVA 4DRRA 2YZ4A 1N47A 2E51A 1D0HA 3A0NA 2D44A 1WLWA 3N36A 4UW6A 1BJQA 1CPNA 4Y1ZA 1LEDA 2ZGTA 2ZMNA 5JOWA 3V0AA 2CTVA 2P3IA 1A8DA 2GMMA 2DWRA 2CY6A 2AENA 4XXPA 1QGLA 2DYCA 4HL0A 1N3QA 5FREA 1QOOA 2R0FA 3B01A 4YM0A 3AXDA 2CWSA 3AFKA 3R05A 4JCKA 2SBAA 1NLSA 2I2SA 3WDWA 5IUQA 3AZYA 1QOSA 1WW4A 2PELA 4XMAA 4Y1VA 1AJKA 1LU1A 4GWMA 5DUWA 3TAYA 1MS1A 3ZSMA 2DU0A 2CL2A 3FUOA 3CNAA 3N7MA 1H9PA 3SLIA 1UN1A 2R16A 3ZXJA 5GLZA 2D6PA 2D43A 4LBJA 2ZGNA 4L8QA 1WD3A 2PHXA 3UK9A 1IS3A 3WG2A 1LJ7A 3UL2A 4YZ3A 1VAMA 2DVFA 1YXWA 2Z42A 1PZ7A 1SCSA 2ZA9A 1LULA 4GKYA 2VXRA 2AUYA 4UW4A 1GZ9A 1N1YA 1GV9A 2P34A 5H9RA 1IKQA 1LCLA 5JOXA 1EPWA 1W6OB 2GNTA 1N1SA 4FVVA 4M3CA 2OW4A 4U36A 4BQ1A 1UZYA 2JD4A 5GZEA 3AYEA 1CR7A 1SACA 2V73A 4YW2A 5DG1A 3USUB 4FOQA 3AZXA 3OY8B 4XXAA 3B3QE 2C9AA 3INAA 1AF9A 1OFSA 1UKGA 1JUIA 4Z8BA 5LK5A 2DURA 4F83A 1CVNA 3AYCA 3FLPA 4XJZA 4M3CE 1AJOA 3N7LA 1LOAA 3VKLA 2GDFA 1CIWA 5KXEA 1CJPA 1IS6A 1WBFA 3AYDA 2A6VA 1MS9A 2A6ZA 1QU0A 3AP6A
chains in the Genus database with same CATH superfamily
4A45A 2HLEA 2WAAA 3CQOA 1BVVA 5LA0A 4CDXB 1KXGA 1RUH2 2HYXA 2FDIA 4CRQA 2WYFA 2JEMA 2P6CA 4P02B 1ODMA 1PNGA 3A4UA 3AMHA 5C70A 2EICA 4UWDA 5A6QA 3GF6A 3IIIA 2YB7A 5D2AA 1UZZA 1LGNA 3H8RA 2ZTNA 3AMNA 4AAPA 1LECA 1JOJA 1POV0 4ZONA 2BBAA 1COV1 2P3YA 4HKLA 3HBKA 1W8WA 3O0XA 2VVFA 1SFPA 2Y0OA 1J3QA 4XBNA 3SITA 1DHKB 1UOFA 2A7AA 4LPLA 4K8FA 3THDA 1N3OA 5CISA 5FPUA 5FKCA 4AQ6A 2JG8A 4PIYA 3WV6A 5KXBA 4Q4X3 5JZGB 3O14A 1OLQA 4META 1N1TA 1GUIA 1JUHA 3AZWA 4YVSB 2EAAA 5T55A 4E8DA 1YIFA 1YWKA 5FYHA 2LM3A 4W6YA 4Z92B 2WZR2 1J1LA 1ULCA 4IL7A 4JDMA 4V1PA 1PVC2 5BNNB 2WNUA 5FP7A 1RITA 2A73B 5FP4A 5FPZA 1FOD1 3BU0A 1QDCA 1NA1A 3C8XA 3RYPA 4P00B 2OZ6A 1T6GC 1WW7A 3DKWA 4IEZA 4QM8A 1E5HA 1LKNA 3NV1A 3LSDA 2YC4A 3AZVA 3QCWA 4QM9A 2XBO3 2OZJA 3AM2A 4ZS3A 1S2EA 2ET1A 3E5XA 4BQ3A 1W06A 2E31A 4YGBA 3B00A 1I9RA 3KD4A 4GIQA 5I0UA 3OUJA 3N9PA 3VZKA 2WNUC 4RR3C 4GXLA 3AYAA 5B4XA 2ZHMA 4EZHA 5DMYA 5JLVA 4AFDA 3PVEA 1SFYA 1ZBE1 2OUJA 4Y1YA 5CG9A 2NPIA 3U11A 2VOVA 2KM2A 1FATA 5T52A 1DBNA 4C8DA 3LFIA 2DUOA 2J7MA 1H9WA 4KG0A 2HBTA 1XE0A 3ZXGA 1IZ3A 3SISA 4K1ZA 3AVSA 1K5MB 1IG0A 3DEMA 3SEEA 2C6SA 4RGAA 1V0AA 3GYDA 5FLHA 2VW0A 5J48A 4H3WA 4EN7B 4OMCA 2Y6JA 4D0QA 1ND3B 1JYWA 5F8PA 1C1FA 2ZCWA 4Q1PA 3IAQA 2EXHA 4IV3A 1ZNPA 4IE0A 3KV6A 3HT1A 2Y33A 3LF7A 3J7MA 5LEJA 2Z4FA 1DDLA 1WWYA 4QKDA 4MHRA 3S7EA 4Q2FA 1W6MA 2E33A 3T1LA 2P3JA 1IS4A 4GWJA 4R9DA 3WDTA 4S2HA 4CDXA 3P5BA 3WNXA 1Z78A 1XQNA 3TB0A 1W8OA 4Y1UA 5E8AA 2QNKA 1BBT2 1MS5A 2CAVA 1Z0HA 2AREA 1F4HA 3OPZA 4J25A 2ZGMA 5E1RA 1F31A 3MW3A 4COWA 5C8CC 1NCQA 1VR3A 4OMDA 4ZY9A 4FP2A 3N35A 4ZHNA 5F5AA 3E5UA 1ENQA 4B1LA 3QH7A 5JR7B 4Q4W3 4Q0VA 4WM7C 5HBAA 4DY5A 4CCJA 4GH4B 5JXJA 3S57A 5TSWA 4HN1A 2XPJA 5FKBA 2EXKA 1PIV3 3PUHA 1O5LA 4LUMA 4QPIB 1CZVA 3UYJA 1GOHA 1LGCA 3PUIA 4OVEA 2VTFA 3TNPB 1GP6A 3WNKA 1GWLA 3D3AA 3T2TA 5GLVA 3MIFA 3NV4A 4L0PA 3IDAA 5GLUA 3VBRB 4DIQA 2DCZA 2BZDA 1YO8A 2QQKA 3D82A 1E5RA 4N9HA 5A1AA 4XJ9A 1JI6A 5BNPA 4OULA 2RDSA 5GM0A 3ATGA 2MEV1 1OF3A 1DU3D 1NA1B 5J37A 4NHKA 3ON7A 5FYSA 3NNMA 2XONA 1PX4A 2QFEA 2BGPA 2WABA 5FP8A 4AVAA 1BMV2 2VZ1A 3EHKA 1ZZ7A 3M70A 2Q0AA 2VMGA 1FAYA 4LJHA 1D4M3 5EJZB 4UXAA 4V2VA 4AGVA 3DGTA 3I2DA 4FPJA 3ZXLA 4CUAA 1C8M2 1W28A 2W0XA 3RMXA 3AP7A 1B09A 5ABJC 3L9JT 1NCQC 4LHNA 3JBG1 2VZPA 2Y6LA 3J26N 3IMMA 3I3EA 4YZ1A 4CCNA 2R061 1PO12 3OJBA 1OD5A 4FTEA 1GYKA 4TXWA 1RVF2 4CDQB 1F2NA 5LWBA 3WNMA 1OC1A 2ZZJA 5FY9A 2W1WA 1UL9A 4X6QB 1W9YA 1I5ZA 2JJ6A 2TUNA 2W92A 3IKWA 3J8F1 5IK4A 1QY4A 4Q4X1 2JICA 2OS2A 3NAPB 1NOVA 1VBA3 3WF2A 1G9FA 3OYWA 2JXAA 2PHUA 4Q4V1 4BIFA 2VMIA 2FDFA 3DKQA 1AYM2 2ARXA 4FPCA 2EVXA 5LATA 2VE1A 4JV4A 3VZNA 1XNAA 2IVIB 4GMP1 1LESA 1CESA 3WOGA 3JQWA 5C3SA 1I1EA 1QQP2 1QDOA 4XFAA 5A7PA 3H8XA 5J7MA 1TME3 5CU1A 3ZFEC 1OH3A 4IERA 4IEQA 1DP0A 3ZPYA 5ERLA 1ZRCA 1W6MB 2P3KA 3K48A 2WFPA 4CU9A 1ULEA 2PHRA 1BZWA 2E32A 3NV2A 3G7DA 2D93A 4FI9A 2BEOA 4A44A 2RMU2 3WQ1A 5CFCA 1NQJA 4CXYA 2NP0A 1X50A 2E7AA 1O4YA 3W20A 1MACA 4XVHA 4LOSA 4BQWA 1NE6A 1PZ9A 3WHUA 2ETEA 1QJX2 4CZSA 5K0UA 2RM21 1DQ4A 3CEWA 1QHDA 3T4VA 1EAH3 3GJAA 4K7JA 3ALQA 4XETA 5FZHA 4YWAA 4W65A 4XIKA 4CEWA 2EIDA 5JMCA 3DECA 4EN6B 5I93A 1NCRA 4N9IA 1VRH1 1R64A 2R49A 5C8CB 1EV12 3PVNA 1YNAA 2E53A 3WNOA 2VAUA 1G9BA 4F8AA 2V09A 5IT6A 1RUH3 3IDCB 3H9AA 4XJAA 2IWGB 3UV9A 4CDWB 4ZS2A 1O3SA 1NZIA 1ZRFA 4LO6B 1FMD2 4WM7B 1LRHA 2B45X 1XYPA 2PLV3 2UURA 3NNLA 3GCXA 4YW5A 1UPSA 4WVVA 1SPPB 2IUWA 4XBQA 1PK6C 1I3HA 2FD8A 2XWJB 2F4LA 1S4CA 1MZEA 4TYSA 1A8MA 1GZWA 1W9SA 1H2LA 3CBNA 5LRRA 5AFEA 4PLMA 5JSOA 2XXZA 3VBRC 1Q56A 2R0HA 3IIAA 1OFNA 4KGGA 4YW7A 1DYKA 3P3PA 2VNRA 1VJ2A 4HKOA 5CZKA 3ZN6B 3UGGA 3ZXEA 4XACA 3ENRA 4E2SA 4TWTA 5LRSA 5FZ1A 3OGSA 3Q8AA 4R9AA 4EWEA 4Y24A 3NNJA 2OXBA 1IS5A 2QQMA 2RM23 3JU9A 4IXLA 3WDVA 3UT0A 4BQ5A 5C9AC 4X8PA 2W46A 3RVHA 1PGSA 3SCHA 3FBYA 2QQLA 2WZR3 2VZVA 4LBOA 5LA2A 2W3JA 1C8NA 1H2KA 2BGOA 2A5ZA 1W9TA 3AMMA 5KXCA 5JDBA 2WQ8A 1ENRA 4FT8A 4QGLA 3OB8A 5CFDA 3E97A 1IG3A 3CO2A 4CA9A 4I2OA 2JDPA 4YFZA 1TME1 4FPEA 1VRH3 4IV3C 4LK6A 5SV8A 1QNYA 2QQVA 2CU5A 2P37A 4JKKA 2FCUA 1GQPA 2XJTA 5HCBA 2XJVA 2GP5A 3Q9OA 3S5AA 1NLRA 1RJ8A 3USUA 1J84A 4AVVA 3D6EA 2JWPA 3I2OA 4W4ZA 3BGAA 2Q8CA 5L7OC 4MGTA 1ODNA 4D69A 2YC2A 1AR72 2D5FA 2UWAA 4IESA 4P9YA 4BQXA 1PX3A 2CV6A 2ZGLA 3NVCA 3U14A 3ETPA 3I54A 4JZRA 4M4RA 4W6XA 4KBZA 1FV3A 3ZFEB 3UKNA 3NWKA 4AHYA 5IK5A 2YPDA 3VBHB 1XSQA 2WQ4A 4XEZA 4QDQA 4EN9B 4XUNA 2XDVA 2EA7A 5EXOA 4CP0A 4CYDA 2XOMA 2WT1A 4KG8A 4AE2A 1HRI1 4LA2A 5FCCA 1UU5A 1XXNA 2WFF2 1YCIA 2ZX2A 4I3PA 5BNPC 4CEWC 3VBOB 4FXKB 5FZ3A 1D7PM 3VZJA 3HD8B 3WDXA 1US3A 4NIGA 1HRV1 5IVBA 4PDWA 1JZ6A 2G4IA 4LA3A 1G7YA 4Y22A 4D94A 4MH0E 1DF0A 3W59A 1WCDJ 4HLTA 4I0BA 1UD1A 1TE1B 2G1MA 2LW8A 1WCKA 2JDAA 2VY0A 5T54A 3DV8A 2VGDA 2ZGUA 5IAXA 4LBKA 1G9AA 2F6BA 4XF3A 4IEVA 1SPPA 1S0GA 2RS12 1FYUA 2EXIA 1QJFA 4NAOA 1KJLA 3IPVA 4GKXA 4A7KA 1IPJA 1HN1A 2RJLA 4GWIA 3M3EA 4JKLA 5JAXA 1E57A 2HWF1 1W8HA 1W2NA 3ZX7A 4YYOA 4CU7A 2O8OA 3VL9A 4PCRA 4K8RB 4AGGA 3K4DA 1W39A 1Y4WA 3JD71 1WBLA 2LALA 1AR92 3UETA 5BY5A 5LY1A 1CIYA 3H0OA 1ZM1A 4HFSA 4AQ2A 5A70A 1J83A 1YUDA 4Q0QA 1W6PA 1ZBA1 3KT1A 3POEA 1QJX1 3BTZA 2AEZA 4AHXA 4CDXC 3B93A 2A6WA 1GBGA 3NJZA 4PIXA 2GC1A 5FXVA 1EAH1 2W08A 3VBFA 2GH2A 4NHLA 2BRTA 1H4GA 1RMU3 5BNNC 5IFPA 5LB6A 2V4AA 2JDMA 3A0NA 5A3NA 1WLWA 2PFWA 3DPRC 5FLJA 3OF1A 2ZMNA 3HJRA 3MUY1 4KWLA 3V0AA 4B3NA 3T3YA 4D6RA 2EIEA 2P3IA 1PGW1 4J1XA 1HV0A 2Y64A 4BK4A 1RUJ2 4XXPA 4E4SA 5A6YA 2R0FA 3T0DA 2CWSA 3KT4A 3PNAA 4QHZA 5C4WB 3LPFA 3NMBA 3KZ4C 2X5IB 3AZYA 2VMFA 4H7LA 4RGKA 1DGWA 4BJ0A 4Y5Z0 4HMZA 1TG7A 4UYBA 1OBNA 3MO4A 3N9LA 1L7LA 4OUSA 1FOD2 3RJRA 3U0ZA 5GKAC 3FC0A 1RUE2 3LEMA 4NUBA 3USSA 5A3WA 2CL2A 3FUOA 3CNAA 1BK0A 3N7MA 1UN1A 2R16A 3ZXJA 4AFMA 3GZUC 4CEYC 4FTBA 3KVAA 1UZ0A 3O1VA 3LA7A 4QXHA 2FBEA 2WWSA 4G4FA 2WS91 2ZGNA 3GZEA 1WD3A 2PHXA 3Q8BA 3ME2A 2OKXA 3FHAA 5BNOA 4WVZA 2B39A 1H8VA 2ZA9A 4Q0SA 5FY5A 5A7QA 5J3UA 1C3HA 1OOPB 2AUYA 4UW4A 4ZPIA 1GZ9A 2HKXA 1CAXB 1XNKA 1D4M1 5FQ0B 1W2TA 3TNQA 1OPOA 1MEC3 1W6OB 2GNTA 3POBA 2VUCA 3LGRA 1BBT3 5EP9A 4BQ1A 1RMU1 4YW2A 2V73A 2Q4SA 2XKOA 3AZXA 5APAA 1TME2 2XUMA 2VQUA 1YFXA 2BP6A 1JUIA 4YVWB 1FPN3 4QX8A 4QX1A 5D21A 4Y5TA 4HSJA 3HQXA 1JS9A 2GC2A 3W21A 4XJZA 1ULOA 4M3CE 4FFHA 2CGOA 2UY9A 4QX7A 2MEV2 5DDJ1 3VBHC 3VKLA 2YGMA 2W1UA 4OHXA 1W8FA 4D3WA 5KXEA 1UY2A 5BV6A 3NRUA 1WBFA 3MZHA 4B4QA 2A6ZA 2HJIA 4NMIA 4BCUA 3WQ7A 5J1XA 1AXZA 5FZ6A 2XQXA 1AR61 1ENXA 3IZOA 5JI7A 2X29A 1W05A 2VW1A 3VD7A 4BE3A 1O3QA 4MGSA 3OBZA 1S2BA 1CX1A 4UI9L 1AXYA 4LO8A 3WR0A 2JIJA 3VUOA 5DUVA 4CDUC 2BV4A 1JH5A 5LASA 2VZ3A 1UMIA 1VLNA 1QH7A 2YU1A 3KGLA 3JQXA 5E89A 2Y34A 4E8CA 1V9U3 4JQTA 2KA3A 5A3PA 3IN9A 1PK6B 2OPWA 2RS31 5FPXA 3BB6A 4LE3A 4OZXA 4XF1A 3ILNA 1ULGA 1Q3EA 1LENA 4KNCA 1D4M2 4COVA 4QXCA 1F15A 1Y9MA 4FBFA 1HKDA 2IFWA 1OXCA 2H0VA 2Q1ZB 2KR2A 3KQRA 4M3CB 1QOTA 2ENRA 1PGL1 1DYOA 1QJEA 4DQAA 1NUKA 3PUQA 3MBWA 4CXXA 4D6SA 3OY8A 4NO4A 4BA6A 4CE8A 5L19A 3ZDVA 2XBO1 2L9LA 4XDQA 4BISA 1FV2A 1RHI1 4QT6A 4F7ZA 4QKBA 1VMHA 1VB4A 1ND2A 1K3IA 4PHZA 3TOJA 4M4PA 1YQ6A 3T09A 4FCAA 4BLJA 4OQ9A 5ANQA 2X5IA 1UO9A 2VH9A 3H3UA 5FZKA 2W9XA 4AFCA 4OCTA 4BU2A 3R4SA 1HXS1 1QWRA 2CWMA 1CGPA 2W39A 3OD4A 5FYCA 2GN3A 2DBNA 4XDPA 2ARAA 2RM22 2W95A 1H6YA 3BOPA 1WW5A 1JXNA 3PLQA 4UFKA 3MW2A 4PLOA 2VQAA 4HANA 1ULFA 1AHSA 1AX0A 2ZGKA 5D8AC 5L73A 1ZZBA 5I0TA 5C4WC 2FDKA 1AZDA 4MSVA 1XOYA 2P2KA 4HBNA 4R52A 3WX5A 1H1MA 2YG0A 4Q4Y3 2EXJA 2GAUA 4JQRA 5FUPA 1CAXA 2WO1A 2YBKA 2B5HA 1W6QA 4A6SA 4HSLA 1WLDA 3M3IA 1W6NA 4YGDA 1C4RA 3RDIA 3WNPA 1MVQA 3FE5A 3B02A 2QUOA 4UW3A 3GXUA 1VRH2 4KL1A 4XF4A 4YW3A 1Y9GA 2ZMKA 1GP5A 3T2PA 4ASMB 3EQEA 3I2KA 5GZGA 1SZBA 2IFRA 4CTEA 4YRDA 3M2MA 1UZWA 3VHOA 1NE4A 1H8TB 4LK7A 4P9XA 3LOBA 2XL7A 4QGMA 3O1TA 5CKNA 4EYUA 1LOBA 2VOTA 1AYN2 5KHKA 1LHWA 4CCLA 1OURA 1V6MA 2ADDA 3J7LA 1YYNA 1EP0A 2WZ8A 1OA2A 4JTNA 4Z82A 4PIZA 3WF1A 3PTYA 1Q8QA 4YM3A 5EHDA 2OVUA 3LD8A 4C0HA 4CUCA 3WP3A 2AZ5A 4ZZ8A 1YI9A 1XU1A 5BPXA 3W5NA 5BNNA 4AOCA 2J1EA 3K2OA 3D8CA 1LOFC 2Y0IA 4KMQA 4XZPA 3ZFFA 4XFBA 1QJY2 5F9TA 4A42A 3MIDA 2PMWB 2R072 1S0CA 4AR2A 1Q43A 4QGNA 1KFUL 1JU4A 5ACA3 4HK8A 2WZPP 2JDKA 3A23A 3ZM8A 3RPQA 5JSPA 2F4PA 5F3GA 3VL8A 5T5LA 3V0BB 3IB3A 4BWOA 5IVVA 2FZ2A 2Y6FA 1HV1A 4UFHA 1WMDA 3MIBA 5FZ8A 2IZWA 5E6HA 5CBLA 4XTPA 3T0BA 2B46X 4CDUB 2JKBA 1VBE1 4XIOA 3VDDA 3J8F2 2RS13 4OI2A 2DUPA 5DAWA 5C3QA 2ZGOA 4AI9A 2ID4A 1QXRA 2W1QA 1GWMA 2YHJA 5H9QA 4BYYA 3AKQA 4P5HA 2XB6C 2GSYA 5GJ6A 3WG1A 2W47A 4LE4A 3OGVA 1AR93 1PM4A 4ONUA 1RGSA 3U07A 3S30A 1G6NA 4A7ZA 5F37A 5F1RA 2Y38A 4Y4YA 4MX3A 4ZU4A 2ZHNA 4TLGA 1RIRA 4QXBA 1T6BX 3EYPA 3A7QA 1SHWB 4QKFA 4RSUA 3O1UA 1RTVA 5F2WA 2CNAA 1HQNA 3PIJA 4LKSA 2W68A 4H14A 5IFTA 3WT3A 3N7JA 4YZ5A 2DVBA 3LIHA 1OVPA 4MGZE 4QWNA 1JZ2A 1ZBA3 4XFGA 4DEVA 2Q30A 3X29B 3GNEA 5G05L 2DUQA 2DCTA 4OUEA 2R071 4A4AA 1LNSA 2OUHA 3BIWE 4GQ7A 1JYVA 2Z2SB 3I59B 1YEWA 4FPLA 4P14A 5F2SA 4NPLA 1NY72 1RUC1 3OEBA 4UFJA 4DNYA 5C5UA 1JHNA 2YV8A 2YROA 1YQ5A 4HPKB 3CU7A 3JUUA 3C2UA 4NWWA 1VP6A 3OGJA 4NR1A 4BB3A 4DUVA 1OI6A 1UCXA 3HN3A 4Y33A 4XFFA 1VPHA 4NRPA 5L9VA 2TBVA 4DXZA 1U5YA 3POWA 3POYA 5EJ1B 5C9AB 1CN1A 1LOGA 3ZFGA 3FFZA 1VRBA 3MIEA 3LB9A 4XCAA 5A3UA 4ATFA 3WDUA 4LBQA 4MV2A 2FHRA 4W50A 1GU3A 1RUJ1 3OG2A 1DZQA 4EV0A 1PO21 3MLKA 1PGW2 1W0OA 4LLOA 5T50A 4BXFA 1L7RA 2ZEWA 1WMFA 3B9CA 3AMPA 4PJYA 2VCBA 4XBLA 4YFWA 1Q8OA 3MIHA 5CYYA 5T5PA 4AI3A 1TQ5A 3ZFFB 2VO5A 5FZ0A 2Q1MA 5FYZA 3CJXA 3WSOA 4NHYA 3FX3A 3LZZA 1UQXA 2O14A 3GBWA 3SH3A 1FNYA 1YQ2A 2X53S 2XHNA 4B7EA 5CIRA 1SBDA 3ZR5A 3N3HA 3RZLA 1U0AA 1BHGA 3POGA 4M00A 1GWKA 1AYN1 1VBB1 1Z7S1 1YJKA 4MXWA 5BYNA 2EIGA 2ZJCA 4EJRA 5FXWA 5A6XA 4KQ7A 2WNVC 1JODA 3IT8A 4RQPA 4ZXKA 5FPAA 4EZ4A 3WXPA 3TRSB 3KCCA 3BPSA 2VMHA 1UYZA 4K40A 3VDDB 2A6XA 2WSVA 1UY0A 3PDQA 2YUEA 4XMIA 3VBSB 4DXTA 4HVQA 4XDOA 3BYWA 4XAAA 2AEYA 1REEA 2JE9A 1KRIA 2FCTA 2R32A 1CAUA 3RNSA 2JG8C 4DMIA 2QZ2A 2PAMA 4FAGA 2IXHA 2G9ZA 2VR4A 4MZUA 2GNMA 2UYBA 2DVGA 4HN0A 3FN9A 1G86A 4IV1B 1WLTA 3MIGA 4A7YA 2CSGA 1LB2A 1JHJA 2XJRA 1K5MA 1MS3A 2Z79A 4Q0PA 1VBD3 3GALA 2VBPA 5IW0A 4A3XA 2NLRA 4CVUA 4EWDA 4IEXA 3SC7X 2GU9A 2P4EA 4YM1A 5CVRA 5AVAA 1WMEA 1RUF1 2WT2A 4CCKA 1S0DA 3M7AA 1RUJ3 2YDEA 3SCGA 2EF6A 4EQVA 3J4UH 1EUTA 3GCWA 2C26A 5FMCA 3ITQA 2JECA 4LKDA 1F5JA 2BDRA 3AK0A 4XJWA 1QH6A 2ZGRA 2DTWA 5FZOB 4AI2A 1CPMA 2OYZA 3WNNA 1DQ5A 1KD7A 5JPNB 1UXXX 3RZZA 2ZGSA 3EXUA 4I0WB 1FOD3 1F4AA 3V56A 2EAKA 5J98B 1AR83 3NV3A 4WVWA 1RUE3 1JYIA 4CUBA 2XBO2 3MGUA 4RHV3 4XTMA 5H9PA 3CKHA 3VBFC 3LE0A 4FFFA 3WG4A 3THCA 2W52A 1WA4A 3I3MA 3WW3A 3N4MA 1YRZA 5IVYA 5FZCA 1ZBE3 3C7HA 1H1IA 3A0KA 3MYXA 4OHYA 4ISRA 1NT0A 4RS5B 3U10A 4OLLA 4FOVA 3RZMA 3I2FA 4FPGA 3SHRA 5HPOA 5JMOA 2R043 3O1RA 5LCWL 2PQSA 1NLQA 4OZOA 3BN6A 3MLLA 1GKBA 2DBIA 3I3DA 3LCPA 4NVPA 2FCVA 4M0NA 4AVTA 1S0BA 4COYA 1PZ8A 1FNZA 2VBBA 2WIIB 3PL0A 4CP2A 3KF5A 1MS0A 2OT7A 1FPN2 1PO13 2VL4A 1YFUA 2XJUA 4JGYA 4QX5A 1RVF3 3VBRA 4IW3A 4E4ZA 4LIUA 4ZU5A 2WC2A 4CCOA 1OSGA 1US2A 4P9WA 4UF0B 2PHTA 5GZFA 1GZWB 2XJPA 5BNPB 2XJQA 1VBA2 3EMRA 1K42A 2WJSA 2FZ1A 2WO7A 2JG9C 1XNDA 1S0FA 2PHLA 4LKFA 3LEKA 3U4SA 4LO5B 3LA2A 2XVKA 3VDCA 1M06G 2VBDA 2YC0A 2WWJA 1XBFA 2AR6A 1W9WA 2VULA 2O0OA 3M3OA 2RR11 5J09A 4JGZB 4MO3M 3AKTA 3PMSA 3SEPA 4FPHA 2UWBA 2VUAA 1KITA 3IM0A 5JVVA 3TN92 4LHLA 1LR5A 1SEFA 3OBTA 3NJXA 4OHVA 2HBUA 1W3XA 3MICA 1V9U1 4XHXA 3UKTA 1DLLA 1TNFA 1W8UA 1R083 4IE7A 4AFBA 4AVSA 1QJY3 4DUXA 2BOJA 3TEYA 1W2OA 4XUOA 4XPVA 5H9SA 4QPWA 3RWKX 4IV1A 1RUG3 5FZLA 5F3CA 5F5CA 3OYWB 5A3TA 1LTEA 2XQRA 1U5IA 1XYNA 2A75A 3AL6A 1EAH2 1N1VA 3DL3A 4LO7A 2ZX0A 2VCCA 3FUQA 3HQRA 4M3CF 4BPZA 3UNPA 5IK8A 4RHV1 5CAZA 3RRDA 2CYFA 4XUPA 1RUE1 4QQOA 3APBA 4K20A 2D3SA 3I8TA 3D0JA 5F32A 1U5ZA 1JYNA 5FZOA 2JIGA 4B1MA 3ZLIA 4ATEA 3UJOA 1RUD1 2PYTA 1SFNA 1V6NA 2B7YA 1VBB2 3MLJA 3B5LB 4RL7A 3ILRA 3ILFA 1YJLA 5F39A 1QJU1 1JW6A 3H50A 3POIA 4XE9A 3OGGA 4WVMA 1ASJ1 3LPGA 2RS11 2YZ4A 1N47A 3VHNA 3VBHA 3C7OA 1D0HA 4BH9A 3LDRA 1DGRN 1WCUA 3M4FA 3N36A 2QZ3A 1BJQA 1CPNA 3N9OA 4SBVA 4IEYA 4INDA 1LEDA 2ZGTA 2VZSA 2IC1A 4Q0UA 5JOWA 4RS5A 4R4ZA 3MI8A 4Q4Y2 4DUWA 1UWWA 1X82A 4AHZA 5K4LA 5ISLA 4AEKA 2CY6A 2Y6KA 2R7EB 5FLIA 3LIGA 5FREA 4AAXA 2WS93 3B01A 4L97A 1ZBA2 3CJIC 5LA9A 3AFKA 3R05A 4JCKA 4TN7A 2I2SA 4DXRA 1QOSA 3F95A 2JDYA 4PI2A 4XMAA 2XWBB 4XF9A 3E6BA 2Y60A 4FSJA 2BPA2 1AJKA 4GWMA 2NQYA 3RZJA 1H9PA 1HXS3 2WZR1 4I01A 4CDWA 1HB2A 2VC9A 4B7KA 1CAVA 1RUF3 1CJDA 5HV4A 2WBKA 4KI5M 1VBC1 5FIXA 2JDHA 3SCFA 2D5HA 3BTYA 2YYOA 1RVF1 2RDRA 1IS3A 5FUIA 2R062 2HWC1 1VAMA 2DVFA 4YZ3A 2Z42A 2H6CA 3B94A 1TMF2 2VMDA 2J1AA 4RFRB 3VBUA 3WQ0A 4ZU7A 5JOXA 1IKQA 2QJVA 5JCTA 1EPWA 5C33A 1N1SA 1VMJA 4FVVA 2OW4A 3DXTA 2RMU3 4U36A 4JGZA 5FYUA 1ZZ6A 3O1MA 2JD4A 3AYEA 1SACA 2VZRA 3NL1A 4XFCA 5D8AB 3INAA 5FMOL 1OFSA 1XJAA 2YPJA 5FYVA 1OA4A 4F83A 1GQHA 1NCRC 4XC9A 5FZ9A 2VJXA 1MQTA 3KV9A 1AJOA 4LMFA 1AR73 1LOAA 3POJA 3ACLA 1DZTA 2I74A 1IS6A 3AYDA 5B2GB 2GNBA 4W8JA 3Q8FA 5HCHA 1T2XA 1EUUA 2WNVB 3VN4A 4Y5SA 4XFIA 2HWD1 3I2GA 3L2YA 3P3NA 3RJ2X 1EV13 1XNTA 1H6XA 4HVRA 1X7NA 1V6IA 1QF3A 2YFUA 3DXUA 2DVDA 1AUYA 3HMYA 3KCYA 1P8JA 1ULPA 2GP3A 5CFDB 3P6BA 4R9CA 3ST7A 1FX5A 2PLV2 5LBFA 3T08A 4DS0A 3KV4A 1ZZ8A 1RINA 4LO4B 4IETA 4YZ2A 5IATA 4FPYA 1ALYA 1M4WA 5FZ7A 1GMMA 5K9YA 2XR4A 1R1ZA 2PHDA 3FLRA 2HWB3 1V6JA 2V4VA 3MF6A 5CKQA 4YVSC 3RYRA 3GZTB 5D1IA 1HRV3 2QCSB 3C7GA 4AGRA 2CGNA 5A6ZA 2VM9A 3SNMA 4HXCA 1OKQA 3FWEA 4GWNA 5BNOB 1GR3A 3NNFA 4NHXA 1O8PA 4D6QA 4I09A 4CXWA 5IAVA 4ZKTB 3GBGA 2D6LX 4KBBA 2W2IA 4WZCA 4YGCA 1W6OA 3RMYA 3ZKYA 2VOKA 2WNOA 2XGXA 1A3KA 2BWAA 2HWC2 5JOYA 3TEWA 4KWJA 1CX4A 4YGEA 1VBC2 4UOJA 3WUCA 1PVXA 4FPKA 2VW2A 4GH4C 3SH5A 4NRQA 3GBFA 3RZGA 1UF2C 3KQ4B 5L9BA 4Y26A 2WA4A 4AVBA 4CDQA 4E4DX 3HOBA 2WT0A 5FBJA 4YPJA 2ZHKA 4Y20B 4Q4V3 3TEXA 3WP5A 3BKZA 5A7WB 2EALA 4Y22B 1SQ4A 1HQWA 3WHTA 1ZRRA 2P6HA 2ZBJA 1RL3A 1CAVB 4QD2A 3B9IA 2HWD3 3D5OA 4P9LA 1STMA 1JYTA 4Y1XA 3AXEA 4AZZA 2YY1A 5IVCA 2A71A 1JZ3A 1NA1C 3ZYHA 1ZBE2 2WO2A 1ZZ9A 5LBEA 2DU1A 4IUGA 2ZMLA 5LZ6A 2D97A 1VE0A 4LUKA 4N53C 3KHCA 1Q8SA 5F6LB 2P17A 1F9KA 2K9ZA 1ASJ2 1CAWA 3EO6A 5FJHA 3WCRA 1SLBA 1IHMA 2AACA 4E9KA 4IE6A 5A3OA 4KGQA 3VD3A 5C3OA 5F3IA 2JE7A 2TEPA 4XILA 3JD73 3CMGA 3ZYRA 2FMDA 5CFCB 1PMHX 4N43A 3ZFFC 2FDGA 4I0AA 5CB7A 1MZ5A 2A3XA 4QDSA 4LKEA 3PUAA 3KHBA 3S5QA 1RUI1 1C57A 4FFIA 2RDNA 3UGHA 4EN8B 5K0UB 5FPVA 4BOWA 1SLCA 2QQUA 1HDKA 1Q8PA 1YHFA 2I07B 4IDZA 4XYXA 3MEPA 5C5TA 4SLIA 4UFLA 4AEMA 1RC6A 4CP9B 4G3YC 1GNHA 2HWF3 4N90A 2BYVE 4OYUA 4NWVA 2NMNA 1VBE3 1RUC2 4KH9A 4PBPA 1IQDC 4CEWB 2WRAA 4QXKA 1BKZA 2D6OX 4AI1A 3FLTA 4CCMA 3BIEA 1A6CA 1KDKA 1NCRB 3ZMOA 4U2AA 5GZDA 4Q26A 4UW5A 5CNAA 4CCCA 3AB0A 1C8M1 1JOPA 2BTVC 1GOFA 1JOBA 5FY4A 5J36A 1PO22 3AKRA 3HNBM 3TN93 2C4XA 2ZEYA 1RUNA 2VNGA 3BPZA 1JN2P 4B8EA 1BXHA 1X9PA 1SCRA 4MG2A 1WZXA 2UYAA 3ZOIA 1IPSA 4UBGA 3QOPA 4AVCA 5FZAA 1HQLA 4G9SB 1I6XA 3LA3A 4DINB 4NRMA 1VAVA 1NXD1 3WUDA 1OHFA 4IV1C 4JRAA 5FP9A 5FY1A 4P5YA 1RUG2 3U37A 1DFQA 2RS52 2ZACA 4NROA 1OA3A 1UMZA 1F35A 1NY71 1MR5A 2DV9A 4Q1RA 1DQ0A 4URAA 1PO11 1JTZX 3BALA 3ZSLA 3WF4A 3AP4A 2GMPA 2WR9A 4JVAA 2XLAA 4L9BA 4ES8A 5BNOC 4W6WA 3THPA 4HZFA 3VDBA 4QPIC 2ZABA 5DDJ2 5GALA 1MS4A 2P1BA 2IXIA 5FUNA 3WY6A 1QKQA 2E6VA 3NQHA 4RR3B 4RN5A 3ZSJA 1RYYA 1H1AA 1VMFA 2WDBA 4QB1A 3TBDA 4OI4A 3A21A 4CDWC 1WUVA 2VMEA 2ZAAA 1DQ6A 2JG8B 2NMOA 4FXGB 4K3UA 5KC5A 4TZDA 2QTWB 1COV3 1A34A 3POSA 2QDNA 2C9KA 3ZYPA 5C8WA 4YG6A 1V70A 1XE7A 4Q27A 3AP5A 3PU8A 4YNIA 4RGGA 3ZYIB 1JZ7A 1REFA 3MPPG 4AEDC 2WN2A 2YU2A 4IEWA 4K6BA 4Y4RA 2Y6GA 2OA2A 4HETA 2WS92 3O7OA 4Z2WA 2BGCA 2RS51 4QB6A 1R1A2 1RUI3 4X8NA 3PIGA 4CEYB 5KHIA 3ZSKA 3ECQA 5JSRA 1OPMA 1POQA 4C90A 2LTNA 1PMIA 1W2AX 2K46A 4LBNA 2VCAA 1U5XA 2XKPA 3ES4A 3HQUA 4IQPA 3PJYA 4XUTA 3SXWA 1OLMA 3U75A 1O59A 1GANA 4KU7A 1F8VA 3ETQA 4E27A 2IXKA 2HEWF 2NN8A 2V5YA 2Z5WA 1RHI3 4DOUA 1RUF2 2ZEZA 4MYEA 1CD3G 2OX0A 1HW5A 3VV1A 3ZXAC 3ZPOA 4AEDA 1UOJA 4EWAA 4KWKA 3MFCA 3H3ZA 4PBOA 4DPNA 1LGBA 2ZS6B 4LR4A 2PHFA 4RS5C 5FZGA 4E4HA 3DCQA 3CIHA 3KT7A 3LAGA 1QJY1 1REDA 4HG6B 3VBOA 1O4TA 1POV1 2KD7A 2Q8DA 3UJQA 1FMD1 4D8MA 1OQ1A 4FTSA 2MEV3 5DXDA 2H0BA 1G9CA 2VZTA 2PAEA 3LEIA 3JXSA 3O0WA 3P1IA 1O3TA 2K0GA 3H1MA 4QB2A 5LY2A 1Q5OA 3BCWA 1ST8A 3ES1A 3DYPA 4P9GA 1HJGA 3WEZA 3ZIWA 1QJU2 4L92A 2GZWA 1W2UA 4LEJA 3MPBA 3Q8CA 4DZGA 2Y26A 2NZ9A 4FOWA 4FPFA 1AL0G 3OEAA 3ZO0B 5FXXA 3GDBA 1YQ8A 2GMEA 2HWE1 1Z7S3 3IWZA 4IGOA 1UY3A 4A3ZA 2BBVA 3I59A 1TZOA 3GGLA 4Q4W1 2Q1FA 3KCXA 5FY8A 4C0BA 4PQQA 1U12A 4MOAA 1VBB3 2IVJA 1ZYBA 3MF9A 2YGLA 2ILMA 2RMU1 3IAPA 4O9GA 5DAVA 4O65A 3ACHA 1GNZA 2A1XA 4JGZC 3WLUA 1LOEA 2BUKA 4XABA 3VBOC 4DEQA 4XCBA 4ARXA 2DTYA 1FT9A 4AXOA 4K9SA 4OFGA 4R8HA 4BLIA 1MZ6A 5ABJB 3LDKA 3H1YA 2HWB2 2UWCA 2ZPXA 3DF0A 3F2ZA 3LDBA 1Y9QA 2VVDA 1HRV2 4JTOA 3KB5A 1BCXA 4JKMA 1S0JA 2WO3A 2XUEA 3ZXDA 3OTFA 3RQ0A 3CZUA 2PXJA 3D0SA 4YW4A 3TN91 4CDQC 4LT5A 2J1TA 3N9QA 1PNFA 2X09A 1UU4A 1W8NA 4EROA 3VLBB 2B9UA 3DPRA 1RXFA 1W03A 4GA9A 4ASLA 4BM8A 3NAPC 4GMP3 3AFGA 1K5JA 3J8F3 5FO7B 1O5UA 1QMJA 1OUSA 4QQ2A 5FFOC 2D3PA 4ZZ5A 1OQEA 1A78A 2D3RA 5M0TA 1W99A 4Q4X2 4LBQD 4QQPA 3AKSA 5C3PA 1F5FA 2ZX1A 4CSWA 4JX0A 1O6UA 1AR81 3OD0A 3KM5A 4URTA 1AR62 3CJIA 3I3QA 2QQPA 2B4KA 2XLFA 2YBPA 3FZ3A 3QD6A 4MXWB 5KHGA 1PIV1 4YG3A 3VGIA 4H2AA 4PT6A 5JXGA 4RQPB 1FPN1 1UPIA 2HEVF 4LXLA 1UMHA 2W94A 1GNYA 1G8WA 3EBRA 1POV3 4FOYA 4HVOA 3V65A 3VDAA 1QEXA 4NPMA 2RHPA 2X8KA 3ZYFA 3IMNA 2RS32 4GZ9A 4B29A 1XNBA 2V5DA 1SBFA 4AEDB 2PHWA 1X8MA 1SLTA 2W1SA 1YFYA 3DN7A 2O8QA 3VHRA 3IDEA 5FO8B 1RXGA 2C24A 3Q8EA 2GN7A 3CL1A 5HCFA 3RGBA 3GHNA 3QACA 3SKJE 4CDUA 3N7KA 1W0NA 1ZA4A 2VTXJ 2QKDA 5LK7B 3I4IA 2HWE3 2WAOA 4AYUA 5FYYA 4BXSV 3SKVA 3DUIA 4YVWA 4DRVA 2IXCA 5FWJA 1YFWA 1K5MC 2D6NA 3VBUC 2QVSB 1O91A 1V6KA 4XAEA 3ZXKA 3WP6A 2OQ6A 1D2SA 2A3YA 5DAPA 1QNWA 4IEUA 4MADA 4YW1A 4FAHA 1LHOA 5FRAA 3POFA 4YW6A 3HAGA 4QU1A 1KQRA 2CDPA 3GZAA 3LFMA 2XLGA 3R4DB 4QX3A 1GP4A 5C3RA 2D6KA 5T5OA 4NN0A 5ACA2 1ZA7A 4Z2AA 1NG0A 2VUDA 2ORXA 2QQJA 5CKMA 2GC3A 3T1MA 5KXDA 3HPNA 1H0BA 1NAEA 1K45A 3EJKA 2FDJA 2FMYA 1H30A 3SMHA 1VB2A 3N9MA 5FPBA 2W91A 1NQDA 4RA0A 3B69A 1ZZCA 3A22A 2WWUA 1OF4A 3I2IA 3LKJA 5FBZA 3QBQA 4XQ4A 3PVBB 5DABA 5A33A 2F17A 1V00A 3PMEA 4LBLA 1BEV2 2R1BA 1B35B 3MDPA 4FPOB 4CCDA 4GAZA 4RD7A 4Q4W2 2I45A 5A80A 2VPVA 2NYYA 3RYKA 3FBMA 3URFA 3JB4C 5C8CA 1V6OA 5HCAA 1J1TA 2G9FA 4FP3A 1APNA 3H8OA 4F3JA 2C1FA 2GC0A 3DPRB 4BIOA 4LBQB 4XJUA 1DGWX 1XC6A 2D6MA 1NZCA 1IQAA 4S2GA 3K75B 5FV3A 2JB8A 4M01A 1KS5A 5AC91 4AWDA 4X6RB 1GOGA 4XJ8A 1AL21 1XRUA 3J7NA 3GJBA 3PVOA 1LOFA 2W87A 4CU8A 4Q4Y1 1QJZA 3CJIB 2E51A 4N7UA 1MQTC 4HK9A 4NE9A 4XUQA 4IV3B 3OSDA 2D44A 4GMP0 4BHPA 4OHWA 3I2HA 4N53A 2BWCA 1HB4A 1HX6A 4LHSA 1VBD2 4XZUG 1E5SA 2BFUL 3ZN6A 1CWPA 4JAAA 5FZMA 4KWUA 2R6QA 4O9EA 4P9IA 1UYXA 4HL0A 3OUHA 1RUOA 2CGPA 1ASJ3 4PDWC 3AXDA 3K46A 4FO9A 5FZ4A 1NCQB 4BDVB 2LS6A 2H6BA 2PELA 2RR12 3C7FA 3O1PA 5AFBA 3GM8A 3MV01 5HXVA 5IYYA 3JD72 1LU1A 5DUWA 2X05A 2E63A 2Y8KA 4AL9A 2FDHA 2MNGA 5A1FA 2DU0A 2J22A 5F7UA 5I0SA 4RHV2 5FDBA 2ZAHA 3NSTA 1BEV1 2D6PA 3E5QA 2W5FA 3BUCA 2JD9A 4ES9A 4QPIA 2D43A 3HEIA 4L8QA 1W8ZA 3LWCA 3FHQA 4AG4A 3MFAA 1LJ7A 3RI9A 3UL2A 2DDUA 3WG2A 2ZXQA 4YVWC 1PZ7A 1SCSA 1LULA 4I02A 3NKGA 2VXRA 2RJKA 4MVTA 3FFQA 4L11A 1LCLA 5FWEA 5K0UC 2BVBA 5JXHA 1W9FA 2AC1A 1JZ4A 2JDNA 3L2HA 1QQP3 5GZEA 3USUB 3ZDSA 5JZGA 5DG1A 4FOQA 4YVSA 4XXAA 4XQWA 2QDRA 2C9AA 3AVRA 1AF9A 2WYSA 1PMJX 2QE3A 1BMV1 4Z8BA 1X8EA 1EYBA 2VCMA 1CVNA 1MZFA 3AYCA 5IVFA 5KC6A 4JHZA 1DCSA 3N7LA 1LAJA 3NJYA 5A32B 2XL9A 2WA3A 2HEYF 2A6VA 3ZFEA 1RUH1 1PIV2 3AP6A 4HONA 3KVBA 1ACCA 5KBFA 2VZOA 4DY3A 1DQ2A 4NIDA 1N3PA 2WNEA 4L2NA 1FXZA 5FK7A 3M3QA 3VDDC 1B35A 4JC1A 2VNOA 5IJRA 3VBSC 5DN2A 4BMBA 2BU9A 5JOZA 2RVAA 4JDOA 3RSJA 3NW4A 1OVSA 4Q8LA 4OI0A 2FQPA 3NAPA 4MLOA 2QQIA 4BQ4A 5DDJ3 4FQ4A 1W3VA 1SG3A 3BI3A 2RDQA 1X9TA 5E16A 3HNYM 4S2DA 5GZCA 2G19A 1R082 5CEHA 4N43C 1DYPA 2HWB1 2OIIA 3HN1A 1LEMA 3QH6A 4JHTA 2VOWA 1B35C 5FY7A 2PA7A 5K7PA 2GNDA 2E26A 1ENSA 3VKNA 4Y3OA 1BBT1 3U4XA 1J3PA 4NIIA 3CLPA 5DAQA 3ZMNA 2YFZA 5EWSA 3VKOA 1XPWA 4CU6A 4GJYA 1OLME 4Q8KA 5IWFA 4TSVA 1AR82 1AL23 1CZSA 1D4VB 1YLLA 4CCEA 4HT1T 4QX0A 1KFXL 1EV11 1ZX5A 3FHIB 1ZRIA 2VNVA 5I8YA 5DZFA 5F6KA 1UNBA 5EJ3A 3ZXFA 1FI2A 1R1A3 1MQTB 1RUI2 1VALA 3I2JA 3VBFB 3VHPA 3O12A 1WMXA 2VOXA 4HPKA 1UY1A 1AYM3 1OOPC 1UAIA 1H4HA 2WKKA 1SMVA 3DYMA 4RQPC 3W58A 5FOJB 2ZX3A 3SQOA 3WDYA 5FMBA 4C1XA 1IPKA 2R042 4B4RA 2XVGA 4CP1A 2JENA 2ARBA 3J7HA 1AR63 5KHJA 3I49A 1GICA 4LTAA 3ZN5A 4MGIE 5I8SA 3R6SA 1UYPA 3ZFGB 4JGYC 3TEZA 5EFUA 4HOOA 4MUVA 3HVDA 5CFCC 3PTRB 4GH4A 4Z07A 3ROUA 2P5BA 3B7MA 3W5MA 1LHUA 4I30A 3MW4A 1ND2C 3J9SA 5FZFA 5C4WA 5FP3A 1OKOA 5JIAA 4OUMA 4CUGA 5B4NA 2RS33 4QPGA 2BJSA 2QQOA 3KS7A 3RFRA 2DFBA 2R1DA 2XHKA 4LULA 3WG3A 1Y3TA 1UYYA 4QHBA 3VZOA 2WINB 3LOIA 3WQBA 1UOBA 1NKGA 1UZVA 3U78A 2B42B 1IGOA 1JBCA 4DXSA 1W8TA 1JZ8A 2B8MA 1CONA 5CG8A 2BFUS 4BQYA 5BNQA 1HXS2 4ITCA 4GALA 2G9GA 2HWE2 5FO9B 3R4UA 3G6JB 5A32A 4LIVA 1Z7S2 3M1HA 3OCPA 4WVMB 1SLIA 1W04A 3T2OA 1UX6A 2BOIA 5GLTA 4DFSA 3WW4A 2WLQA 2WLPA 5FXZA 2YXSA 1VIWB 2R063 3RZKA 3N9NA 5DPNA 1TMF3 5FYMA 3ACGA 2ORZA 2VD7A 2WSUA 3C7EA 5DZGA 4PLNA 1L3JA 5A7NA 1H8TC 2DF7A 4AHWA 2WQZC 1DGRA 1TEIA 1URXA 1CZTA 4Y20A 3WINE 1WCQA 5A7OA 1S1AA 1S2KA 1UIKA 3ZYBA 5A7WA 4WV8A 1O8SA 2AH2A 3HIFA 1FMD3 2WFF3 2OPKA 3ABZA 1CAUB 2HH9A 2D7FA 5DUUA 1HRI3 1UW8A 5JXIA 1LU2A 3M3CA 1JU3A 4AK3A 5GLWA 5EPAA 3M8LA 3O5SA 2AYHA 1X36A 2ZKLA 5FYIA 2RJ2A 4A2UA 1RUD3 2LROA 3ACIA 3TYJA 3T0AA 1AYM1 1MS8A 3CF6E 3DYOA 2YBSA 1KJRA 2DCJA 4XW3A 2BNMA 5FMOS 4EE2A 3VZMA 1R1A1 2JG9A 4MGYE 5DAXA 4IGPA 4LBMA 5LEKA 3ASIA 2ADEA 2ARCA 3MHZA 2E7QA 1IOAA 2Q5TA 3AL5A 3WNLA 3O0VA 4WZFA 5L9RA 5JR2A 1RUG1 4N43B 3JBG2 1LOCA 1PK6A 5C7GA 1R091 4AQSA 2VVEA 4XF0A 1XE8A 4H55A 4QHOA 1NXMA 1SLLA 2KXLA 5I91A 3I3BA 1EPZA 2Q8OA 3ZR6A 1G9DA 5A1LA 2Y6HA 2DFCA 3S7IA 1UY4A 5JZGC 1IKPA 3PHMA 3TWIA 4LOTA 2JB4A 1RMU2 4H7MA 5AC93 2A70A 4GB32 1PHMA 3AZZA 1KDMA 3AC0A 2WNVA 3ZN4A 4PDWB 2HWC3 1WKYA 2XG3A 4YLZA 4ASKA 4AFAA 4BMEA 4C1WA 2ZEXA 4WM8B 1VBC3 4P08A 2XJSA 1TVGA 4ZXEA 3ELNA 4QPGB 1C28A 1JZ5A 1MVEA 2X5IC 2QQWA 3AKPA 4Q5OA 1EY2A 3IBMA 2BERA 1SBEA 1PVC3 1X33A 3AJYA 3K3NA 1AVBA 1L7QA 5FOBB 4AW7A 5A7SA 3VKMA 5A3LA 5KWRA 4D7TA 3ZYJB 5F5QA 1MPXA 4UT5A 4E2GA 3NO8A 2HYKA 3AJZA 4WM7A 1ULDA 2V72A 3H8UA 1BQPA 2YMZA 5FZBA 1UX7A 1WW6A 2GALA 4UAPA 5C71A 3LEGA 5FYTA 2ZOEB 3NNGA 4PF5A 4UFMA 1DQ1A 2RE9A 3WW2A 1E5IA 3BTAA 3ZSEA 1W6NB 3PURA 3CZJA 2JKXA 4M0HA 3RZHA 4BZ4A 2ZHLA 5EYXA 3VB9A 4COUA 3OBRA 4O7XA 1JMUB 3MUZ1 1R093 4RR3A 4BQ2A 2ZX4A 1S0IA 1ONAA 5E88A 5KR7A 3NJVA 3FJSA 4NPRA 5T3NA 2ZKNA 4OQ8A 2SLIA 3V64A 4D7SA 4AEJA 1BEV3 1RJ7A 4NAMA 4IGQA 1VAKA 3H7JA 1I5PA 5FTTC 1GZTA 5EZWA 5A3MA 4K1YA 5DUXA 2VG9A 1BK1A 1HJFA 2BQPA 4LORA 5FPLA 1PVC1 2WL1A 3GHMA 4YSFA 1K12A 2HWF2 2E7TA 2JG9B 4XFHA 5CA6A 5IHRA 2ZGQA 4KU8A 4XOGA 3SH4A 3QLQA 1WLCA 2JX9A 4R9BA 5F5IA 2QBXA 3PUSA 3U1XA 3UGFA 4YARA 5LBCA 3K4ZA 5JIUA 1PM7A 2BW8A 3UKVA 1PGL2 3KGZA 4J6GA 1O7FA 1YI7A 3V0BA 2J42A 4QDRA 1XNCA 4S2FA 4BK5A 2AGSA 1V9U2 5EV7A 3T30A 1OOPA 3WF3A 1CQ9A 4CPBA 2R041 4QQLA 5FQ0A 3PJQA 5LA1A 1QQP1 1SDDB 2DVAA 2R30A 4IEPA 5AVPA 2VUJA 3VKFC 5ACA1 3HR9A 4NHMA 4NOTA 1WCSA 4ISQA 3K3OA 4Z1VA 4QX2A 2BNNA 4E2QA 4NIAA 5JPMB 4QQHA 5ANNA 1XU2A 5K8SA 3WCSA 4J1WA 2C5DA 2PLV1 3H3LA 5KHHA 3WVJA 3R0RA 4CP9A 2RR13 1OT5A 3VD4A 4Q4V2 1WA6X 3FMGA 4WM8A 4GULA 3OPTA 3T2QA 3ZVXA 4O61A 2LUWA 1TNRA 2C0ZA 5FMDA 4A41A 4C91A 1VBA1 3RWNA 3T4HB 1UU6A 2HWD2 3HT2A 4RYDA 2PQQA 4OI1A 5I8TA 3EB7A 3BODA 1ZRDA 5FJKA 2JDZA 5DQ0A 2XVLA 5DZEA 3THTA 1J59A 1C5IA 4DO0A 1J3RA 4IE4A 3ZFGC 1XYOA 3E6CC 3BTXA 3OPWA 4GB31 5EQUA 1BYHA 1H2NA 2K2SA 1SLAA 3H42B 2CHHA 4WM8C 2J1SA 3MV11 4N7IA 3LQCA 4YG0A 4AI0A 1MEC2 3HWJA 4QPGC 5FY0A 1COV2 1OLRA 3VBUB 4AI8A 1MEC1 2A3WA 3IPVB 5J96B 1C8M3 1GSLA 1DGLA 1LODA 4GJZA 5JI9A 1WD4A 3D4KA 4RFT0 4P9JA 2D40A 4TTGA 5D8AA 4K21A 1OQDA 2UY8A 3LSEA 3KLSA 2VU9A 4I3GA 1TMF1 4D7YA 1HLCA 1W6PB 5EYYA 2JDUA 1ZVFA 4QMAA 1AX2A 3BVCA 1UXZA 1H2MA 5C9AA 3I97A 1DIWA 3WZ1A 2VZQA 5LW9A 2DCKA 3CDZB 1JYCA 3ORJA 1VBE2 1RUC3 1YC61 3H1WA 5FR3A 1ZREA 1ND3C 5IK7A 3K4AA 4UFIA 5FAXA 3ZKUA 1HN0A 3O1SA 2RV9A 4YZ4A 1Y7BA 2WN3A 2Q8EA 4HKWA 2VECA 2ZGPA 3ZYGA 2PAKA 3WW1A 3PU3A 5L7OB 3IDBB 2ES3A 3RI8A 2ERFA 1AYN3 1LHNA 2IXLA 3UESA 5BUVA 3V0AB 3W9AA 1PO23 4XURA 1KS4A 3JZVA 3HBZA 2PN5A 4IEOA 2VTXA 3JCIA 2NM1A 5F3EA 2UU8A 2VMCA 1O3RA 4FFGA 3O1OA 1S0EA 1UIJA 4QU2A 1NYWA 2PTMA 2VZUA 3S0MA 3H7YA 2J1RA 2E9QA 1O4ZA 2J1VA 1DG6A 1VBD1 2ET7A 4V2WA 2ATFA 3S6PA 1QXJA 1OMIA 3KMHA 1XSRA 3I7DA 1OD3A 1AX1A 4CEYA 5FK8A 4DB5A 1W0PA 4IE5A 1QXPA 4YM2A 1OH4A 1QJX3 2BNOA 2RS53 3E1F1 1UOGA 5LBBA 3RS6A 5I0DA 2N7GA 1D2QA 2MPFA 1HB1A 2EIBA 3KV5A 1V6LA 1GQGA 3ACFA 5IVEA 1AL22 2GH8A 4FQZA 1W6QB 3BU7A 1HIXA 5T5JA 4AF9A 1RUD2 5DG2A 4MHUA 1C1LA 1AXKA 3VBSA 4ET7A 1YQCA 1GLHA 3AX4A 4LQRA 3JB8A 4PQ9A 4UBHA 5I0RA 5FZEA 1OUXA 3FL7A 4XHBA 2D98A 2MHFA 4WBBA 5JUVA 2WZEA 5HV0A 1J58A 1H8TA 5FZDA 2ZZQA 2XH6A 1Q8VA 2A6YA 1HB3A 4MGQA 2JE8A 2WUHA 3RG0A 3AP9A 1GZCA 1LHVA 2RG4A 2CDOA 4DRRA 3JBG3 3OOXA 1D0GA 2XMLA 3VZLA 4COZA 4OHZA 1KEXA 3ZIXA 3E6DA 4LITA 4UW6A 4QPYA 4Y1ZA 2X10A 4L99A 4XQDA 2CTVA 4GD4A 3OBAA 1A8DA 1DLCA 2GMMA 4Q29A 2B9VA 2DWRA 3C3VA 4JDNA 3NKTA 4LNVA 5C6CA 1XB9A 1RB8G 2AENA 1QGLA 2DYCA 1N3QA 1QOOA 1JYXA 4PF1A 5FZIA 4YM0A 5AC92 2LRPA 2DCYA 3AMQA 2VXJA 2J1UA 2SBAA 1NLSA 4GB33 2IXJA 3WP4A 5EIYB 3WDWA 5IUQA 1W90A 2WFF1 2WNUB 3KF3A 1S55A 1WW4A 1CAWB 4N8MA 5BXXA 1AR91 4Y1VA 5FYBA 4EN0A 5JWPA 4R4XA 2QQNA 3TAYA 1MS1A 3ZSMA 4PI0A 1QIQA 3SLIA 3VD5A 5A33B 3CHXA 3HNMA 3OGRA 1UKRA 5G04L 5GLZA 1RHI2 2BVVA 1Y43B 4JRLA 1BVP1 2Z69A 1SDWA 1DZRA 4LBJA 4LHKA 4AQTA 3UK9A 3BOWA 1AR71 1C5HA 1YXWA 1BLZA 2OQ7A 1GFF2 4MGKE 4GKYA 4TLFA 5ABJA 1N1YA 4MXVA 1GV9A 2P34A 5H9RA 5HI0A 4CPBD 1YIPA 4M3CA 4LLFA 5L7OA 1R081 1UZYA 2R073 4ARYA 1CR7A 3KSCA 4JGYB 1WGPA 3K77A 5HXMA 2CAUA 3KWVA 3OY8B 3WF0A 5CADA 3WD5A 3B3QE 1QJU3 3OUIA 5SV5A 1UKGA 3VD9A 2O1QA 4UF0A 5LK5A 1HRI2 2DURA 1ND2B 4NJ4A 4N53B 4A6OA 2VQTA 3FLPA 4QAWA 5L36A 1R092 3K51A 2TNFA 1ND3A 2GDFA 1CIWA 4ORFA 4QKNA 4B4PA 5CFDC 1CJPA 1KGYA 5IVJA 4NIHA 1MS9A 1QU0A 1NX9A 2VQ0A
chains in the Genus database with same CATH topology
1BVVA 4CDXB 1KXGA 1RUH2 4CRQA 2JEMA 1PNGA 3A4UA 3AMHA 3GF6A 1UZZA 1LGNA 2ZTNA 3AMNA 1LECA 1JOJA 1POV0 1COV1 4HKLA 3O0XA 2VVFA 2Y0OA 1J3QA 4XBNA 3SITA 1DHKB 2A7AA 4K8FA 1N3OA 4AQ6A 2JG8A 4PIYA 3WV6A 5KXBA 4Q4X3 5JZGB 3O14A 1OLQA 4META 1N1TA 3AZWA 1JUHA 4YVSB 2EAAA 5T55A 1YIFA 1YWKA 2LM3A 4W6YA 4Z92B 2WZR2 1J1LA 1ULCA 4IL7A 4JDMA 4V1PA 1PVC2 5BNNB 2WNUA 1RITA 2A73B 5FPZA 1FOD1 1QDCA 1NA1A 3RYPA 2OZ6A 1T6GC 1WW7A 3DKWA 4IEZA 4QM8A 1LKNA 3NV1A 3LSDA 3AZVA 3QCWA 4QM9A 2XBO3 2OZJA 3AM2A 2ET1A 3E5XA 4YGBA 3B00A 1I9RA 3KD4A 4GIQA 5I0UA 3VZKA 2WNUC 4RR3C 4GXLA 3AYAA 2ZHMA 5JLVA 4AFDA 3PVEA 1SFYA 1ZBE1 2OUJA 4Y1YA 5CG9A 2NPIA 3U11A 2VOVA 2KM2A 1FATA 5T52A 1DBNA 2DUOA 1H9WA 4KG0A 3ZXGA 1IZ3A 3SISA 4K1ZA 1K5MB 4RGAA 3GYDA 5FLHA 2VW0A 5J48A 4H3WA 4EN7B 1ND3B 1C1FA 2ZCWA 4Q1PA 2EXHA 4IV3A 1ZNPA 3HT1A 5LEJA 1DDLA 3S7EA 4Q2FA 1W6MA 3T1LA 3WDTA 2P3JA 1IS4A 4R9DA 4CDXA 4S2HA 3WNXA 1Z78A 1XQNA 3TB0A 4Y1UA 5E8AA 2QNKA 1BBT2 1MS5A 2CAVA 1Z0HA 2AREA 3OPZA 2ZGMA 5E1RA 1F31A 3MW3A 4COWA 5C8CC 1NCQA 1VR3A 4FP2A 3N35A 3E5UA 1ENQA 3QH7A 5JR7B 4Q4W3 4Q0VA 4WM7C 5HBAA 4DY5A 4GH4B 5TSWA 4HN1A 2XPJA 2EXKA 1PIV3 1O5LA 4LUMA 4QPIB 1LGCA 4OVEA 3TNPB 3T2TA 5GLVA 3MIFA 3NV4A 5GLUA 3VBRB 2DCZA 1YO8A 3D82A 4N9HA 4XJ9A 5BNPA 4OULA 5GM0A 3ATGA 2MEV1 1DU3D 1NA1B 5J37A 4NHKA 2QFEA 4AVAA 1BMV2 3EHKA 1ZZ7A 3M70A 2Q0AA 2VMGA 1FAYA 1D4M3 4UXAA 4AGVA 3DGTA 3I2DA 4FPJA 3ZXLA 1C8M2 2W0XA 3RMXA 3AP7A 1B09A 5ABJC 3L9JT 1NCQC 4LHNA 3JBG1 3J26N 4YZ1A 2R061 1PO12 3OJBA 1OD5A 4FTEA 1GYKA 4CDQB 1RVF2 1F2NA 2ZZJA 1UL9A 4X6QB 3IKWA 1I5ZA 2JJ6A 2TUNA 3J8F1 5IK4A 1QY4A 4Q4X1 2JICA 3NAPB 1NOVA 1VBA3 1G9FA 3OYWA 2JXAA 2PHUA 4Q4V1 4BIFA 2VMIA 1AYM2 2ARXA 4FPCA 2EVXA 4JV4A 3VZNA 4GMP1 1LESA 1CESA 3WOGA 3JQWA 1I1EA 1QQP2 1QDOA 4XFAA 5J7MA 1TME3 5CU1A 3ZFEC 4IERA 4IEQA 3ZPYA 1ZRCA 1W6MB 2P3KA 3K48A 2WFPA 1ULEA 2PHRA 1BZWA 3NV2A 3G7DA 2D93A 2BEOA 2RMU2 3WQ1A 5CFCA 1NQJA 2NP0A 1X50A 2E7AA 1O4YA 1MACA 1NE6A 1PZ9A 3WHUA 2ETEA 1QJX2 4CZSA 5K0UA 3CEWA 2RM21 1DQ4A 1QHDA 1EAH3 4K7JA 3ALQA 4XETA 4W65A 4XIKA 4CEWA 5JMCA 4EN6B 5I93A 1NCRA 4N9IA 1VRH1 5C8CB 2R49A 1EV12 3PVNA 1YNAA 2E53A 1G9BA 4F8AA 2V09A 5IT6A 1RUH3 3IDCB 3H9AA 4XJAA 2IWGB 3UV9A 4CDWB 1O3SA 1ZRFA 4LO6B 1FMD2 4WM7B 1LRHA 2B45X 1XYPA 2PLV3 2UURA 4YW5A 1UPSA 4WVVA 4XBQA 1PK6C 1I3HA 2XWJB 1MZEA 4TYSA 1A8MA 1GZWA 1H2LA 5LRRA 5AFEA 4PLMA 5JSOA 3VBRC 1Q56A 2R0HA 3IIAA 1OFNA 4KGGA 1DYKA 3P3PA 2VNRA 1VJ2A 4HKOA 3ZN6B 3ZXEA 3ENRA 4E2SA 4TWTA 5LRSA 4EWEA 4R9AA 4Y24A 1IS5A 2RM23 3JU9A 4IXLA 3WDVA 5C9AC 4X8PA 1PGSA 3SCHA 3FBYA 2WZR3 4LBOA 1C8NA 1H2KA 2A5ZA 3AMMA 5KXCA 5JDBA 1ENRA 4FT8A 4QGLA 5CFDA 3E97A 3CO2A 4I2OA 4YFZA 1TME1 4FPEA 1VRH3 4IV3C 5SV8A 1QNYA 2P37A 2XJTA 5HCBA 2XJVA 3Q9OA 1NLRA 1RJ8A 3USUA 4AVVA 3D6EA 5L7OC 4D69A 1AR72 2D5FA 2UWAA 4IESA 4P9YA 3NVCA 2CV6A 2ZGLA 3I54A 4W6XA 1FV3A 3ZFEB 3UKNA 3NWKA 4AHYA 5IK5A 3VBHB 2WQ4A 4XEZA 4EN9B 5EXOA 2EA7A 4CP0A 4CYDA 2WT1A 4KG8A 4AE2A 1HRI1 4LA2A 5FCCA 1UU5A 1XXNA 2WFF2 1YCIA 2ZX2A 4I3PA 5BNPC 4CEWC 3VBOB 4FXKB 3VZJA 3HD8B 3WDXA 1HRV1 4PDWA 2G4IA 4LA3A 1G7YA 4Y22A 4D94A 4MH0E 1DF0A 3W59A 1WCDJ 4HLTA 4I0BA 1UD1A 1TE1B 2VY0A 1WCKA 5T54A 3DV8A 2VGDA 2ZGUA 4LBKA 1G9AA 2F6BA 4XF3A 4IEVA 1S0GA 2RS12 1FYUA 2EXIA 1KJLA 3IPVA 4GKXA 4A7KA 1IPJA 2RJLA 5JAXA 3M3EA 1E57A 2HWF1 3ZX7A 4YYOA 2O8OA 3VL9A 4PCRA 4AGGA 1W39A 5BY5A 3JD71 1WBLA 2LALA 1AR92 3H0OA 1ZM1A 4HFSA 4AQ2A 1YUDA 4Q0QA 1W6PA 1ZBA1 3KT1A 1QJX1 4CDXC 3B93A 2A6WA 1GBGA 3NJZA 4PIXA 2GC1A 3VBFA 1EAH1 2W08A 2GH2A 4NHLA 1H4GA 1RMU3 5BNNC 3A0NA 1WLWA 2PFWA 3DPRC 5FLJA 3OF1A 2ZMNA 4KWLA 3V0AA 4B3NA 2P3IA 1PGW1 4J1XA 1HV0A 1RUJ2 4XXPA 4E4SA 2R0FA 2CWSA 3KT4A 3PNAA 5C4WB 3KZ4C 2X5IB 3AZYA 4H7LA 1DGWA 4Y5Z0 4HMZA 3U0ZA 4OUSA 3RJRA 1FOD2 5GKAC 3FC0A 1RUE2 3USSA 2CL2A 3FUOA 3CNAA 3N7MA 1UN1A 2R16A 3ZXJA 4AFMA 3GZUC 4CEYC 4FTBA 3LA7A 2FBEA 2WWSA 4G4FA 2WS91 2ZGNA 1WD3A 2PHXA 3ME2A 5BNOA 4WVZA 2B39A 1H8VA 2ZA9A 4Q0SA 5J3UA 1C3HA 1OOPB 2AUYA 4UW4A 1GZ9A 2HKXA 1CAXB 1XNKA 1D4M1 5FQ0B 3TNQA 1OPOA 1MEC3 1W6OB 2GNTA 3LGRA 1BBT3 4BQ1A 1RMU1 4YW2A 2V73A 2Q4SA 2XKOA 3AZXA 1TME2 2XUMA 1YFXA 1JUIA 4YVWB 1FPN3 4HSJA 3HQXA 2GC2A 4XJZA 4AHXA 4M3CE 3VBHC 2CGOA 2UY9A 5DDJ1 2MEV2 3VKLA 2YGMA 4OHXA 5KXEA 4D3WA 5BV6A 1WBFA 3MZHA 4B4QA 2A6ZA 2HJIA 4BCUA 3WQ7A 1AXZA 1AR61 1ENXA 5JI7A 2X29A 2VW1A 4BE3A 1O3QA 1S2BA 1AXYA 4LO8A 3WR0A 3VUOA 5DUVA 4CDUC 1JH5A 1VLNA 1QH7A 5E89A 3KGLA 3JQXA 1V9U3 2KA3A 3IN9A 1PK6B 2RS31 5FPXA 3BB6A 4LE3A 4OZXA 4XF1A 3ILNA 1ULGA 1Q3EA 1LENA 4KNCA 1D4M2 4COVA 4FBFA 1HKDA 2IFWA 2H0VA 3KQRA 2Q1ZB 4M3CB 1QOTA 2ENRA 1PGL1 4DQAA 3OY8A 4NO4A 4BA6A 5L19A 2XBO1 4XDQA 1FV2A 1RHI1 4QT6A 4F7ZA 1VB4A 1ND2A 3TOJA 4BLJA 4FCAA 2X5IA 2VH9A 3H3UA 4AFCA 3R4SA 1HXS1 1QWRA 2CWMA 1CGPA 2W39A 3OD4A 2GN3A 2RM22 3BOPA 1WW5A 1JXNA 3PLQA 3MW2A 4PLOA 2VQAA 4HANA 1ULFA 1AHSA 1AX0A 2ZGKA 5D8AC 5L73A 1ZZBA 5I0TA 5C4WC 1AZDA 4MSVA 2P2KA 4R52A 4HBNA 3WX5A 1H1MA 4Q4Y3 2EXJA 2GAUA 4JQRA 1CAXA 2B5HA 1W6QA 4HSLA 1WLDA 3M3IA 1W6NA 4YGDA 1C4RA 3RDIA 1MVQA 3FE5A 3B02A 2QUOA 4UW3A 4KL1A 1VRH2 4XF4A 4YW3A 2ZMKA 4ASMB 3EQEA 5GZGA 2IFRA 4CTEA 4YRDA 3M2MA 3VHOA 1NE4A 1H8TB 4P9XA 3LOBA 2XL7A 4QGMA 1LOBA 1AYN2 5KHKA 1LHWA 1V6MA 1YYNA 1EP0A 1OA2A 4JTNA 4Z82A 4PIZA 4YM3A 3PTYA 1Q8QA 2OVUA 4C0HA 3WP3A 2AZ5A 1YI9A 1XU1A 5BPXA 5BNNA 3D8CA 1LOFC 2Y0IA 4XZPA 3ZFFA 4XFBA 1QJY2 5F9TA 3MIDA 2R072 1S0CA 1Q43A 4QGNA 1KFUL 5ACA3 4HK8A 2WZPP 3RPQA 5JSPA 2F4PA 3VL8A 5T5LA 3V0BB 4BWOA 2FZ2A 1HV1A 1WMDA 3MIBA 2IZWA 5CBLA 4XTPA 2B46X 4CDUB 2JKBA 1VBE1 4XIOA 3VDDA 3J8F2 2RS13 4OI2A 2DUPA 2ZGOA 1QXRA 2YHJA 5H9QA 4BYYA 3AKQA 4P5HA 2XB6C 2GSYA 5GJ6A 3WG1A 4LE4A 1AR93 4ONUA 1RGSA 3U07A 3S30A 1G6NA 4A7ZA 5F1RA 2Y38A 4Y4YA 4MX3A 4ZU4A 2ZHNA 1RIRA 4RSUA 1RTVA 2CNAA 1HQNA 2W68A 4H14A 3WT3A 3N7JA 4YZ5A 2DVBA 4MGZE 1ZBA3 4XFGA 2Q30A 3X29B 3GNEA 2DUQA 2DCTA 2R071 2OUHA 3BIWE 4GQ7A 2Z2SB 3I59B 4FPLA 4P14A 1NY72 1RUC1 4DNYA 1JHNA 2YV8A 2YROA 4HPKB 3CU7A 3JUUA 3C2UA 4NWWA 1VP6A 3OGJA 4NR1A 1OI6A 1UCXA 4XFFA 2TBVA 4DXZA 1U5YA 3POWA 3POYA 5C9AB 1CN1A 1LOGA 3ZFGA 3FFZA 3MIEA 3LB9A 4ATFA 3WDUA 4LBQA 4MV2A 2FHRA 1RUJ1 4EV0A 1DZQA 1PO21 3MLKA 1PGW2 1W0OA 4LLOA 5T50A 3B9CA 1WMFA 4YFWA 3AMPA 4PJYA 5T5PA 4XBLA 4AI3A 1Q8OA 3MIHA 1TQ5A 3ZFFB 2Q1MA 3CJXA 3FX3A 3LZZA 3GBWA 3SH3A 1FNYA 2X53S 4B7EA 5CIRA 1SBDA 3N3HA 1U0AA 4M00A 1AYN1 1VBB1 1Z7S1 1YJKA 4MXWA 5BYNA 2EIGA 2ZJCA 4EJRA 4KQ7A 2WNVC 3IT8A 4RQPA 4ZXKA 3WXPA 3TRSB 3KCCA 2VMHA 4K40A 3VDDB 2A6XA 2WSVA 2YUEA 4XMIA 3VBSB 4HVQA 2JE9A 1REEA 1KRIA 2R32A 1CAUA 3RNSA 2JG8C 4DMIA 2QZ2A 2PAMA 4FAGA 2IXHA 4MZUA 2GNMA 2UYBA 2DVGA 4HN0A 1G86A 4IV1B 1WLTA 3MIGA 4A7YA 1LB2A 2Z79A 1MS3A 1K5MA 2XJRA 4Q0PA 1VBD3 3GALA 4A3XA 4EWDA 2NLRA 4IEXA 2GU9A 4YM1A 5CVRA 5AVAA 1WMEA 1RUF1 2WT2A 1S0DA 3M7AA 1RUJ3 2YDEA 3SCGA 2EF6A 3J4UH 2JECA 1F5JA 3AK0A 4XJWA 1QH6A 2ZGRA 2DTWA 4AI2A 1CPMA 2OYZA 1DQ5A 1KD7A 5JPNB 3RZZA 2ZGSA 3EXUA 4I0WB 1FOD3 3V56A 2EAKA 5J98B 1AR83 3NV3A 4WVWA 1RUE3 1JYIA 2XBO2 3MGUA 4RHV3 4XTMA 5H9PA 3VBFC 3WG4A 2W52A 1WA4A 3WW3A 3N4MA 1YRZA 1ZBE3 1H1IA 3A0KA 3MYXA 4OHYA 4ISRA 4RS5B 3U10A 4OLLA 4FOVA 4FPGA 3SHRA 2R043 3MLLA 1GKBA 3LCPA 4NVPA 4COYA 4M0NA 4AVTA 1S0BA 1PZ8A 1FNZA 2WIIB 4CP2A 1MS0A 2XJUA 1FPN2 1PO13 4JGYA 1YFUA 4QX5A 1RVF3 3VBRA 4E4ZA 4ZU5A 2WC2A 1OSGA 4P9WA 5GZFA 2PHTA 1GZWB 2XJPA 5BNPB 2XJQA 1VBA2 2WJSA 2FZ1A 2JG9C 1XNDA 1S0FA 2PHLA 4LO5B 3LA2A 2XVKA 1M06G 2YC0A 2AR6A 2VULA 2O0OA 3M3OA 2RR11 5J09A 4JGZB 3AKTA 3PMSA 4FPHA 2UWBA 2VUAA 1KITA 3IM0A 5JVVA 3TN92 4LHLA 1LR5A 1SEFA 3OBTA 4OHVA 3MICA 1V9U1 4XHXA 3UKTA 1DLLA 1TNFA 1R083 4AFBA 4AVSA 1QJY3 4XPVA 5H9SA 4IV1A 1RUG3 3OYWB 1LTEA 3DL3A 1U5IA 1XYNA 2A75A 5A3MA 1EAH2 1N1VA 4LO7A 2ZX0A 3FUQA 4M3CF 4BPZA 5IK8A 4RHV1 5CAZA 3RRDA 2CYFA 1RUE1 4QQOA