1AY4A

Aromatic amino acid aminotransferase without substrate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
394
structure length
394
Chain Sequence
MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Paracoccus denitrificans aromatic amino acid aminotransferase: a substrate recognition site constructed by rearrangement of hydrogen bond network.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transferase
molecule keywords AROMATIC AMINO ACID AMINOTRANSFERASE
total genus 141
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 1997-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ay4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ay4A01
1LS3A 1C9CA 1DJEA 3DU4A 1M7YA 1BS0A 1RVUA 3I5TA 3RBLA 4EU1A 4A0FA 4M2JA 2W7KA 1TOKA 1D7VA 2FM1A 1B5PA 2OGEA 5M49A 2VMXA 3A9ZA 3RBFA 1WYTB 2D63A 2Z61A 1W7NA 4Q76A 4AZJA 2D7ZA 2FQ6A 2WK8A 3N0LA 3II0A 2BWPA 2ZSLA 1ZOBA 3R9AA 1O61A 1S09A 2D66A 4WXBA 4ZM3A 2D65A 3ATHA 4WD2A 2EO5A 1KL1A 2ZP7A 4ZWVA 1B4XA 3WX9A 4WXGA 3FZ6A 3WCNA 2ZSMA 3AOWA 3FFHA 1TOEA 1MAPA 3DZZA 3G8MA 4EFFA 2EGYA 1YAAA 3ELPA 3FVXA 5E3KA 4RJ0A 5LHAA 1MGVA 3EI9A 3EIAA 2TPLA 1ARSA 2E7UA 2OKKA 3BWNC 2W8UA 1IX6A 2JJEA 3OKSA 4KYOA 4GRXA 4UOYA 1LC8A 3FQAA 3MBBA 2ZC0A 4K2MA 4EB7A 1EJIA 3KKIA 4ZAHA 3PDBB 3ZZJA 4PFNA 4R2NA 3BCAA 1AMQA 1FC4A 3PD6A 1X2AA 4P3MA 5M46A 2VLHA 1O69A 2BIAA 1ASNA 1BJOA 3NDNA 1MDXA 4W1XA 1TOJA 4BA5A 1DTYA 4XEWA 2AY1A 4AOAA 5D5SA 1PMOA 1OXPA 3HQTA 3P1TA 1X28A 2W7EA 3MC6C 1N31A 5DX5A 5EIGA 1B5OA 2VMPA 3MAFA 4R5FA 1G7XA 3CQ6A 3BN1A 2R5CA 3E77A 4XJLA 4RLGA 3K28A 4B98A 1AHYA 1AAMA 3GZDA 1ELQA 3DR7A 1ASCA 1MDOA 1O62A 1AY4A 4ISYA 1FG3A 4WB0B 4GE4A 2W8WA 1UU1A 3ISLA 1W7MA 3DODA 2Q7WA 1D7SA 1M0PA 3VK2A 3TQXA 1AHXA 1ARTA 1J32A 1ZC9A 2BI5A 2DGKA 4WBTA 3H14A 3FVSA 4E1OA 4F4EA 1ASMA 1LK9A 2ZY5A 1G4VA 4ATQA 2DR1A 3ASBA 1TOIA 1CS1A 2VMVA 4F5HA 4AH3A 1AHGA 4EB5A 1SPAA 1OHYA 5G4JA 1BJWA 1TARA 3DXWA 3EUCA 3JTXA 4IXZA 1SF2A 3GETA 4UQVA 4XJPA 2VGTA 4L0OA 2DKJA 5G09A 2C44A 4PIWA 1M6SA 2BI9A 3FFRA 2ZY4A 4TV7A 2O0RA 3B1DA 4IYOA 1ORDA 2ORDA 1MAQA 3A2BA 3WY7A 3GR9A 3AENA 5EAVA 3AATA 3VOMA 1W3UA 3E6GA 1I29A 1YOOA 1JG8A 3FD0A 4N0BA 1I48A 3RI6A 5M4BA 4WYEA 3WKRA 4W1VA 3HT4A 4U2HA 4AO4A 3G0TA 5G2QA 1B9HA 2Z9VA 3PD6B 2RFVA 1IX8A 3MC6A 1MDZA 1QJ5A 1G7WA 1GC0A 1RV4A 2BYLA 2V1PA 1AJSB 5EQCA 4A0HA 2W7FA 1I43A 2CJDA 1AJSA 1N8PA 2AY8A 4XJOA 1D7RA 1C0NA 2GQNA 5EIGB 3AENB 2O7CA 2BHXA 1S0AA 4ADBA 2AY2A 4ITXA 2HUUA 2Z1YA 5EAAA 4DQ6A 3B1EA 4I8AA 1S07A 3AELA 3FZ7A 3UAKA 2AY6A 5F9SA 3QBOA 2AEVA 2CH1A 3QM2A 4W5KA 1M0NA 2E7IA 4A0GA 2ZY2A 2QB2A 4WXFA 1C7GA 3AV7A 3WKSA 2VI8A 4BMKA 2EZ2A 3N5MA 4ZLVA 2GMSA 2FYFA 1QGNA 2JGTA 2VGZA 3UE8A 1ASAA 1AHFA 1CQ8A 1DGEA 2CSTA 2QA3A 1IUGA 4OTLA 2QB3A 2HOXA 4OBVA 4UHOA 4UHMA 2PB2A 1ARGA 4F5IA 8AATA 2GMUA 2X5DA 3NRAA 4WLJA 4ZSYA 4MGRA 1AICA 3MKJA 4ZWMA 4Q31A 3DC1A 1GEXA 2X8UA 2W7IA 1KKPA 4ZDOA 1B8GA 1E5EA 2VYCA 2ZUKA 2OATA 1D2FA 1AJRA 4F5GA 2YOBA 1I41A 1QJ3A 2Z67A 1GDEA 4R8DA 1GC4A 3IHJA 3ZRPA 4CVQA 2HP1A 3NUIA 3OP7A 2O1BA 3CBFA 1IX7A 3VP6A 4A6TA 3D6KA 4PVFA 1AKBA 4CBSA 2HOZA 1U08A 1LW4A 2VI9A 1OHVA 1GCKA 3LWSA 2HP2A 3BCBA 1O4SA 4J8LA 2C81A 4A72A 5JAYA 1QISA 2CY8A 3KE3A 3LVKA 2W8JA 2AY5A 4JE5A 1LW5A 2W7JA 7AATA 1S08A 1YJSA 2YCPA 2Z20A 3TCMA 5AX8A 3PJ0A 3JU7A 4O6ZA 2VIBA 3PIUA 3ZZKA 3FDDA 1LKCA 3FCRA 3NX3A 1B9IA 2HUIA 4JEVA 4U1TA 1JS3A 4MQRA 2ZJGA 4LNMA 2VGUA 1V72A 3DR4A 3B1CA 4RKCA 3WZFA 4MKJA 1CZEA 4JF0A 2EZ1A 5C6UA 2YHKA 5E4ZA 2VMUA 3RCHA 4CBRA 1BQAA 1AY5A 1GEWA 3NUBA 1UU0A 3F9TA 2QBTA 1OATA 1AX4A 1M32A 4J5UA 2ZY3A 1VJOA 4IY7A 3CQ5A 1S06A 1YJYA 1BJ4A 4R5ZA 3A9XA 2PB0A 3ZRQA 2R0TA 1JS6A 5DJ1A 3GJUA 4OBUA 4WB0A 2HUFA 3JW9A 3QI6A 3KGWA 2CANA 1DGDA 1LC7A 3KGXA 2YCTA 3NU7A 1GC2A 2JJGA 1OXOA 3FKDA 4ADDA 4M2KA 4OT8A 1C4KA 4JEZA 2BIEA 2FN6A 2WK7A 3HBXA 2BI3A 4RIZA 3TATA 3EI6A 3WLXA 5BJ3A 2CH2A 1N2TA 3I4JA 1TOGA 1GBNA 4MY5A 1CL1A 1ASFA 1VEFA 3RCHB 2CTZA 3JWAA 1C7NA 1ASLA 3WCOA 3UWCA 2DKBA 1QZ9A 2C7TA 4LC3A 1J04A 3G7QA 2QLRA 3A8UX 3USFA 3EZSA 4JEYA 4WYDA 5EUEA 2W7LA 4ZASA 4AZKA 3ACZA 3M5UA 3LVMA 3GZDC 4KAMA 4H51A 1MLYA 2VMYA 2Z1ZA 1YNUA 2VMTA 3LG0A 4ZDPA 3BC8A 3B8XA 3EZ1A 1KMJA 3PA9A 2JJFA 2JJHA 3B46A 5DJ9A 2BI2A 1TASA 4GSAA 4OMAA 5F8VA 4WYAA 3GWPA 4FFCA 2Z9UA 1BT4A 3W1JA 3HMUA 3W1IA 1D7UA 3QGUA 1X0MA 2AY4A 4RITA 3IF2A 5LH9A 2VMZA 4BHDA 2W8VA 3L8AA 3QHXA 2NMPA 2VGWA 4DBCA 2VMOA 1AIBA 3AEPA 3LVJA 1BKGA 2W7DA 2CJHA 4IW7A 4LNLA 1WKGA 2VMQA 3E2ZB 1WYVA 3DYDA 2VMWA 1M0QA 2QMAA 2BIGA 4NOGA 1UKJA 3FVUA 4XK1A 4ZDLA 4GDYA 5HXXA 4OCAA 1DJ9A 2VMNA 2ZYJA 1AKAA 3AEJC 4IXOA 5BJ4A 2W8TA 5EUNA 3ASAA 3BV0A 3Q8NA 4A0RA 3HLMA 4MKKA 1W23A 1SZKA 1Z3ZA 2W7GA 5EUDA 1P3WA 1H1CA 2JISA 2VMSA 1OHWA 4F5FA 1GD9A 2VGVA 3PGYA 4K2IA 1ARHA 4OC9A 1RV3A 4ZM4A 2JG2A 4E3RA 4W91A 2DGLA 1CZCA 3EI8A 4JF1A 2E7JA 3WGBA 3ZRRA 4IXSA 3RQ1A 3VAXA 5M4DA 4F5LA 3PDXA 1SVVA 2R2NA 1ASDA 3RUYA 1SZUA 2Z9WA 3N75A 3QPGA 4XQ2A 2CFBA 2WKAA 4F5JA 4JEXA 1V2EA 4WLHA 3CQ4A 2V0YA 3AEJA 1WYUB 4PFFA 3FQ8A 1ECXA 3W1HA 2YKVA 5FT4A 2YRRA 2Z9XA 2BWOA 1CJ0A 1VP4A 1G4XA 4XJMA 1YIZA 1AAWA 1V2FA 4UHNA 4TN4A 3E2FA 4W8IA 3FTBA 4Y0HA 2DOUA 2X5FA 2DGMA 5HHYA 3DXVA 1EQBA 4W1WA 1AHEA 2YCNA 3FRKA 1YJZA 4TMRA 4CXQA 4LW2A 2AY9A 4BA4A 1IJIA 1QIRA 2GB3A 3FQ7A 1GC3A 3A9YA 3EI5A 1IVRA 1Y4IA 3ECDA 1MLZA 1AMRA 5G0AA 1AKCA 3AEOA 3COGA 4GE7A 2AY3A 1WYVB 1ASBA 1TPLA 3F6TA 2VGSA 3JZLA 2HZPA 9AATA 3BCXA 2R5CB 1XEYA 3NNKA 4IX8A 4JE5D 2BI1A 2CJGA 1RVYA 1X29A 4HF8A 4B9BA 4BQ0A 2YKUA 3FSLA 4P7YA 1ASEA 2D5YA 1V2DA 1PMMA 2FNIA 5D95A 1DFOA 4MQQA 4E3QA 4F5MA 1WYTA 3AEMA 4N0WA 4Q6RA 2VIAA 4DGTA 5IWQA 2W7MA 1FG7A 3EI7A 1AMAA 4FL0A 1ARIA 4ZSWA 4F5KA 3GBXA 3DRDA 2GSAA 1KMKA 3E9KA 4ADCA 2YKYA 3I16A 1W7LA 3NTJA 2HOYA 3F0HA 2CINA 3PPLA 3NU8A 3QN6A 5E5IA 2D61A 1M0OA 4WP0A 1AIAA 2F8JA 4LW4A 1PFFA 3CAIA 3BWOA 3GSBA 3AOVA 4RKDA 4A6RA 2D7YA 3BB8A 3H7FA 4ADEA 1TATA 4MQPA 4QGRA 4E77A 4EMYA 4Y0IA 3FZ8A 1XI9A 4HVKA 1Z7DA 3EIBA 3R4TA 3LV2A 5K8BA 3JWBA 2EH6A 4CXRA 2XH1A 1IBJA 3BS8A 3MADA 3TFUA 4RAEA 4MSOA 2D64A 2VMRA 2WK9A 3PAAA 4XAUA 3GZCA 1E5FA 4Y0DA 3ELEA 3E2YA 2PO3A 2EPJA 1PG8A 1WSTA 5HDMA 1ASGA 1UU2A 2C0RA 5FT5A 3MEBA 5FT6A 1GEYA 3L44A 1IAXA 1SZSA 2OGAA 3K7YA 3MAFB 5DB5A 1BQDA 2E54A 2XBNA 2YKXA 3BWNA 3T32A 4LNJA 2HORA 2BYJA 2BKWA 2OKJA 3VK4A 4OYTA 1M4NA 2AATA 2FNUA 4M2MA 3E2ZA 2AY7A 4JEWA 3HL2A 1CQ7A 1DKAA 4IYOB 4AO9A 3AEMC 1JF9A 1BW0A 3PDBA 5EFSA 1BJNA 1AY8A 2OQXA 3K40A 4GE9A 2BWNA 4ATPA 3TFTA 1AMSA 1WKHA 4GEBA 3WGCA 1DJUA 1CL2A 2R5EA 3LVLB 3NYUA 1BJOB 2AEUA 4RM1A 3NYSA 4K2BA 5TF5A 2YRIA 1SFFA 5FT8A 3HVYA 1KL2A 3FDBA 4WYCA 4KXKA 3HDOA 5J8QA 4RJYA 5G2PA 1H0CA 2G6WA 1T3IA 2VLFA 1CQ6A 4A6UA 1C7OA 3VK3A 1IAYA 2W7HA 2X3LA 1QITA 3LY1A 1LC5A 4ITGA 2CB1A 4WYGA 1EG5A 3NYTA 1ZODA 1KKJA 1WYUA 4WYFA 4Q75A 1ELUA 3MAUA 3P6KA 5I92A 1YIYA 4A00A 5G4IA
chains in the Genus database with same CATH superfamily
1LS3A 1C9CA 1DJEA 3DU4A 1M7YA 1BS0A 1RVUA 3I5TA 3RBLA 4EU1A 4A0FA 4M2JA 2W7KA 1TOKA 1D7VA 2FM1A 1B5PA 2OGEA 5M49A 2VMXA 3A9ZA 3RBFA 1WYTB 2D63A 2Z61A 1W7NA 4Q76A 4AZJA 2D7ZA 2FQ6A 2WK8A 3N0LA 3II0A 2BWPA 2ZSLA 1ZOBA 3R9AA 1O61A 1S09A 2D66A 4WXBA 4ZM3A 2D65A 3ATHA 4WD2A 2EO5A 1KL1A 2ZP7A 4ZWVA 1B4XA 3WX9A 4WXGA 3FZ6A 3WCNA 2ZSMA 3AOWA 3FFHA 1TOEA 1MAPA 3DZZA 3G8MA 4EFFA 2EGYA 1YAAA 3ELPA 3FVXA 5E3KA 4RJ0A 5LHAA 1MGVA 3EI9A 3EIAA 2TPLA 1ARSA 2E7UA 2OKKA 3BWNC 2W8UA 1IX6A 2JJEA 3OKSA 4KYOA 4GRXA 4UOYA 1LC8A 3FQAA 3MBBA 2ZC0A 4K2MA 4EB7A 1EJIA 3KKIA 4ZAHA 3PDBB 3ZZJA 4PFNA 4R2NA 3BCAA 1AMQA 1FC4A 3PD6A 1X2AA 4P3MA 5M46A 2VLHA 1O69A 2BIAA 1ASNA 1BJOA 3NDNA 1MDXA 4W1XA 1TOJA 4BA5A 1DTYA 4XEWA 2AY1A 4AOAA 5D5SA 1PMOA 1OXPA 3HQTA 3P1TA 1X28A 2W7EA 3MC6C 1N31A 5DX5A 5EIGA 1B5OA 2VMPA 3MAFA 4R5FA 1G7XA 3CQ6A 3BN1A 2R5CA 3E77A 2EYQA 4XJLA 4RLGA 3K28A 4B98A 1AHYA 1AAMA 3GZDA 1ELQA 3DR7A 1ASCA 1MDOA 1O62A 1AY4A 4ISYA 1FG3A 4WB0B 4GE4A 2W8WA 1UU1A 3ISLA 1W7MA 3DODA 2Q7WA 1D7SA 1M0PA 3VK2A 3TQXA 1AHXA 1ARTA 1J32A 1ZC9A 2BI5A 2DGKA 4WBTA 3H14A 3FVSA 4E1OA 4F4EA 1ASMA 1LK9A 2ZY5A 1G4VA 4ATQA 2DR1A 3ASBA 1TOIA 1CS1A 2VMVA 4F5HA 4AH3A 3N7NA 1AHGA 4EB5A 1SPAA 1OHYA 5G4JA 1BJWA 1TARA 3DXWA 3EUCA 3JTXA 4IXZA 2QSRA 1SF2A 3GETA 4UQVA 4XJPA 2VGTA 4L0OA 2DKJA 5G09A 5KTBA 2C44A 4PIWA 1M6SA 2BI9A 3FFRA 2ZY4A 4TV7A 2O0RA 3B1DA 4IYOA 1ORDA 2ORDA 1MAQA 3A2BA 3WY7A 3N4RA 3GR9A 3AENA 5EAVA 3AATA 3VOMA 1W3UA 3E6GA 1I29A 1YOOA 1JG8A 3FD0A 3N4SA 4N0BA 1I48A 3RI6A 5M4BA 4WYEA 3WKRA 4W1VA 3HT4A 4U2HA 4AO4A 3G0TA 2KFPA 5G2QA 1B9HA 2Z9VA 3PD6B 2RFVA 1IX8A 3MC6A 1MDZA 1QJ5A 1G7WA 1GC0A 1RV4A 2BYLA 2V1PA 1AJSB 5EQCA 4A0HA 2W7FA 1I43A 2CJDA 1AJSA 1N8PA 2AY8A 4XJOA 1D7RA 1C0NA 2GQNA 5EIGB 3AENB 2O7CA 2BHXA 1S0AA 4ADBA 2AY2A 4ITXA 2HUUA 2Z1YA 5EAAA 4DQ6A 3B1EA 4I8AA 1S07A 3AELA 3FZ7A 3UAKA 2AY6A 5F9SA 3QBOA 2AEVA 2CH1A 3QM2A 4W5KA 1M0NA 2E7IA 4A0GA 2ZY2A 2QB2A 4WXFA 1C7GA 3AV7A 3WKSA 2VI8A 4BMKA 2EZ2A 3N5MA 4ZLVA 2GMSA 2FYFA 1QGNA 2JGTA 2VGZA 3UE8A 1ASAA 1AHFA 1CQ8A 1DGEA 2CSTA 2QA3A 1IUGA 4OTLA 2QB3A 2HOXA 4OBVA 4UHOA 4UHMA 2PB2A 1ARGA 4F5IA 8AATA 2GMUA 2X5DA 3NRAA 4WLJA 4ZSYA 4MGRA 1AICA 3MKJA 4ZWMA 4Q31A 3DC1A 1GEXA 2X8UA 2W7IA 1KKPA 4ZDOA 1B8GA 1E5EA 2VYCA 2ZUKA 2OATA 1D2FA 1AJRA 4F5GA 2YOBA 1I41A 1QJ3A 2Z67A 1GDEA 4R8DA 1GC4A 3IHJA 3ZRPA 4CVQA 2HP1A 3NUIA 3OP7A 2O1BA 3CBFA 1IX7A 3VP6A 4A6TA 3D6KA 4PVFA 1AKBA 4CBSA 2HOZA 1U08A 1LW4A 2VI9A 1OHVA 1GCKA 3LWSA 2HP2A 3BCBA 1O4SA 4J8LA 2C81A 4A72A 5JAYA 1QISA 2CY8A 3KE3A 3LVKA 2W8JA 2AY5A 4JE5A 1LW5A 2W7JA 7AATA 1S08A 1YJSA 2YCPA 2Z20A 3TCMA 5AX8A 3PJ0A 3JU7A 4O6ZA 2VIBA 3PIUA 3ZZKA 3FDDA 1LKCA 3FCRA 3NX3A 1B9IA 2HUIA 4JEVA 4U1TA 1JS3A 4MQRA 2ZJGA 4LNMA 2VGUA 1V72A 3DR4A 3B1CA 4RKCA 3WZFA 4MKJA 1CZEA 4JF0A 2EZ1A 5C6UA 2YHKA 5E4ZA 2VMUA 3RCHA 4CBRA 1BQAA 1AY5A 1GEWA 3NUBA 1UU0A 3F9TA 2QBTA 1OATA 1AX4A 1M32A 4J5UA 2ZY3A 1VJOA 4IY7A 3CQ5A 1S06A 1YJYA 1BJ4A 4R5ZA 3A9XA 2PB0A 3ZRQA 2R0TA 1JS6A 5DJ1A 3GJUA 4OBUA 4WB0A 2HUFA 3JW9A 3QI6A 3KGWA 2CANA 1DGDA 1LC7A 3KGXA 2YCTA 3NU7A 1GC2A 2JJGA 1OXOA 3FKDA 4ADDA 4M2KA 4OT8A 1C4KA 4JEZA 2BIEA 2FN6A 2WK7A 3HBXA 2BI3A 4RIZA 3TATA 3EI6A 3WLXA 5BJ3A 2CH2A 1N2TA 3I4JA 1TOGA 1GBNA 4MY5A 1CL1A 1ASFA 1VEFA 3RCHB 2CTZA 3JWAA 1C7NA 1ASLA 3WCOA 3UWCA 2DKBA 1QZ9A 2C7TA 4LC3A 1J04A 3N4XA 3G7QA 2QLRA 3A8UX 3USFA 3EZSA 4JEYA 4WYDA 5EUEA 2W7LA 4ZASA 4AZKA 3ACZA 3M5UA 3LVMA 3GZDC 4KAMA 4H51A 1MLYA 2VMYA 2Z1ZA 1YNUA 2VMTA 3LG0A 4ZDPA 3BC8A 3B8XA 3EZ1A 1KMJA 3PA9A 2JJFA 2JJHA 3B46A 5DJ9A 2BI2A 1TASA 4GSAA 4OMAA 5F8VA 4WYAA 3GWPA 4FFCA 2Z9UA 1BT4A 3W1JA 3HMUA 3W1IA 1D7UA 3QGUA 1X0MA 2AY4A 4RITA 3IF2A 5LH9A 2VMZA 4BHDA 2W8VA 3L8AA 3QHXA 2NMPA 2VGWA 4DBCA 2VMOA 1AIBA 3AEPA 3LVJA 1BKGA 2W7DA 2CJHA 4IW7A 4LNLA 1WKGA 2VMQA 3E2ZB 1WYVA 3DYDA 2G7JA 2VMWA 1M0QA 2QMAA 2BIGA 4NOGA 1UKJA 3FVUA 4XK1A 4ZDLA 4GDYA 5HXXA 4H63Q 4OCAA 1DJ9A 2VMNA 2ZYJA 1AKAA 3AEJC 4IXOA 5BJ4A 2W8TA 5EUNA 3ASAA 3BV0A 3Q8NA 4A0RA 3HLMA 4MKKA 1W23A 1SZKA 1Z3ZA 2W7GA 5EUDA 1P3WA 1H1CA 2JISA 2VMSA 1OHWA 4F5FA 1GD9A 2VGVA 3PGYA 4K2IA 1ARHA 4OC9A 1RV3A 4ZM4A 2JG2A 4E3RA 4W91A 2DGLA 1CZCA 3EI8A 4JF1A 2E7JA 3WGBA 3ZRRA 4IXSA 3RQ1A 3VAXA 5M4DA 4F5LA 3PDXA 1SVVA 2R2NA 1ASDA 3RUYA 1SZUA 2Z9WA 3N75A 3QPGA 4XQ2A 2CFBA 2WKAA 4F5JA 4JEXA 1V2EA 4WLHA 3CQ4A 2V0YA 3AEJA 1WYUB 4PFFA 3FQ8A 1ECXA 3W1HA 2YKVA 5FT4A 2YRRA 2A1VA 2Z9XA 2BWOA 1CJ0A 1VP4A 1G4XA 4XJMA 1YIZA 1AAWA 1V2FA 4UHNA 4TN4A 3E2FA 4W8IA 3FTBA 4Y0HA 2DOUA 2X5FA 2DGMA 5HHYA 3DXVA 1EQBA 4W1WA 1AHEA 3H9XA 2YCNA 3FRKA 1YJZA 4TMRA 4CXQA 4LW2A 2AY9A 4BA4A 1IJIA 1QIRA 2GB3A 3FQ7A 1GC3A 3A9YA 3EI5A 1IVRA 1Y4IA 3ECDA 1MLZA 1AMRA 5G0AA 1AKCA 3AEOA 3COGA 4GE7A 2AY3A 1WYVB 1ASBA 1TPLA 3F6TA 2VGSA 3JZLA 2HZPA 9AATA 3BCXA 2R5CB 1XEYA 3NNKA 4IX8A 4JE5D 2BI1A 2CJGA 1RVYA 1X29A 4HF8A 4B9BA 4BQ0A 2YKUA 3FSLA 4P7YA 1ASEA 2D5YA 2FKIA 1V2DA 1PMMA 2FNIA 5D95A 1DFOA 4MQQA 4E3QA 4F5MA 1WYTA 3AEMA 4N0WA 4Q6RA 2VIAA 4DGTA 5IWQA 2W7MA 1FG7A 3EI7A 1AMAA 4FL0A 1ARIA 4ZSWA 4F5KA 3GBXA 3DRDA 2GSAA 1KMKA 3E9KA 4ADCA 2YKYA 3I16A 1W7LA 3NTJA 2HOYA 3F0HA 2CINA 3PPLA 2WB6A 3NU8A 3QN6A 5E5IA 2D61A 1M0OA 1KAFA 4WP0A 1AIAA 2F8JA 4LW4A 1PFFA 3CAIA 3BWOA 3GSBA 3AOVA 4RKDA 4A6RA 2D7YA 3BB8A 3H7FA 4ADEA 1TATA 4MQPA 4QGRA 4E77A 4EMYA 4Y0IA 3FZ8A 1XI9A 4HVKA 1Z7DA 3EIBA 3R4TA 3LV2A 5K8BA 3JWBA 2EH6A 4CXRA 2XH1A 1IBJA 3BS8A 3MADA 3TFUA 4RAEA 4MSOA 2D64A 2VMRA 2WK9A 3PAAA 4XAUA 3GZCA 1E5FA 4Y0DA 3ELEA 3E2YA 2PO3A 2EPJA 1PG8A 1WSTA 5HDMA 1ASGA 1UU2A 2C0RA 5FT5A 3MEBA 4K05A 5FT6A 1GEYA 3L44A 1IAXA 1SZSA 2OGAA 3K7YA 3MAFB 5DB5A 1BQDA 2E54A 2XBNA 2YKXA 3BWNA 3T32A 4LNJA 2HORA 2BYJA 2BKWA 2OKJA 3VK4A 4OYTA 1M4NA 2AATA 2FNUA 4M2MA 3E2ZA 2AY7A 4JEWA 3HL2A 1CQ7A 1DKAA 4IYOB 4AO9A 3AEMC 1JF9A 1BW0A 3PDBA 5EFSA 1BJNA 1AY8A 2OQXA 3K40A 4GE9A 2BWNA 4ATPA 3TFTA 1AMSA 1WKHA 4GEBA 3WGCA 1DJUA 1CL2A 2R5EA 3LVLB 3NYUA 1BJOB 2AEUA 4RM1A 3NYSA 4K2BA 5TF5A 2YRIA 1SFFA 5FT8A 3HVYA 1KL2A 3FDBA 4WYCA 4KXKA 3HDOA 5J8QA 4RJYA 5G2PA 1H0CA 2G6WA 1T3IA 2VLFA 1CQ6A 4A6UA 1C7OA 3VK3A 1IAYA 2W7HA 2X3LA 1QITA 3LY1A 1LC5A 4ITGA 2CB1A 4WYGA 1EG5A 3NYTA 1ZODA 1KKJA 1WYUA 4WYFA 4Q75A 1ELUA 3MAUA 3P6KA 5I92A 1YIYA 4A00A 5G4IA
chains in the Genus database with same CATH topology
1LS3A 1C9CA 1DJEA 3DU4A 1M7YA 1BS0A 1RVUA 3I5TA 3RBLA 4EU1A 4A0FA 4M2JA 2W7KA 1TOKA 1D7VA 2FM1A 1B5PA 2OGEA 5M49A 2VMXA 3A9ZA 3RBFA 1WYTB 2D63A 2Z61A 1W7NA 4Q76A 4AZJA 2D7ZA 2FQ6A 2WK8A 3N0LA 3II0A 2BWPA 2ZSLA 1ZOBA 3R9AA 1O61A 1S09A 2D66A 4WXBA 4ZM3A 2D65A 3ATHA 4WD2A 2EO5A 1KL1A 2ZP7A 4ZWVA 1B4XA 3WX9A 4WXGA 3FZ6A 3WCNA 2ZSMA 3AOWA 3FFHA 1TOEA 1MAPA 3DZZA 3G8MA 4EFFA 2EGYA 1YAAA 3ELPA 3FVXA 5E3KA 4RJ0A 5LHAA 1MGVA 3EI9A 3EIAA 2TPLA 1ARSA 2E7UA 2OKKA 3BWNC 2W8UA 1IX6A 2JJEA 3OKSA 4KYOA 4GRXA 4UOYA 1LC8A 3FQAA 3MBBA 2ZC0A 4K2MA 4EB7A 1EJIA 3KKIA 4ZAHA 3PDBB 3ZZJA 4PFNA 4R2NA 3BCAA 1AMQA 1FC4A 3PD6A 1X2AA 4P3MA 5M46A 2VLHA 1O69A 2BIAA 1ASNA 1BJOA 3NDNA 1MDXA 4W1XA 1TOJA 4BA5A 1DTYA 4XEWA 2AY1A 4AOAA 5D5SA 1PMOA 1OXPA 3HQTA 3P1TA 1X28A 2W7EA 3MC6C 1N31A 5DX5A 5EIGA 1B5OA 2VMPA 3MAFA 4R5FA 1G7XA 3CQ6A 3BN1A 2R5CA 3E77A 2EYQA 4XJLA 4RLGA 3K28A 4B98A 1AHYA 1AAMA 3GZDA 1ELQA 3DR7A 1ASCA 1MDOA 1O62A 1AY4A 4ISYA 1FG3A 4WB0B 4GE4A 2W8WA 1UU1A 3ISLA 1W7MA 3DODA 2Q7WA 1D7SA 1M0PA 3VK2A 3TQXA 1AHXA 1ARTA 1J32A 1ZC9A 2BI5A 2DGKA 4WBTA 3H14A 3FVSA 4E1OA 4F4EA 1ASMA 1LK9A 2ZY5A 1G4VA 4ATQA 2DR1A 3ASBA 1TOIA 1CS1A 2VMVA 4F5HA 4AH3A 3N7NA 1AHGA 4EB5A 1SPAA 1OHYA 5G4JA 1BJWA 1TARA 3DXWA 3EUCA 3JTXA 4IXZA 2QSRA 1SF2A 3GETA 4UQVA 4XJPA 2VGTA 4L0OA 2DKJA 5G09A 5KTBA 2C44A 4PIWA 1M6SA 2BI9A 3FFRA 2ZY4A 4TV7A 2O0RA 3B1DA 4IYOA 1ORDA 2ORDA 1MAQA 3A2BA 3WY7A 3N4RA 3GR9A 3AENA 5EAVA 3AATA 3VOMA 1W3UA 3E6GA 1I29A 1YOOA 1JG8A 3FD0A 3N4SA 4N0BA 1I48A 3RI6A 5M4BA 4WYEA 3WKRA 4W1VA 3HT4A 4U2HA 4AO4A 3G0TA 2KFPA 5G2QA 1B9HA 2Z9VA 3PD6B 2RFVA 1IX8A 3MC6A 1MDZA 1QJ5A 1G7WA 1GC0A 1RV4A 2BYLA 2V1PA 1AJSB 5EQCA 4A0HA 2W7FA 1I43A 2CJDA 1AJSA 1N8PA 2AY8A 4XJOA 1D7RA 1C0NA 2GQNA 5EIGB 3AENB 2O7CA 2BHXA 1S0AA 4ADBA 2AY2A 4ITXA 2HUUA 2Z1YA 5EAAA 4DQ6A 3B1EA 4I8AA 1S07A 3AELA 3FZ7A 3UAKA 2AY6A 5F9SA 3QBOA 2AEVA 2CH1A 3QM2A 4W5KA 1M0NA 2E7IA 4A0GA 2ZY2A 2QB2A 4WXFA 1C7GA 3AV7A 3WKSA 2VI8A 4BMKA 2EZ2A 3N5MA 4ZLVA 2GMSA 2FYFA 1QGNA 2JGTA 2VGZA 3UE8A 1ASAA 1AHFA 1CQ8A 1DGEA 2CSTA 2QA3A 1IUGA 4OTLA 2QB3A 2HOXA 4OBVA 4UHOA 4UHMA 2PB2A 1ARGA 4F5IA 8AATA 2GMUA 2X5DA 3NRAA 4WLJA 4ZSYA 4MGRA 1AICA 3MKJA 4ZWMA 4Q31A 3DC1A 1GEXA 2X8UA 2W7IA 1KKPA 4ZDOA 1B8GA 1E5EA 2VYCA 2ZUKA 2OATA 1D2FA 1AJRA 4F5GA 2YOBA 1I41A 1QJ3A 2Z67A 1GDEA 4R8DA 1GC4A 3IHJA 3ZRPA 4CVQA 2HP1A 3NUIA 3OP7A 2O1BA 3CBFA 1IX7A 3VP6A 4A6TA 3D6KA 4PVFA 1AKBA 4CBSA 2HOZA 1U08A 1LW4A 2VI9A 1OHVA 1GCKA 3LWSA 2HP2A 3BCBA 1O4SA 4J8LA 2C81A 4A72A 5JAYA 1QISA 2CY8A 3KE3A 3LVKA 2W8JA 2AY5A 4JE5A 1LW5A 2W7JA 7AATA 1S08A 1YJSA 2YCPA 2Z20A 3TCMA 5AX8A 3PJ0A 3JU7A 4O6ZA 2VIBA 3PIUA 3ZZKA 3FDDA 1LKCA 3FCRA 3NX3A 1B9IA 2HUIA 4JEVA 4U1TA 1JS3A 4MQRA 2ZJGA 4LNMA 2VGUA 1V72A 3DR4A 3B1CA 4RKCA 3WZFA 4MKJA 1CZEA 4JF0A 2EZ1A 5C6UA 2YHKA 5E4ZA 2VMUA 3RCHA 4CBRA 1BQAA 1AY5A 1GEWA 3NUBA 1UU0A 3F9TA 2QBTA 1OATA 1AX4A 1M32A 4J5UA 2ZY3A 1VJOA 4IY7A 3CQ5A 1S06A 1YJYA 1BJ4A 4R5ZA 3A9XA 2PB0A 3ZRQA 2R0TA 1JS6A 5DJ1A 3GJUA 4OBUA 4WB0A 2HUFA 3JW9A 3QI6A 3KGWA 2CANA 1DGDA 1LC7A 3KGXA 2YCTA 3NU7A 1GC2A 2JJGA 1OXOA 3FKDA 4ADDA 4M2KA 4OT8A 1C4KA 4JEZA 2BIEA 2FN6A 2WK7A 3HBXA 2BI3A 4RIZA 3TATA 3EI6A 3WLXA 5BJ3A 2CH2A 1N2TA 3I4JA 1TOGA 1GBNA 4MY5A 1CL1A 1ASFA 1VEFA 3RCHB 2CTZA 3JWAA 1C7NA 1ASLA 3WCOA 3UWCA 2DKBA 1QZ9A 2C7TA 4LC3A 1J04A 3N4XA 3G7QA 2QLRA 3A8UX 3USFA 3EZSA 4JEYA 4WYDA 5EUEA 2W7LA 4ZASA 4AZKA 3ACZA 3M5UA 3LVMA 3GZDC 4KAMA 4H51A 1MLYA 2VMYA 2Z1ZA 1YNUA 2VMTA 3LG0A 4ZDPA 3BC8A 3B8XA 3EZ1A 1KMJA 3PA9A 2JJFA 2JJHA 3B46A 5DJ9A 2BI2A 1TASA 4GSAA 4OMAA 5F8VA 4WYAA 3GWPA 4FFCA 2Z9UA 1BT4A 3W1JA 3HMUA 3W1IA 1D7UA 3QGUA 1X0MA 2AY4A 4RITA 3IF2A 5LH9A 2VMZA 4BHDA 2W8VA 3L8AA 3QHXA 2NMPA 2VGWA 4DBCA 2VMOA 1AIBA 3AEPA 3LVJA 1BKGA 2W7DA 2CJHA 4IW7A 4LNLA 1WKGA 2VMQA 3E2ZB 1WYVA 3DYDA 2G7JA 2VMWA 1M0QA 2QMAA 2BIGA 4NOGA 1UKJA 3FVUA 4XK1A 4ZDLA 4GDYA 5HXXA 4H63Q 4OCAA 1DJ9A 2VMNA 2ZYJA 1AKAA 3AEJC 4IXOA 5BJ4A 2W8TA 5EUNA 3ASAA 3BV0A 3Q8NA 4A0RA 3HLMA 4MKKA 1W23A 1SZKA 1Z3ZA 2W7GA 5EUDA 1P3WA 1H1CA 2JISA 2VMSA 1OHWA 4F5FA 1GD9A 2VGVA 3PGYA 4K2IA 1ARHA 4OC9A 1RV3A 4ZM4A 2JG2A 4E3RA 4W91A 2DGLA 1CZCA 3EI8A 4JF1A 2E7JA 3WGBA 3ZRRA 4IXSA 3RQ1A 3VAXA 5M4DA 4F5LA 3PDXA 1SVVA 2R2NA 1ASDA 3RUYA 1SZUA 2Z9WA 3N75A 3QPGA 4XQ2A 2CFBA 2WKAA 4F5JA 4JEXA 1V2EA 4WLHA 3CQ4A 2V0YA 3AEJA 1WYUB 4PFFA 3FQ8A 1ECXA 3W1HA 2YKVA 5FT4A 2YRRA 2A1VA 2Z9XA 2BWOA 1CJ0A 1VP4A 1G4XA 4XJMA 1YIZA 1AAWA 1V2FA 4UHNA 4TN4A 3E2FA 4W8IA 3FTBA 4Y0HA 2DOUA 2X5FA 2DGMA 5HHYA 3DXVA 1EQBA 4W1WA 1AHEA 3H9XA 2YCNA 3FRKA 1YJZA 4TMRA 4CXQA 4LW2A 2AY9A 4BA4A 1IJIA 1QIRA 2GB3A 3FQ7A 1GC3A 3A9YA 3EI5A 1IVRA 1Y4IA 3ECDA 1MLZA 1AMRA 5G0AA 1AKCA 3AEOA 3COGA 4GE7A 2AY3A 1WYVB 1ASBA 1TPLA 3F6TA 2VGSA 3JZLA 2HZPA 9AATA 3BCXA 2R5CB 1XEYA 3NNKA 4IX8A 4JE5D 2BI1A 2CJGA 1RVYA 1X29A 4HF8A 4B9BA 4BQ0A 2YKUA 3FSLA 4P7YA 1ASEA 2D5YA 2FKIA 1V2DA 1PMMA 2FNIA 5D95A 1DFOA 4MQQA 4E3QA 4F5MA 1WYTA 3AEMA 4N0WA 4Q6RA 2VIAA 4DGTA 5IWQA 2W7MA 1FG7A 3EI7A 1AMAA 4FL0A 1ARIA 4ZSWA 4F5KA 3GBXA 3DRDA 2GSAA 1KMKA 3E9KA 4ADCA 2YKYA 3I16A 1W7LA 3NTJA 2HOYA 3F0HA 2CINA 3PPLA 2WB6A 3NU8A 3QN6A 5E5IA 2D61A 1M0OA 4WP0A 1AIAA 2F8JA 4LW4A 1PFFA 3CAIA 3BWOA 3GSBA 3AOVA 4RKDA 4A6RA 2D7YA 3BB8A 3H7FA 4ADEA 1TATA 4MQPA 4QGRA 4E77A 4EMYA 4Y0IA 3FZ8A 1XI9A 4HVKA 1Z7DA 3EIBA 3R4TA 3LV2A 5K8BA 3JWBA 2EH6A 4CXRA 2XH1A 1IBJA 3BS8A 3MADA 3TFUA 4RAEA 4MSOA 2D64A 2VMRA 2WK9A 3PAAA 4XAUA 3GZCA 1E5FA 4Y0DA 3ELEA 3E2YA 2PO3A 2EPJA 1PG8A 1WSTA 5HDMA 1ASGA 1UU2A 2C0RA 5FT5A 3MEBA 4K05A 5FT6A 1GEYA 3L44A 1IAXA 1SZSA 2OGAA 3K7YA 3MAFB 5DB5A 1BQDA 2E54A 2XBNA 2YKXA 3BWNA 3T32A 4LNJA 2HORA 2BYJA 2BKWA 2OKJA 3VK4A 4OYTA 1M4NA 2AATA 2FNUA 4M2MA 3E2ZA 2AY7A 4JEWA 3HL2A 1CQ7A 1DKAA 4IYOB 4AO9A 3AEMC 1JF9A 1BW0A 3PDBA 5EFSA 1BJNA 1AY8A 2OQXA 3K40A 4GE9A 2BWNA 4ATPA 3TFTA 1AMSA 1WKHA 4GEBA 3WGCA 1DJUA 1CL2A 2R5EA 3LVLB 3NYUA 1BJOB 2AEUA 4RM1A 3NYSA 4K2BA 5TF5A 2YRIA 1SFFA 5FT8A 3HVYA 1KL2A 3FDBA 4WYCA 4KXKA 3HDOA 5J8QA 4RJYA 5G2PA 1H0CA 2G6WA 1T3IA 2VLFA 1CQ6A 4A6UA 1C7OA 3VK3A 1IAYA 2W7HA 2X3LA 1QITA 3LY1A 1LC5A 4ITGA 2CB1A 4WYGA 1EG5A 3NYTA 1ZODA 1KKJA 1WYUA 4WYFA 4Q75A 1ELUA 3MAUA 3P6KA 5I92A 1YIYA 4A00A 5G4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS3 A;  1C9C A;  1DJE A;  3DU4 A;  1M7Y A;  1BS0 A;  1RVU A;  3I5T A;  3RBL A;  4EU1 A;  4A0F A;  4M2J A;  2W7K A;  1TOK A;  1D7V A;  2FM1 A;  1B5P A;  2OGE A;  5M49 A;  2VMX A;  3A9Z A;  3RBF A;  1WYT B;  2D63 A;  2Z61 A;  1W7N A;  4Q76 A;  4AZJ A;  2D7Z A;  2FQ6 A;  2WK8 A;  3N0L A;  3II0 A;  2BWP A;  2ZSL A;  1ZOB A;  3R9A A;  1O61 A;  1S09 A;  2D66 A;  4WXB A;  4ZM3 A;  2D65 A;  3ATH A;  4WD2 A;  2EO5 A;  1KL1 A;  2ZP7 A;  4ZWV A;  1B4X A;  3WX9 A;  4WXG A;  3FZ6 A;  3WCN A;  2ZSM A;  3AOW A;  3FFH A;  1TOE A;  1MAP A;  3DZZ A;  3G8M A;  4EFF A;  2EGY A;  1YAA A;  3ELP A;  3FVX A;  5E3K A;  4RJ0 A;  5LHA A;  1MGV A;  3EI9 A;  3EIA A;  2TPL A;  1ARS A;  2E7U A;  2OKK A;  3BWN C;  2W8U A;  1IX6 A;  2JJE A;  3OKS A;  4KYO A;  4GRX A;  4UOY A;  1LC8 A;  3FQA A;  3MBB A;  2ZC0 A;  4K2M A;  4EB7 A;  1EJI A;  3KKI A;  4ZAH A;  3PDB B;  3ZZJ A;  4PFN A;  4R2N A;  3BCA A;  1AMQ A;  1FC4 A;  3PD6 A;  1X2A A;  4P3M A;  5M46 A;  2VLH A;  1O69 A;  2BIA A;  1ASN A;  1BJO A;  3NDN A;  1MDX A;  4W1X A;  1TOJ A;  4BA5 A;  1DTY A;  4XEW A;  2AY1 A;  4AOA A;  5D5S A;  1PMO A;  1OXP A;  3HQT A;  3P1T A;  1X28 A;  2W7E A;  3MC6 C;  1N31 A;  5DX5 A;  5EIG A;  1B5O A;  2VMP A;  3MAF A;  4R5F A;  1G7X A;  3CQ6 A;  3BN1 A;  2R5C A;  3E77 A;  4XJL A;  4RLG A;  3K28 A;  4B98 A;  1AHY A;  1AAM A;  3GZD A;  1ELQ A;  3DR7 A;  1ASC A;  1MDO A;  1O62 A;  1AY4 A;  4ISY A;  1FG3 A;  4WB0 B;  4GE4 A;  2W8W A;  1UU1 A;  3ISL A;  1W7M A;  3DOD A;  2Q7W A;  1D7S A;  1M0P A;  3VK2 A;  3TQX A;  1AHX A;  1ART A;  1J32 A;  1ZC9 A;  2BI5 A;  2DGK A;  4WBT A;  3H14 A;  3FVS A;  4E1O A;  4F4E A;  1ASM A;  1LK9 A;  2ZY5 A;  1G4V A;  4ATQ A;  2DR1 A;  3ASB A;  1TOI A;  1CS1 A;  2VMV A;  4F5H A;  4AH3 A;  1AHG A;  4EB5 A;  1SPA A;  1OHY A;  5G4J A;  1BJW A;  1TAR A;  3DXW A;  3EUC A;  3JTX A;  4IXZ A;  1SF2 A;  3GET A;  4UQV A;  4XJP A;  2VGT A;  4L0O A;  2DKJ A;  5G09 A;  2C44 A;  4PIW A;  1M6S A;  2BI9 A;  3FFR A;  2ZY4 A;  4TV7 A;  2O0R A;  3B1D A;  4IYO A;  1ORD A;  2ORD A;  1MAQ A;  3A2B A;  3WY7 A;  3GR9 A;  3AEN A;  5EAV A;  3AAT A;  3VOM A;  1W3U A;  3E6G A;  1I29 A;  1YOO A;  1JG8 A;  3FD0 A;  4N0B A;  1I48 A;  3RI6 A;  5M4B A;  4WYE A;  3WKR A;  4W1V A;  3HT4 A;  4U2H A;  4AO4 A;  3G0T A;  5G2Q A;  1B9H A;  2Z9V A;  3PD6 B;  2RFV A;  1IX8 A;  3MC6 A;  1MDZ A;  1QJ5 A;  1G7W A;  1GC0 A;  1RV4 A;  2BYL A;  2V1P A;  1AJS B;  5EQC A;  4A0H A;  2W7F A;  1I43 A;  2CJD A;  1AJS A;  1N8P A;  2AY8 A;  4XJO A;  1D7R A;  1C0N A;  2GQN A;  5EIG B;  3AEN B;  2O7C A;  2BHX A;  1S0A A;  4ADB A;  2AY2 A;  4ITX A;  2HUU A;  2Z1Y A;  5EAA A;  4DQ6 A;  3B1E A;  4I8A A;  1S07 A;  3AEL A;  3FZ7 A;  3UAK A;  2AY6 A;  5F9S A;  3QBO A;  2AEV A;  2CH1 A;  3QM2 A;  4W5K A;  1M0N A;  2E7I A;  4A0G A;  2ZY2 A;  2QB2 A;  4WXF A;  1C7G A;  3AV7 A;  3WKS A;  2VI8 A;  4BMK A;  2EZ2 A;  3N5M A;  4ZLV A;  2GMS A;  2FYF A;  1QGN A;  2JGT A;  2VGZ A;  3UE8 A;  1ASA A;  1AHF A;  1CQ8 A;  1DGE A;  2CST A;  2QA3 A;  1IUG A;  4OTL A;  2QB3 A;  2HOX A;  4OBV A;  4UHO A;  4UHM A;  2PB2 A;  1ARG A;  4F5I A;  8AAT A;  2GMU A;  2X5D A;  3NRA A;  4WLJ A;  4ZSY A;  4MGR A;  1AIC A;  3MKJ A;  4ZWM A;  4Q31 A;  3DC1 A;  1GEX A;  2X8U A;  2W7I A;  1KKP A;  4ZDO A;  1B8G A;  1E5E A;  2VYC A;  2ZUK A;  2OAT A;  1D2F A;  1AJR A;  4F5G A;  2YOB A;  1I41 A;  1QJ3 A;  2Z67 A;  1GDE A;  4R8D A;  1GC4 A;  3IHJ A;  3ZRP A;  4CVQ A;  2HP1 A;  3NUI A;  3OP7 A;  2O1B A;  3CBF A;  1IX7 A;  3VP6 A;  4A6T A;  3D6K A;  4PVF A;  1AKB A;  4CBS A;  2HOZ A;  1U08 A;  1LW4 A;  2VI9 A;  1OHV A;  1GCK A;  3LWS A;  2HP2 A;  3BCB A;  1O4S A;  4J8L A;  2C81 A;  4A72 A;  5JAY A;  1QIS A;  2CY8 A;  3KE3 A;  3LVK A;  2W8J A;  2AY5 A;  4JE5 A;  1LW5 A;  2W7J A;  7AAT A;  1S08 A;  1YJS A;  2YCP A;  2Z20 A;  3TCM A;  5AX8 A;  3PJ0 A;  3JU7 A;  4O6Z A;  2VIB A;  3PIU A;  3ZZK A;  3FDD A;  1LKC A;  3FCR A;  3NX3 A;  1B9I A;  2HUI A;  4JEV A;  4U1T A;  1JS3 A;  4MQR A;  2ZJG A;  4LNM A;  2VGU A;  1V72 A;  3DR4 A;  3B1C A;  4RKC A;  3WZF A;  4MKJ A;  1CZE A;  4JF0 A;  2EZ1 A;  5C6U A;  2YHK A;  5E4Z A;  2VMU A;  3RCH A;  4CBR A;  1BQA A;  1AY5 A;  1GEW A;  3NUB A;  1UU0 A;  3F9T A;  2QBT A;  1OAT A;  1AX4 A;  1M32 A;  4J5U A;  2ZY3 A;  1VJO A;  4IY7 A;  3CQ5 A;  1S06 A;  1YJY A;  1BJ4 A;  4R5Z A;  3A9X A;  2PB0 A;  3ZRQ A;  2R0T A;  1JS6 A;  5DJ1 A;  3GJU A;  4OBU A;  4WB0 A;  2HUF A;  3JW9 A;  3QI6 A;  3KGW A;  2CAN A;  1DGD A;  1LC7 A;  3KGX A;  2YCT A;  3NU7 A;  1GC2 A;  2JJG A;  1OXO A;  3FKD A;  4ADD A;  4M2K A;  4OT8 A;  1C4K A;  4JEZ A;  2BIE A;  2FN6 A;  2WK7 A;  3HBX A;  2BI3 A;  4RIZ A;  3TAT A;  3EI6 A;  3WLX A;  5BJ3 A;  2CH2 A;  1N2T A;  3I4J A;  1TOG A;  1GBN A;  4MY5 A;  1CL1 A;  1ASF A;  1VEF A;  3RCH B;  2CTZ A;  3JWA A;  1C7N A;  1ASL A;  3WCO A;  3UWC A;  2DKB A;  1QZ9 A;  2C7T A;  4LC3 A;  1J04 A;  3G7Q A;  2QLR A;  3A8U X;  3USF A;  3EZS A;  4JEY A;  4WYD A;  5EUE A;  2W7L A;  4ZAS A;  4AZK A;  3ACZ A;  3M5U A;  3LVM A;  3GZD C;  4KAM A;  4H51 A;  1MLY A;  2VMY A;  2Z1Z A;  1YNU A;  2VMT A;  3LG0 A;  4ZDP A;  3BC8 A;  3B8X A;  3EZ1 A;  1KMJ A;  3PA9 A;  2JJF A;  2JJH A;  3B46 A;  5DJ9 A;  2BI2 A;  1TAS A;  4GSA A;  4OMA A;  5F8V A;  4WYA A;  3GWP A;  4FFC A;  2Z9U A;  1BT4 A;  3W1J A;  3HMU A;  3W1I A;  1D7U A;  3QGU A;  1X0M A;  2AY4 A;  4RIT A;  3IF2 A;  5LH9 A;  2VMZ A;  4BHD A;  2W8V A;  3L8A A;  3QHX A;  2NMP A;  2VGW A;  4DBC A;  2VMO A;  1AIB A;  3AEP A;  3LVJ A;  1BKG A;  2W7D A;  2CJH A;  4IW7 A;  4LNL A;  1WKG A;  2VMQ A;  3E2Z B;  1WYV A;  3DYD A;  2VMW A;  1M0Q A;  2QMA A;  2BIG A;  4NOG A;  1UKJ A;  3FVU A;  4XK1 A;  4ZDL A;  4GDY A;  5HXX A;  4OCA A;  1DJ9 A;  2VMN A;  2ZYJ A;  1AKA A;  3AEJ C;  4IXO A;  5BJ4 A;  2W8T A;  5EUN A;  3ASA A;  3BV0 A;  3Q8N A;  4A0R A;  3HLM A;  4MKK A;  1W23 A;  1SZK A;  1Z3Z A;  2W7G A;  5EUD A;  1P3W A;  1H1C A;  2JIS A;  2VMS A;  1OHW A;  4F5F A;  1GD9 A;  2VGV A;  3PGY A;  4K2I A;  1ARH A;  4OC9 A;  1RV3 A;  4ZM4 A;  2JG2 A;  4E3R A;  4W91 A;  2DGL A;  1CZC A;  3EI8 A;  4JF1 A;  2E7J A;  3WGB A;  3ZRR A;  4IXS A;  3RQ1 A;  3VAX A;  5M4D A;  4F5L A;  3PDX A;  1SVV A;  2R2N A;  1ASD A;  3RUY A;  1SZU A;  2Z9W A;  3N75 A;  3QPG A;  4XQ2 A;  2CFB A;  2WKA A;  4F5J A;  4JEX A;  1V2E A;  4WLH A;  3CQ4 A;  2V0Y A;  3AEJ A;  1WYU B;  4PFF A;  3FQ8 A;  1ECX A;  3W1H A;  2YKV A;  5FT4 A;  2YRR A;  2Z9X A;  2BWO A;  1CJ0 A;  1VP4 A;  1G4X A;  4XJM A;  1YIZ A;  1AAW A;  1V2F A;  4UHN A;  4TN4 A;  3E2F A;  4W8I A;  3FTB A;  4Y0H A;  2DOU A;  2X5F A;  2DGM A;  5HHY A;  3DXV A;  1EQB A;  4W1W A;  1AHE A;  2YCN A;  3FRK A;  1YJZ A;  4TMR A;  4CXQ A;  4LW2 A;  2AY9 A;  4BA4 A;  1IJI A;  1QIR A;  2GB3 A;  3FQ7 A;  1GC3 A;  3A9Y A;  3EI5 A;  1IVR A;  1Y4I A;  3ECD A;  1MLZ A;  1AMR A;  5G0A A;  1AKC A;  3AEO A;  3COG A;  4GE7 A;  2AY3 A;  1WYV B;  1ASB A;  1TPL A;  3F6T A;  2VGS A;  3JZL A;  2HZP A;  9AAT A;  3BCX A;  2R5C B;  1XEY A;  3NNK A;  4IX8 A;  4JE5 D;  2BI1 A;  2CJG A;  1RVY A;  1X29 A;  4HF8 A;  4B9B A;  4BQ0 A;  2YKU A;  3FSL A;  4P7Y A;  1ASE A;  2D5Y A;  1V2D A;  1PMM A;  2FNI A;  5D95 A;  1DFO A;  4MQQ A;  4E3Q A;  4F5M A;  1WYT A;  3AEM A;  4N0W A;  4Q6R A;  2VIA A;  4DGT A;  5IWQ A;  2W7M A;  1FG7 A;  3EI7 A;  1AMA A;  4FL0 A;  1ARI A;  4ZSW A;  4F5K A;  3GBX A;  3DRD A;  2GSA A;  1KMK A;  3E9K A;  4ADC A;  2YKY A;  3I16 A;  1W7L A;  3NTJ A;  2HOY A;  3F0H A;  2CIN A;  3PPL A;  3NU8 A;  3QN6 A;  5E5I A;  2D61 A;  1M0O A;  4WP0 A;  1AIA A;  2F8J A;  4LW4 A;  1PFF A;  3CAI A;  3BWO A;  3GSB A;  3AOV A;  4RKD A;  4A6R A;  2D7Y A;  3BB8 A;  3H7F A;  4ADE A;  1TAT A;  4MQP A;  4QGR A;  4E77 A;  4EMY A;  4Y0I A;  3FZ8 A;  1XI9 A;  4HVK A;  1Z7D A;  3EIB A;  3R4T A;  3LV2 A;  5K8B A;  3JWB A;  2EH6 A;  4CXR A;  2XH1 A;  1IBJ A;  3BS8 A;  3MAD A;  3TFU A;  4RAE A;  4MSO A;  2D64 A;  2VMR A;  2WK9 A;  3PAA A;  4XAU A;  3GZC A;  1E5F A;  4Y0D A;  3ELE A;  3E2Y A;  2PO3 A;  2EPJ A;  1PG8 A;  1WST A;  5HDM A;  1ASG A;  1UU2 A;  2C0R A;  5FT5 A;  3MEB A;  5FT6 A;  1GEY A;  3L44 A;  1IAX A;  1SZS A;  2OGA A;  3K7Y A;  3MAF B;  5DB5 A;  1BQD A;  2E54 A;  2XBN A;  2YKX A;  3BWN A;  3T32 A;  4LNJ A;  2HOR A;  2BYJ A;  2BKW A;  2OKJ A;  3VK4 A;  4OYT A;  1M4N A;  2AAT A;  2FNU A;  4M2M A;  3E2Z A;  2AY7 A;  4JEW A;  3HL2 A;  1CQ7 A;  1DKA A;  4IYO B;  4AO9 A;  3AEM C;  1JF9 A;  1BW0 A;  3PDB A;  5EFS A;  1BJN A;  1AY8 A;  2OQX A;  3K40 A;  4GE9 A;  2BWN A;  4ATP A;  3TFT A;  1AMS A;  1WKH A;  4GEB A;  3WGC A;  1DJU A;  1CL2 A;  2R5E A;  3LVL B;  3NYU A;  1BJO B;  2AEU A;  4RM1 A;  3NYS A;  4K2B A;  5TF5 A;  2YRI A;  1SFF A;  5FT8 A;  3HVY A;  1KL2 A;  3FDB A;  4WYC A;  4KXK A;  3HDO A;  5J8Q A;  4RJY A;  5G2P A;  1H0C A;  2G6W A;  1T3I A;  2VLF A;  1CQ6 A;  4A6U A;  1C7O A;  3VK3 A;  1IAY A;  2W7H A;  2X3L A;  1QIT A;  3LY1 A;  1LC5 A;  4ITG A;  2CB1 A;  4WYG A;  1EG5 A;  3NYT A;  1ZOD A;  1KKJ A;  1WYU A;  4WYF A;  4Q75 A;  1ELU A;  3MAU A;  3P6K A;  5I92 A;  1YIY A;  4A00 A;  5G4I A; 
#chains in the Genus database with same CATH topology
 1LS3 A;  1C9C A;  1DJE A;  3DU4 A;  1M7Y A;  1BS0 A;  1RVU A;  3I5T A;  3RBL A;  4EU1 A;  4A0F A;  4M2J A;  2W7K A;  1TOK A;  1D7V A;  2FM1 A;  1B5P A;  2OGE A;  5M49 A;  2VMX A;  3A9Z A;  3RBF A;  1WYT B;  2D63 A;  2Z61 A;  1W7N A;  4Q76 A;  4AZJ A;  2D7Z A;  2FQ6 A;  2WK8 A;  3N0L A;  3II0 A;  2BWP A;  2ZSL A;  1ZOB A;  3R9A A;  1O61 A;  1S09 A;  2D66 A;  4WXB A;  4ZM3 A;  2D65 A;  3ATH A;  4WD2 A;  2EO5 A;  1KL1 A;  2ZP7 A;  4ZWV A;  1B4X A;  3WX9 A;  4WXG A;  3FZ6 A;  3WCN A;  2ZSM A;  3AOW A;  3FFH A;  1TOE A;  1MAP A;  3DZZ A;  3G8M A;  4EFF A;  2EGY A;  1YAA A;  3ELP A;  3FVX A;  5E3K A;  4RJ0 A;  5LHA A;  1MGV A;  3EI9 A;  3EIA A;  2TPL A;  1ARS A;  2E7U A;  2OKK A;  3BWN C;  2W8U A;  1IX6 A;  2JJE A;  3OKS A;  4KYO A;  4GRX A;  4UOY A;  1LC8 A;  3FQA A;  3MBB A;  2ZC0 A;  4K2M A;  4EB7 A;  1EJI A;  3KKI A;  4ZAH A;  3PDB B;  3ZZJ A;  4PFN A;  4R2N A;  3BCA A;  1AMQ A;  1FC4 A;  3PD6 A;  1X2A A;  4P3M A;  5M46 A;  2VLH A;  1O69 A;  2BIA A;  1ASN A;  1BJO A;  3NDN A;  1MDX A;  4W1X A;  1TOJ A;  4BA5 A;  1DTY A;  4XEW A;  2AY1 A;  4AOA A;  5D5S A;  1PMO A;  1OXP A;  3HQT A;  3P1T A;  1X28 A;  2W7E A;  3MC6 C;  1N31 A;  5DX5 A;  5EIG A;  1B5O A;  2VMP A;  3MAF A;  4R5F A;  1G7X A;  3CQ6 A;  3BN1 A;  2R5C A;  3E77 A;  2EYQ A;  4XJL A;  4RLG A;  3K28 A;  4B98 A;  1AHY A;  1AAM A;  3GZD A;  1ELQ A;  3DR7 A;  1ASC A;  1MDO A;  1O62 A;  1AY4 A;  4ISY A;  1FG3 A;  4WB0 B;  4GE4 A;  2W8W A;  1UU1 A;  3ISL A;  1W7M A;  3DOD A;  2Q7W A;  1D7S A;  1M0P A;  3VK2 A;  3TQX A;  1AHX A;  1ART A;  1J32 A;  1ZC9 A;  2BI5 A;  2DGK A;  4WBT A;  3H14 A;  3FVS A;  4E1O A;  4F4E A;  1ASM A;  1LK9 A;  2ZY5 A;  1G4V A;  4ATQ A;  2DR1 A;  3ASB A;  1TOI A;  1CS1 A;  2VMV A;  4F5H A;  4AH3 A;  3N7N A;  1AHG A;  4EB5 A;  1SPA A;  1OHY A;  5G4J A;  1BJW A;  1TAR A;  3DXW A;  3EUC A;  3JTX A;  4IXZ A;  2QSR A;  1SF2 A;  3GET A;  4UQV A;  4XJP A;  2VGT A;  4L0O A;  2DKJ A;  5G09 A;  5KTB A;  2C44 A;  4PIW A;  1M6S A;  2BI9 A;  3FFR A;  2ZY4 A;  4TV7 A;  2O0R A;  3B1D A;  4IYO A;  1ORD A;  2ORD A;  1MAQ A;  3A2B A;  3WY7 A;  3N4R A;  3GR9 A;  3AEN A;  5EAV A;  3AAT A;  3VOM A;  1W3U A;  3E6G A;  1I29 A;  1YOO A;  1JG8 A;  3FD0 A;  3N4S A;  4N0B A;  1I48 A;  3RI6 A;  5M4B A;  4WYE A;  3WKR A;  4W1V A;  3HT4 A;  4U2H A;  4AO4 A;  3G0T A;  2KFP A;  5G2Q A;  1B9H A;  2Z9V A;  3PD6 B;  2RFV A;  1IX8 A;  3MC6 A;  1MDZ A;  1QJ5 A;  1G7W A;  1GC0 A;  1RV4 A;  2BYL A;  2V1P A;  1AJS B;  5EQC A;  4A0H A;  2W7F A;  1I43 A;  2CJD A;  1AJS A;  1N8P A;  2AY8 A;  4XJO A;  1D7R A;  1C0N A;  2GQN A;  5EIG B;  3AEN B;  2O7C A;  2BHX A;  1S0A A;  4ADB A;  2AY2 A;  4ITX A;  2HUU A;  2Z1Y A;  5EAA A;  4DQ6 A;  3B1E A;  4I8A A;  1S07 A;  3AEL A;  3FZ7 A;  3UAK A;  2AY6 A;  5F9S A;  3QBO A;  2AEV A;  2CH1 A;  3QM2 A;  4W5K A;  1M0N A;  2E7I A;  4A0G A;  2ZY2 A;  2QB2 A;  4WXF A;  1C7G A;  3AV7 A;  3WKS A;  2VI8 A;  4BMK A;  2EZ2 A;  3N5M A;  4ZLV A;  2GMS A;  2FYF A;  1QGN A;  2JGT A;  2VGZ A;  3UE8 A;  1ASA A;  1AHF A;  1CQ8 A;  1DGE A;  2CST A;  2QA3 A;  1IUG A;  4OTL A;  2QB3 A;  2HOX A;  4OBV A;  4UHO A;  4UHM A;  2PB2 A;  1ARG A;  4F5I A;  8AAT A;  2GMU A;  2X5D A;  3NRA A;  4WLJ A;  4ZSY A;  4MGR A;  1AIC A;  3MKJ A;  4ZWM A;  4Q31 A;  3DC1 A;  1GEX A;  2X8U A;  2W7I A;  1KKP A;  4ZDO A;  1B8G A;  1E5E A;  2VYC A;  2ZUK A;  2OAT A;  1D2F A;  1AJR A;  4F5G A;  2YOB A;  1I41 A;  1QJ3 A;  2Z67 A;  1GDE A;  4R8D A;  1GC4 A;  3IHJ A;  3ZRP A;  4CVQ A;  2HP1 A;  3NUI A;  3OP7 A;  2O1B A;  3CBF A;  1IX7 A;  3VP6 A;  4A6T A;  3D6K A;  4PVF A;  1AKB A;  4CBS A;  2HOZ A;  1U08 A;  1LW4 A;  2VI9 A;  1OHV A;  1GCK A;  3LWS A;  2HP2 A;  3BCB A;  1O4S A;  4J8L A;  2C81 A;  4A72 A;  5JAY A;  1QIS A;  2CY8 A;  3KE3 A;  3LVK A;  2W8J A;  2AY5 A;  4JE5 A;  1LW5 A;  2W7J A;  7AAT A;  1S08 A;  1YJS A;  2YCP A;  2Z20 A;  3TCM A;  5AX8 A;  3PJ0 A;  3JU7 A;  4O6Z A;  2VIB A;  3PIU A;  3ZZK A;  3FDD A;  1LKC A;  3FCR A;  3NX3 A;  1B9I A;  2HUI A;  4JEV A;  4U1T A;  1JS3 A;  4MQR A;  2ZJG A;  4LNM A;  2VGU A;  1V72 A;  3DR4 A;  3B1C A;  4RKC A;  3WZF A;  4MKJ A;  1CZE A;  4JF0 A;  2EZ1 A;  5C6U A;  2YHK A;  5E4Z A;  2VMU A;  3RCH A;  4CBR A;  1BQA A;  1AY5 A;  1GEW A;  3NUB A;  1UU0 A;  3F9T A;  2QBT A;  1OAT A;  1AX4 A;  1M32 A;  4J5U A;  2ZY3 A;  1VJO A;  4IY7 A;  3CQ5 A;  1S06 A;  1YJY A;  1BJ4 A;  4R5Z A;  3A9X A;  2PB0 A;  3ZRQ A;  2R0T A;  1JS6 A;  5DJ1 A;  3GJU A;  4OBU A;  4WB0 A;  2HUF A;  3JW9 A;  3QI6 A;  3KGW A;  2CAN A;  1DGD A;  1LC7 A;  3KGX A;  2YCT A;  3NU7 A;  1GC2 A;  2JJG A;  1OXO A;  3FKD A;  4ADD A;  4M2K A;  4OT8 A;  1C4K A;  4JEZ A;  2BIE A;  2FN6 A;  2WK7 A;  3HBX A;  2BI3 A;  4RIZ A;  3TAT A;  3EI6 A;  3WLX A;  5BJ3 A;  2CH2 A;  1N2T A;  3I4J A;  1TOG A;  1GBN A;  4MY5 A;  1CL1 A;  1ASF A;  1VEF A;  3RCH B;  2CTZ A;  3JWA A;  1C7N A;  1ASL A;  3WCO A;  3UWC A;  2DKB A;  1QZ9 A;  2C7T A;  4LC3 A;  1J04 A;  3N4X A;  3G7Q A;  2QLR A;  3A8U X;  3USF A;  3EZS A;  4JEY A;  4WYD A;  5EUE A;  2W7L A;  4ZAS A;  4AZK A;  3ACZ A;  3M5U A;  3LVM A;  3GZD C;  4KAM A;  4H51 A;  1MLY A;  2VMY A;  2Z1Z A;  1YNU A;  2VMT A;  3LG0 A;  4ZDP A;  3BC8 A;  3B8X A;  3EZ1 A;  1KMJ A;  3PA9 A;  2JJF A;  2JJH A;  3B46 A;  5DJ9 A;  2BI2 A;  1TAS A;  4GSA A;  4OMA A;  5F8V A;  4WYA A;  3GWP A;  4FFC A;  2Z9U A;  1BT4 A;  3W1J A;  3HMU A;  3W1I A;  1D7U A;  3QGU A;  1X0M A;  2AY4 A;  4RIT A;  3IF2 A;  5LH9 A;  2VMZ A;  4BHD A;  2W8V A;  3L8A A;  3QHX A;  2NMP A;  2VGW A;  4DBC A;  2VMO A;  1AIB A;  3AEP A;  3LVJ A;  1BKG A;  2W7D A;  2CJH A;  4IW7 A;  4LNL A;  1WKG A;  2VMQ A;  3E2Z B;  1WYV A;  3DYD A;  2G7J A;  2VMW A;  1M0Q A;  2QMA A;  2BIG A;  4NOG A;  1UKJ A;  3FVU A;  4XK1 A;  4ZDL A;  4GDY A;  5HXX A;  4H63 Q;  4OCA A;  1DJ9 A;  2VMN A;  2ZYJ A;  1AKA A;  3AEJ C;  4IXO A;  5BJ4 A;  2W8T A;  5EUN A;  3ASA A;  3BV0 A;  3Q8N A;  4A0R A;  3HLM A;  4MKK A;  1W23 A;  1SZK A;  1Z3Z A;  2W7G A;  5EUD A;  1P3W A;  1H1C A;  2JIS A;  2VMS A;  1OHW A;  4F5F A;  1GD9 A;  2VGV A;  3PGY A;  4K2I A;  1ARH A;  4OC9 A;  1RV3 A;  4ZM4 A;  2JG2 A;  4E3R A;  4W91 A;  2DGL A;  1CZC A;  3EI8 A;  4JF1 A;  2E7J A;  3WGB A;  3ZRR A;  4IXS A;  3RQ1 A;  3VAX A;  5M4D A;  4F5L A;  3PDX A;  1SVV A;  2R2N A;  1ASD A;  3RUY A;  1SZU A;  2Z9W A;  3N75 A;  3QPG A;  4XQ2 A;  2CFB A;  2WKA A;  4F5J A;  4JEX A;  1V2E A;  4WLH A;  3CQ4 A;  2V0Y A;  3AEJ A;  1WYU B;  4PFF A;  3FQ8 A;  1ECX A;  3W1H A;  2YKV A;  5FT4 A;  2YRR A;  2A1V A;  2Z9X A;  2BWO A;  1CJ0 A;  1VP4 A;  1G4X A;  4XJM A;  1YIZ A;  1AAW A;  1V2F A;  4UHN A;  4TN4 A;  3E2F A;  4W8I A;  3FTB A;  4Y0H A;  2DOU A;  2X5F A;  2DGM A;  5HHY A;  3DXV A;  1EQB A;  4W1W A;  1AHE A;  3H9X A;  2YCN A;  3FRK A;  1YJZ A;  4TMR A;  4CXQ A;  4LW2 A;  2AY9 A;  4BA4 A;  1IJI A;  1QIR A;  2GB3 A;  3FQ7 A;  1GC3 A;  3A9Y A;  3EI5 A;  1IVR A;  1Y4I A;  3ECD A;  1MLZ A;  1AMR A;  5G0A A;  1AKC A;  3AEO A;  3COG A;  4GE7 A;  2AY3 A;  1WYV B;  1ASB A;  1TPL A;  3F6T A;  2VGS A;  3JZL A;  2HZP A;  9AAT A;  3BCX A;  2R5C B;  1XEY A;  3NNK A;  4IX8 A;  4JE5 D;  2BI1 A;  2CJG A;  1RVY A;  1X29 A;  4HF8 A;  4B9B A;  4BQ0 A;  2YKU A;  3FSL A;  4P7Y A;  1ASE A;  2D5Y A;  2FKI A;  1V2D A;  1PMM A;  2FNI A;  5D95 A;  1DFO A;  4MQQ A;  4E3Q A;  4F5M A;  1WYT A;  3AEM A;  4N0W A;  4Q6R A;  2VIA A;  4DGT A;  5IWQ A;  2W7M A;  1FG7 A;  3EI7 A;  1AMA A;  4FL0 A;  1ARI A;  4ZSW A;  4F5K A;  3GBX A;  3DRD A;  2GSA A;  1KMK A;  3E9K A;  4ADC A;  2YKY A;  3I16 A;  1W7L A;  3NTJ A;  2HOY A;  3F0H A;  2CIN A;  3PPL A;  2WB6 A;  3NU8 A;  3QN6 A;  5E5I A;  2D61 A;  1M0O A;  1KAF A;  4WP0 A;  1AIA A;  2F8J A;  4LW4 A;  1PFF A;  3CAI A;  3BWO A;  3GSB A;  3AOV A;  4RKD A;  4A6R A;  2D7Y A;  3BB8 A;  3H7F A;  4ADE A;  1TAT A;  4MQP A;  4QGR A;  4E77 A;  4EMY A;  4Y0I A;  3FZ8 A;  1XI9 A;  4HVK A;  1Z7D A;  3EIB A;  3R4T A;  3LV2 A;  5K8B A;  3JWB A;  2EH6 A;  4CXR A;  2XH1 A;  1IBJ A;  3BS8 A;  3MAD A;  3TFU A;  4RAE A;  4MSO A;  2D64 A;  2VMR A;  2WK9 A;  3PAA A;  4XAU A;  3GZC A;  1E5F A;  4Y0D A;  3ELE A;  3E2Y A;  2PO3 A;  2EPJ A;  1PG8 A;  1WST A;  5HDM A;  1ASG A;  1UU2 A;  2C0R A;  5FT5 A;  3MEB A;  4K05 A;  5FT6 A;  1GEY A;  3L44 A;  1IAX A;  1SZS A;  2OGA A;  3K7Y A;  3MAF B;  5DB5 A;  1BQD A;  2E54 A;  2XBN A;  2YKX A;  3BWN A;  3T32 A;  4LNJ A;  2HOR A;  2BYJ A;  2BKW A;  2OKJ A;  3VK4 A;  4OYT A;  1M4N A;  2AAT A;  2FNU A;  4M2M A;  3E2Z A;  2AY7 A;  4JEW A;  3HL2 A;  1CQ7 A;  1DKA A;  4IYO B;  4AO9 A;  3AEM C;  1JF9 A;  1BW0 A;  3PDB A;  5EFS A;  1BJN A;  1AY8 A;  2OQX A;  3K40 A;  4GE9 A;  2BWN A;  4ATP A;  3TFT A;  1AMS A;  1WKH A;  4GEB A;  3WGC A;  1DJU A;  1CL2 A;  2R5E A;  3LVL B;  3NYU A;  1BJO B;  2AEU A;  4RM1 A;  3NYS A;  4K2B A;  5TF5 A;  2YRI A;  1SFF A;  5FT8 A;  3HVY A;  1KL2 A;  3FDB A;  4WYC A;  4KXK A;  3HDO A;  5J8Q A;  4RJY A;  5G2P A;  1H0C A;  2G6W A;  1T3I A;  2VLF A;  1CQ6 A;  4A6U A;  1C7O A;  3VK3 A;  1IAY A;  2W7H A;  2X3L A;  1QIT A;  3LY1 A;  1LC5 A;  4ITG A;  2CB1 A;  4WYG A;  1EG5 A;  3NYT A;  1ZOD A;  1KKJ A;  1WYU A;  4WYF A;  4Q75 A;  1ELU A;  3MAU A;  3P6K A;  5I92 A;  1YIY A;  4A00 A;  5G4I A; 
#chains in the Genus database with same CATH homology
 1LS3 A;  1C9C A;  1DJE A;  3DU4 A;  1M7Y A;  1BS0 A;  1RVU A;  3I5T A;  3RBL A;  4EU1 A;  4A0F A;  4M2J A;  2W7K A;  1TOK A;  1D7V A;  2FM1 A;  1B5P A;  2OGE A;  5M49 A;  2VMX A;  3A9Z A;  3RBF A;  1WYT B;  2D63 A;  2Z61 A;  1W7N A;  4Q76 A;  4AZJ A;  2D7Z A;  2FQ6 A;  2WK8 A;  3N0L A;  3II0 A;  2BWP A;  2ZSL A;  1ZOB A;  3R9A A;  1O61 A;  1S09 A;  2D66 A;  4WXB A;  4ZM3 A;  2D65 A;  3ATH A;  4WD2 A;  2EO5 A;  1KL1 A;  2ZP7 A;  4ZWV A;  1B4X A;  3WX9 A;  4WXG A;  3FZ6 A;  3WCN A;  2ZSM A;  3AOW A;  3FFH A;  1TOE A;  1MAP A;  3DZZ A;  3G8M A;  4EFF A;  2EGY A;  1YAA A;  3ELP A;  3FVX A;  5E3K A;  4RJ0 A;  5LHA A;  1MGV A;  3EI9 A;  3EIA A;  2TPL A;  1ARS A;  2E7U A;  2OKK A;  3BWN C;  2W8U A;  1IX6 A;  2JJE A;  3OKS A;  4KYO A;  4GRX A;  4UOY A;  1LC8 A;  3FQA A;  3MBB A;  2ZC0 A;  4K2M A;  4EB7 A;  1EJI A;  3KKI A;  4ZAH A;  3PDB B;  3ZZJ A;  4PFN A;  4R2N A;  3BCA A;  1AMQ A;  1FC4 A;  3PD6 A;  1X2A A;  4P3M A;  5M46 A;  2VLH A;  1O69 A;  2BIA A;  1ASN A;  1BJO A;  3NDN A;  1MDX A;  4W1X A;  1TOJ A;  4BA5 A;  1DTY A;  4XEW A;  2AY1 A;  4AOA A;  5D5S A;  1PMO A;  1OXP A;  3HQT A;  3P1T A;  1X28 A;  2W7E A;  3MC6 C;  1N31 A;  5DX5 A;  5EIG A;  1B5O A;  2VMP A;  3MAF A;  4R5F A;  1G7X A;  3CQ6 A;  3BN1 A;  2R5C A;  3E77 A;  2EYQ A;  4XJL A;  4RLG A;  3K28 A;  4B98 A;  1AHY A;  1AAM A;  3GZD A;  1ELQ A;  3DR7 A;  1ASC A;  1MDO A;  1O62 A;  1AY4 A;  4ISY A;  1FG3 A;  4WB0 B;  4GE4 A;  2W8W A;  1UU1 A;  3ISL A;  1W7M A;  3DOD A;  2Q7W A;  1D7S A;  1M0P A;  3VK2 A;  3TQX A;  1AHX A;  1ART A;  1J32 A;  1ZC9 A;  2BI5 A;  2DGK A;  4WBT A;  3H14 A;  3FVS A;  4E1O A;  4F4E A;  1ASM A;  1LK9 A;  2ZY5 A;  1G4V A;  4ATQ A;  2DR1 A;  3ASB A;  1TOI A;  1CS1 A;  2VMV A;  4F5H A;  4AH3 A;  3N7N A;  1AHG A;  4EB5 A;  1SPA A;  1OHY A;  5G4J A;  1BJW A;  1TAR A;  3DXW A;  3EUC A;  3JTX A;  4IXZ A;  2QSR A;  1SF2 A;  3GET A;  4UQV A;  4XJP A;  2VGT A;  4L0O A;  2DKJ A;  5G09 A;  5KTB A;  2C44 A;  4PIW A;  1M6S A;  2BI9 A;  3FFR A;  2ZY4 A;  4TV7 A;  2O0R A;  3B1D A;  4IYO A;  1ORD A;  2ORD A;  1MAQ A;  3A2B A;  3WY7 A;  3N4R A;  3GR9 A;  3AEN A;  5EAV A;  3AAT A;  3VOM A;  1W3U A;  3E6G A;  1I29 A;  1YOO A;  1JG8 A;  3FD0 A;  3N4S A;  4N0B A;  1I48 A;  3RI6 A;  5M4B A;  4WYE A;  3WKR A;  4W1V A;  3HT4 A;  4U2H A;  4AO4 A;  3G0T A;  2KFP A;  5G2Q A;  1B9H A;  2Z9V A;  3PD6 B;  2RFV A;  1IX8 A;  3MC6 A;  1MDZ A;  1QJ5 A;  1G7W A;  1GC0 A;  1RV4 A;  2BYL A;  2V1P A;  1AJS B;  5EQC A;  4A0H A;  2W7F A;  1I43 A;  2CJD A;  1AJS A;  1N8P A;  2AY8 A;  4XJO A;  1D7R A;  1C0N A;  2GQN A;  5EIG B;  3AEN B;  2O7C A;  2BHX A;  1S0A A;  4ADB A;  2AY2 A;  4ITX A;  2HUU A;  2Z1Y A;  5EAA A;  4DQ6 A;  3B1E A;  4I8A A;  1S07 A;  3AEL A;  3FZ7 A;  3UAK A;  2AY6 A;  5F9S A;  3QBO A;  2AEV A;  2CH1 A;  3QM2 A;  4W5K A;  1M0N A;  2E7I A;  4A0G A;  2ZY2 A;  2QB2 A;  4WXF A;  1C7G A;  3AV7 A;  3WKS A;  2VI8 A;  4BMK A;  2EZ2 A;  3N5M A;  4ZLV A;  2GMS A;  2FYF A;  1QGN A;  2JGT A;  2VGZ A;  3UE8 A;  1ASA A;  1AHF A;  1CQ8 A;  1DGE A;  2CST A;  2QA3 A;  1IUG A;  4OTL A;  2QB3 A;  2HOX A;  4OBV A;  4UHO A;  4UHM A;  2PB2 A;  1ARG A;  4F5I A;  8AAT A;  2GMU A;  2X5D A;  3NRA A;  4WLJ A;  4ZSY A;  4MGR A;  1AIC A;  3MKJ A;  4ZWM A;  4Q31 A;  3DC1 A;  1GEX A;  2X8U A;  2W7I A;  1KKP A;  4ZDO A;  1B8G A;  1E5E A;  2VYC A;  2ZUK A;  2OAT A;  1D2F A;  1AJR A;  4F5G A;  2YOB A;  1I41 A;  1QJ3 A;  2Z67 A;  1GDE A;  4R8D A;  1GC4 A;  3IHJ A;  3ZRP A;  4CVQ A;  2HP1 A;  3NUI A;  3OP7 A;  2O1B A;  3CBF A;  1IX7 A;  3VP6 A;  4A6T A;  3D6K A;  4PVF A;  1AKB A;  4CBS A;  2HOZ A;  1U08 A;  1LW4 A;  2VI9 A;  1OHV A;  1GCK A;  3LWS A;  2HP2 A;  3BCB A;  1O4S A;  4J8L A;  2C81 A;  4A72 A;  5JAY A;  1QIS A;  2CY8 A;  3KE3 A;  3LVK A;  2W8J A;  2AY5 A;  4JE5 A;  1LW5 A;  2W7J A;  7AAT A;  1S08 A;  1YJS A;  2YCP A;  2Z20 A;  3TCM A;  5AX8 A;  3PJ0 A;  3JU7 A;  4O6Z A;  2VIB A;  3PIU A;  3ZZK A;  3FDD A;  1LKC A;  3FCR A;  3NX3 A;  1B9I A;  2HUI A;  4JEV A;  4U1T A;  1JS3 A;  4MQR A;  2ZJG A;  4LNM A;  2VGU A;  1V72 A;  3DR4 A;  3B1C A;  4RKC A;  3WZF A;  4MKJ A;  1CZE A;  4JF0 A;  2EZ1 A;  5C6U A;  2YHK A;  5E4Z A;  2VMU A;  3RCH A;  4CBR A;  1BQA A;  1AY5 A;  1GEW A;  3NUB A;  1UU0 A;  3F9T A;  2QBT A;  1OAT A;  1AX4 A;  1M32 A;  4J5U A;  2ZY3 A;  1VJO A;  4IY7 A;  3CQ5 A;  1S06 A;  1YJY A;  1BJ4 A;  4R5Z A;  3A9X A;  2PB0 A;  3ZRQ A;  2R0T A;  1JS6 A;  5DJ1 A;  3GJU A;  4OBU A;  4WB0 A;  2HUF A;  3JW9 A;  3QI6 A;  3KGW A;  2CAN A;  1DGD A;  1LC7 A;  3KGX A;  2YCT A;  3NU7 A;  1GC2 A;  2JJG A;  1OXO A;  3FKD A;  4ADD A;  4M2K A;  4OT8 A;  1C4K A;  4JEZ A;  2BIE A;  2FN6 A;  2WK7 A;  3HBX A;  2BI3 A;  4RIZ A;  3TAT A;  3EI6 A;  3WLX A;  5BJ3 A;  2CH2 A;  1N2T A;  3I4J A;  1TOG A;  1GBN A;  4MY5 A;  1CL1 A;  1ASF A;  1VEF A;  3RCH B;  2CTZ A;  3JWA A;  1C7N A;  1ASL A;  3WCO A;  3UWC A;  2DKB A;  1QZ9 A;  2C7T A;  4LC3 A;  1J04 A;  3N4X A;  3G7Q A;  2QLR A;  3A8U X;  3USF A;  3EZS A;  4JEY A;  4WYD A;  5EUE A;  2W7L A;  4ZAS A;  4AZK A;  3ACZ A;  3M5U A;  3LVM A;  3GZD C;  4KAM A;  4H51 A;  1MLY A;  2VMY A;  2Z1Z A;  1YNU A;  2VMT A;  3LG0 A;  4ZDP A;  3BC8 A;  3B8X A;  3EZ1 A;  1KMJ A;  3PA9 A;  2JJF A;  2JJH A;  3B46 A;  5DJ9 A;  2BI2 A;  1TAS A;  4GSA A;  4OMA A;  5F8V A;  4WYA A;  3GWP A;  4FFC A;  2Z9U A;  1BT4 A;  3W1J A;  3HMU A;  3W1I A;  1D7U A;  3QGU A;  1X0M A;  2AY4 A;  4RIT A;  3IF2 A;  5LH9 A;  2VMZ A;  4BHD A;  2W8V A;  3L8A A;  3QHX A;  2NMP A;  2VGW A;  4DBC A;  2VMO A;  1AIB A;  3AEP A;  3LVJ A;  1BKG A;  2W7D A;  2CJH A;  4IW7 A;  4LNL A;  1WKG A;  2VMQ A;  3E2Z B;  1WYV A;  3DYD A;  2G7J A;  2VMW A;  1M0Q A;  2QMA A;  2BIG A;  4NOG A;  1UKJ A;  3FVU A;  4XK1 A;  4ZDL A;  4GDY A;  5HXX A;  4H63 Q;  4OCA A;  1DJ9 A;  2VMN A;  2ZYJ A;  1AKA A;  3AEJ C;  4IXO A;  5BJ4 A;  2W8T A;  5EUN A;  3ASA A;  3BV0 A;  3Q8N A;  4A0R A;  3HLM A;  4MKK A;  1W23 A;  1SZK A;  1Z3Z A;  2W7G A;  5EUD A;  1P3W A;  1H1C A;  2JIS A;  2VMS A;  1OHW A;  4F5F A;  1GD9 A;  2VGV A;  3PGY A;  4K2I A;  1ARH A;  4OC9 A;  1RV3 A;  4ZM4 A;  2JG2 A;  4E3R A;  4W91 A;  2DGL A;  1CZC A;  3EI8 A;  4JF1 A;  2E7J A;  3WGB A;  3ZRR A;  4IXS A;  3RQ1 A;  3VAX A;  5M4D A;  4F5L A;  3PDX A;  1SVV A;  2R2N A;  1ASD A;  3RUY A;  1SZU A;  2Z9W A;  3N75 A;  3QPG A;  4XQ2 A;  2CFB A;  2WKA A;  4F5J A;  4JEX A;  1V2E A;  4WLH A;  3CQ4 A;  2V0Y A;  3AEJ A;  1WYU B;  4PFF A;  3FQ8 A;  1ECX A;  3W1H A;  2YKV A;  5FT4 A;  2YRR A;  2A1V A;  2Z9X A;  2BWO A;  1CJ0 A;  1VP4 A;  1G4X A;  4XJM A;  1YIZ A;  1AAW A;  1V2F A;  4UHN A;  4TN4 A;  3E2F A;  4W8I A;  3FTB A;  4Y0H A;  2DOU A;  2X5F A;  2DGM A;  5HHY A;  3DXV A;  1EQB A;  4W1W A;  1AHE A;  3H9X A;  2YCN A;  3FRK A;  1YJZ A;  4TMR A;  4CXQ A;  4LW2 A;  2AY9 A;  4BA4 A;  1IJI A;  1QIR A;  2GB3 A;  3FQ7 A;  1GC3 A;  3A9Y A;  3EI5 A;  1IVR A;  1Y4I A;  3ECD A;  1MLZ A;  1AMR A;  5G0A A;  1AKC A;  3AEO A;  3COG A;  4GE7 A;  2AY3 A;  1WYV B;  1ASB A;  1TPL A;  3F6T A;  2VGS A;  3JZL A;  2HZP A;  9AAT A;  3BCX A;  2R5C B;  1XEY A;  3NNK A;  4IX8 A;  4JE5 D;  2BI1 A;  2CJG A;  1RVY A;  1X29 A;  4HF8 A;  4B9B A;  4BQ0 A;  2YKU A;  3FSL A;  4P7Y A;  1ASE A;  2D5Y A;  2FKI A;  1V2D A;  1PMM A;  2FNI A;  5D95 A;  1DFO A;  4MQQ A;  4E3Q A;  4F5M A;  1WYT A;  3AEM A;  4N0W A;  4Q6R A;  2VIA A;  4DGT A;  5IWQ A;  2W7M A;  1FG7 A;  3EI7 A;  1AMA A;  4FL0 A;  1ARI A;  4ZSW A;  4F5K A;  3GBX A;  3DRD A;  2GSA A;  1KMK A;  3E9K A;  4ADC A;  2YKY A;  3I16 A;  1W7L A;  3NTJ A;  2HOY A;  3F0H A;  2CIN A;  3PPL A;  2WB6 A;  3NU8 A;  3QN6 A;  5E5I A;  2D61 A;  1M0O A;  4WP0 A;  1AIA A;  2F8J A;  4LW4 A;  1PFF A;  3CAI A;  3BWO A;  3GSB A;  3AOV A;  4RKD A;  4A6R A;  2D7Y A;  3BB8 A;  3H7F A;  4ADE A;  1TAT A;  4MQP A;  4QGR A;  4E77 A;  4EMY A;  4Y0I A;  3FZ8 A;  1XI9 A;  4HVK A;  1Z7D A;  3EIB A;  3R4T A;  3LV2 A;  5K8B A;  3JWB A;  2EH6 A;  4CXR A;  2XH1 A;  1IBJ A;  3BS8 A;  3MAD A;  3TFU A;  4RAE A;  4MSO A;  2D64 A;  2VMR A;  2WK9 A;  3PAA A;  4XAU A;  3GZC A;  1E5F A;  4Y0D A;  3ELE A;  3E2Y A;  2PO3 A;  2EPJ A;  1PG8 A;  1WST A;  5HDM A;  1ASG A;  1UU2 A;  2C0R A;  5FT5 A;  3MEB A;  4K05 A;  5FT6 A;  1GEY A;  3L44 A;  1IAX A;  1SZS A;  2OGA A;  3K7Y A;  3MAF B;  5DB5 A;  1BQD A;  2E54 A;  2XBN A;  2YKX A;  3BWN A;  3T32 A;  4LNJ A;  2HOR A;  2BYJ A;  2BKW A;  2OKJ A;  3VK4 A;  4OYT A;  1M4N A;  2AAT A;  2FNU A;  4M2M A;  3E2Z A;  2AY7 A;  4JEW A;  3HL2 A;  1CQ7 A;  1DKA A;  4IYO B;  4AO9 A;  3AEM C;  1JF9 A;  1BW0 A;  3PDB A;  5EFS A;  1BJN A;  1AY8 A;  2OQX A;  3K40 A;  4GE9 A;  2BWN A;  4ATP A;  3TFT A;  1AMS A;  1WKH A;  4GEB A;  3WGC A;  1DJU A;  1CL2 A;  2R5E A;  3LVL B;  3NYU A;  1BJO B;  2AEU A;  4RM1 A;  3NYS A;  4K2B A;  5TF5 A;  2YRI A;  1SFF A;  5FT8 A;  3HVY A;  1KL2 A;  3FDB A;  4WYC A;  4KXK A;  3HDO A;  5J8Q A;  4RJY A;  5G2P A;  1H0C A;  2G6W A;  1T3I A;  2VLF A;  1CQ6 A;  4A6U A;  1C7O A;  3VK3 A;  1IAY A;  2W7H A;  2X3L A;  1QIT A;  3LY1 A;  1LC5 A;  4ITG A;  2CB1 A;  4WYG A;  1EG5 A;  3NYT A;  1ZOD A;  1KKJ A;  1WYU A;  4WYF A;  4Q75 A;  1ELU A;  3MAU A;  3P6K A;  5I92 A;  1YIY A;  4A00 A;  5G4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...