1AY8A

Aromatic amino acid aminotransferase complex with 3-phenylpropionate
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
394
structure length
394
Chain Sequence
MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINO ACID AMINOTRANSFERASE
publication title Crystal structures of Paracoccus denitrificans aromatic amino acid aminotransferase: a substrate recognition site constructed by rearrangement of hydrogen bond network.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transferase
total genus 145
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 1997-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ay8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ay8A01
1ARSA 2C81A 3ASBA 3B8XA 2FNUA 4RJYA 3E2YA 4KAMA 4W91A 4DGTA 1B5PA 2Z9UA 3DC1A 4F5FA 1GEWA 1D7VA 2X3LA 2W7KA 2VIAA 4MSOA 4CXRA 1BJ4A 5HDMA 3GZDA 1CZEA 4CXQA 2DGLA 2YCPA 1MDXA 4NOGA 1ASCA 2VGVA 1W7NA 3NYTA 2YKYA 3GBXA 2BI1A 5EFSA 2PB0A 1LW5A 3PGYA 4PFNA 4JF0A 1V72A 4TN4A 4ADEA 3EI6A 3A9ZA 4A6RA 1SZKA 1OXPA 3NDNA 1H0CA 2D7ZA 2YCTA 3TFTA 1CJ0A 1WYVB 1WYUB 2CJDA 4ITGA 2BWOA 3WGCA 2VMWA 3GR9A 4L0OA 1IX6A 4R5FA 4WBTA 3AELA 2HUFA 5BJ3A 4RIZA 4F5MA 1IUGA 1I29A 1XEYA 1OHVA 2YRIA 4IYOB 2ZY3A 3PIUA 1J32A 2WK7A 2VMPA 2VMYA 3EIBA 3R9AA 2VLFA 2QMAA 3NU8A 1VJOA 1M6SA 3BCAA 2GB3A 2VMUA 1C7GA 4BA5A 2W8JA 4AO9A 4JEXA 3FVSA 2R5CB 3AEJC 1DGDA 3KGWA 4ADBA 1WKGA 2QA3A 3FFRA 3PDXA 5FT6A 3RBLA 5DB5A 2O0RA 2BI5A 3FSLA 4WD2A 4ATQA 3BV0A 5IWQA 1KMKA 4XEWA 3NU7A 4GE7A 2YKXA 4LNJA 1ARGA 1QJ3A 4EB5A 4IX8A 4CBSA 4ZWVA 2HOZA 4JEYA 3MBBA 1ARHA 3FFHA 3Q8NA 1CZCA 3R4TA 1W23A 4WYEA 1S0AA 1B9HA 1DJUA 1BJOB 3N5MA 4QGRA 5M4BA 2ZYJA 1OHWA 3DU4A 1ASAA 1YAAA 2VMSA 1AJSA 3II0A 1TOJA 2W8UA 3P1TA 3K7YA 1SFFA 2O1BA 3PDBA 4GSAA 5G2PA 3ZRRA 2VMZA 2ZP7A 2CINA 1O4SA 4UHMA 3FQ8A 1TOIA 4RITA 1AMSA 1X29A 3WCNA 1WYTA 4M2KA 3ELPA 1BQAA 2ZUKA 4F5HA 2E7UA 2ZJGA 4AZKA 2CJGA 2CY8A 1GEXA 4F4EA 2HZPA 2V0YA 1DFOA 1GC3A 2X8UA 3ECDA 3FVXA 3FZ7A 4W1VA 4Y0HA 5EQCA 1TOGA 1IX7A 1YNUA 3FZ8A 4EU1A 1FC4A 3FRKA 1G7WA 3E77A 3QHXA 3NRAA 2BIGA 3I5TA 3NTJA 1CQ8A 3F0HA 2HUUA 2Z1YA 3A8UX 3N75A 1YJYA 1AX4A 4JE5D 4A6UA 4ZASA 2GMUA 5AX8A 4ADCA 2ZC0A 4J8LA 2BIEA 1WYUA 1WYVA 1I43A 1S07A 1VP4A 2Z9XA 3BN1A 2AEUA 2G6WA 4FFCA 4IW7A 3VK3A 3TATA 3FDBA 2YHKA 1AHXA 1AKCA 4ZSYA 1VEFA 2D5YA 4IYOA 2EZ1A 4W8IA 3HDOA 3EI8A 4F5IA 3WY7A 3PA9A 3QI6A 2ORDA 4Q76A 1ASEA 4F5JA 4ZDOA 2GMSA 1UU1A 3BC8A 3LY1A 1SZSA 2OGAA 3BWNC 5G0AA 1OATA 3HLMA 2R5CA 1RVYA 2QBTA 1M4NA 1YIYA 4LW2A 3RUYA 1AMRA 4JE5A 1WKHA 1JS3A 2W8WA 1GC4A 3A9YA 2BIAA 4Q31A 3AENB 2Z1ZA 5EAAA 5G09A 1EQBA 1AAWA 1I48A 2DR1A 3CBFA 4HF8A 4JEVA 4A0GA 4A6TA 4ZAHA 2W7MA 2W8VA 3AOWA 4K2BA 5E3KA 3EZ1A 2YRRA 5EUNA 4U1TA 5JAYA 1IJIA 1BJOA 3MC6C 4EB7A 3FVUA 3QN6A 5EUDA 4P3MA 2D61A 3DXVA 3K28A 1C7OA 4N0BA 2VGSA 3MADA 1FG3A 2X5DA 2WK9A 4KXKA 3MAFB 1E5FA 4ZSWA 1JG8A 2DGMA 2FYFA 1IAYA 1PMOA 1AIBA 1QITA 3H7FA 1BS0A 1E5EA 2C44A 1ELQA 3P6KA 4MKKA 2OKKA 3LWSA 1MDOA 4ZM3A 1JF9A 3ACZA 3MEBA 3JWAA 4OBUA 3FQ7A 5E4ZA 1TATA 1AJRA 1DJ9A 3DZZA 2EO5A 5HXXA 1EJIA 3M5UA 3G8MA 3B46A 4AZJA 4J5UA 4R2NA 3DR7A 2C0RA 4MY5A 3NYSA 3G0TA 1XI9A 3FQAA 2VGZA 1ASGA 1GD9A 3EI7A 4GEBA 5EIGB 4MQPA 4IXZA 1ASBA 1ASFA 3WLXA 2YCNA 1YIZA 4LNMA 1AKBA 1MDZA 2AY9A 2E7IA 1N31A 5G2QA 4W1WA 4ZDPA 1V2EA 1QZ9A 2DKJA 3LVLB 3TCMA 2R0TA 1MLYA 3B1CA 3JTXA 1BT4A 2HORA 4UHOA 3QPGA 3LVMA 2JJHA 3KE3A 5DJ9A 4A0HA 2Z9WA 9AATA 2BKWA 1H1CA 2D66A 1C9CA 4XJMA 2EPJA 1W3UA 3D6KA 2HP1A 3BCXA 3AEMC 5EUEA 3ISLA 1SVVA 1OHYA 2W7IA 2Z9VA 1M7YA 2TPLA 3JWBA 1KKJA 2YKVA 4RLGA 4F5KA 1ARIA 2CH2A 4PFFA 2QB3A 2DKBA 1C0NA 3E2ZB 1RV4A 2HUIA 1GEYA 4F5LA 1M0OA 3AEJA 3HT4A 2VMOA 1Z3ZA 3PD6B 4WYCA 4WXBA 3AENA 1ASDA 3RI6A 3UE8A 3WKRA 5G4JA 3K40A 3WCOA 3W1HA 1G7XA 3E2FA 4R5ZA 2VMVA 3DYDA 1ASNA 2VGTA 3EI5A 3EIAA 1UU0A 3ASAA 2VLHA 3KGXA 5M46A 2ZY4A 4WXFA 1AMQA 3JZLA 2Z67A 4FL0A 2JISA 4ATPA 4LC3A 4A0RA 3IHJA 5BJ4A 1AY4A 3MAFA 4WB0B 1AKAA 4I8AA 4CVQA 4AO4A 3JW9A 2OGEA 1PMMA 3VK2A 4UQVA 2VGWA 4XK1A 5C6UA 3A2BA 4RKDA 4IXSA 4DQ6A 4ZDLA 2O7CA 3N0LA 1UU2A 3ELEA 3VAXA 1IX8A 1M0PA 1M0QA 2W7DA 1N8PA 1CQ7A 1YOOA 4JEWA 4LW4A 1W7MA 2CB1A 1MGVA 1S06A 1MAPA 2JJFA 4RKCA 1TOKA 4ISYA 4O6ZA 5LHAA 1ARTA 4A72A 1RV3A 4WXGA 5EIGA 2WKAA 3GJUA 1D7SA 3MAUA 4IXOA 3ZRQA 3T32A 3RBFA 1DTYA 3VP6A 1ASMA 2BI2A 3BS8A 4H51A 5EAVA 1LKCA 4E77A 4P7YA 1AHGA 1B5OA 1WSTA 1Y4IA 4Q6RA 2Q7WA 3FCRA 2YOBA 3GZDC 1CS1A 4JF1A 5E5IA 4WYDA 2XH1A 1C4KA 4OT8A 4BQ0A 3MKJA 2X5FA 2EGYA 3WKSA 1I41A 1ZODA 2AATA 3DODA 3NNKA 2BI3A 5TF5A 5G4IA 4Y0IA 1X2AA 2VYCA 3COGA 1O61A 3HQTA 3RCHB 1O69A 4XJPA 3UWCA 3BWOA 2BI9A 1G4VA 4M2MA 3W1IA 4Y0DA 2QLRA 1IVRA 3AATA 3NYUA 3AEPA 4XJLA 3USFA 2ZSLA 1M32A 3ZZJA 3PPLA 3QBOA 4WYFA 4XAUA 2F8JA 2BHXA 2NMPA 1M0NA 1OXOA 3BWNA 1D2FA 1IBJA 3E2ZA 1KMJA 4RAEA 4DBCA 3PD6A 3EI9A 4HVKA 3HMUA 3VK4A 1YJSA 3FKDA 2QB2A 4TMRA 2AY4A 4WYAA 2EH6A 2HP2A 1AICA 4CBRA 2FM1A 1DJEA 1AHYA 2AY6A 1ASLA 2HOYA 2R5EA 4UOYA 3H14A 1RVUA 1S08A 3OKSA 4GRXA 4GDYA 4UHNA 1AIAA 2ZSMA 1AMAA 3E6GA 3QM2A 1QIRA 1ELUA 1GCKA 3EUCA 5J8QA 1QJ5A 3NUIA 3LVJA 2VIBA 4U2HA 2AY1A 3FZ6A 4RJ0A 4XQ2A 2W8TA 3MC6A 4ITXA 2VMRA 3WGBA 4AOAA 3FD0A 4WB0A 1V2DA 2CJHA 4ZM4A 2C7TA 3QGUA 1QGNA 1BJWA 2WK8A 4GE9A 1BKGA 2VMTA 2AEVA 1J04A 4AH3A 3VOMA 2RFVA 2OKJA 2PB2A 2VI8A 3ATHA 1LC7A 1C7NA 1DGEA 3CQ5A 4W5KA 2AY5A 1LC8A 3BB8A 1PFFA 2CANA 4A0FA 2FQ6A 4A00A 2ZY2A 1AHEA 1KL2A 4K2IA 3WX9A 3I16A 1CL2A 2EZ2A 3W1JA 2VMQA 4BA4A 1MLZA 1GC0A 1O62A 5DJ1A 4KYOA 1AY8A 4BMKA 2AY8A 1QISA 2AY7A 4F5GA 3HL2A 3EZSA 3GSBA 1AY5A 1SZUA 3ZRPA 2OQXA 1FG7A 1UKJA 1JS6A 4WYGA 1YJZA 1SPAA 1ZOBA 2FN6A 2XBNA 4LNLA 5FT5A 4ADDA 2D64A 4M2JA 1TASA 2JJEA 4WLJA 2HOXA 2ZY5A 1TPLA 1GDEA 5D5SA 5M49A 4WP0A 2YKUA 1AHFA 2W7LA 3PJ0A 2BYLA 3GWPA 4R8DA 4N0WA 2GSAA 1D7UA 1Z7DA 2VGUA 3KKIA 4XJOA 5I92A 4PVFA 2V1PA 3OP7A 4PIWA 2R2NA 3RCHA 1V2FA 1BW0A 4Q75A 4OCAA 3A9XA 4EMYA 2D63A 1B8GA 4B9BA 1TARA 4MGRA 5HHYA 2DOUA 3AEMA 3BCBA 2BYJA 4MKJA 2W7HA 5DX5A 5F9SA 2CTZA 1DKAA 2AY2A 3LV2A 1D7RA 2BWPA 1U08A 3DRDA 5M4DA 3NUBA 1BQDA 1LC5A 1X0MA 4EFFA 1SF2A 2VI9A 4TV7A 3NX3A 4K2MA 3TFUA 7AATA 4W1XA 3IF2A 1MAQA 2W7JA 3PAAA 1AAMA 1EG5A 4E1OA 1PG8A 1B9IA 1GBNA 3TQXA 1LK9A 2JJGA 1B4XA 2D7YA 4MQQA 1W7LA 2JGTA 1G4XA 1CL1A 3E9KA 2FNIA 1LS3A 2W7EA 4E3QA 5FT4A 4ZLVA 5K8BA 3CQ4A 8AATA 2CFBA 3AV7A 5FT8A 3WZFA 4B98A 1T3IA 2OATA 2JG2A 3GZCA 3HBXA 1CQ6A 3L8AA 4OTLA 3RQ1A 1TOEA 3B1DA 4IY7A 3DR4A 2D65A 3L44A 3AOVA 3F6TA 5D95A 3LVKA 3CQ6A 2W7GA 2W7FA 4E3RA 1BJNA 3JU7A 1N2TA 1ORDA 4JEZA 4BHDA 2AY3A 2CSTA 3GETA 4RM1A 5F8VA 2E7JA 2VMNA 1KL1A 3LG0A 3AEOA 2DGKA 5LH9A 3CAIA 1P3WA 2CH1A 3B1EA 1AJSB 4OYTA 1ZC9A 2BWNA 2E54A 4GE4A 4OMAA 2PO3A 1KKPA 2Z61A 3I4JA 3PDBB 4WLHA 4MQRA 3G7QA 1LW4A 4OC9A 4OBVA 3ZZKA 4ZWMA 3FDDA 1GC2A 2Z20A 3FTBA 1IAXA 1S09A 1ECXA 2VMXA 2GQNA 1WYTB 3DXWA 3HVYA 3F9TA 1X28A 3UAKA
chains in the Genus database with same CATH superfamily
1ARSA 2C81A 3ASBA 3B8XA 2FNUA 4RJYA 3E2YA 4KAMA 4W91A 4DGTA 1B5PA 2Z9UA 3DC1A 4F5FA 1GEWA 1D7VA 2X3LA 2W7KA 2VIAA 4MSOA 4CXRA 1BJ4A 5HDMA 3GZDA 1CZEA 4CXQA 2DGLA 2YCPA 4H63Q 1MDXA 4NOGA 1ASCA 2VGVA 1W7NA 3NYTA 2YKYA 3GBXA 2BI1A 5EFSA 2PB0A 1LW5A 3PGYA 4PFNA 4JF0A 1V72A 4TN4A 4ADEA 3EI6A 3A9ZA 4A6RA 1SZKA 1OXPA 3NDNA 1H0CA 2D7ZA 2YCTA 3TFTA 1CJ0A 1WYVB 1WYUB 2CJDA 4ITGA 3N4SA 2BWOA 3WGCA 2VMWA 3GR9A 4L0OA 1IX6A 4R5FA 4WBTA 3AELA 2HUFA 5BJ3A 4RIZA 4F5MA 1IUGA 1I29A 1XEYA 1OHVA 2YRIA 4IYOB 2ZY3A 3PIUA 1J32A 2WK7A 2VMPA 2VMYA 3EIBA 3R9AA 2VLFA 2QMAA 3NU8A 1VJOA 1M6SA 3BCAA 2GB3A 2VMUA 1C7GA 4BA5A 2EYQA 2W8JA 4AO9A 4JEXA 3FVSA 2R5CB 3AEJC 1DGDA 3KGWA 4ADBA 1WKGA 2QA3A 3FFRA 3PDXA 5FT6A 3RBLA 5DB5A 2O0RA 2BI5A 3FSLA 4WD2A 4ATQA 3BV0A 5IWQA 1KMKA 4XEWA 3NU7A 4GE7A 2YKXA 4LNJA 1ARGA 1QJ3A 4EB5A 4IX8A 4CBSA 4ZWVA 2HOZA 4JEYA 3MBBA 1ARHA 3FFHA 3Q8NA 1CZCA 3R4TA 1W23A 4WYEA 1S0AA 1B9HA 1DJUA 1BJOB 3N5MA 4QGRA 5M4BA 2ZYJA 1OHWA 2G7JA 3DU4A 1ASAA 1YAAA 2VMSA 1AJSA 3II0A 1TOJA 2W8UA 3P1TA 3K7YA 1SFFA 2O1BA 3PDBA 4GSAA 5G2PA 3ZRRA 2VMZA 2ZP7A 2CINA 1O4SA 4UHMA 3FQ8A 1TOIA 4RITA 1AMSA 1X29A 3WCNA 1WYTA 4M2KA 3ELPA 1BQAA 2ZUKA 4F5HA 2E7UA 2ZJGA 4AZKA 2CJGA 2CY8A 1GEXA 4F4EA 2HZPA 2V0YA 1DFOA 1GC3A 2X8UA 3ECDA 3FVXA 3FZ7A 4W1VA 4Y0HA 5EQCA 2WB6A 1TOGA 1IX7A 1YNUA 3FZ8A 4EU1A 1FC4A 3FRKA 1G7WA 3E77A 3QHXA 3NRAA 2BIGA 3I5TA 3NTJA 1CQ8A 3F0HA 2HUUA 2Z1YA 3A8UX 3N75A 2KFPA 1YJYA 1AX4A 4JE5D 4A6UA 4ZASA 2GMUA 5AX8A 4ADCA 2ZC0A 4J8LA 2BIEA 1WYUA 1WYVA 1I43A 1S07A 1VP4A 2Z9XA 3BN1A 2AEUA 2G6WA 4FFCA 4IW7A 3VK3A 3TATA 3FDBA 2YHKA 1AHXA 1AKCA 4ZSYA 1VEFA 2D5YA 4IYOA 2EZ1A 4W8IA 3HDOA 3EI8A 4F5IA 3WY7A 3PA9A 3QI6A 2ORDA 4Q76A 1ASEA 4F5JA 4ZDOA 2GMSA 1UU1A 3BC8A 3LY1A 1SZSA 2OGAA 3BWNC 5G0AA 1OATA 3HLMA 2R5CA 1RVYA 2QBTA 1M4NA 1YIYA 4LW2A 3RUYA 1AMRA 4JE5A 1WKHA 1JS3A 2W8WA 1GC4A 3A9YA 2BIAA 4Q31A 3AENB 2Z1ZA 5EAAA 5G09A 1EQBA 1AAWA 1I48A 2DR1A 3CBFA 4HF8A 4JEVA 4A0GA 4A6TA 4ZAHA 2W7MA 2W8VA 3AOWA 4K2BA 5E3KA 3EZ1A 2YRRA 5EUNA 4U1TA 5JAYA 1IJIA 1BJOA 3MC6C 4EB7A 3FVUA 3QN6A 5EUDA 4P3MA 2D61A 3DXVA 3K28A 1C7OA 4N0BA 2VGSA 3MADA 1FG3A 2X5DA 2WK9A 4KXKA 3MAFB 1E5FA 4ZSWA 1JG8A 2DGMA 2FYFA 1IAYA 1PMOA 1AIBA 1QITA 3H7FA 1BS0A 1E5EA 2C44A 1ELQA 3P6KA 4MKKA 2OKKA 3LWSA 1MDOA 4ZM3A 1JF9A 3ACZA 3MEBA 3JWAA 4OBUA 3FQ7A 5E4ZA 1TATA 1AJRA 1DJ9A 3DZZA 2EO5A 5HXXA 1EJIA 3M5UA 3G8MA 3B46A 4AZJA 4J5UA 4R2NA 3DR7A 2C0RA 4MY5A 3NYSA 3G0TA 1XI9A 3FQAA 2VGZA 1ASGA 1GD9A 3EI7A 4GEBA 5EIGB 4MQPA 4IXZA 1ASBA 1ASFA 3WLXA 2YCNA 1YIZA 4LNMA 1AKBA 1MDZA 2AY9A 2E7IA 1N31A 5G2QA 4W1WA 4ZDPA 1V2EA 1QZ9A 2DKJA 3LVLB 3N4XA 3TCMA 2R0TA 1MLYA 3B1CA 3JTXA 1BT4A 2HORA 4UHOA 3QPGA 2FKIA 3LVMA 2JJHA 3KE3A 5DJ9A 4A0HA 2Z9WA 9AATA 2BKWA 1H1CA 2D66A 1C9CA 4XJMA 2EPJA 1W3UA 3D6KA 2HP1A 3BCXA 3AEMC 5EUEA 3H9XA 3ISLA 1SVVA 1OHYA 2W7IA 2Z9VA 1M7YA 2TPLA 3JWBA 1KKJA 2YKVA 4RLGA 4F5KA 1ARIA 3N4RA 2CH2A 4PFFA 2QB3A 2DKBA 1C0NA 3E2ZB 1RV4A 2HUIA 1GEYA 4F5LA 1M0OA 3AEJA 3HT4A 2VMOA 1Z3ZA 3PD6B 4WYCA 4WXBA 3AENA 1ASDA 3RI6A 3UE8A 3WKRA 5G4JA 3K40A 3WCOA 3W1HA 1G7XA 3E2FA 4R5ZA 2VMVA 3DYDA 1ASNA 2VGTA 3EI5A 3EIAA 1UU0A 3ASAA 2VLHA 3KGXA 5M46A 2ZY4A 4WXFA 1AMQA 3JZLA 2Z67A 4FL0A 2JISA 4ATPA 4LC3A 4A0RA 3IHJA 5BJ4A 1AY4A 3MAFA 4WB0B 1AKAA 4I8AA 4CVQA 4AO4A 3JW9A 2OGEA 1PMMA 3VK2A 4UQVA 2VGWA 4XK1A 5C6UA 3A2BA 4RKDA 4IXSA 4DQ6A 4ZDLA 2O7CA 3N0LA 1UU2A 3ELEA 3VAXA 1IX8A 1M0PA 1M0QA 2W7DA 1N8PA 1CQ7A 1YOOA 4JEWA 4LW4A 1W7MA 2CB1A 1MGVA 1S06A 1MAPA 2JJFA 4RKCA 1TOKA 4ISYA 4O6ZA 5LHAA 1ARTA 4A72A 1RV3A 4WXGA 5EIGA 2WKAA 3GJUA 1D7SA 3MAUA 4IXOA 3ZRQA 3T32A 3RBFA 1DTYA 3VP6A 1ASMA 2BI2A 3BS8A 4H51A 5EAVA 1LKCA 4E77A 4P7YA 1AHGA 1B5OA 1WSTA 1Y4IA 4Q6RA 2Q7WA 3FCRA 2YOBA 3GZDC 1CS1A 4JF1A 5E5IA 4K05A 4WYDA 2XH1A 1C4KA 4OT8A 4BQ0A 3MKJA 2X5FA 2EGYA 3WKSA 1I41A 1ZODA 2AATA 3DODA 3NNKA 2BI3A 5TF5A 5G4IA 4Y0IA 1X2AA 2VYCA 3COGA 1O61A 3HQTA 3RCHB 1O69A 4XJPA 3UWCA 3BWOA 2BI9A 1G4VA 4M2MA 3W1IA 4Y0DA 2QLRA 1IVRA 3AATA 3NYUA 3AEPA 4XJLA 3USFA 2ZSLA 1M32A 3ZZJA 3PPLA 3QBOA 4WYFA 4XAUA 2F8JA 2BHXA 2NMPA 1M0NA 1OXOA 3BWNA 1D2FA 1IBJA 3E2ZA 1KMJA 4RAEA 4DBCA 3PD6A 3EI9A 4HVKA 3HMUA 3VK4A 1YJSA 3FKDA 2QB2A 4TMRA 2AY4A 4WYAA 2EH6A 2HP2A 1AICA 4CBRA 2FM1A 1DJEA 1AHYA 2AY6A 1ASLA 2HOYA 2R5EA 4UOYA 3H14A 1RVUA 1S08A 3OKSA 4GRXA 4GDYA 4UHNA 1AIAA 2A1VA 2ZSMA 1AMAA 3E6GA 3QM2A 1QIRA 1ELUA 1GCKA 3EUCA 5J8QA 1QJ5A 3NUIA 3LVJA 2VIBA 4U2HA 2AY1A 3FZ6A 4RJ0A 4XQ2A 2W8TA 3MC6A 4ITXA 2VMRA 3WGBA 4AOAA 3FD0A 4WB0A 1V2DA 2CJHA 4ZM4A 2C7TA 3QGUA 1QGNA 1BJWA 2WK8A 4GE9A 1BKGA 2VMTA 2AEVA 1J04A 4AH3A 3VOMA 2RFVA 2OKJA 2PB2A 2VI8A 3ATHA 1LC7A 1C7NA 1DGEA 3CQ5A 4W5KA 2AY5A 1LC8A 3BB8A 1PFFA 2CANA 4A0FA 2FQ6A 4A00A 2ZY2A 1AHEA 1KL2A 4K2IA 3WX9A 3I16A 1CL2A 2EZ2A 3W1JA 2VMQA 4BA4A 1MLZA 1GC0A 1O62A 5DJ1A 4KYOA 1AY8A 4BMKA 2AY8A 1QISA 2AY7A 4F5GA 3HL2A 3EZSA 3GSBA 1AY5A 1SZUA 3ZRPA 2OQXA 1FG7A 1UKJA 1KAFA 1JS6A 4WYGA 1YJZA 1SPAA 1ZOBA 2FN6A 2XBNA 4LNLA 5FT5A 4ADDA 2D64A 4M2JA 1TASA 2JJEA 4WLJA 2HOXA 2ZY5A 1TPLA 1GDEA 5D5SA 5M49A 4WP0A 2YKUA 1AHFA 2W7LA 3PJ0A 2BYLA 3GWPA 4R8DA 4N0WA 2GSAA 1D7UA 1Z7DA 2VGUA 3KKIA 4XJOA 5I92A 4PVFA 2V1PA 3OP7A 4PIWA 2R2NA 3RCHA 1V2FA 1BW0A 4Q75A 4OCAA 3A9XA 4EMYA 2D63A 1B8GA 4B9BA 1TARA 4MGRA 5HHYA 2DOUA 3AEMA 3BCBA 2BYJA 4MKJA 2W7HA 5DX5A 5F9SA 2CTZA 1DKAA 2AY2A 3LV2A 1D7RA 2BWPA 1U08A 3DRDA 5M4DA 3NUBA 1BQDA 1LC5A 1X0MA 4EFFA 1SF2A 2VI9A 4TV7A 3NX3A 4K2MA 3TFUA 7AATA 4W1XA 3IF2A 1MAQA 2W7JA 3PAAA 1AAMA 1EG5A 4E1OA 1PG8A 1B9IA 1GBNA 3TQXA 1LK9A 2JJGA 1B4XA 2D7YA 4MQQA 3N7NA 1W7LA 2JGTA 1G4XA 1CL1A 3E9KA 2FNIA 1LS3A 2W7EA 4E3QA 5FT4A 4ZLVA 5K8BA 3CQ4A 8AATA 2CFBA 3AV7A 5FT8A 3WZFA 4B98A 1T3IA 2OATA 2JG2A 3GZCA 3HBXA 1CQ6A 3L8AA 4OTLA 3RQ1A 1TOEA 3B1DA 4IY7A 3DR4A 2D65A 3L44A 3AOVA 3F6TA 5D95A 3LVKA 3CQ6A 2W7GA 2W7FA 4E3RA 1BJNA 3JU7A 1N2TA 1ORDA 4JEZA 4BHDA 2AY3A 2CSTA 3GETA 4RM1A 5F8VA 2E7JA 2VMNA 1KL1A 3LG0A 3AEOA 2DGKA 5LH9A 3CAIA 1P3WA 2CH1A 5KTBA 3B1EA 1AJSB 4OYTA 1ZC9A 2BWNA 2E54A 4GE4A 4OMAA 2PO3A 1KKPA 2Z61A 3I4JA 3PDBB 4WLHA 4MQRA 3G7QA 1LW4A 4OC9A 4OBVA 3ZZKA 4ZWMA 3FDDA 1GC2A 2Z20A 3FTBA 1IAXA 1S09A 1ECXA 2VMXA 2GQNA 1WYTB 3DXWA 3HVYA 3F9TA 2QSRA 1X28A 3UAKA
chains in the Genus database with same CATH topology
1ARSA 2C81A 3ASBA 3B8XA 2FNUA 4RJYA 3E2YA 4KAMA 4W91A 4DGTA 1B5PA 2Z9UA 3DC1A 4F5FA 1GEWA 1D7VA 2X3LA 2W7KA 2VIAA 4MSOA 4CXRA 1BJ4A 5HDMA 3GZDA 1CZEA 4CXQA 2DGLA 2YCPA 4H63Q 1MDXA 4NOGA 1ASCA 2VGVA 1W7NA 3NYTA 2YKYA 3GBXA 2BI1A 5EFSA 2PB0A 1LW5A 3PGYA 4PFNA 4JF0A 1V72A 4TN4A 4ADEA 3EI6A 3A9ZA 4A6RA 1SZKA 1OXPA 3NDNA 1H0CA 2D7ZA 2YCTA 3TFTA 1CJ0A 1WYVB 1WYUB 2CJDA 4ITGA 3N4SA 2BWOA 3WGCA 2VMWA 3GR9A 4L0OA 1IX6A 4R5FA 4WBTA 3AELA 2HUFA 5BJ3A 4RIZA 4F5MA 1IUGA 1I29A 1XEYA 1OHVA 2YRIA 4IYOB 2ZY3A 3PIUA 1J32A 2WK7A 2VMPA 2VMYA 3EIBA 3R9AA 2VLFA 2QMAA 3NU8A 1VJOA 1M6SA 3BCAA 2GB3A 2VMUA 1C7GA 4BA5A 2EYQA 2W8JA 4AO9A 4JEXA 3FVSA 2R5CB 3AEJC 1DGDA 3KGWA 4ADBA 1WKGA 2QA3A 3FFRA 3PDXA 5FT6A 3RBLA 5DB5A 2O0RA 2BI5A 3FSLA 4WD2A 4ATQA 3BV0A 5IWQA 1KMKA 4XEWA 3NU7A 4GE7A 2YKXA 4LNJA 1ARGA 1QJ3A 4EB5A 4IX8A 4CBSA 4ZWVA 2HOZA 4JEYA 3MBBA 1ARHA 3FFHA 3Q8NA 1CZCA 3R4TA 1W23A 4WYEA 1S0AA 1B9HA 1DJUA 1BJOB 3N5MA 4QGRA 5M4BA 2ZYJA 1OHWA 2G7JA 3DU4A 1ASAA 1YAAA 2VMSA 1AJSA 3II0A 1TOJA 2W8UA 3P1TA 3K7YA 1SFFA 2O1BA 3PDBA 4GSAA 5G2PA 3ZRRA 2VMZA 2ZP7A 2CINA 1O4SA 4UHMA 3FQ8A 1TOIA 4RITA 1AMSA 1X29A 3WCNA 1WYTA 4M2KA 3ELPA 1BQAA 2ZUKA 4F5HA 2E7UA 2ZJGA 4AZKA 2CJGA 2CY8A 1GEXA 4F4EA 2HZPA 2V0YA 1DFOA 1GC3A 2X8UA 3ECDA 3FVXA 3FZ7A 4W1VA 4Y0HA 5EQCA 2WB6A 1TOGA 1IX7A 1YNUA 3FZ8A 4EU1A 1FC4A 3FRKA 1G7WA 3E77A 3QHXA 3NRAA 2BIGA 3I5TA 3NTJA 1CQ8A 3F0HA 2HUUA 2Z1YA 3A8UX 3N75A 2KFPA 1YJYA 1AX4A 4JE5D 4A6UA 4ZASA 2GMUA 5AX8A 4ADCA 2ZC0A 4J8LA 2BIEA 1WYUA 1WYVA 1I43A 1S07A 1VP4A 2Z9XA 3BN1A 2AEUA 2G6WA 4FFCA 4IW7A 3VK3A 3TATA 3FDBA 2YHKA 1AHXA 1AKCA 4ZSYA 1VEFA 2D5YA 4IYOA 2EZ1A 4W8IA 3HDOA 3EI8A 4F5IA 3WY7A 3PA9A 3QI6A 2ORDA 4Q76A 1ASEA 4F5JA 4ZDOA 2GMSA 1UU1A 3BC8A 3LY1A 1SZSA 2OGAA 3BWNC 5G0AA 1OATA 3HLMA 2R5CA 1RVYA 2QBTA 1M4NA 1YIYA 4LW2A 3RUYA 1AMRA 4JE5A 1WKHA 1JS3A 2W8WA 1GC4A 3A9YA 2BIAA 4Q31A 3AENB 2Z1ZA 5EAAA 5G09A 1EQBA 1AAWA 1I48A 2DR1A 3CBFA 4HF8A 4JEVA 4A0GA 4A6TA 4ZAHA 2W7MA 2W8VA 3AOWA 4K2BA 5E3KA 3EZ1A 2YRRA 5EUNA 4U1TA 5JAYA 1IJIA 1BJOA 3MC6C 4EB7A 3FVUA 3QN6A 5EUDA 4P3MA 2D61A 3DXVA 3K28A 1C7OA 4N0BA 2VGSA 3MADA 1FG3A 2X5DA 2WK9A 4KXKA 3MAFB 1E5FA 4ZSWA 1JG8A 2DGMA 2FYFA 1IAYA 1PMOA 1AIBA 1QITA 3H7FA 1BS0A 1E5EA 2C44A 1ELQA 3P6KA 4MKKA 2OKKA 3LWSA 1MDOA 4ZM3A 1JF9A 3ACZA 3MEBA 3JWAA 4OBUA 3FQ7A 5E4ZA 1TATA 1AJRA 1DJ9A 3DZZA 2EO5A 5HXXA 1EJIA 3M5UA 3G8MA 3B46A 4AZJA 4J5UA 4R2NA 3DR7A 2C0RA 4MY5A 3NYSA 3G0TA 1XI9A 3FQAA 2VGZA 1ASGA 1GD9A 3EI7A 4GEBA 5EIGB 4MQPA 4IXZA 1ASBA 1ASFA 3WLXA 2YCNA 1YIZA 4LNMA 1AKBA 1MDZA 2AY9A 2E7IA 1N31A 5G2QA 4W1WA 4ZDPA 1V2EA 1QZ9A 2DKJA 3LVLB 3N4XA 3TCMA 2R0TA 1MLYA 3B1CA 3JTXA 1BT4A 2HORA 4UHOA 3QPGA 2FKIA 3LVMA 2JJHA 3KE3A 5DJ9A 4A0HA 2Z9WA 9AATA 2BKWA 1H1CA 2D66A 1C9CA 4XJMA 2EPJA 1W3UA 3D6KA 2HP1A 3BCXA 3AEMC 5EUEA 3H9XA 3ISLA 1SVVA 1OHYA 2W7IA 2Z9VA 1M7YA 2TPLA 3JWBA 1KKJA 2YKVA 4RLGA 4F5KA 1ARIA 3N4RA 2CH2A 4PFFA 2QB3A 2DKBA 1C0NA 3E2ZB 1RV4A 2HUIA 1GEYA 4F5LA 1M0OA 3AEJA 3HT4A 2VMOA 1Z3ZA 3PD6B 4WYCA 4WXBA 3AENA 1ASDA 3RI6A 3UE8A 3WKRA 5G4JA 3K40A 3WCOA 3W1HA 1G7XA 3E2FA 4R5ZA 2VMVA 3DYDA 1ASNA 2VGTA 3EI5A 3EIAA 1UU0A 3ASAA 2VLHA 3KGXA 5M46A 2ZY4A 4WXFA 1AMQA 3JZLA 2Z67A 4FL0A 2JISA 4ATPA 4LC3A 4A0RA 3IHJA 5BJ4A 1AY4A 3MAFA 4WB0B 1AKAA 4I8AA 4CVQA 4AO4A 3JW9A 2OGEA 1PMMA 3VK2A 4UQVA 2VGWA 4XK1A 5C6UA 3A2BA 4RKDA 4IXSA 4DQ6A 4ZDLA 2O7CA 3N0LA 1UU2A 3ELEA 3VAXA 1IX8A 1M0PA 1M0QA 2W7DA 1N8PA 1CQ7A 1YOOA 4JEWA 4LW4A 1W7MA 2CB1A 1MGVA 1S06A 1MAPA 2JJFA 4RKCA 1TOKA 4ISYA 4O6ZA 5LHAA 1ARTA 4A72A 1RV3A 4WXGA 5EIGA 2WKAA 3GJUA 1D7SA 3MAUA 4IXOA 3ZRQA 3T32A 3RBFA 1DTYA 3VP6A 1ASMA 2BI2A 3BS8A 4H51A 5EAVA 1LKCA 4E77A 4P7YA 1AHGA 1B5OA 1WSTA 1Y4IA 4Q6RA 2Q7WA 3FCRA 2YOBA 3GZDC 1CS1A 4JF1A 5E5IA 4K05A 4WYDA 2XH1A 1C4KA 4OT8A 4BQ0A 3MKJA 2X5FA 2EGYA 3WKSA 1I41A 1ZODA 2AATA 3DODA 3NNKA 2BI3A 5TF5A 5G4IA 4Y0IA 1X2AA 2VYCA 3COGA 1O61A 3HQTA 3RCHB 1O69A 4XJPA 3UWCA 3BWOA 2BI9A 1G4VA 4M2MA 3W1IA 4Y0DA 2QLRA 1IVRA 3AATA 3NYUA 3AEPA 4XJLA 3USFA 2ZSLA 1M32A 3ZZJA 3PPLA 3QBOA 4WYFA 4XAUA 2F8JA 2BHXA 2NMPA 1M0NA 1OXOA 3BWNA 1D2FA 1IBJA 3E2ZA 1KMJA 4RAEA 4DBCA 3PD6A 3EI9A 4HVKA 3HMUA 3VK4A 1YJSA 3FKDA 2QB2A 4TMRA 2AY4A 4WYAA 2EH6A 2HP2A 1AICA 4CBRA 2FM1A 1DJEA 1AHYA 2AY6A 1ASLA 2HOYA 2R5EA 4UOYA 3H14A 1RVUA 1S08A 3OKSA 4GRXA 4GDYA 4UHNA 1AIAA 2A1VA 2ZSMA 1AMAA 3E6GA 3QM2A 1QIRA 1ELUA 1GCKA 3EUCA 5J8QA 1QJ5A 3NUIA 3LVJA 2VIBA 4U2HA 2AY1A 3FZ6A 4RJ0A 4XQ2A 2W8TA 3MC6A 4ITXA 2VMRA 3WGBA 4AOAA 3FD0A 4WB0A 1V2DA 2CJHA 4ZM4A 2C7TA 3QGUA 1QGNA 1BJWA 2WK8A 4GE9A 1BKGA 2VMTA 2AEVA 1J04A 4AH3A 3VOMA 2RFVA 2OKJA 2PB2A 2VI8A 3ATHA 1LC7A 1C7NA 1DGEA 3CQ5A 4W5KA 2AY5A 1LC8A 3BB8A 1PFFA 2CANA 4A0FA 2FQ6A 4A00A 2ZY2A 1AHEA 1KL2A 4K2IA 3WX9A 3I16A 1CL2A 2EZ2A 3W1JA 2VMQA 4BA4A 1MLZA 1GC0A 1O62A 5DJ1A 4KYOA 1AY8A 4BMKA 2AY8A 1QISA 2AY7A 4F5GA 3HL2A 3EZSA 3GSBA 1AY5A 1SZUA 3ZRPA 2OQXA 1FG7A 1UKJA 1JS6A 4WYGA 1YJZA 1SPAA 1ZOBA 2FN6A 2XBNA 4LNLA 5FT5A 4ADDA 2D64A 4M2JA 1TASA 2JJEA 4WLJA 2HOXA 2ZY5A 1TPLA 1GDEA 5D5SA 5M49A 4WP0A 2YKUA 1AHFA 2W7LA 3PJ0A 2BYLA 3GWPA 4R8DA 4N0WA 2GSAA 1D7UA 1Z7DA 2VGUA 3KKIA 4XJOA 5I92A 4PVFA 2V1PA 3OP7A 4PIWA 2R2NA 3RCHA 1V2FA 1BW0A 4Q75A 4OCAA 3A9XA 4EMYA 2D63A 1B8GA 4B9BA 1TARA 4MGRA 5HHYA 2DOUA 3AEMA 3BCBA 2BYJA 4MKJA 2W7HA 5DX5A 5F9SA 2CTZA 1DKAA 2AY2A 3LV2A 1D7RA 2BWPA 1U08A 3DRDA 5M4DA 3NUBA 1BQDA 1LC5A 1X0MA 4EFFA 1SF2A 2VI9A 4TV7A 3NX3A 4K2MA 3TFUA 7AATA 4W1XA 3IF2A 1MAQA 2W7JA 3PAAA 1AAMA 1EG5A 4E1OA 1PG8A 1B9IA 1GBNA 3TQXA 1LK9A 2JJGA 1B4XA 2D7YA 4MQQA 3N7NA 1W7LA 2JGTA 1G4XA 1CL1A 3E9KA 2FNIA 1LS3A 2W7EA 4E3QA 5FT4A 4ZLVA 5K8BA 3CQ4A 8AATA 2CFBA 3AV7A 5FT8A 3WZFA 4B98A 1T3IA 2OATA 2JG2A 3GZCA 3HBXA 1CQ6A 3L8AA 4OTLA 3RQ1A 1TOEA 3B1DA 4IY7A 3DR4A 2D65A 3L44A 3AOVA 3F6TA 5D95A 3LVKA 3CQ6A 2W7GA 2W7FA 4E3RA 1BJNA 3JU7A 1N2TA 1ORDA 4JEZA 4BHDA 2AY3A 2CSTA 3GETA 4RM1A 5F8VA 2E7JA 2VMNA 1KL1A 3LG0A 3AEOA 2DGKA 5LH9A 3CAIA 1P3WA 2CH1A 5KTBA 3B1EA 1AJSB 4OYTA 1ZC9A 2BWNA 2E54A 4GE4A 4OMAA 2PO3A 1KKPA 2Z61A 3I4JA 3PDBB 4WLHA 4MQRA 3G7QA 1LW4A 4OC9A 4OBVA 3ZZKA 4ZWMA 3FDDA 1GC2A 2Z20A 3FTBA 1IAXA 1S09A 1ECXA 2VMXA 2GQNA 1WYTB 3DXWA 3HVYA 3F9TA 2QSRA 1X28A 3UAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARS A;  2C81 A;  3ASB A;  3B8X A;  2FNU A;  4RJY A;  3E2Y A;  4KAM A;  4W91 A;  4DGT A;  1B5P A;  2Z9U A;  3DC1 A;  4F5F A;  1GEW A;  1D7V A;  2X3L A;  2W7K A;  2VIA A;  4MSO A;  4CXR A;  1BJ4 A;  5HDM A;  3GZD A;  1CZE A;  4CXQ A;  2DGL A;  2YCP A;  1MDX A;  4NOG A;  1ASC A;  2VGV A;  1W7N A;  3NYT A;  2YKY A;  3GBX A;  2BI1 A;  5EFS A;  2PB0 A;  1LW5 A;  3PGY A;  4PFN A;  4JF0 A;  1V72 A;  4TN4 A;  4ADE A;  3EI6 A;  3A9Z A;  4A6R A;  1SZK A;  1OXP A;  3NDN A;  1H0C A;  2D7Z A;  2YCT A;  3TFT A;  1CJ0 A;  1WYV B;  1WYU B;  2CJD A;  4ITG A;  2BWO A;  3WGC A;  2VMW A;  3GR9 A;  4L0O A;  1IX6 A;  4R5F A;  4WBT A;  3AEL A;  2HUF A;  5BJ3 A;  4RIZ A;  4F5M A;  1IUG A;  1I29 A;  1XEY A;  1OHV A;  2YRI A;  4IYO B;  2ZY3 A;  3PIU A;  1J32 A;  2WK7 A;  2VMP A;  2VMY A;  3EIB A;  3R9A A;  2VLF A;  2QMA A;  3NU8 A;  1VJO A;  1M6S A;  3BCA A;  2GB3 A;  2VMU A;  1C7G A;  4BA5 A;  2W8J A;  4AO9 A;  4JEX A;  3FVS A;  2R5C B;  3AEJ C;  1DGD A;  3KGW A;  4ADB A;  1WKG A;  2QA3 A;  3FFR A;  3PDX A;  5FT6 A;  3RBL A;  5DB5 A;  2O0R A;  2BI5 A;  3FSL A;  4WD2 A;  4ATQ A;  3BV0 A;  5IWQ A;  1KMK A;  4XEW A;  3NU7 A;  4GE7 A;  2YKX A;  4LNJ A;  1ARG A;  1QJ3 A;  4EB5 A;  4IX8 A;  4CBS A;  4ZWV A;  2HOZ A;  4JEY A;  3MBB A;  1ARH A;  3FFH A;  3Q8N A;  1CZC A;  3R4T A;  1W23 A;  4WYE A;  1S0A A;  1B9H A;  1DJU A;  1BJO B;  3N5M A;  4QGR A;  5M4B A;  2ZYJ A;  1OHW A;  3DU4 A;  1ASA A;  1YAA A;  2VMS A;  1AJS A;  3II0 A;  1TOJ A;  2W8U A;  3P1T A;  3K7Y A;  1SFF A;  2O1B A;  3PDB A;  4GSA A;  5G2P A;  3ZRR A;  2VMZ A;  2ZP7 A;  2CIN A;  1O4S A;  4UHM A;  3FQ8 A;  1TOI A;  4RIT A;  1AMS A;  1X29 A;  3WCN A;  1WYT A;  4M2K A;  3ELP A;  1BQA A;  2ZUK A;  4F5H A;  2E7U A;  2ZJG A;  4AZK A;  2CJG A;  2CY8 A;  1GEX A;  4F4E A;  2HZP A;  2V0Y A;  1DFO A;  1GC3 A;  2X8U A;  3ECD A;  3FVX A;  3FZ7 A;  4W1V A;  4Y0H A;  5EQC A;  1TOG A;  1IX7 A;  1YNU A;  3FZ8 A;  4EU1 A;  1FC4 A;  3FRK A;  1G7W A;  3E77 A;  3QHX A;  3NRA A;  2BIG A;  3I5T A;  3NTJ A;  1CQ8 A;  3F0H A;  2HUU A;  2Z1Y A;  3A8U X;  3N75 A;  1YJY A;  1AX4 A;  4JE5 D;  4A6U A;  4ZAS A;  2GMU A;  5AX8 A;  4ADC A;  2ZC0 A;  4J8L A;  2BIE A;  1WYU A;  1WYV A;  1I43 A;  1S07 A;  1VP4 A;  2Z9X A;  3BN1 A;  2AEU A;  2G6W A;  4FFC A;  4IW7 A;  3VK3 A;  3TAT A;  3FDB A;  2YHK A;  1AHX A;  1AKC A;  4ZSY A;  1VEF A;  2D5Y A;  4IYO A;  2EZ1 A;  4W8I A;  3HDO A;  3EI8 A;  4F5I A;  3WY7 A;  3PA9 A;  3QI6 A;  2ORD A;  4Q76 A;  1ASE A;  4F5J A;  4ZDO A;  2GMS A;  1UU1 A;  3BC8 A;  3LY1 A;  1SZS A;  2OGA A;  3BWN C;  5G0A A;  1OAT A;  3HLM A;  2R5C A;  1RVY A;  2QBT A;  1M4N A;  1YIY A;  4LW2 A;  3RUY A;  1AMR A;  4JE5 A;  1WKH A;  1JS3 A;  2W8W A;  1GC4 A;  3A9Y A;  2BIA A;  4Q31 A;  3AEN B;  2Z1Z A;  5EAA A;  5G09 A;  1EQB A;  1AAW A;  1I48 A;  2DR1 A;  3CBF A;  4HF8 A;  4JEV A;  4A0G A;  4A6T A;  4ZAH A;  2W7M A;  2W8V A;  3AOW A;  4K2B A;  5E3K A;  3EZ1 A;  2YRR A;  5EUN A;  4U1T A;  5JAY A;  1IJI A;  1BJO A;  3MC6 C;  4EB7 A;  3FVU A;  3QN6 A;  5EUD A;  4P3M A;  2D61 A;  3DXV A;  3K28 A;  1C7O A;  4N0B A;  2VGS A;  3MAD A;  1FG3 A;  2X5D A;  2WK9 A;  4KXK A;  3MAF B;  1E5F A;  4ZSW A;  1JG8 A;  2DGM A;  2FYF A;  1IAY A;  1PMO A;  1AIB A;  1QIT A;  3H7F A;  1BS0 A;  1E5E A;  2C44 A;  1ELQ A;  3P6K A;  4MKK A;  2OKK A;  3LWS A;  1MDO A;  4ZM3 A;  1JF9 A;  3ACZ A;  3MEB A;  3JWA A;  4OBU A;  3FQ7 A;  5E4Z A;  1TAT A;  1AJR A;  1DJ9 A;  3DZZ A;  2EO5 A;  5HXX A;  1EJI A;  3M5U A;  3G8M A;  3B46 A;  4AZJ A;  4J5U A;  4R2N A;  3DR7 A;  2C0R A;  4MY5 A;  3NYS A;  3G0T A;  1XI9 A;  3FQA A;  2VGZ A;  1ASG A;  1GD9 A;  3EI7 A;  4GEB A;  5EIG B;  4MQP A;  4IXZ A;  1ASB A;  1ASF A;  3WLX A;  2YCN A;  1YIZ A;  4LNM A;  1AKB A;  1MDZ A;  2AY9 A;  2E7I A;  1N31 A;  5G2Q A;  4W1W A;  4ZDP A;  1V2E A;  1QZ9 A;  2DKJ A;  3LVL B;  3TCM A;  2R0T A;  1MLY A;  3B1C A;  3JTX A;  1BT4 A;  2HOR A;  4UHO A;  3QPG A;  3LVM A;  2JJH A;  3KE3 A;  5DJ9 A;  4A0H A;  2Z9W A;  9AAT A;  2BKW A;  1H1C A;  2D66 A;  1C9C A;  4XJM A;  2EPJ A;  1W3U A;  3D6K A;  2HP1 A;  3BCX A;  3AEM C;  5EUE A;  3ISL A;  1SVV A;  1OHY A;  2W7I A;  2Z9V A;  1M7Y A;  2TPL A;  3JWB A;  1KKJ A;  2YKV A;  4RLG A;  4F5K A;  1ARI A;  2CH2 A;  4PFF A;  2QB3 A;  2DKB A;  1C0N A;  3E2Z B;  1RV4 A;  2HUI A;  1GEY A;  4F5L A;  1M0O A;  3AEJ A;  3HT4 A;  2VMO A;  1Z3Z A;  3PD6 B;  4WYC A;  4WXB A;  3AEN A;  1ASD A;  3RI6 A;  3UE8 A;  3WKR A;  5G4J A;  3K40 A;  3WCO A;  3W1H A;  1G7X A;  3E2F A;  4R5Z A;  2VMV A;  3DYD A;  1ASN A;  2VGT A;  3EI5 A;  3EIA A;  1UU0 A;  3ASA A;  2VLH A;  3KGX A;  5M46 A;  2ZY4 A;  4WXF A;  1AMQ A;  3JZL A;  2Z67 A;  4FL0 A;  2JIS A;  4ATP A;  4LC3 A;  4A0R A;  3IHJ A;  5BJ4 A;  1AY4 A;  3MAF A;  4WB0 B;  1AKA A;  4I8A A;  4CVQ A;  4AO4 A;  3JW9 A;  2OGE A;  1PMM A;  3VK2 A;  4UQV A;  2VGW A;  4XK1 A;  5C6U A;  3A2B A;  4RKD A;  4IXS A;  4DQ6 A;  4ZDL A;  2O7C A;  3N0L A;  1UU2 A;  3ELE A;  3VAX A;  1IX8 A;  1M0P A;  1M0Q A;  2W7D A;  1N8P A;  1CQ7 A;  1YOO A;  4JEW A;  4LW4 A;  1W7M A;  2CB1 A;  1MGV A;  1S06 A;  1MAP A;  2JJF A;  4RKC A;  1TOK A;  4ISY A;  4O6Z A;  5LHA A;  1ART A;  4A72 A;  1RV3 A;  4WXG A;  5EIG A;  2WKA A;  3GJU A;  1D7S A;  3MAU A;  4IXO A;  3ZRQ A;  3T32 A;  3RBF A;  1DTY A;  3VP6 A;  1ASM A;  2BI2 A;  3BS8 A;  4H51 A;  5EAV A;  1LKC A;  4E77 A;  4P7Y A;  1AHG A;  1B5O A;  1WST A;  1Y4I A;  4Q6R A;  2Q7W A;  3FCR A;  2YOB A;  3GZD C;  1CS1 A;  4JF1 A;  5E5I A;  4WYD A;  2XH1 A;  1C4K A;  4OT8 A;  4BQ0 A;  3MKJ A;  2X5F A;  2EGY A;  3WKS A;  1I41 A;  1ZOD A;  2AAT A;  3DOD A;  3NNK A;  2BI3 A;  5TF5 A;  5G4I A;  4Y0I A;  1X2A A;  2VYC A;  3COG A;  1O61 A;  3HQT A;  3RCH B;  1O69 A;  4XJP A;  3UWC A;  3BWO A;  2BI9 A;  1G4V A;  4M2M A;  3W1I A;  4Y0D A;  2QLR A;  1IVR A;  3AAT A;  3NYU A;  3AEP A;  4XJL A;  3USF A;  2ZSL A;  1M32 A;  3ZZJ A;  3PPL A;  3QBO A;  4WYF A;  4XAU A;  2F8J A;  2BHX A;  2NMP A;  1M0N A;  1OXO A;  3BWN A;  1D2F A;  1IBJ A;  3E2Z A;  1KMJ A;  4RAE A;  4DBC A;  3PD6 A;  3EI9 A;  4HVK A;  3HMU A;  3VK4 A;  1YJS A;  3FKD A;  2QB2 A;  4TMR A;  2AY4 A;  4WYA A;  2EH6 A;  2HP2 A;  1AIC A;  4CBR A;  2FM1 A;  1DJE A;  1AHY A;  2AY6 A;  1ASL A;  2HOY A;  2R5E A;  4UOY A;  3H14 A;  1RVU A;  1S08 A;  3OKS A;  4GRX A;  4GDY A;  4UHN A;  1AIA A;  2ZSM A;  1AMA A;  3E6G A;  3QM2 A;  1QIR A;  1ELU A;  1GCK A;  3EUC A;  5J8Q A;  1QJ5 A;  3NUI A;  3LVJ A;  2VIB A;  4U2H A;  2AY1 A;  3FZ6 A;  4RJ0 A;  4XQ2 A;  2W8T A;  3MC6 A;  4ITX A;  2VMR A;  3WGB A;  4AOA A;  3FD0 A;  4WB0 A;  1V2D A;  2CJH A;  4ZM4 A;  2C7T A;  3QGU A;  1QGN A;  1BJW A;  2WK8 A;  4GE9 A;  1BKG A;  2VMT A;  2AEV A;  1J04 A;  4AH3 A;  3VOM A;  2RFV A;  2OKJ A;  2PB2 A;  2VI8 A;  3ATH A;  1LC7 A;  1C7N A;  1DGE A;  3CQ5 A;  4W5K A;  2AY5 A;  1LC8 A;  3BB8 A;  1PFF A;  2CAN A;  4A0F A;  2FQ6 A;  4A00 A;  2ZY2 A;  1AHE A;  1KL2 A;  4K2I A;  3WX9 A;  3I16 A;  1CL2 A;  2EZ2 A;  3W1J A;  2VMQ A;  4BA4 A;  1MLZ A;  1GC0 A;  1O62 A;  5DJ1 A;  4KYO A;  1AY8 A;  4BMK A;  2AY8 A;  1QIS A;  2AY7 A;  4F5G A;  3HL2 A;  3EZS A;  3GSB A;  1AY5 A;  1SZU A;  3ZRP A;  2OQX A;  1FG7 A;  1UKJ A;  1JS6 A;  4WYG A;  1YJZ A;  1SPA A;  1ZOB A;  2FN6 A;  2XBN A;  4LNL A;  5FT5 A;  4ADD A;  2D64 A;  4M2J A;  1TAS A;  2JJE A;  4WLJ A;  2HOX A;  2ZY5 A;  1TPL A;  1GDE A;  5D5S A;  5M49 A;  4WP0 A;  2YKU A;  1AHF A;  2W7L A;  3PJ0 A;  2BYL A;  3GWP A;  4R8D A;  4N0W A;  2GSA A;  1D7U A;  1Z7D A;  2VGU A;  3KKI A;  4XJO A;  5I92 A;  4PVF A;  2V1P A;  3OP7 A;  4PIW A;  2R2N A;  3RCH A;  1V2F A;  1BW0 A;  4Q75 A;  4OCA A;  3A9X A;  4EMY A;  2D63 A;  1B8G A;  4B9B A;  1TAR A;  4MGR A;  5HHY A;  2DOU A;  3AEM A;  3BCB A;  2BYJ A;  4MKJ A;  2W7H A;  5DX5 A;  5F9S A;  2CTZ A;  1DKA A;  2AY2 A;  3LV2 A;  1D7R A;  2BWP A;  1U08 A;  3DRD A;  5M4D A;  3NUB A;  1BQD A;  1LC5 A;  1X0M A;  4EFF A;  1SF2 A;  2VI9 A;  4TV7 A;  3NX3 A;  4K2M A;  3TFU A;  7AAT A;  4W1X A;  3IF2 A;  1MAQ A;  2W7J A;  3PAA A;  1AAM A;  1EG5 A;  4E1O A;  1PG8 A;  1B9I A;  1GBN A;  3TQX A;  1LK9 A;  2JJG A;  1B4X A;  2D7Y A;  4MQQ A;  1W7L A;  2JGT A;  1G4X A;  1CL1 A;  3E9K A;  2FNI A;  1LS3 A;  2W7E A;  4E3Q A;  5FT4 A;  4ZLV A;  5K8B A;  3CQ4 A;  8AAT A;  2CFB A;  3AV7 A;  5FT8 A;  3WZF A;  4B98 A;  1T3I A;  2OAT A;  2JG2 A;  3GZC A;  3HBX A;  1CQ6 A;  3L8A A;  4OTL A;  3RQ1 A;  1TOE A;  3B1D A;  4IY7 A;  3DR4 A;  2D65 A;  3L44 A;  3AOV A;  3F6T A;  5D95 A;  3LVK A;  3CQ6 A;  2W7G A;  2W7F A;  4E3R A;  1BJN A;  3JU7 A;  1N2T A;  1ORD A;  4JEZ A;  4BHD A;  2AY3 A;  2CST A;  3GET A;  4RM1 A;  5F8V A;  2E7J A;  2VMN A;  1KL1 A;  3LG0 A;  3AEO A;  2DGK A;  5LH9 A;  3CAI A;  1P3W A;  2CH1 A;  3B1E A;  1AJS B;  4OYT A;  1ZC9 A;  2BWN A;  2E54 A;  4GE4 A;  4OMA A;  2PO3 A;  1KKP A;  2Z61 A;  3I4J A;  3PDB B;  4WLH A;  4MQR A;  3G7Q A;  1LW4 A;  4OC9 A;  4OBV A;  3ZZK A;  4ZWM A;  3FDD A;  1GC2 A;  2Z20 A;  3FTB A;  1IAX A;  1S09 A;  1ECX A;  2VMX A;  2GQN A;  1WYT B;  3DXW A;  3HVY A;  3F9T A;  1X28 A;  3UAK A; 
#chains in the Genus database with same CATH topology
 1ARS A;  2C81 A;  3ASB A;  3B8X A;  2FNU A;  4RJY A;  3E2Y A;  4KAM A;  4W91 A;  4DGT A;  1B5P A;  2Z9U A;  3DC1 A;  4F5F A;  1GEW A;  1D7V A;  2X3L A;  2W7K A;  2VIA A;  4MSO A;  4CXR A;  1BJ4 A;  5HDM A;  3GZD A;  1CZE A;  4CXQ A;  2DGL A;  2YCP A;  4H63 Q;  1MDX A;  4NOG A;  1ASC A;  2VGV A;  1W7N A;  3NYT A;  2YKY A;  3GBX A;  2BI1 A;  5EFS A;  2PB0 A;  1LW5 A;  3PGY A;  4PFN A;  4JF0 A;  1V72 A;  4TN4 A;  4ADE A;  3EI6 A;  3A9Z A;  4A6R A;  1SZK A;  1OXP A;  3NDN A;  1H0C A;  2D7Z A;  2YCT A;  3TFT A;  1CJ0 A;  1WYV B;  1WYU B;  2CJD A;  4ITG A;  3N4S A;  2BWO A;  3WGC A;  2VMW A;  3GR9 A;  4L0O A;  1IX6 A;  4R5F A;  4WBT A;  3AEL A;  2HUF A;  5BJ3 A;  4RIZ A;  4F5M A;  1IUG A;  1I29 A;  1XEY A;  1OHV A;  2YRI A;  4IYO B;  2ZY3 A;  3PIU A;  1J32 A;  2WK7 A;  2VMP A;  2VMY A;  3EIB A;  3R9A A;  2VLF A;  2QMA A;  3NU8 A;  1VJO A;  1M6S A;  3BCA A;  2GB3 A;  2VMU A;  1C7G A;  4BA5 A;  2EYQ A;  2W8J A;  4AO9 A;  4JEX A;  3FVS A;  2R5C B;  3AEJ C;  1DGD A;  3KGW A;  4ADB A;  1WKG A;  2QA3 A;  3FFR A;  3PDX A;  5FT6 A;  3RBL A;  5DB5 A;  2O0R A;  2BI5 A;  3FSL A;  4WD2 A;  4ATQ A;  3BV0 A;  5IWQ A;  1KMK A;  4XEW A;  3NU7 A;  4GE7 A;  2YKX A;  4LNJ A;  1ARG A;  1QJ3 A;  4EB5 A;  4IX8 A;  4CBS A;  4ZWV A;  2HOZ A;  4JEY A;  3MBB A;  1ARH A;  3FFH A;  3Q8N A;  1CZC A;  3R4T A;  1W23 A;  4WYE A;  1S0A A;  1B9H A;  1DJU A;  1BJO B;  3N5M A;  4QGR A;  5M4B A;  2ZYJ A;  1OHW A;  2G7J A;  3DU4 A;  1ASA A;  1YAA A;  2VMS A;  1AJS A;  3II0 A;  1TOJ A;  2W8U A;  3P1T A;  3K7Y A;  1SFF A;  2O1B A;  3PDB A;  4GSA A;  5G2P A;  3ZRR A;  2VMZ A;  2ZP7 A;  2CIN A;  1O4S A;  4UHM A;  3FQ8 A;  1TOI A;  4RIT A;  1AMS A;  1X29 A;  3WCN A;  1WYT A;  4M2K A;  3ELP A;  1BQA A;  2ZUK A;  4F5H A;  2E7U A;  2ZJG A;  4AZK A;  2CJG A;  2CY8 A;  1GEX A;  4F4E A;  2HZP A;  2V0Y A;  1DFO A;  1GC3 A;  2X8U A;  3ECD A;  3FVX A;  3FZ7 A;  4W1V A;  4Y0H A;  5EQC A;  2WB6 A;  1TOG A;  1IX7 A;  1YNU A;  3FZ8 A;  4EU1 A;  1FC4 A;  3FRK A;  1G7W A;  3E77 A;  3QHX A;  3NRA A;  2BIG A;  3I5T A;  3NTJ A;  1CQ8 A;  3F0H A;  2HUU A;  2Z1Y A;  3A8U X;  3N75 A;  2KFP A;  1YJY A;  1AX4 A;  4JE5 D;  4A6U A;  4ZAS A;  2GMU A;  5AX8 A;  4ADC A;  2ZC0 A;  4J8L A;  2BIE A;  1WYU A;  1WYV A;  1I43 A;  1S07 A;  1VP4 A;  2Z9X A;  3BN1 A;  2AEU A;  2G6W A;  4FFC A;  4IW7 A;  3VK3 A;  3TAT A;  3FDB A;  2YHK A;  1AHX A;  1AKC A;  4ZSY A;  1VEF A;  2D5Y A;  4IYO A;  2EZ1 A;  4W8I A;  3HDO A;  3EI8 A;  4F5I A;  3WY7 A;  3PA9 A;  3QI6 A;  2ORD A;  4Q76 A;  1ASE A;  4F5J A;  4ZDO A;  2GMS A;  1UU1 A;  3BC8 A;  3LY1 A;  1SZS A;  2OGA A;  3BWN C;  5G0A A;  1OAT A;  3HLM A;  2R5C A;  1RVY A;  2QBT A;  1M4N A;  1YIY A;  4LW2 A;  3RUY A;  1AMR A;  4JE5 A;  1WKH A;  1JS3 A;  2W8W A;  1GC4 A;  3A9Y A;  2BIA A;  4Q31 A;  3AEN B;  2Z1Z A;  5EAA A;  5G09 A;  1EQB A;  1AAW A;  1I48 A;  2DR1 A;  3CBF A;  4HF8 A;  4JEV A;  4A0G A;  4A6T A;  4ZAH A;  2W7M A;  2W8V A;  3AOW A;  4K2B A;  5E3K A;  3EZ1 A;  2YRR A;  5EUN A;  4U1T A;  5JAY A;  1IJI A;  1BJO A;  3MC6 C;  4EB7 A;  3FVU A;  3QN6 A;  5EUD A;  4P3M A;  2D61 A;  3DXV A;  3K28 A;  1C7O A;  4N0B A;  2VGS A;  3MAD A;  1FG3 A;  2X5D A;  2WK9 A;  4KXK A;  3MAF B;  1E5F A;  4ZSW A;  1JG8 A;  2DGM A;  2FYF A;  1IAY A;  1PMO A;  1AIB A;  1QIT A;  3H7F A;  1BS0 A;  1E5E A;  2C44 A;  1ELQ A;  3P6K A;  4MKK A;  2OKK A;  3LWS A;  1MDO A;  4ZM3 A;  1JF9 A;  3ACZ A;  3MEB A;  3JWA A;  4OBU A;  3FQ7 A;  5E4Z A;  1TAT A;  1AJR A;  1DJ9 A;  3DZZ A;  2EO5 A;  5HXX A;  1EJI A;  3M5U A;  3G8M A;  3B46 A;  4AZJ A;  4J5U A;  4R2N A;  3DR7 A;  2C0R A;  4MY5 A;  3NYS A;  3G0T A;  1XI9 A;  3FQA A;  2VGZ A;  1ASG A;  1GD9 A;  3EI7 A;  4GEB A;  5EIG B;  4MQP A;  4IXZ A;  1ASB A;  1ASF A;  3WLX A;  2YCN A;  1YIZ A;  4LNM A;  1AKB A;  1MDZ A;  2AY9 A;  2E7I A;  1N31 A;  5G2Q A;  4W1W A;  4ZDP A;  1V2E A;  1QZ9 A;  2DKJ A;  3LVL B;  3N4X A;  3TCM A;  2R0T A;  1MLY A;  3B1C A;  3JTX A;  1BT4 A;  2HOR A;  4UHO A;  3QPG A;  2FKI A;  3LVM A;  2JJH A;  3KE3 A;  5DJ9 A;  4A0H A;  2Z9W A;  9AAT A;  2BKW A;  1H1C A;  2D66 A;  1C9C A;  4XJM A;  2EPJ A;  1W3U A;  3D6K A;  2HP1 A;  3BCX A;  3AEM C;  5EUE A;  3H9X A;  3ISL A;  1SVV A;  1OHY A;  2W7I A;  2Z9V A;  1M7Y A;  2TPL A;  3JWB A;  1KKJ A;  2YKV A;  4RLG A;  4F5K A;  1ARI A;  3N4R A;  2CH2 A;  4PFF A;  2QB3 A;  2DKB A;  1C0N A;  3E2Z B;  1RV4 A;  2HUI A;  1GEY A;  4F5L A;  1M0O A;  3AEJ A;  3HT4 A;  2VMO A;  1Z3Z A;  3PD6 B;  4WYC A;  4WXB A;  3AEN A;  1ASD A;  3RI6 A;  3UE8 A;  3WKR A;  5G4J A;  3K40 A;  3WCO A;  3W1H A;  1G7X A;  3E2F A;  4R5Z A;  2VMV A;  3DYD A;  1ASN A;  2VGT A;  3EI5 A;  3EIA A;  1UU0 A;  3ASA A;  2VLH A;  3KGX A;  5M46 A;  2ZY4 A;  4WXF A;  1AMQ A;  3JZL A;  2Z67 A;  4FL0 A;  2JIS A;  4ATP A;  4LC3 A;  4A0R A;  3IHJ A;  5BJ4 A;  1AY4 A;  3MAF A;  4WB0 B;  1AKA A;  4I8A A;  4CVQ A;  4AO4 A;  3JW9 A;  2OGE A;  1PMM A;  3VK2 A;  4UQV A;  2VGW A;  4XK1 A;  5C6U A;  3A2B A;  4RKD A;  4IXS A;  4DQ6 A;  4ZDL A;  2O7C A;  3N0L A;  1UU2 A;  3ELE A;  3VAX A;  1IX8 A;  1M0P A;  1M0Q A;  2W7D A;  1N8P A;  1CQ7 A;  1YOO A;  4JEW A;  4LW4 A;  1W7M A;  2CB1 A;  1MGV A;  1S06 A;  1MAP A;  2JJF A;  4RKC A;  1TOK A;  4ISY A;  4O6Z A;  5LHA A;  1ART A;  4A72 A;  1RV3 A;  4WXG A;  5EIG A;  2WKA A;  3GJU A;  1D7S A;  3MAU A;  4IXO A;  3ZRQ A;  3T32 A;  3RBF A;  1DTY A;  3VP6 A;  1ASM A;  2BI2 A;  3BS8 A;  4H51 A;  5EAV A;  1LKC A;  4E77 A;  4P7Y A;  1AHG A;  1B5O A;  1WST A;  1Y4I A;  4Q6R A;  2Q7W A;  3FCR A;  2YOB A;  3GZD C;  1CS1 A;  4JF1 A;  5E5I A;  4K05 A;  4WYD A;  2XH1 A;  1C4K A;  4OT8 A;  4BQ0 A;  3MKJ A;  2X5F A;  2EGY A;  3WKS A;  1I41 A;  1ZOD A;  2AAT A;  3DOD A;  3NNK A;  2BI3 A;  5TF5 A;  5G4I A;  4Y0I A;  1X2A A;  2VYC A;  3COG A;  1O61 A;  3HQT A;  3RCH B;  1O69 A;  4XJP A;  3UWC A;  3BWO A;  2BI9 A;  1G4V A;  4M2M A;  3W1I A;  4Y0D A;  2QLR A;  1IVR A;  3AAT A;  3NYU A;  3AEP A;  4XJL A;  3USF A;  2ZSL A;  1M32 A;  3ZZJ A;  3PPL A;  3QBO A;  4WYF A;  4XAU A;  2F8J A;  2BHX A;  2NMP A;  1M0N A;  1OXO A;  3BWN A;  1D2F A;  1IBJ A;  3E2Z A;  1KMJ A;  4RAE A;  4DBC A;  3PD6 A;  3EI9 A;  4HVK A;  3HMU A;  3VK4 A;  1YJS A;  3FKD A;  2QB2 A;  4TMR A;  2AY4 A;  4WYA A;  2EH6 A;  2HP2 A;  1AIC A;  4CBR A;  2FM1 A;  1DJE A;  1AHY A;  2AY6 A;  1ASL A;  2HOY A;  2R5E A;  4UOY A;  3H14 A;  1RVU A;  1S08 A;  3OKS A;  4GRX A;  4GDY A;  4UHN A;  1AIA A;  2A1V A;  2ZSM A;  1AMA A;  3E6G A;  3QM2 A;  1QIR A;  1ELU A;  1GCK A;  3EUC A;  5J8Q A;  1QJ5 A;  3NUI A;  3LVJ A;  2VIB A;  4U2H A;  2AY1 A;  3FZ6 A;  4RJ0 A;  4XQ2 A;  2W8T A;  3MC6 A;  4ITX A;  2VMR A;  3WGB A;  4AOA A;  3FD0 A;  4WB0 A;  1V2D A;  2CJH A;  4ZM4 A;  2C7T A;  3QGU A;  1QGN A;  1BJW A;  2WK8 A;  4GE9 A;  1BKG A;  2VMT A;  2AEV A;  1J04 A;  4AH3 A;  3VOM A;  2RFV A;  2OKJ A;  2PB2 A;  2VI8 A;  3ATH A;  1LC7 A;  1C7N A;  1DGE A;  3CQ5 A;  4W5K A;  2AY5 A;  1LC8 A;  3BB8 A;  1PFF A;  2CAN A;  4A0F A;  2FQ6 A;  4A00 A;  2ZY2 A;  1AHE A;  1KL2 A;  4K2I A;  3WX9 A;  3I16 A;  1CL2 A;  2EZ2 A;  3W1J A;  2VMQ A;  4BA4 A;  1MLZ A;  1GC0 A;  1O62 A;  5DJ1 A;  4KYO A;  1AY8 A;  4BMK A;  2AY8 A;  1QIS A;  2AY7 A;  4F5G A;  3HL2 A;  3EZS A;  3GSB A;  1AY5 A;  1SZU A;  3ZRP A;  2OQX A;  1FG7 A;  1UKJ A;  1KAF A;  1JS6 A;  4WYG A;  1YJZ A;  1SPA A;  1ZOB A;  2FN6 A;  2XBN A;  4LNL A;  5FT5 A;  4ADD A;  2D64 A;  4M2J A;  1TAS A;  2JJE A;  4WLJ A;  2HOX A;  2ZY5 A;  1TPL A;  1GDE A;  5D5S A;  5M49 A;  4WP0 A;  2YKU A;  1AHF A;  2W7L A;  3PJ0 A;  2BYL A;  3GWP A;  4R8D A;  4N0W A;  2GSA A;  1D7U A;  1Z7D A;  2VGU A;  3KKI A;  4XJO A;  5I92 A;  4PVF A;  2V1P A;  3OP7 A;  4PIW A;  2R2N A;  3RCH A;  1V2F A;  1BW0 A;  4Q75 A;  4OCA A;  3A9X A;  4EMY A;  2D63 A;  1B8G A;  4B9B A;  1TAR A;  4MGR A;  5HHY A;  2DOU A;  3AEM A;  3BCB A;  2BYJ A;  4MKJ A;  2W7H A;  5DX5 A;  5F9S A;  2CTZ A;  1DKA A;  2AY2 A;  3LV2 A;  1D7R A;  2BWP A;  1U08 A;  3DRD A;  5M4D A;  3NUB A;  1BQD A;  1LC5 A;  1X0M A;  4EFF A;  1SF2 A;  2VI9 A;  4TV7 A;  3NX3 A;  4K2M A;  3TFU A;  7AAT A;  4W1X A;  3IF2 A;  1MAQ A;  2W7J A;  3PAA A;  1AAM A;  1EG5 A;  4E1O A;  1PG8 A;  1B9I A;  1GBN A;  3TQX A;  1LK9 A;  2JJG A;  1B4X A;  2D7Y A;  4MQQ A;  3N7N A;  1W7L A;  2JGT A;  1G4X A;  1CL1 A;  3E9K A;  2FNI A;  1LS3 A;  2W7E A;  4E3Q A;  5FT4 A;  4ZLV A;  5K8B A;  3CQ4 A;  8AAT A;  2CFB A;  3AV7 A;  5FT8 A;  3WZF A;  4B98 A;  1T3I A;  2OAT A;  2JG2 A;  3GZC A;  3HBX A;  1CQ6 A;  3L8A A;  4OTL A;  3RQ1 A;  1TOE A;  3B1D A;  4IY7 A;  3DR4 A;  2D65 A;  3L44 A;  3AOV A;  3F6T A;  5D95 A;  3LVK A;  3CQ6 A;  2W7G A;  2W7F A;  4E3R A;  1BJN A;  3JU7 A;  1N2T A;  1ORD A;  4JEZ A;  4BHD A;  2AY3 A;  2CST A;  3GET A;  4RM1 A;  5F8V A;  2E7J A;  2VMN A;  1KL1 A;  3LG0 A;  3AEO A;  2DGK A;  5LH9 A;  3CAI A;  1P3W A;  2CH1 A;  5KTB A;  3B1E A;  1AJS B;  4OYT A;  1ZC9 A;  2BWN A;  2E54 A;  4GE4 A;  4OMA A;  2PO3 A;  1KKP A;  2Z61 A;  3I4J A;  3PDB B;  4WLH A;  4MQR A;  3G7Q A;  1LW4 A;  4OC9 A;  4OBV A;  3ZZK A;  4ZWM A;  3FDD A;  1GC2 A;  2Z20 A;  3FTB A;  1IAX A;  1S09 A;  1ECX A;  2VMX A;  2GQN A;  1WYT B;  3DXW A;  3HVY A;  3F9T A;  2QSR A;  1X28 A;  3UAK A; 
#chains in the Genus database with same CATH homology
 1ARS A;  2C81 A;  3ASB A;  3B8X A;  2FNU A;  4RJY A;  3E2Y A;  4KAM A;  4W91 A;  4DGT A;  1B5P A;  2Z9U A;  3DC1 A;  4F5F A;  1GEW A;  1D7V A;  2X3L A;  2W7K A;  2VIA A;  4MSO A;  4CXR A;  1BJ4 A;  5HDM A;  3GZD A;  1CZE A;  4CXQ A;  2DGL A;  2YCP A;  4H63 Q;  1MDX A;  4NOG A;  1ASC A;  2VGV A;  1W7N A;  3NYT A;  2YKY A;  3GBX A;  2BI1 A;  5EFS A;  2PB0 A;  1LW5 A;  3PGY A;  4PFN A;  4JF0 A;  1V72 A;  4TN4 A;  4ADE A;  3EI6 A;  3A9Z A;  4A6R A;  1SZK A;  1OXP A;  3NDN A;  1H0C A;  2D7Z A;  2YCT A;  3TFT A;  1CJ0 A;  1WYV B;  1WYU B;  2CJD A;  4ITG A;  3N4S A;  2BWO A;  3WGC A;  2VMW A;  3GR9 A;  4L0O A;  1IX6 A;  4R5F A;  4WBT A;  3AEL A;  2HUF A;  5BJ3 A;  4RIZ A;  4F5M A;  1IUG A;  1I29 A;  1XEY A;  1OHV A;  2YRI A;  4IYO B;  2ZY3 A;  3PIU A;  1J32 A;  2WK7 A;  2VMP A;  2VMY A;  3EIB A;  3R9A A;  2VLF A;  2QMA A;  3NU8 A;  1VJO A;  1M6S A;  3BCA A;  2GB3 A;  2VMU A;  1C7G A;  4BA5 A;  2EYQ A;  2W8J A;  4AO9 A;  4JEX A;  3FVS A;  2R5C B;  3AEJ C;  1DGD A;  3KGW A;  4ADB A;  1WKG A;  2QA3 A;  3FFR A;  3PDX A;  5FT6 A;  3RBL A;  5DB5 A;  2O0R A;  2BI5 A;  3FSL A;  4WD2 A;  4ATQ A;  3BV0 A;  5IWQ A;  1KMK A;  4XEW A;  3NU7 A;  4GE7 A;  2YKX A;  4LNJ A;  1ARG A;  1QJ3 A;  4EB5 A;  4IX8 A;  4CBS A;  4ZWV A;  2HOZ A;  4JEY A;  3MBB A;  1ARH A;  3FFH A;  3Q8N A;  1CZC A;  3R4T A;  1W23 A;  4WYE A;  1S0A A;  1B9H A;  1DJU A;  1BJO B;  3N5M A;  4QGR A;  5M4B A;  2ZYJ A;  1OHW A;  2G7J A;  3DU4 A;  1ASA A;  1YAA A;  2VMS A;  1AJS A;  3II0 A;  1TOJ A;  2W8U A;  3P1T A;  3K7Y A;  1SFF A;  2O1B A;  3PDB A;  4GSA A;  5G2P A;  3ZRR A;  2VMZ A;  2ZP7 A;  2CIN A;  1O4S A;  4UHM A;  3FQ8 A;  1TOI A;  4RIT A;  1AMS A;  1X29 A;  3WCN A;  1WYT A;  4M2K A;  3ELP A;  1BQA A;  2ZUK A;  4F5H A;  2E7U A;  2ZJG A;  4AZK A;  2CJG A;  2CY8 A;  1GEX A;  4F4E A;  2HZP A;  2V0Y A;  1DFO A;  1GC3 A;  2X8U A;  3ECD A;  3FVX A;  3FZ7 A;  4W1V A;  4Y0H A;  5EQC A;  2WB6 A;  1TOG A;  1IX7 A;  1YNU A;  3FZ8 A;  4EU1 A;  1FC4 A;  3FRK A;  1G7W A;  3E77 A;  3QHX A;  3NRA A;  2BIG A;  3I5T A;  3NTJ A;  1CQ8 A;  3F0H A;  2HUU A;  2Z1Y A;  3A8U X;  3N75 A;  2KFP A;  1YJY A;  1AX4 A;  4JE5 D;  4A6U A;  4ZAS A;  2GMU A;  5AX8 A;  4ADC A;  2ZC0 A;  4J8L A;  2BIE A;  1WYU A;  1WYV A;  1I43 A;  1S07 A;  1VP4 A;  2Z9X A;  3BN1 A;  2AEU A;  2G6W A;  4FFC A;  4IW7 A;  3VK3 A;  3TAT A;  3FDB A;  2YHK A;  1AHX A;  1AKC A;  4ZSY A;  1VEF A;  2D5Y A;  4IYO A;  2EZ1 A;  4W8I A;  3HDO A;  3EI8 A;  4F5I A;  3WY7 A;  3PA9 A;  3QI6 A;  2ORD A;  4Q76 A;  1ASE A;  4F5J A;  4ZDO A;  2GMS A;  1UU1 A;  3BC8 A;  3LY1 A;  1SZS A;  2OGA A;  3BWN C;  5G0A A;  1OAT A;  3HLM A;  2R5C A;  1RVY A;  2QBT A;  1M4N A;  1YIY A;  4LW2 A;  3RUY A;  1AMR A;  4JE5 A;  1WKH A;  1JS3 A;  2W8W A;  1GC4 A;  3A9Y A;  2BIA A;  4Q31 A;  3AEN B;  2Z1Z A;  5EAA A;  5G09 A;  1EQB A;  1AAW A;  1I48 A;  2DR1 A;  3CBF A;  4HF8 A;  4JEV A;  4A0G A;  4A6T A;  4ZAH A;  2W7M A;  2W8V A;  3AOW A;  4K2B A;  5E3K A;  3EZ1 A;  2YRR A;  5EUN A;  4U1T A;  5JAY A;  1IJI A;  1BJO A;  3MC6 C;  4EB7 A;  3FVU A;  3QN6 A;  5EUD A;  4P3M A;  2D61 A;  3DXV A;  3K28 A;  1C7O A;  4N0B A;  2VGS A;  3MAD A;  1FG3 A;  2X5D A;  2WK9 A;  4KXK A;  3MAF B;  1E5F A;  4ZSW A;  1JG8 A;  2DGM A;  2FYF A;  1IAY A;  1PMO A;  1AIB A;  1QIT A;  3H7F A;  1BS0 A;  1E5E A;  2C44 A;  1ELQ A;  3P6K A;  4MKK A;  2OKK A;  3LWS A;  1MDO A;  4ZM3 A;  1JF9 A;  3ACZ A;  3MEB A;  3JWA A;  4OBU A;  3FQ7 A;  5E4Z A;  1TAT A;  1AJR A;  1DJ9 A;  3DZZ A;  2EO5 A;  5HXX A;  1EJI A;  3M5U A;  3G8M A;  3B46 A;  4AZJ A;  4J5U A;  4R2N A;  3DR7 A;  2C0R A;  4MY5 A;  3NYS A;  3G0T A;  1XI9 A;  3FQA A;  2VGZ A;  1ASG A;  1GD9 A;  3EI7 A;  4GEB A;  5EIG B;  4MQP A;  4IXZ A;  1ASB A;  1ASF A;  3WLX A;  2YCN A;  1YIZ A;  4LNM A;  1AKB A;  1MDZ A;  2AY9 A;  2E7I A;  1N31 A;  5G2Q A;  4W1W A;  4ZDP A;  1V2E A;  1QZ9 A;  2DKJ A;  3LVL B;  3N4X A;  3TCM A;  2R0T A;  1MLY A;  3B1C A;  3JTX A;  1BT4 A;  2HOR A;  4UHO A;  3QPG A;  2FKI A;  3LVM A;  2JJH A;  3KE3 A;  5DJ9 A;  4A0H A;  2Z9W A;  9AAT A;  2BKW A;  1H1C A;  2D66 A;  1C9C A;  4XJM A;  2EPJ A;  1W3U A;  3D6K A;  2HP1 A;  3BCX A;  3AEM C;  5EUE A;  3H9X A;  3ISL A;  1SVV A;  1OHY A;  2W7I A;  2Z9V A;  1M7Y A;  2TPL A;  3JWB A;  1KKJ A;  2YKV A;  4RLG A;  4F5K A;  1ARI A;  3N4R A;  2CH2 A;  4PFF A;  2QB3 A;  2DKB A;  1C0N A;  3E2Z B;  1RV4 A;  2HUI A;  1GEY A;  4F5L A;  1M0O A;  3AEJ A;  3HT4 A;  2VMO A;  1Z3Z A;  3PD6 B;  4WYC A;  4WXB A;  3AEN A;  1ASD A;  3RI6 A;  3UE8 A;  3WKR A;  5G4J A;  3K40 A;  3WCO A;  3W1H A;  1G7X A;  3E2F A;  4R5Z A;  2VMV A;  3DYD A;  1ASN A;  2VGT A;  3EI5 A;  3EIA A;  1UU0 A;  3ASA A;  2VLH A;  3KGX A;  5M46 A;  2ZY4 A;  4WXF A;  1AMQ A;  3JZL A;  2Z67 A;  4FL0 A;  2JIS A;  4ATP A;  4LC3 A;  4A0R A;  3IHJ A;  5BJ4 A;  1AY4 A;  3MAF A;  4WB0 B;  1AKA A;  4I8A A;  4CVQ A;  4AO4 A;  3JW9 A;  2OGE A;  1PMM A;  3VK2 A;  4UQV A;  2VGW A;  4XK1 A;  5C6U A;  3A2B A;  4RKD A;  4IXS A;  4DQ6 A;  4ZDL A;  2O7C A;  3N0L A;  1UU2 A;  3ELE A;  3VAX A;  1IX8 A;  1M0P A;  1M0Q A;  2W7D A;  1N8P A;  1CQ7 A;  1YOO A;  4JEW A;  4LW4 A;  1W7M A;  2CB1 A;  1MGV A;  1S06 A;  1MAP A;  2JJF A;  4RKC A;  1TOK A;  4ISY A;  4O6Z A;  5LHA A;  1ART A;  4A72 A;  1RV3 A;  4WXG A;  5EIG A;  2WKA A;  3GJU A;  1D7S A;  3MAU A;  4IXO A;  3ZRQ A;  3T32 A;  3RBF A;  1DTY A;  3VP6 A;  1ASM A;  2BI2 A;  3BS8 A;  4H51 A;  5EAV A;  1LKC A;  4E77 A;  4P7Y A;  1AHG A;  1B5O A;  1WST A;  1Y4I A;  4Q6R A;  2Q7W A;  3FCR A;  2YOB A;  3GZD C;  1CS1 A;  4JF1 A;  5E5I A;  4K05 A;  4WYD A;  2XH1 A;  1C4K A;  4OT8 A;  4BQ0 A;  3MKJ A;  2X5F A;  2EGY A;  3WKS A;  1I41 A;  1ZOD A;  2AAT A;  3DOD A;  3NNK A;  2BI3 A;  5TF5 A;  5G4I A;  4Y0I A;  1X2A A;  2VYC A;  3COG A;  1O61 A;  3HQT A;  3RCH B;  1O69 A;  4XJP A;  3UWC A;  3BWO A;  2BI9 A;  1G4V A;  4M2M A;  3W1I A;  4Y0D A;  2QLR A;  1IVR A;  3AAT A;  3NYU A;  3AEP A;  4XJL A;  3USF A;  2ZSL A;  1M32 A;  3ZZJ A;  3PPL A;  3QBO A;  4WYF A;  4XAU A;  2F8J A;  2BHX A;  2NMP A;  1M0N A;  1OXO A;  3BWN A;  1D2F A;  1IBJ A;  3E2Z A;  1KMJ A;  4RAE A;  4DBC A;  3PD6 A;  3EI9 A;  4HVK A;  3HMU A;  3VK4 A;  1YJS A;  3FKD A;  2QB2 A;  4TMR A;  2AY4 A;  4WYA A;  2EH6 A;  2HP2 A;  1AIC A;  4CBR A;  2FM1 A;  1DJE A;  1AHY A;  2AY6 A;  1ASL A;  2HOY A;  2R5E A;  4UOY A;  3H14 A;  1RVU A;  1S08 A;  3OKS A;  4GRX A;  4GDY A;  4UHN A;  1AIA A;  2A1V A;  2ZSM A;  1AMA A;  3E6G A;  3QM2 A;  1QIR A;  1ELU A;  1GCK A;  3EUC A;  5J8Q A;  1QJ5 A;  3NUI A;  3LVJ A;  2VIB A;  4U2H A;  2AY1 A;  3FZ6 A;  4RJ0 A;  4XQ2 A;  2W8T A;  3MC6 A;  4ITX A;  2VMR A;  3WGB A;  4AOA A;  3FD0 A;  4WB0 A;  1V2D A;  2CJH A;  4ZM4 A;  2C7T A;  3QGU A;  1QGN A;  1BJW A;  2WK8 A;  4GE9 A;  1BKG A;  2VMT A;  2AEV A;  1J04 A;  4AH3 A;  3VOM A;  2RFV A;  2OKJ A;  2PB2 A;  2VI8 A;  3ATH A;  1LC7 A;  1C7N A;  1DGE A;  3CQ5 A;  4W5K A;  2AY5 A;  1LC8 A;  3BB8 A;  1PFF A;  2CAN A;  4A0F A;  2FQ6 A;  4A00 A;  2ZY2 A;  1AHE A;  1KL2 A;  4K2I A;  3WX9 A;  3I16 A;  1CL2 A;  2EZ2 A;  3W1J A;  2VMQ A;  4BA4 A;  1MLZ A;  1GC0 A;  1O62 A;  5DJ1 A;  4KYO A;  1AY8 A;  4BMK A;  2AY8 A;  1QIS A;  2AY7 A;  4F5G A;  3HL2 A;  3EZS A;  3GSB A;  1AY5 A;  1SZU A;  3ZRP A;  2OQX A;  1FG7 A;  1UKJ A;  1JS6 A;  4WYG A;  1YJZ A;  1SPA A;  1ZOB A;  2FN6 A;  2XBN A;  4LNL A;  5FT5 A;  4ADD A;  2D64 A;  4M2J A;  1TAS A;  2JJE A;  4WLJ A;  2HOX A;  2ZY5 A;  1TPL A;  1GDE A;  5D5S A;  5M49 A;  4WP0 A;  2YKU A;  1AHF A;  2W7L A;  3PJ0 A;  2BYL A;  3GWP A;  4R8D A;  4N0W A;  2GSA A;  1D7U A;  1Z7D A;  2VGU A;  3KKI A;  4XJO A;  5I92 A;  4PVF A;  2V1P A;  3OP7 A;  4PIW A;  2R2N A;  3RCH A;  1V2F A;  1BW0 A;  4Q75 A;  4OCA A;  3A9X A;  4EMY A;  2D63 A;  1B8G A;  4B9B A;  1TAR A;  4MGR A;  5HHY A;  2DOU A;  3AEM A;  3BCB A;  2BYJ A;  4MKJ A;  2W7H A;  5DX5 A;  5F9S A;  2CTZ A;  1DKA A;  2AY2 A;  3LV2 A;  1D7R A;  2BWP A;  1U08 A;  3DRD A;  5M4D A;  3NUB A;  1BQD A;  1LC5 A;  1X0M A;  4EFF A;  1SF2 A;  2VI9 A;  4TV7 A;  3NX3 A;  4K2M A;  3TFU A;  7AAT A;  4W1X A;  3IF2 A;  1MAQ A;  2W7J A;  3PAA A;  1AAM A;  1EG5 A;  4E1O A;  1PG8 A;  1B9I A;  1GBN A;  3TQX A;  1LK9 A;  2JJG A;  1B4X A;  2D7Y A;  4MQQ A;  3N7N A;  1W7L A;  2JGT A;  1G4X A;  1CL1 A;  3E9K A;  2FNI A;  1LS3 A;  2W7E A;  4E3Q A;  5FT4 A;  4ZLV A;  5K8B A;  3CQ4 A;  8AAT A;  2CFB A;  3AV7 A;  5FT8 A;  3WZF A;  4B98 A;  1T3I A;  2OAT A;  2JG2 A;  3GZC A;  3HBX A;  1CQ6 A;  3L8A A;  4OTL A;  3RQ1 A;  1TOE A;  3B1D A;  4IY7 A;  3DR4 A;  2D65 A;  3L44 A;  3AOV A;  3F6T A;  5D95 A;  3LVK A;  3CQ6 A;  2W7G A;  2W7F A;  4E3R A;  1BJN A;  3JU7 A;  1N2T A;  1ORD A;  4JEZ A;  4BHD A;  2AY3 A;  2CST A;  3GET A;  4RM1 A;  5F8V A;  2E7J A;  2VMN A;  1KL1 A;  3LG0 A;  3AEO A;  2DGK A;  5LH9 A;  3CAI A;  1P3W A;  2CH1 A;  5KTB A;  3B1E A;  1AJS B;  4OYT A;  1ZC9 A;  2BWN A;  2E54 A;  4GE4 A;  4OMA A;  2PO3 A;  1KKP A;  2Z61 A;  3I4J A;  3PDB B;  4WLH A;  4MQR A;  3G7Q A;  1LW4 A;  4OC9 A;  4OBV A;  3ZZK A;  4ZWM A;  3FDD A;  1GC2 A;  2Z20 A;  3FTB A;  1IAX A;  1S09 A;  1ECX A;  2VMX A;  2GQN A;  1WYT B;  3DXW A;  3HVY A;  3F9T A;  2QSR A;  1X28 A;  3UAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...