1AYIA

Colicin e7 immunity protein im7
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural comparison of the colicin immunity proteins Im7 and Im9 gives new insights into the molecular determinants of immunity-protein specificity.
pubmed rcsb
source organism Escherichia coli
molecule tags Bacteriocin
molecule keywords COLICIN E IMMUNITY PROTEIN 7
total genus 26
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1997-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1ayiA00
2VLPA 1BXIA 1CEIA 2K5XA 7CEIA 3U43A 1GXHA 2GYKA 1GXGA 2GZFA 3GJNA 1ZNVA 2JBGA 2VLOA 2VLNA 2GZGA 2GZIA 1UNKA 1IMQA 2GZJA 2K0DX 2JB0A 2WPTA 2GZEA 3GKLC 1MZ8A 4F37A 1EMVA 1UJZA 1AYIA 1IMPA 2VLQA 5EW5E 1E0HA 4QKOA 2NO8A 4UHPB 2JAZA 2ERHA 1FR2A
chains in the Genus database with same CATH superfamily
1L0IA 1Q86Q 3DS1A 2FADA 1RNIA 3RG2A 1Z6MA 1VQMP 3B5IA 1RO2A 3DS2A 3CPWO 1Q7YQ 1M1KQ 1EMVA 2FVFA 4XFZA 3G26A 1YI2P 2X2BA 4R0MA 3CE7A 2BHVA 1M6NA 2N6YA 2GYKA 1UNKA 2KWLA 5HVCA 2M8LA 5I4TG 5JPAA 5HGNA 4U0BA 1YJ9P 2PEMA 1VHNA 5F2NA 2CGQA 4CA3A 1BXIA 5CZDB 3U43A 2JQ4A 2GZIA 2FQ0A 2FVAA 2QNWA 2FACA 2CWOA 2PNGA 2N98A 1VQ4P 4H2XC 2XZ1C 1GXHA 2JBGA 3CC2P 3CCSP 2Z44A 3HYBA 2N50A 2MR7A 2AVAA 2KOOA 1QRJA 1KQSO 2E1MA 2WPTA 3CCLP 3GKLC 2KGDA 3G71P 3G1IA 1YITP 1IMPA 1EOQA 2AFDA 2JGPA 1NQ4A 3HZQA 2L4BA 1CEIA 2K5XA 4NEOA 4PXHB 2JU2A 3CCVP 2KGEA 2KGAA 3I55P 1OR5A 2PEIA 4BPFA 1VKUA 2K2QA 2FAEA 1N8RQ 1DNYA 3DS0A 4WYMA 2EHTA 1IUQA 3CCQP 4XFXA 2VLOA 2L22A 1K30A 1L0HA 2K0DX 2BUOA 3EJDA 2GZEA 4PH0A 4XFYA 1VQOP 5HGLA 1Q82Q 3NY7B 4QKOA 3G29A 1RO0A 2N5HA 2FQ1A 1QVFO 1KLPA 2K94A 1EIAA 1QVGO 2MVUA 2JB0A 2LOLA 2VSQA 2K0YA 2PEOA 4HKGA 4UHPB 2XZ0D 3MGEA 1KC8Q 2PEKA 7CEIA 1GPJA 2MY5A 1F80D 2GZGA 3RG6C 2OTLP 2KODA 1YJNP 1IMQA 2MF4A 2KW2A 1MZ8A 2EIAA 3NTEA 2P9XA 1AUMA 2GDXA 2XT1A 3CC7P 3G28A 3DS5A 2LTEA 1VQPP 4COPA 2LL8A 5F2KA 2JU1A 2GDWA 3LMOA 1ZMBA 3G1GA 2AFEA 2LIUA 3VRLC 1K9MQ 2FHSC 1VQLP 2KOSA 2ONTA 1M6EX 2M8PA 2KOPA 2MR8A 3GZLA 1JJ2O 2N5IA 3CCRP 3GJNA 3E2DA 3OW2O 2EG5A 1KD1Q 2K0XA 5BS2A 1A43A 1M90Q 2LIWA 2CG5B 2GDYA 4MRTC 5DCKA 2KOQA 1FR2A 2XV6A 3H47A 2L9FA 5KP7B 5BS1A 2FQ2A 1D1DA 4QNBA 2LPKA 3CMEP 1M74A 2M8NA 1DV5A 1K8AQ 3DPHA 1AYIA 4U0CA 4U0DA 2PEQA 1AF8A 1VQ8P 5KP8B 1HQBA 2KORA 3CCUP 2Z46A 1T8KA 2VLPA 1S72P 2CNRA 2N6ZA 1Q81Q 2VLNA 3DS4A 2JYGA 4IPYA 2GZJA 4U0AA 4H2YC 3P05A 4COCA 3CCMP 1UJZA 2DGYA 5HGMA 4BPHA 3M1MA 5HGOA 2EFJA 1W2BO 4BPGA 3B4QA 1VQ7P 2GZFA 2K93A 2QEXP 2CQ8A 2FVEA 2AF8A 3CXCO 4U0FA 2KR5A 2L6EA 1NJIQ 5EW5E 3CMAP 1E0HA 2LKIA 1VQ9P 2ERHA 2JO0A 3EJBA 4GR2A 2PY8A 2ROQA 1X3OA 2PENA 3GZMA 2KGCA 4XROA 1YJWP 4PH1A 1ACPA 2Z45A 3I56P 1VQ6P 3G0VA 1YIJP 4F37A 4H2WC 3H4EA 1VQNP 3CD6P 4M0IA 3CCJP 2KG6A 3G6EP 2OTJP 3G21A 2JYLA 2M5RA 1ZNVA 3G4SP 3CCEP 2KG9A 1E6JP 1YHQP 3EJEA 1BAJA 5HV8A 2EHSA 5KP6B 2MD9A 1HY8A 3DTJA 3Q20A 2MVVA 2NO8A 2JAZA 4IZ6A 2QA4P 2KG8A 2L0QA 2LMLA 1A8OA 5EJDA 1GXGA 1VQ5P 5F2OA 4XRQA 4PWVB 2DNWA 2LF4A 4GR6A 3WBHA 2OARA 2VLQA 2XXMA 4DG9A 3LRYA 2K92A 2PEJA 1VQKP 4U0EA 3H0DA 3CC4P 1K73Q 3DS3A
chains in the Genus database with same CATH topology
2VLPA 1BXIA 1CEIA 2K5XA 7CEIA 3U43A 1GXHA 2GYKA 1GXGA 2GZFA 3GJNA 1ZNVA 2JBGA 2VLOA 2VLNA 2GZGA 2GZIA 1UNKA 1IMQA 2GZJA 2K0DX 2JB0A 2WPTA 2GZEA 3GKLC 1MZ8A 4F37A 1EMVA 1UJZA 1AYIA 1IMPA 2VLQA 5EW5E 1E0HA 4QKOA 2NO8A 4UHPB 2JAZA 2ERHA 1FR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLP A;  1BXI A;  1CEI A;  2K5X A;  7CEI A;  3U43 A;  1GXH A;  2GYK A;  1GXG A;  2GZF A;  3GJN A;  1ZNV A;  2JBG A;  2VLO A;  2VLN A;  2GZG A;  2GZI A;  1UNK A;  1IMQ A;  2GZJ A;  2K0D X;  2JB0 A;  2WPT A;  2GZE A;  3GKL C;  1MZ8 A;  4F37 A;  1EMV A;  1UJZ A;  1AYI A;  1IMP A;  2VLQ A;  5EW5 E;  1E0H A;  4QKO A;  2NO8 A;  4UHP B;  2JAZ A;  2ERH A;  1FR2 A; 
#chains in the Genus database with same CATH topology
 1L0I A;  1Q86 Q;  3DS1 A;  2FAD A;  1RNI A;  3RG2 A;  1Z6M A;  1VQM P;  3B5I A;  1RO2 A;  3DS2 A;  3CPW O;  1Q7Y Q;  1M1K Q;  1EMV A;  2FVF A;  4XFZ A;  3G26 A;  1YI2 P;  2X2B A;  4R0M A;  3CE7 A;  2BHV A;  1M6N A;  2N6Y A;  2GYK A;  1UNK A;  2KWL A;  5HVC A;  2M8L A;  5I4T G;  5JPA A;  5HGN A;  4U0B A;  1YJ9 P;  2PEM A;  1VHN A;  5F2N A;  2CGQ A;  4CA3 A;  1BXI A;  5CZD B;  3U43 A;  2JQ4 A;  2GZI A;  2FQ0 A;  2FVA A;  2QNW A;  2FAC A;  2CWO A;  2PNG A;  2N98 A;  1VQ4 P;  4H2X C;  2XZ1 C;  1GXH A;  2JBG A;  3CC2 P;  3CCS P;  2Z44 A;  3HYB A;  2N50 A;  2MR7 A;  2AVA A;  2KOO A;  1QRJ A;  1KQS O;  2E1M A;  2WPT A;  3CCL P;  3GKL C;  2KGD A;  3G71 P;  3G1I A;  1YIT P;  1IMP A;  1EOQ A;  2AFD A;  2JGP A;  1NQ4 A;  3HZQ A;  2L4B A;  1CEI A;  2K5X A;  4NEO A;  4PXH B;  2JU2 A;  3CCV P;  2KGE A;  2KGA A;  3I55 P;  1OR5 A;  2PEI A;  4BPF A;  1VKU A;  2K2Q A;  2FAE A;  1N8R Q;  1DNY A;  3DS0 A;  4WYM A;  2EHT A;  1IUQ A;  3CCQ P;  4XFX A;  2VLO A;  2L22 A;  1K30 A;  1L0H A;  2K0D X;  2BUO A;  3EJD A;  2GZE A;  4PH0 A;  4XFY A;  1VQO P;  5HGL A;  1Q82 Q;  3NY7 B;  4QKO A;  3G29 A;  1RO0 A;  2N5H A;  2FQ1 A;  1QVF O;  1KLP A;  2K94 A;  1EIA A;  1QVG O;  2MVU A;  2JB0 A;  2LOL A;  2VSQ A;  2K0Y A;  2PEO A;  4HKG A;  4UHP B;  2XZ0 D;  3MGE A;  1KC8 Q;  2PEK A;  7CEI A;  1GPJ A;  2MY5 A;  1F80 D;  2GZG A;  3RG6 C;  2OTL P;  2KOD A;  1YJN P;  1IMQ A;  2MF4 A;  2KW2 A;  1MZ8 A;  2EIA A;  3NTE A;  2P9X A;  1AUM A;  2GDX A;  2XT1 A;  3CC7 P;  3G28 A;  3DS5 A;  2LTE A;  1VQP P;  4COP A;  2LL8 A;  5F2K A;  2JU1 A;  2GDW A;  3LMO A;  1ZMB A;  3G1G A;  2AFE A;  2LIU A;  3VRL C;  1K9M Q;  2FHS C;  1VQL P;  2KOS A;  2ONT A;  1M6E X;  2M8P A;  2KOP A;  2MR8 A;  3GZL A;  1JJ2 O;  2N5I A;  3CCR P;  3GJN A;  3E2D A;  3OW2 O;  2EG5 A;  1KD1 Q;  2K0X A;  5BS2 A;  1A43 A;  1M90 Q;  2LIW A;  2CG5 B;  2GDY A;  4MRT C;  5DCK A;  2KOQ A;  1FR2 A;  2XV6 A;  3H47 A;  2L9F A;  5KP7 B;  5BS1 A;  2FQ2 A;  1D1D A;  4QNB A;  2LPK A;  3CME P;  1M74 A;  2M8N A;  1DV5 A;  1K8A Q;  3DPH A;  1AYI A;  4U0C A;  4U0D A;  2PEQ A;  1AF8 A;  1VQ8 P;  5KP8 B;  1HQB A;  2KOR A;  3CCU P;  2Z46 A;  1T8K A;  2VLP A;  1S72 P;  2CNR A;  2N6Z A;  1Q81 Q;  2VLN A;  3DS4 A;  2JYG A;  4IPY A;  2GZJ A;  4U0A A;  4H2Y C;  3P05 A;  4COC A;  3CCM P;  1UJZ A;  2DGY A;  5HGM A;  4BPH A;  3M1M A;  5HGO A;  2EFJ A;  1W2B O;  4BPG A;  3B4Q A;  1VQ7 P;  2GZF A;  2K93 A;  2QEX P;  2CQ8 A;  2FVE A;  2AF8 A;  3CXC O;  4U0F A;  2KR5 A;  2L6E A;  1NJI Q;  5EW5 E;  3CMA P;  1E0H A;  2LKI A;  1VQ9 P;  2ERH A;  2JO0 A;  3EJB A;  4GR2 A;  2PY8 A;  2ROQ A;  1X3O A;  2PEN A;  3GZM A;  2KGC A;  4XRO A;  1YJW P;  4PH1 A;  1ACP A;  2Z45 A;  3I56 P;  1VQ6 P;  3G0V A;  1YIJ P;  4F37 A;  4H2W C;  3H4E A;  1VQN P;  3CD6 P;  4M0I A;  3CCJ P;  2KG6 A;  3G6E P;  2OTJ P;  3G21 A;  2JYL A;  2M5R A;  1ZNV A;  3G4S P;  3CCE P;  2KG9 A;  1E6J P;  1YHQ P;  3EJE A;  1BAJ A;  5HV8 A;  2EHS A;  5KP6 B;  2MD9 A;  1HY8 A;  3DTJ A;  3Q20 A;  2MVV A;  2NO8 A;  2JAZ A;  4IZ6 A;  2QA4 P;  2KG8 A;  2L0Q A;  2LML A;  1A8O A;  5EJD A;  1GXG A;  1VQ5 P;  5F2O A;  4XRQ A;  4PWV B;  2DNW A;  2LF4 A;  4GR6 A;  3WBH A;  2OAR A;  2VLQ A;  2XXM A;  4DG9 A;  3LRY A;  2K92 A;  2PEJ A;  1VQK P;  4U0E A;  3H0D A;  3CC4 P;  1K73 Q;  3DS3 A; 
#chains in the Genus database with same CATH homology
 2VLP A;  1BXI A;  1CEI A;  2K5X A;  7CEI A;  3U43 A;  1GXH A;  2GYK A;  1GXG A;  2GZF A;  3GJN A;  1ZNV A;  2JBG A;  2VLO A;  2VLN A;  2GZG A;  2GZI A;  1UNK A;  1IMQ A;  2GZJ A;  2K0D X;  2JB0 A;  2WPT A;  2GZE A;  3GKL C;  1MZ8 A;  4F37 A;  1EMV A;  1UJZ A;  1AYI A;  1IMP A;  2VLQ A;  5EW5 E;  1E0H A;  4QKO A;  2NO8 A;  4UHP B;  2JAZ A;  2ERH A;  1FR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...