1AYM2

Human rhinovirus 16 coat protein at high resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym200
1RUE1 4YVSA 2FZ1A 3JBG2 3VBRB 4Q4W3 3J8F3 2RS51 1R1A2 4RR3C 2FZ2A 1AR81 3VBSC 4CDUC 3VBHB 1SMVA 1VRH3 4FTEA 3JBG1 2RR11 1R092 2R062 5BNNB 1VBA3 2BPA2 1R1A1 5CFCA 3NAPA 4QPIA 1AYN3 1COV2 2RS12 2ZAHA 1EAH3 3ZFGC 1Z7S3 5ACA1 3ZFEB 1K5MA 1VBD3 2WFF1 4WM7A 5J98B 1FOD1 5C8CC 1BMV2 1R081 1CD3G 4RS5C 2Y26A 4GB33 1MQTA 5AC93 2WZR2 1BBT3 4RQPA 3ZFGB 4Q4W2 3J8F2 1BMV1 4JGZA 1HRV1 5C8CB 1VRH2 5CFDA 4Q4W1 3VBUC 5L7OA 4N43C 1AYN2 1Z7S2 1VRH1 3VBFC 3ZFFC 1VBD2 4Q4Y3 1TMF3 2R043 1VBA1 4GH4A 5A32A 1AYN1 2BBVA 1EAH1 1QJX2 1Z7S1 1NCQA 2MEV2 1VBD1 5A33B 3CJIB 3ZFFB 4RHV2 1ND3C 4SBVA 1MEC3 4GB31 1AR73 5AC91 1RUF3 3TN93 4CEYA 3CJIA 1BBT1 1B35A 4AEDC 1QJZA 4CDXB 2XPJA 1X33A 5JZGB 1VBC2 4Q4X2 5FMOS 1CJDA 1RMU3 4Q4Y2 2R042 4CDWB 5GKAC 4AEDB 4CEWA 1VB4A 4Q4Y1 1TMF1 1NA1A 2RS31 1H8TA 3VDDC 2HWF2 5BNOC 1PVC3 1MEC2 1AR72 4JGYA 1RUF2 4QPGC 2R072 1ZBE2 4CDQC 3VBOB 5C9AB 1PGL2 1MEC1 1AR71 1RUF1 3TN91 5BNOB 1RUJ1 1VBE2 2HWC3 4YVWB 1VB2A 4QPGB 4N53B 4PDWB 1R093 2R063 5K0UC 1POV0 1RMU1 5ABJB 1D4M3 1COV3 2RS13 3DPRA 1AL22 4N53A 5ABJA 1AR93 1RUC3 1FPN2 5K0UB 2GSYA 2WZR3 1PVC1 2XBO3 1QJY3 4EJRA 1AR63 4Z92B 2HWC2 5D8AC 3VBRA 5C4WB 1X36A 3LOBA 1D4M2 2HWC1 3VBHA 1EV12 1K5MC 4RR3B 5C4WA 5BNNA 1R091 2R061 3VBSB 4CDUB 5D8AB 2TBVA 1AR92 1RUC2 1D4M1 1COV1 2RS11 1MQTC 1QJX3 3ZFEA 4RR3A 1RUI3 2MEV3 3VBSA 4RQPC 2XBO2 1AR91 1QJY2 2ZZQA 1RUC1 4RHV3 1AR62 2WZR1 1PGW2 4RS5B 3ZFGA 1QJU2 2XBO1 4BCUA 1QJY1 3J8F1 5FOJB 2WS92 1AR61 1VBC3 5C8CA 4IV3C 4Q4X3 1PGW1 1NY72 1RUD2 1RVF2 1RUG2 1PO13 1NCQC 1OHFA 1RUI2 3VBUB 4N43B 4IV3B 1PO22 2HWF3 1C8NA 3VBFB 1TME2 1QJX1 4CEYC 5A33A 1VBB2 1RUI1 2MEV1 2R073 1ZBE3 1B35C 1M06G 3ZFFA 1HQNA 4RHV1 3JB4C 1HX6A 2VQ0A 4WM8C 1ND2C 4CDXA 1ND3B 1VBE3 2WLPA 3ZXAC 2WWSA 5JZGA 4IV1C 1VBC1 4CEWC 4Q4X1 1PO12 1A6CA 2R041 1H8TC 1AL23 4CDWA 4WM8B 2X5IC 1ND2B 4AEDA 3S6PA 1NOVA 4IV1B 2BFUL 3IDEA 1FPN3 1HXS3 1V9U3 2HWF1 2RMU2 1IHMA 1POV3 1AYM3 3VDDB 2R071 4Q4V2 1ZBE1 3VBOA 5C9AA 2HWE2 1PGL1 5BNPC 3VDDA 4CDQB 5BNOA 4FTBA 4YVWA 1VBE1 3DPRC 4QPGA 1EV13 5DDJ2 4PDWA 1HRI2 1NCRC 1OOPC 2HWB3 1ZBA2 1AL21 2BUKA 4YVSC 1HXS2 1V9U2 1AUYA 1AYM2 1F2NA 1W39A 1NCRB 1RUH3 1FOD3 2PLV2 5K0UA 1OOPB 1FPN1 1HXS1 1PIV3 1V9U1 1QJU3 1POV1 4YVSB 5CFCC 3NAPC 4QPIC 2WS93 3VBHC 2RS52 1AR82 5BNNC 4WM7C 1RUD3 1ASJ3 2HWB2 1RVF3 2RR12 1FMD3 1RUG3 3ZFEC 1EV11 1OPOA 5CFCB 3NAPB 4NWWA 4QPIB 4CDUA 5D8AA 5ACA2 2HWB1 1PO23 2WFF2 1K5MB 1TME3 4WM7B 1RUH2 1FOD2 4JGZC 2ZTNA 1R082 1VBB3 1PIV2 5CFDC 2QQPA 3JB8A 1MQTB 5L7OC 1E57A 1RUH1 4RQPB 1PIV1 4RS5A 1HRV2 1VAKA 4GH4C 4GMP3 1QJU1 4JGZB 1ASJ2 2WS91 5CFDB 1FMD2 4Y5Z0 5L7OB 2RM23 5LK7B 1NY71 1RUD1 2IZWA 1ASJ1 4GMP0 1RVF1 1RHI3 1FMD1 1VBA2 4GH4B 1RUG1 5A32B 3VBUA 4N43A 3CJIC 1EAH2 4IV3A 1F8VA 1PO21 3VBFA 1DDLA 1NCQB 2DF7A 2RMU3 1TME1 2GH8A 2RS33 1VBB1 4Q4V3 4CDXC 4GB32 5AC92 5JZGC 4CEYB 1BBT2 2HWE3 4LLFA 1B35B 2RM22 1ND3A 1QQP3 1NA1C 4GMP1 4CDWC 5DDJ3 1RHI2 1HRI3 1RUJ3 4FTSA 4JGYC 1PO11 5FMOL 2RM21 1ZBA3 1C8M3 3JD73 4CEWB 4WM8A 1RHI1 1ND2A 2BFUS 1TMF2 1NA1B 2RS32 4IV1A 2HWD3 1H8TB 4NWVA 2X5IB 2PLV3 3VBOC 4JGYB 5C9AC 1BEV3 2RMU1 1RUE3 1AL0G 2X5IA 4Q4V1 4YVWC 1QQP2 3TN92 2RS53 4N53C 4PDWC 1AR83 3FBMA 3M8LA 2HWE1 1RUJ2 1NG0A 4CDQA 5J96B 4RFT0 5ABJC 3JBG3 2RR13 1QQP1 1C8M2 3JD72 1WCDJ 1RB8G 1R1A3 5BNPB 5DDJ1 1RMU2 1HRI1 3DPRB 5ACA3 2HWD2 2WFF3 1ZBA1 4FSJA 1C8M1 3JD71 5BNPA 1GFF2 1R083 3HAGA 1BEV2 3VBRC 1RUE2 2HWD1 1PVC2 1AYM1 4Y4YA 1NCRA 1OOPA 2PLV1 1BEV1 5C4WC 1HRV3
chains in the Genus database with same CATH superfamily
3ZDSA 1CAUA 2V5YA 4YVSA 3DF0A 2VOTA 2WJSA 1XE8A 3GHMA 3O1RA 3H8OA 3JBG2 3N9MA 5FO7B 3BTZA 4TLGA 4AQ2A 4MGSA 2AGSA 3ZSKA 3A0NA 4AWDA 2BV4A 4BJ0A 4A3ZA 4DXZA 5FYMA 1W90A 3BYWA 3VBSC 4AZZA 1N47A 4V2WA 3SH4A 4JDMA 3WF2A 2CAUA 1VRH3 2P6CA 3KWVA 2VCBA 3ORJA 5IT6A 3BIWE 1KDKA 1R092 4AGVA 5BNNB 1VBA3 2QVSB 1J3QA 3QCWA 3ROUA 3PTRB 3BODA 4L11A 5T5JA 3SCHA 4QX0A 3ZPYA 4ZY9A 2ZAHA 4GAZA 4PT6A 3NJYA 1W2TA 2WFF1 4LBQB 4BISA 2FDGA 4RL7A 2YYOA 4GA9A 2RDQA 4HONA 5FZHA 3AB0A 1FOD1 1BMV2 3OBRA 2VXJA 4RS5C 2Y26A 1FI2A 2QZ2A 1W6OA 4LBQA 3WVJA 1HJGA 2WZR2 4Z07A 5FLIA 3TB0A 2PHUA 4ASLA 4AVVA 2VOWA 4Q0QA 5CKQA 3ZFGB 2AREA 1NXD1 1YHFA 1UW8A 4BYYA 2WN3A 2K2SA 2VMFA 4IQPA 1NLQA 1ENQA 4BIFA 3N4MA 3ZSJA 5FK8A 3T09A 1D7PM 2H0VA 2ZMNA 5H9RA 5BXXA 4D6RA 1PHMA 1FX5A 4FPYA 5FZ1A 1BLZA 4CU7A 4K20A 3VBUC 5L7OA 3I97A 4MHRA 5BUVA 5FJKA 4Q27A 2VBBA 4ZU5A 4Y1UA 1Z7S2 1LOFC 1G9DA 1W3VA 2ZGLA 1VBD2 5IVBA 1LODA 2NQYA 3ZYBA 5A32A 2R043 3U4SA 2XR4A 4HKWA 4KH9A 2YU2A 4UFHA 1DQ1A 1AYN1 4JQTA 4MADA 1QJFA 1QJX2 4LO5B 4FAGA 2L9LA 3EHKA 4XMIA 1NCQA 3T08A 4PLNA 4D69A 3PUSA 2E26A 2XJRA 4KBBA 4XCBA 5DUWA 4AFCA 4P02B 2GH2A 3ZFFB 4RHV2 4ZHNA 1O5LA 2YGMA 3GZUC 3KB5A 4DRRA 2HBTA 5FV3A 4CTEA 1SEFA 3RJRA 4E4DX 1BBT1 4V1PA 3SH3A 4LITA 5DAXA 3H8UA 4CDXB 4QXCA 1CIYA 2A70A 2HBUA 2ORXA 2XB6C 3ECQA 2FBEA 1X33A 2QE3A 2XJTA 5JZGB 3NJZA 4HK9A 3IZOA 4ONUA 2K46A 1OD5A 4IUGA 1DYKA 5FMOS 2WWJA 2PA7A 5AVPA 1SBEA 5K7PA 4CDWB 1ULGA 4K9SA 3LA2A 5IAVA 2B39A 2NN8A 4HVQA 2VY0A 3FFQA 4GJYA 4HN0A 1JHJA 1ZZBA 3A4UA 4BWOA 4IESA 1RXFA 2G9FA 3VDDC 2EIDA 3H8RA 5BNOC 4DMIA 1MEC2 4AVCA 1P8JA 5M0TA 4DNYA 1IS4A 1UZZA 3ZM8A 4QPGC 4KU7A 1D2SA 3POWA 1GQHA 2J1TA 4Q5OA 1XYNA 4HSLA 5E89A 2WUHA 2D98A 2O8OA 4AFBA 2GMPA 1WLTA 3M4FA 1KGYA 2CHHA 4YGDA 1AR71 5I91A 1LGCA 3CO2A 1RUF1 4PF1A 3S5QA 4F83A 1JW6A 4LO6B 1ENSA 1W9WA 1SBDA 4Y4RA 2VVDA 4GALA 2G1MA 5LK5A 3E5UA 3K75B 3BN6A 4C0BA 1W2UA 1OA4A 1R093 3VKLA 2PHDA 2V73A 3NO8A 1POV0 2MHFA 3MUZ1 4NHXA 1RMU1 1KS4A 2PQSA 1D4M3 2VZOA 2XJPA 5FJHA 1I3HA 4ZXKA 1SZBA 2NYYA 2YGLA 5LASA 1JYVA 5IK4A 3M2MA 1YFXA 2DU1A 4QB6A 5HI0A 4TWTA 1XE0A 2A6VA 4YRDA 1F4AA 2LM3A 4ITCA 1E5RA 4HOOA 1UYZA 3GBGA 4NE9A 5L36A 5F9TA 2GSYA 2WRAA 4B3NA 2WZR3 3DN7A 4Q0UA 4AHWA 3POJA 3TOJA 2XBO3 4XE9A 1QJY3 2J1RA 3HJRA 3PLQA 5FP8A 5FXXA 3O1SA 5K4LA 3T0BA 5FOBB 4OQ9A 3I3DA 4Z2WA 5I8YA 2WR9A 2GZWA 3VBRA 4I30A 1J58A 3VV1A 1NT0A 4AI1A 5C4WB 2MNGA 4S2GA 3LOBA 1Q5OA 2WDBA 5LA0A 1ZZ7A 4IEUA 2CGOA 2HWC1 2VOKA 2VPVA 4CZSA 4COVA 5C7GA 3JQXA 4JC1A 1MS9A 4CVUA 1LENA 4RR3B 2JWPA 5C4WA 2R061 4FOQA 1U5XA 1GBGA 4M01A 4MO3M 4CDUB 3C8XA 1AR92 2P6HA 1Y3TA 2XHNA 1RUC2 3MDPA 3VD7A 1H6XA 1QJX3 1DGRN 1BKZA 4QKNA 4RR3A 2WIIB 1RUI3 2YC4A 4UBGA 5EXOA 1AX1A 1JTZX 4IGOA 2OKXA 1O8PA 3ZYGA 1RXGA 5FPZA 1DZTA 3WW2A 3WNKA 3IM0A 4RHV3 4ZU7A 3H9AA 4MVTA 1AR62 3IMNA 4XFGA 4BZ4A 2J42A 1PGW2 4XJAA 5LBBA 3RMXA 5KHHA 5ISLA 4OHYA 3RI9A 5GALA 5BYNA 5GZFA 3J8F1 2Y0OA 1MPXA 4U36A 2WS92 4BK5A 1KJRA 3P6BA 5H9QA 4IEXA 1GWKA 4BQYA 3KQ4B 4P00B 5A3OA 4K8RB 2XLAA 4JAAA 3K46A 1H1AA 2PHFA 3I2JA 2UY8A 1HIXA 3UL2A 1OUSA 3LFIA 3GGLA 3WF4A 1PO13 4DUWA 5C5TA 1NCQC 2ZOEB 5F32A 1DQ0A 3WG3A 5HV4A 4N43B 4QX2A 2D6KA 1OI6A 4IV3B 3WQ7A 4Y1VA 2PHLA 4YFZA 4MGTA 1QWRA 3E6BA 1DFQA 5EV7A 3M1HA 1WW7A 5CYYA 3WX5A 1PNFA 4C8DA 4XXPA 3K2OA 5A33A 4CP2A 5GLUA 2MEV1 2VW2A 4M4RA 4XETA 4LORA 2UYBA 2QZ3A 1Y43B 3WDUA 1XB9A 4XZPA 3OY8B 1UY0A 3ACLA 4N90A 2BOJA 1DG6A 3CZUA 4NIIA 4WM8C 2XQRA 1ND2C 1ND3B 3ZXAC 2VULA 4P9LA 5KR7A 1RYYA 4XF9A 5F3CA 2D7FA 3AYDA 4IV1C 1SBFA 1KEXA 3MBWA 1VBC1 1ZA7A 4JTNA 4B1MA 4EROA 4N8MA 1HN0A 1REDA 2PAKA 2VMIA 1A6CA 4Q0VA 2FDIA 2F6BA 2BJSA 4UFIA 3OYWA 4XFCA 1C1FA 4E2GA 3VKFC 2WQ8A 2X5IC 3KV4A 1JBCA 3N7MA 4AHZA 1Q8QA 1HQLA 3POEA 1S0JA 4OYUA 5FREA 5T50A 4CCKA 2BEOA 1V6MA 4RYDA 3TYJA 1TNRA 1V9U3 2RMU2 5CKNA 2VMEA 1IHMA 5FZCA 4AL9A 4NO4A 4X8NA 5A7NA 1CX1A 3AYCA 1F31A 1AYM3 1W05A 3ILNA 4UWDA 5KXBA 3H7JA 3VBOA 1S0CA 4YW7A 5JXJA 2C6SA 3MF6A 2ZGNA 4EYUA 4C90A 5FZ4A 1OVSA 5DXDA 4O65A 4BIOA 4YPJA 2VQAA 4YVWA 2DFBA 1VBE1 2ZGSA 3C7FA 5KHGA 4K8FA 2OQ6A 3RG0A 5JAXA 3UJOA 1CAXA 1KS5A 3UKTA 3VHNA 5IUQA 1ZBA2 1UIJA 2ZGOA 2WAOA 3WQ0A 2ZX4A 3TWIA 1GP5A 1JZ2A 3I3MA 1IOAA 1YQ8A 4XJ8A 1YFWA 4DOUA 4XPVA 5JXIA 3I2IA 1S0DA 4S2HA 3AVRA 1F2NA 1JHNA 4CCCA 3O1MA 1W39A 2A3YA 1NCRB 1RUH3 1FOD3 2PLV2 4HPKB 4MSVA 5K0UA 5LA9A 3VD3A 3CBNA 3T2TA 1JI6A 1RUOA 1JYWA 3HQRA 1ULPA 4Y3OA 4AG4A 1UO9A 4NROA 5G04L 2E9QA 5CFCC 2WS93 3PUIA 4WVVA 3RRDA 1JYNA 4DS0A 5FMBA 3AP4A 3DYPA 4WM7C 4XMAA 2QQMA 1ASJ3 2HWB2 3HMYA 2QCSB 2OX0A 2ZEYA 4AF9A 1W9FA 1FMD3 1UAIA 1CJPA 2VOXA 2AUYA 2C9KA 3FBYA 4AEJA 3NKGA 5C5UA 1XNTA 1W8HA 2OW4A 1JZ3A 5C3SA 3Q8EA 1E5IA 5FY9A 2AEYA 4E8CA 1ULFA 5D8AA 3PMSA 1WMDA 2UYAA 1K5MB 5IVFA 1S2KA 3LOIA 1CN1A 3KT1A 2VCAA 1Q8OA 1G9FA 5FP7A 3LDRA 1PIV2 4NAMA 2CAVA 2UWAA 2QNKA 3SKVA 2RJLA 3JB8A 2QKDA 2VE1A 1V6LA 3MFCA 4JRLA 4IEQA 1TNFA 4OUSA 4RGGA 1VIWB 1OXCA 3EYPA 1VAVA 2EA7A 1LCLA 4OI1A 2WNVB 1O59A 3IT8A 5FYIA 2G9ZA 3T4HB 4FOWA 5CFDB 2JJ6A 2QJVA 3RPQA 2IXCA 5IK5A 1W03A 2PXJA 2C0ZA 4HANA 4Y20A 4LQRA 3R05A 3Q8BA 3ACHA 1WCQA 3RFRA 1H1IA 4GMP0 1RVF1 4IW3A 5A6QA 1XNDA 3ON7A 2RJKA 2TEPA 1NXMA 2JEMA 4B7KA 4MLOA 5J3UA 5FZ3A 4I0BA 2Z79A 2IUWA 5FPVA 3DKWA 4CPBA 1PO21 3H8XA 3KZ4C 2RMU3 2Z5WA 3FMGA 1H4GA 2AACA 3D3AA 4QMAA 4XFIA 5FPUA 4CP9B 5AC92 5F8PA 4FBFA 3WP6A 4XTMA 2Q8OA 5FPXA 5FTTC 4GJZA 1CAVA 4IERA 4Q8LA 3VHRA 3PU3A 1ENRA 2BQPA 2DURA 1YO8A 3HOBA 3J9SA 1W6QB 3K77A 2JD9A 2BTVC 3ZXKA 4ARXA 1ZNPA 2R16A 3LWCA 3LEMA 4WV8A 4GMP1 3RZLA 3MIHA 3GZEA 2YB7A 5FY7A 1V70A 3RMYA 3PU8A 4UI9L 3U37A 3T1MA 2VO5A 1DF0A 4TXWA 4JGYC 5FK7A 5FMOL 5FY5A 5JSRA 1ZBA3 1ULEA 2HEVF 1TEIA 3MIDA 1C8M3 4M00A 2FHRA 4UW5A 4PIXA 3I2OA 3KT7A 4BB3A 4CSWA 1LOAA 1RHI1 2BFUS 1FAYA 4LJHA 1NA1B 5B4XA 2HWD3 3AMNA 3FLPA 2CSGA 5FIXA 5AVAA 3VBOC 2PLV3 2WZ8A 3SHRA 2XLFA 3ZXDA 3IBMA 5FBJA 2CL2A 2NMNA 2D3SA 1WA6X 1OKQA 1RUE3 1QNYA 2VCCA 3KCCA 5IWFA 4YVWC 4UFJA 1QQP2 4PLOA 4PLMA 1OFSA 4N53C 3FUOA 4QU1A 3LEGA 4BH9A 4CDQA 4DPNA 5J96B 2NM1A 2BZDA 4Q2FA 1RITA 2Y6LA 3V56A 2FCVA 4PHZA 3HNMA 4YYOA 1IG0A 5FKBA 4LBJA 1RB8G 3ZYHA 4M0HA 3EJKA 5JWPA 4X6QB 2D6PA 4YW1A 1QGLA 4LBQD 2D3PA 4CCOA 5JPNB 2WQ4A 1L7LA 4QX1A 1Q8SA 5KHJA 3JZVA 3AKSA 5KXDA 5T5LA 3ZIWA 1W3XA 5F5QA 1SLTA 3ME2A 2YV8A 1XQNA 2WO1A 2JE8A 4OI4A 5BPXA 2P3YA 1E5SA 3CNAA 4Y33A 3U14A 2JKBA 4OMCA 1OOPA 4Q1RA 2VUCA 2ZJCA 1BEV1 2E6VA 1LHOA 4GD4A 1U5YA 3PTYA 4GKXA 4H14A 1ODNA 4MXVA 5L73A 3RZJA 3O14A 4DINB 1I6XA 2FDHA 3AJZA 3DECA 4Q4W3 1H4HA 2RS51 3J8F3 1R1A2 3ZX7A 3VD9A 3OUHA 4IE5A 1OD3A 4XEZA 4XF0A 5KC6A 3T0DA 3VBHB 2W1QA 1YNAA 2ET7A 2FDKA 1UOJA 1LULA 4FTEA 4BLJA 3JBG1 2RR11 4I02A 3ASIA 4JHTA 4LT5A 4LK7A 5FMDA 5JSPA 3LFMA 3NAPA 4QPIA 3L2HA 4FCAA 5FYBA 1COV2 2RS12 4WZCA 5CBLA 2LALA 3GJBA 2GMMA 5J7MA 4LIUA 2VZSA 4D8MA 4I0AA 1MVEA 4W6YA 4OFGA 4META 5C8CC 4ASMB 1R081 1PZ9A 1CD3G 5C3OA 3J7HA 4WVZA 3P3NA 5EFUA 4HVRA 5AC93 4NAOA 2J1VA 3O0XA 2OZ6A 1LAJA 5FZIA 3NJVA 1LOCA 4GKYA 1UF2C 3ZN4A 1BMV1 3MIGA 4NOTA 5JCTA 1LEDA 2NLRA 2R1BA 4M3CB 2DCYA 3PHMA 4JGZA 5DQ0A 1SFPA 1YJLA 1W0PA 4CUCA 1VRH2 2NPIA 4J6GA 2MPFA 4A3XA 2AC1A 4AYUA 4OLLA 4KQ7A 5A7SA 5C71A 1JYIA 3NW4A 3U07A 4B4PA 4Y22B 2BOIA 2ERFA 2JX9A 1GP6A 3D4KA 3U1XA 5A7WB 1ZVFA 4Q4Y3 2YUEA 1WA4A 4GH4A 1EP0A 2WBKA 5A7PA 2BGCA 4XW3A 3HQUA 1HV1A 5LEJA 2EXKA 4W65A 1WCSA 3AZYA 1EAH1 4OCTA 5FFOC 1Z7S1 2EXHA 4QKBA 1EY2A 1X7NA 1VBD1 1YLLA 4J1WA 3L9JT 2CY6A 2GU9A 3CJIB 3H7YA 5HV0A 4ZU4A 3KVAA 3OUJA 4GB31 3Q8AA 3LE0A 3CJIA 4LKSA 3OGJA 1HB2A 1VPHA 4I0WB 3WF0A 4AEDC 1OUXA 3KF5A 2XPJA 1UY4A 2BDRA 3SEPA 4K40A 4AXOA 4Q4X2 2ZGPA 1JYXA 3W5MA 4XBLA 1LNSA 2XUMA 5J09A 1LJ7A 2EICA 2R7EB 5JXHA 2R042 1BQPA 1PZ8A 1YI7A 3LEKA 3UYJA 2BU9A 2VTXA 1MZ6A 1YQ2A 2D44A 4XUOA 3RWNA 5GKAC 1PM4A 3Q8FA 4MOAA 5F6KA 4NVPA 4R52A 4XDOA 2JE7A 3KT4A 1VB4A 3ZKUA 4CEWA 4CRQA 1O3SA 4FPLA 2JIJA 1W2NA 2XKPA 1TMF1 4FAHA 4AW7A 2QQNA 1BVP1 1H8TA 2RS31 3UETA 2HWF2 3UJQA 4XQDA 3S0MA 1S2EA 3NKTA 5G05L 1NZIA 1O6UA 1MZ5A 3ES4A 3SH5A 1DCSA 1NKGA 4AAXA 3RGBA 5A3PA 3ZXLA 2VUJA 3LF7A 4QX8A 2Y60A 1U0AA 5EYYA 5B2GB 2XDVA 4CDQC 4H7LA 4LHKA 3I49A 5KHIA 4KNCA 5C9AB 1X50A 4QQ2A 3WXPA 1MEC1 3H3UA 4GULA 4CCLA 3TN91 1KQRA 3WSOA 1SPPB 2H6BA 2Z69A 5BNOB 1OH4A 2WNUB 2EIGA 3POYA 2VCMA 3DKQA 3IIAA 3WNPA 4QQHA 3PVBB 4QPGB 4HG6B 3A7QA 3NJXA 3RDIA 4BQWA 1KFXL 5I0DA 4LE4A 1CPNA 4FT8A 2P4EA 3I7DA 1GU3A 1ZRIA 1OURA 1I5ZA 4LKDA 4BPZA 1COV3 1S0GA 2RS13 3DPRA 1AL22 1MZFA 1DYPA 1UU5A 5CADA 3ITQA 4CU8A 5EZWA 3PUAA 3SC7X 3HEIA 4LKFA 4PF5A 2RJ2A 1ZRRA 3I8TA 5E1RA 4W50A 4W6WA 4XOGA 2J1EA 1KDMA 1PVC1 1ULCA 1WMXA 2P37A 3BU0A 1O4ZA 5HXVA 5HCBA 4BQ4A 1ZREA 3X29B 2LRPA 1QMJA 3HT1A 3B5LB 5FZOB 4AE2A 1YQ5A 5C6CA 2GP5A 2KA3A 2VNRA 2YMZA 3I54A 4A6SA 3B69A 3RNSA 3WG2A 3NV2A 4XFAA 4N9IA 2VU9A 2JDYA 5FZOA 1D4M2 2XVGA 1EV12 2QDNA 1H1MA 2D6LX 4D3WA 3ZMNA 1JMUB 4NR1A 5L9BA 5BNNA 4CP0A 2BBAA 3ZYIB 1UMHA 1ODMA 3B9IA 3J4UH 3N3HA 5JI7A 5FZAA 4HN1A 3HPNA 3I3QA 3KVBA 3PVNA 5I0UA 4PQQA 3WHTA 1IPKA 2OPWA 2CTVA 2WSUA 1J84A 1C5IA 3DV8A 3EQEA 2OT7A 2XBO2 3UGGA 1AR91 1QJY2 3LPGA 4LIVA 1RUC1 5KBFA 4LPLA 3USUB 2LUWA 2CV6A 3AM2A 2WL1A 1W06A 2R1DA 1GZWB 3L2YA 4LBOA 4XHXA 3TEXA 1BK0A 3ZSLA 4UF0B 1KRIA 1WCKA 1YJKA 3ZFGA 4CA9A 1QJU2 4IE4A 5T3NA 4BMEA 5JOZA 2PHRA 4DY3A 3USUA 5ERLA 2BGOA 5J48A 2DVAA 1AR61 5FP9A 1H2KA 3T0AA 4Q4X3 4M4PA 1PGW1 4FPFA 4HVOA 4Q29A 3AL6A 4D7SA 2EXJA 2OZJA 4Q8KA 4YGCA 5J1XA 1IKQA 3GDBA 2VZ1A 1WWYA 2VR4A 4LHNA 1W6MB 4R9DA 5FP4A 4AFDA 1RUG2 1US2A 1AXKA 4FQZA 4E8DA 5IK7A 2DCZA 2IXLA 3R4SA 1OHFA 1RUI2 4QHZA 5DG1A 5FZGA 2V09A 3B3QE 2D93A 4P5HA 2ZHMA 3GF6A 1A3KA 5LB6A 1UD1A 3ZOIA 2HWF3 1C8NA 4QB2A 3VBFB 3ZR6A 5JMCA 4YW6A 1S0FA 3VGIA 3WP5A 2ZGQA 1IPSA 1VAMA 3THTA 2XWJB 1VBB2 1OLMA 4QXKA 2JG8B 5EWSA 2XVLA 5FAXA 4LXLA 3UGHA 4EN9B 2PAMA 1POQA 2ZX2A 4ZS2A 3N35A 3ZFFA 2R0HA 2BW8A 2W94A 4AI2A 3JB4C 2IVJA 2W3JA 2JG8A 2W1UA 4IGQA 2Z4FA 1O8SA 3M3QA 4CDXA 3INAA 4D94A 2DVGA 2D5HA 2FDFA 5EHDA 2WLQA 3BOWA 5JZGA 1GSLA 3PNAA 5T54A 3H3LA 3ZR5A 3FN9A 5CB7A 4CEWC 4N7UA 3S57A 1PO12 4EN6B 3N36A 4NPMA 2J22A 3DGTA 4B29A 1H8TC 1AL23 3RVHA 4CDWA 2JDKA 3B00A 5CVRA 1OMIA 3JXSA 4WM8B 4D0QA 1ND2B 3I3EA 3H1MA 4Y1XA 2ILMA 3CQOA 4H55A 2X29A 4IV1B 3NVCA 1UX7A 2BFUL 2W9XA 2RDNA 3K4AA 3O0VA 3C7GA 4C1WA 1WUVA 4HFSA 1HXS3 1QU0A 1JOPA 1MACA 4FFFA 1LOGA 4G3YC 2AZ5A 1RUNA 5FY4A 5IVYA 2R071 2XKOA 4Q4V2 1ZBE1 2K9ZA 1EUUA 3MF9A 2UU8A 4NN0A 2Q8EA 3QH7A 4XHBA 4B4RA 1QJEA 1J3PA 5F2SA 2ZX0A 4ZPIA 1PGL1 5JR2A 4HL0A 3HBZA 5IVJA 4FTBA 1JZ8A 3FL7A 3DPRC 3RS6A 1AF9A 3BGAA 3KGLA 1EV13 5DDJ2 5F7UA 1WD3A 1HRI2 4QKDA 1NUKA 3OPTA 2I2SA 4P9JA 4PI0A 3IPVB 1H6YA 3M70A 4KWJA 2Q4SA 2VZQA 3O5SA 4LBKA 2BUKA 4YVSC 3FHIB 1VALA 2B5HA 5A3NA 1V9U2 4I09A 4TN7A 4A7KA 4XILA 1XNCA 4YG6A 5I8TA 2JKXA 1ZZ9A 3EXUA 1AYM2 4C1XA 2R6QA 2WZEA 3AKRA 1W8UA 2QQWA 3PJQA 4I01A 1FPN1 1JOBA 4GIQA 4GWIA 2A3XA 2XL7A 3GZTB 2ZMLA 4R8HA 3D8CA 5LRSA 1LB2A 1UMIA 2EAKA 5EP9A 1QJU3 1RTVA 1RJ8A 1POV1 1SCSA 1DBNA 2OA2A 5DAWA 4CCJA 3DXUA 1G9AA 2GN7A 2UWBA 1UKRA 1B09A 1XSRA 3B93A 4L97A 2IWGB 5DUVA 5ANNA 1S4CA 3WDTA 5BNNC 3WQ1A 1OQEA 4CPBD 2ATFA 2YPJA 2O1QA 1S2BA 2WA3A 4ES9A 3F2ZA 3POGA 1Q3EA 3ES1A 4F3JA 3GCWA 4P9IA 4AQTA 4Y1YA 5A6XA 1RUG3 2HJIA 2JIGA 2WZPP 4DEQA 5CFCB 4L9BA 1NQDA 3MV11 1UPIA 4CDUA 3LIGA 2HWB1 4P9WA 3O1OA 2WFF2 3O12A 1VJ2A 1OSGA 1ULOA 3KCYA 4WM7B 1RUH2 1FOD2 2E7QA 2ZTNA 5FO9B 1V0AA 3WQBA 1W9YA 2A6YA 2Q5TA 1VBB3 2VH9A 5EJ3A 2QQPA 4B4QA 1MQTB 3JU9A 5L7OC 2GC3A 1GANA 5L9VA 1UL9A 4OZOA 1DQ5A 1BYHA 4RQPB 1PIV1 1XRUA 4S2DA 4CUAA 1SLCA 1VAKA 3PDQA 4GZ9A 3BPZA 1ASJ2 1YCIA 4Q0SA 5I8SA 2GN3A 2JDZA 3WOGA 2Y6JA 3ZLIA 1FMD2 3HT2A 3BOPA 2NZ9A 3CDZB 4XJZA 4AHXA 2RM23 4D6SA 5LK7B 5FZFA 1NY71 5KWRA 1RUD1 1C28A 4XYXA 5IW0A 2AYHA 3AKTA 3THDA 4AAPA 4H3WA 4LOSA 3OOXA 4O7XA 4IL7A 3MIEA 4YARA 3AMMA 5IVEA 4N43A 4QD2A 5I0RA 1SHWB 1R1ZA 1UXXX 2RV9A 4FP2A 4IV3A 4CCEA 1F8VA 4R9AA 5JOWA 1UWWA 3ZXEA 1TME1 1CONA 5F1RA 3KHCA 2GH8A 1AZDA 2RS33 3B02A 5TSWA 1K5JA 1DHKB 4L99A 4Q4V3 1W6NB 4CDXC 2E32A 4YNIA 1XYPA 3AP9A 4LKEA 4FP3A 5JZGC 4CEYB 3OY8A 3IAQA 1BBT2 4BQ5A 3SQOA 2QDRA 1NYWA 1OF3A 3NV1A 1B35B 1JOJA 1JZ6A 3BI3A 4TSVA 3THCA 3TEWA 1ND3A 2JB4A 3I2DA 4AOCA 1DYOA 2LTNA 4L0PA 5E88A 1OC1A 4CDWC 3V0AB 3WY6A 2ADEA 5DDJ3 1HRI3 4XJUA 3T3YA 1TZOA 3H1YA 3VUOA 3MIBA 3RZKA 1WCUA 3GM8A 3WG1A 2XHKA 1S0EA 3V0AA 1O91A 3WF1A 3AP5A 1ZZ6A 3JD73 1UOGA 3APBA 1IQDC 1RIRA 1PX3A 3A21A 3MW4A 3WW1A 3E97A 1XBFA 2O14A 1GQGA 4G4FA 5CU1A 4RN5A 4J25A 4LA3A 5A7OA 4PI2A 4AR2A 3I2KA 3OD4A 1UQXA 4JGYB 3GBWA 3O1UA 4KG0A 5FBZA 3NWKA 4K6BA 3KLSA 1UYPA 2H0BA 4XURA 4DRVA 3D5OA 4OVEA 5LBEA 5JOXA 1US3A 3W9AA 2W39A 1GV9A 1I1EA 1SLLA 3TEZA 4LEJA 1ULDA 5FLHA 2BP6A 3NNFA 2X10A 2HWE1 4YZ4A 5C70A 1NG0A 1XNAA 3CU7A 4XFHA 4ET7A 2DTYA 3EMRA 3TBDA 3D6EA 4ISQA 4XQ4A 2NP0A 1QQP1 1C8M2 2W46A 3N7LA 1BZWA 1A8MA 5FXZA 5BNPB 4Y24A 4FPEA 1RMU2 1DGLA 4CXXA 5JXGA 4QAWA 3WDXA 2P34A 5FXWA 1MS4A 3BUCA 2HWD2 2P3JA 4ZXEA 2WFF3 3MYXA 4MXWB 1YEWA 2K0GA 5BNPA 4R4XA 3KD4A 3KV5A 1CAWB 2YY1A 5F3IA 3VBRC 4CXWA 2B9VA 2WT1A 5DAPA 3S7EA 2C26A 1JXNA 3W58A 1RUE2 2ZEZA 3SXWA 4EZ4A 5C33A 3VLBB 3OGVA 1NCRA 3USSA 3ZN6B 4HPKA 2WAAA 3AZZA 3DEMA 1CAWA 3OBAA 5A3WA 5A3MA 1RINA 4IE0A 2JDUA 2IXJA 1AHSA 1GWLA 1K45A 5C4WC 1Y9QA 2ARXA 1NE6A 1XPWA 2VECA 1H8VA 2FZ1A 4B1LA 1GOHA 2EF6A 4UW6A 1REEA 2QBXA 3K51A 4RR3C 1AR81 1AVBA 5F2WA 4TTGA 2FZ2A 1URXA 2QUOA 5EQUA 1GNYA 1O5UA 2HYXA 2PELA 4WVMB 5FYVA 4AHYA 4CDUC 4COZA 1DZQA 3FZ3A 4EZHA 4MGIE 5L9RA 3A23A 2R062 1BK1A 1R1A1 3AMQA 1AYN3 1EPWA 1FYUA 1D4VB 4Y5TA 4RGAA 1UN1A 2BVVA 2D40A 3BB6A 5ACA1 4XTPA 3BTXA 3ZFEB 1K5MA 1QXPA 4EN7B 5DMYA 1DLCA 3OEAA 4XABA 2BYVE 3KV6A 1QHDA 4K21A 2OUJA 4LHSA 2Q1FA 2QQJA 4DEVA 2XJUA 1N1YA 1GNZA 3NSTA 2E7TA 4LE3A 1BBT3 3WLUA 4PQ9A 2C9AA 1UIKA 4XAAA 2C4XA 4Q4W2 5CZKA 3J8F2 1N3QA 1VMHA 5IFPA 1MR5A 2J7MA 2G19A 2WNVA 3FE5A 3H42B 2I45A 3OB8A 4NIGA 1HRV1 4QM8A 5EJZB 4AI9A 3I2HA 4FI9A 2VXRA 3FLRA 5C8CB 5LZ6A 1ZRFA 5CFDA 4HKLA 3VB9A 2W52A 1DIWA 5FWEA 4H2AA 2G9GA 4NIHA 3D0SA 4N43C 2DBNA 3WNLA 1J83A 1FXZA 1VRH1 4Q26A 1GOFA 1Y7BA 4KGQA 4F7ZA 1VBA1 1DQ6A 1SDDB 1VRBA 5F5IA 1OLQA 1FNYA 1AJOA 3WUCA 1Q8PA 1CQ9A 2P3KA 4V2VA 4UFMA 3OBZA 4UOJA 2MEV2 4AEMA 3HNYM 1LEMA 2CWSA 2JG9B 4K1ZA 2Y6KA 3MPPG 3NRUA 1ND3C 4JKKA 4CP9A 2JDNA 5DAVA 1AR73 2EAAA 1RUF3 5A3UA 4UBHA 1X8EA 1GLHA 4AFMA 4COUA 5HXMA 4E4ZA 4BXFA 4HZFA 1A34A 1W6QA 4NHYA 1VBC2 2BNMA 2VMGA 3NNLA 1CJDA 4KBZA 1XNKA 1RMU3 3AZWA 4Q4Y2 4W8JA 4HT1T 5E6HA 2ZPXA 1XSQA 5EJ1B 2ZXQA 4MYEA 4XFFA 5FLJA 1LR5A 2PTMA 1ACCA 1PK6B 3I2FA 4QQLA 4AEDB 1LHNA 4MGQA 4XJWA 3ZKYA 4OI0A 3QH6A 5HBAA 1NA1A 4C0HA 1C3HA 3K4DA 2GNTA 3V64A 5FZEA 1JU4A 1PK6A 4BQXA 3O1VA 2XUEA 2P17A 3KHBA 3V65A 1Y9GA 1YRZA 3FFZA 3PUQA 2XH6A 1SG3A 5GLWA 3NMBA 2QQUA 4S2FA 4CCMA 1Z0HA 3PJYA 3SITA 1W9SA 2VL4A 3MHZA 5IVCA 4QT6A 2ZHKA 1OF4A 4EWDA 3LEIA 5FRAA 2DCKA 1C57A 1WW4A 2ADDA 1RUJ1 1VBE2 2HWC3 3WNNA 2XJQA 4UT5A 1NLRA 2JB8A 2DFCA 4PDWB 3HNBM 3O0WA 5FQ0B 3ZDVA 4GWMA 2R063 4YW2A 4K7JA 4ZS3A 5K0UC 1XU2A 5A3TA 1W0OA 2GP3A 1X9TA 2PHXA 4QQOA 5ABJB 3RZHA 2VW1A 5LBCA 4OUEA 4QU2A 5JUVA 3K4ZA 3UKNA 5GLVA 1IG3A 1U12A 1S0BA 5SV5A 4BQ1A 5BNQA 3E5QA 1QOSA 1V00A 3AYAA 5ABJA 2KM2A 2A75A 1GMMA 3IAPA 2EVXA 3HBKA 3LDKA 4FXKB 4UFLA 5EPAA 1W04A 2ZBJA 3HN3A 3P3PA 5GZEA 1WMEA 1QH6A 1TQ5A 4EWAA 3SNMA 4MUVA 2DU0A 4URTA 5FUNA 3ATGA 4EJRA 4Z8BA 2H6CA 5FY1A 2LROA 1LOEA 2QTWB 3A0KA 3NL1A 1L7RA 3AP6A 3R4DB 5D8AC 3FJSA 3KMHA 2ZA9A 3BTAA 5GLTA 1CZVA 3M3EA 2YXSA 3PUHA 1X82A 3BPSA 3VD4A 5F5AA 3P1IA 3QOPA 1ZM1A 2XWBB 3VBHA 3T30A 4LULA 4QGMA 4CP1A 2FD8A 3DXTA 5JLVA 1K5MC 1TE1B 2RE9A 3VZMA 4A41A 5LWBA 1MS8A 1DGWX 1R091 2VZTA 5KC5A 2FCUA 3VBSB 1I9RA 2PN5A 1W8WA 3POBA 4ISRA 4TLFA 1D0HA 1D4M1 1UY2A 3AXDA 4ZONA 3SLIA 2FQPA 2MEV3 4NMIA 4ES8A 3VBSA 3ILFA 2OUHA 2VNOA 2WNOA 3OBTA 1J1TA 2ZZQA 3D82A 2WNVC 2ZKLA 4JDNA 4DIQA 4YLZA 2PHWA 4DXRA 4BU2A 3VL9A 4EV0A 2WZR1 4FPOB 1J3RA 1V6OA 2XQXA 3I2GA 3IDAA 4RS5B 3OPWA 2XBO1 4U2AA 1IQAA 1QJY1 1H9PA 5FOJB 5DUXA 2JDHA 2WSVA 1WLDA 3B7MA 4M3CA 5EYXA 4AQ6A 1VBC3 4JDOA 1WD4A 3TAYA 5LY1A 4KWLA 4YSFA 3TRSB 3FHAA 1WW6A 2YHJA 1MS3A 3OPZA 2GAUA 3LA3A 1RVF2 2I07B 4FVVA 3OGSA 5A3LA 3ELNA 3GCXA 4KL1A 4Y22A 4PJYA 1L7QA 3DL3A 5A7WA 3J26N 2QFEA 4AEKA 4N9HA 2V5DA 3VBUB 1PNGA 1SCRA 4UXAA 2OVUA 3H3ZA 4O9GA 1PO22 1JH5A 1WGPA 2BNNA 1LHWA 2VAUA 4FPKA 3KQRA 4IEVA 4LOTA 4KG8A 4N7IA 4F8AA 2CGPA 1QJX1 4AVAA 2BVBA 1RUI1 3UGFA 1XU1A 2R32A 4JHZA 1O4YA 2FMYA 1LOFA 2VVEA 5CKMA 1HQNA 2W87A 4ARYA 4RHV1 1BCXA 2Y64A 4L8QA 1Q43A 1HX6A 4NIAA 1YIFA 2X53S 4FXGB 1VE0A 1DLLA 1VBE3 3GYDA 3UESA 1QH7A 3G6JB 1FV2A 4Y1ZA 3T1LA 1VMFA 2F17A 4UYBA 2Q8CA 2GALA 4BOWA 2X05A 2XJVA 1Z78A 2WQZC 5AFBA 3CZJA 3MLKA 4JQRA 3BTYA 3IWZA 3CLPA 3LCPA 1XYOA 2Y6FA 1JYCA 5JR7B 1NOVA 1OT5A 4A6OA 4NPLA 3K48A 4EN0A 4XUNA 5GJ6A 3VKMA 1NX9A 4BQ2A 4QGNA 2XMLA 5B4NA 4DZGA 1RL3A 3V0BB 5BV6A 4Y26A 1W9TA 2J1UA 2GC1A 4DY5A 3VDDB 5K9YA 4CUBA 2TNFA 5C9AA 3V0BA 4P9YA 5A1FA 3ZXGA 1IZ3A 2JENA 2OIIA 3LDBA 3WV6A 1F5FA 3FWEA 4NJ4A 1SPPA 2LW8A 4OUMA 3VDDA 2OPKA 4XFBA 5BNOA 2DDUA 2WNUA 4Z1VA 4B7EA 1UZYA 2WABA 1HB4A 1PMIA 2ZKNA 3OF1A 4JKLA 1V6NA 4XXAA 4QPGA 5FZKA 3SCFA 2ZHNA 4YZ5A 1WBLA 3LKJA 2P5BA 1HQWA 1LGBA 3N9QA 3OJBA 3WNXA 2Y33A 5GZDA 3ZIXA 1OLME 1OOPC 3WDVA 3AKQA 4Z82A 3MIFA 4QM9A 1OQ1A 4YW3A 3VL8A 1XC6A 2VTXJ 4HKOA 5GM0A 3M3IA 3RI8A 1HXS2 1M4WA 2KR2A 2Z42A 4D7YA 3UT0A 4MGKE 4ORFA 4FPJA 3M7AA 4LMFA 5SV8A 3ZYPA 4E4SA 5HCAA 3ZPOA 1AUYA 1LHUA 1D2QA 2SBAA 1VP6A 3ZO0B 4M3CF 3RZZA 1JUHA 2RDSA 2TUNA 2XOMA 3B01A 1V9U1 2PMWB 1ST8A 1NZCA 1T6GC 2WYSA 1GOGA 1ENXA 3ACIA 2YC0A 2WNEA 5FXVA 4QX7A 1CAUB 1HN1A 1ZZCA 3NAPC 4JRAA 1SDWA 2ZEWA 3OGRA 4QPIC 4XACA 4YVSB 1X8MA 2PAEA 3VBHC 2QQVA 2RS52 2FCTA 4XF1A 5I93A 2Y8KA 2E53A 1BVVA 5C3QA 1OA2A 3O1TA 2J1SA 2ZX3A 4NHLA 4XUPA 1S1AA 1RVF3 2RR12 1PGSA 2JDMA 5HCFA 3F95A 3I59B 4A7YA 4MX3A 1OPOA 3VN4A 4IEOA 3AMHA 3SKJE 2ZS6B 5GZGA 2D6NA 1PO23 1O4TA 5FZ7A 3I59A 4JGZC 1DGRA 1R082 4NRPA 4E9KA 1UPSA 1VR3A 2XL9A 3C7EA 3MI8A 5FYSA 3ZSEA 5J36A 1W6OB 3CL1A 3IN9A 2VNGA 4W4ZA 2OQ7A 1FT9A 1RUH1 1GZWA 4BXSV 4MG2A 2AEZA 2V4VA 4UF0A 1JODA 4HLTA 4LBMA 2ZGMA 4GQ7A 5CG9A 3T2OA 4GH4C 1KITA 4GMP3 2Q30A 2ES3A 1HLCA 4NHKA 4AQSA 2WN2A 2WS91 4LA2A 3IIIA 4PCRA 5HPOA 3SISA 5H9SA 3GALA 5DZFA 5L7OB 4RGKA 5FZLA 3MUY1 3U4XA 1ASJ1 2CYFA 4XBNA 5AFEA 3ST7A 3WG4A 5IYYA 1RHI3 1O3QA 1FMD1 1W6MA 3AX4A 3MLJA 4I3PA 2R49A 1APNA 5A32B 4L2NA 3Q8CA 5A1AA 1WBFA 4IGPA 3CJIC 3G7DA 2B8MA 1EAH2 1SLAA 1H2MA 3ACFA 4HK8A 1F4HA 4KMQA 2C1FA 4K1YA 3VBFA 1NCQB 3RZMA 1DDLA 1QEXA 2A6XA 2DF7A 5A6YA 1O3TA 3ZN5A 4AVBA 5IVVA 3ZVXA 4COWA 2NMOA 3QBQA 4MGYE 3FHQA 3K3OA 4GB32 1CESA 4CXYA 3B94A 1OPMA 2AH2A 4FOYA 1QF3A 1YIPA 1LRHA 4XC9A 4MH0E 3ZXJA 4HXCA 2A7AA 2XONA 4QXHA 2RM22 4XZUG 4ZZ8A 1HB3A 1ONAA 1T2XA 3PMEA 2PYTA 2VBDA 5BY5A 3E6CC 1G9BA 1YYNA 3N9NA 3WT3A 2V72A 3D0JA 1H2NA 1RUJ3 2O8QA 3BALA 2G4IA 4XIKA 1Q8VA 3WUDA 4FTSA 4LHLA 2VVFA 4IEWA 4Z2AA 2EIBA 4YZ2A 2R0FA 3BKZA 4JVAA 5I0TA 4IXLA 4BM8A 5IJRA 4WM8A 1ND2A 1TMF2 3RSJA 2HKXA 1AXZA 2ENRA 2RS32 2ZHLA 5DG2A 4IV1A 3U78A 5DAQA 4LUKA 4PIZA 3CMGA 1FV3A 2JXAA 4XJ9A 1HJFA 2WINB 4GWJA 2W91A 2X5IB 3MO4A 4AGRA 5C9AC 1BEV3 4AGGA 2RMU1 2ZGUA 2A1XA 4O9EA 2FMDA 4YGEA 5FZ8A 1MS1A 1WW5A 2VNVA 2XGXA 5JVVA 1AL0G 2WNUC 1QIQA 3FLTA 1OH3A 4QGLA 2X5IA 3PIJA 4QX5A 3KCXA 3RJ2X 3TN92 2E63A 2RS53 3VZJA 3BU7A 3FBMA 3M8LA 4YM1A 4PBPA 2HEYF 2IXHA 2DUQA 4RFT0 1UU6A 4TZDA 2DUOA 3JBG3 5FZBA 1DGWA 2RR13 2VOVA 1MVQA 3JD72 4LBLA 3VKNA 3OCPA 4IETA 5FZ9A 5FYZA 2ARAA 5FY8A 3W21A 4RA0A 3IPVA 2D5FA 2CGNA 3BIEA 5JI9A 1QDCA 1ZBA1 1C8M1 1IS6A 1L3JA 4AVTA 2QQIA 2ZGKA 3FUQA 1QY4A 1R083 5LRRA 1W2AX 1ZX5A 2VZ3A 2W0XA 4MV2A 2VMCA 4JCKA 3POFA 3RWKX 2WKKA 1H9WA 2HWD1 1PVC2 2CWMA 4IDZA 5K8SA 1FNZA 4QPYA 2OYZA 2X8KA 3MLLA 2PLV1 3N9OA 1RJ7A 2VGDA 4QHBA 2YZ4A 5GZCA 1XNBA 2YROA 5KHKA 2Q0AA 2PHTA 4QPWA 3WP3A 1RUE1 2GNDA 5LA2A 4XF4A 2AENA 3N9PA 3VBRB 4YM2A 1REFA 1W8NA 4XUQA 1C1LA 1NLSA 1GUIA 2E33A 1YQCA 2B42B 3VD5A 2EIEA 4OI2A 1NE4A 2GNBA 1SMVA 4BHPA 5F5CA 4BK4A 1GWMA 2GDFA 2A6ZA 2JDPA 2OXBA 2BPA2 4KWKA 4CCNA 1N3PA 5CFCA 4XAEA 3W5NA 5D1IA 3RZGA 1TG7A 1LU2A 1OBNA 3IKWA 1EAH3 3ZFGC 1S55A 1Z7S3 5FZMA 5KXCA 1F5JA 2YPDA 1VBD3 5F37A 3C7OA 4WM7A 1UOBA 2Q8DA 5J98B 3MZHA 5FCCA 5J37A 2ORZA 3LGRA 2VG9A 3AXEA 5JIUA 2HYKA 4ZZ5A 4GB33 1MQTA 3K3NA 3HN1A 2LS6A 3ETPA 5FUPA 3BCWA 3QACA 3PL0A 4OHWA 4RQPA 3IDCB 1GYKA 2XLGA 1OFNA 3AYEA 5LW9A 5DN2A 4R4ZA 2B46X 2J1AA 1ZA4A 2ZEXA 4QX3A 2VQUA 3GHNA 1PZ7A 3CF6E 4EWEA 4OHXA 5FR3A 5I0SA 5LATA 3MICA 4IE7A 4Q4W1 3T2QA 3J7MA 3CEWA 4D7TA 3KV9A 1GQPA 4JKMA 1AYN2 3RYKA 2Y38A 4P9GA 1JZ5A 3ZFFC 3VBFC 5FPAA 1K42A 4OULA 1TMF3 1AX0A 2WA4A 3LPFA 4OZXA 4BA6A 3RYPA 2JG8C 4LTAA 1RC6A 2A71A 2Z2SB 3WW4A 2BBVA 2ZGTA 1A78A 1ALYA 1ZYBA 5A33B 2Y6GA 3S5AA 2W95A 4LUMA 4MHUA 2QQKA 1G9CA 4LO7A 3WNOA 3QD6A 1W6NA 4L92A 3T4VA 4A7ZA 4FOVA 3OSDA 2ID4A 4SBVA 4XDQA 1MEC3 2VZRA 5FP3A 5AC91 3TN93 4CEYA 3GNEA 1IS3A 2JECA 1B35A 1QJZA 3H1WA 2WYFA 2GNMA 2KXLA 5JIAA 3VHPA 2D43A 4C91A 1UX6A 4X8PA 3GBFA 3R0RA 4B8EA 3RYRA 3LSDA 3R4UA 5LA1A 4ASKA 1DQ4A 4WVWA 1H30A 1ZRCA 2VZUA 1OLRA 2DV9A 4FQ4A 1F15A 2VQTA 3OYWB 5LEKA 1D0GA 4PIYA 1K12A 5T5PA 3NNJA 2CU5A 3UV9A 4RD7A 4Q4Y1 4CU9A 2WFPA 1V6IA 2ZMKA 4P9XA 1V6JA 2VZPA 1GICA 3AFKA 3NV3A 1PVC3 5A70A 4BDVB 4RFRB 1AR72 4P5YA 4JGYA 1RUF2 1WKYA 3ALQA 1KJLA 2R072 4FO9A 1GNHA 1ZBE2 4IE6A 1XJAA 2WO2A 4LLOA 3W20A 4DXTA 2CDPA 1XOYA 2Q1MA 2YBSA 3URFA 3VBOB 2BERA 5KXEA 2YBPA 1PGL2 1QKQA 1LU1A 3E5XA 1AJKA 3POSA 3UK9A 4DO0A 1STMA 4QWNA 4NRMA 5FUIA 4AK3A 1JN2P 3OTFA 5IK8A 1BJQA 1UCXA 4YVWB 1VB2A 3WDWA 1PX4A 2DVDA 2PQQA 3S30A 3BVCA 4N53B 2Q1ZB 1H0BA 2WC2A 1NQJA 1CAXB 3KS7A 5APAA 2W68A 5F3EA 3VDBA 1HW5A 4CYDA 4XBQA 1F9KA 5ANQA 2HEWF 3A22A 1H2LA 3N7JA 4EQVA 2ZABA 3FC0A 4N53A 4SLIA 5LBFA 5JOYA 2HLEA 1UZVA 4FPGA 4MXWA 4BQ3A 1ZRDA 5DZEA 4DUVA 1AR93 4JTOA 5FDBA 1RUC3 4YM3A 1Q56A 1UXZA 2E7AA 3AK0A 3P5BA 3Q9OA 2RDRA 3MV01 1FPN2 3CKHA 3MW3A 4IEYA 5K0UB 4QDRA 3ZN6A 3S7IA 3IMMA 3PVEA 4UFKA 1AR63 4Z92B 2HWC2 3LA7A 1Y9MA 4FFIA 3H50A 2W47A 1N3OA 2GC2A 5C3PA 4XDPA 1X36A 4XUTA 1QOOA 4JV4A 2B4KA 4WVMA 4ATFA 4KWUA 2V4AA 1W99A 2DYCA 1U5ZA 3O7OA 5IHRA 1WLCA 1PVXA 3OUIA 5L19A 2SLIA 1GZ9A 3IB3A 5D8AB 4NPRA 2JICA 2TBVA 4HBNA 5JPMB 2JD4A 3LZZA 1Y4WA 1COV1 2RS11 1MQTC 2VW0A 3LIHA 3HD8B 3ZFEA 1W2OA 4BE3A 5CNAA 4A2UA 1MZEA 1SQ4A 2JE9A 4RQPC 3ZYJB 3U10A 1QDOA 4MZUA 3WW3A 1U5IA 5F3GA 4AI3A 4NIDA 3C7HA 2FDJA 5FYTA 3AZXA 2YU1A 3KF3A 1X9PA 1V6KA 1GZTA 1E5HA 1BXHA 4HSJA 1YFYA 3J7NA 4BCUA 1OA3A 2A6WA 2P1BA 1IGOA 2D6MA 1HV0A 2BGPA 2CDOA 2WT0A 4IV3C 4E2SA 5C8CA 2DBIA 5CEHA 3TNQA 4ZKTB 3KGZA 1NY72 5FWJA 4Y20B 1RUD2 1UZWA 4I2OA 3IDBB 5A6ZA 2B45X 5T5OA 3AMPA 4AI0A 2WT2A 2Y6HA 5E16A 1IPJA 4PBOA 2X09A 1YI9A 3WD5A 5FY0A 1UKGA 4LNVA 1W8TA 1TVGA 3VDCA 1GKBA 5A1LA 5D21A 1LTEA 4EE2A 2C5DA 4AI8A 1TME2 2ET1A 4UW4A 5HCHA 1OQDA 2QQOA 1JUIA 4CEYC 2D3RA 3E6DA 4DB5A 2R073 1ZBE3 1B35C 2JG9A 2XVKA 4A45A 1GR3A 1EYBA 1UU4A 1M06G 4YW5A 3ZMOA 4P08A 1LKNA 3HIFA 4Q0PA 4CUGA 1CAVB 1PMJX 3OEBA 3UNPA 2VQ0A 1UZ0A 1DU3D 3DCQA 3SEEA 4WBBA 1CGPA 3EB7A 2WLPA 5DPNA 3WEZA 1UYXA 2WWSA 3EBRA 3AKPA 4QHOA 4EN8B 1CVNA 5CG8A 1XXNA 2YG0A 4LO8A 3JQWA 4Q4X1 1DZRA 1HKDA 3RQ0A 2DCJA 2WO7A 4W6XA 5JSOA 4KU8A 2IC1A 2R041 3WZ1A 2XG3A 5A7QA 3U11A 3AP7A 4AEDA 1CZTA 1SACA 4GXLA 4OQ8A 1DP0A 2GMEA 3NNMA 4LK6A 3S6PA 4OHZA 3HVDA 3IDEA 1UY3A 5C8WA 1O7FA 2UWCA 3ACGA 4HETA 4M3CE 1FPN3 5F39A 3AFGA 1FATA 2HWF1 4LO4B 4TYSA 1W8ZA 3VZOA 1KXGA 1CIWA 1YXWA 1G8WA 2VTFA 2VM9A 3M3OA 4QB1A 1POV3 2XXZA 3AL5A 5FPLA 3ZSMA 3U0ZA 1T6BX 4J1XA 2A3WA 3EO6A 5E8AA 1N1SA 1PMHX 2HWE2 2O0OA 4YM0A 1SLBA 4XVHA 1LOBA 2ETEA 3LQCA 4CDQB 5BNPC 3ETQA 1NAEA 1IKPA 3PIGA 4UAPA 4OMDA 2PFWA 5LCWL 5LY2A 5FQ0A 1BHGA 4PDWA 1G6NA 1NCRC 2P3IA 3UKVA 2HWB3 2R30A 1YC61 3POIA 2WO3A 3PVOA 4UW3A 1QXRA 3AJYA 3WNMA 5CISA 1I5PA 2YFZA 5DUUA 3ILRA 1AL21 2IFRA 1C5HA 5FO8B 2DCTA 5IFTA 3MPBA 2ARCA 1YWKA 2VUDA 2WWUA 2XJSA 3HQXA 2D6OX 2JDAA 1SFNA 2QQLA 5DABA 2ZACA 3MEPA 1SFYA 2KD7A 1J1LA 2Y34A 3DUIA 1UOFA 4LBNA 4DQAA 4RSUA 1JU3A 4QDSA 1OOPB 3HWJA 1W8FA 4YG3A 1HXS1 1PIV3 3WINE 5CAZA 3LAGA 2BWCA 4P14A 4DUXA 2ZZJA 4O61A 1CWPA 2YBKA 4AVSA 1QXJA 2DVBA 3SCGA 2E31A 3NQHA 4NUBA 3AVSA 4XF3A 1CPMA 5JDBA 1AR82 1AX2A 1JS9A 1LESA 1G86A 1RUD3 3ZXFA 4YZ1A 1MS0A 3CHXA 1MS5A 2P2KA 2Y0IA 1UMZA 4G9SB 5H9PA 3QLQA 3ZFEC 1R64A 1EV11 1UY1A 3WR0A 2BWAA 3NAPB 4NWWA 4QPIB 4YWAA 2RHPA 5FYYA 5ACA2 3C2UA 4D6QA 3N9LA 3DYOA 1TME3 1QNWA 3VZNA 3VZLA 3OGGA 1CR7A 1DQ2A 4CU6A 4JZRA 1JZ7A 3CIHA 5CFDC 1UYYA 2VD7A 2ZX1A 1N1VA 3WDYA 1CZSA 3JCIA 4X6RB 2VUAA 3LB9A 3VZKA 1E57A 1W6PB 3NV4A 4A4AA 3M3CA 3H0OA 1VMJA 3MW2A 1CX4A 1RGSA 3N7KA 1LECA 5FPBA 2DWRA 2I74A 5T55A 5IATA 4WZFA 4RS5A 4ATEA 3FX3A 1HRV2 3VDAA 4COYA 1QJU1 1W6PA 1XE7A 1WMFA 1QOTA 1EPZA 3ABZA 4JGZB 4A44A 3ENRA 4R9BA 4Y5Z0 4JX0A 3LD8A 1O3RA 1OVPA 2ZGRA 3C3VA 3I3BA 2YC2A 4MGZE 3GXUA 2IZWA 3TNPB 2DVFA 1S0IA 4R9CA 5DZGA 1SLIA 1LGNA 1G7YA 3R6SA 3TEYA 1VBA2 4AFAA 1YUDA 4GH4B 1RUG1 4YFWA 3E1F1 3VBUA 5FYUA 5GLZA 2E51A 4DXSA 4XQWA 2JG9C 5IAXA 4YG0A 4LR4A 3HR9A 1GZCA 3THPA 1W0NA 5FYHA 2W1WA 2F4LA 5D2AA 5CA6A 3U75A 3KSCA 3AC0A 2UY9A 1VBB1 5FKCA 4INDA 4OHVA 2W2IA 3I4IA 4NHMA 2EALA 4URAA 2IVIB 1UNBA 2VBPA 4FFHA 4FPHA 2HWE3 3WF3A 3W59A 4LLFA 2W92A 2HH9A 2VJXA 3OG2A 4BMBA 4IEZA 4KGGA 1YQ6A 2IXIA 3VKOA 2A5ZA 4Q1PA 5FZ6A 3WP4A 1QQP3 1JYTA 1NA1C 5A80A 2D97A 3WCRA 3O1PA 4QDQA 1W28A 2VC9A 1AXYA 2A73B 4YGBA 4GWNA 1RHI2 3DYMA 1PK6C 1IS5A 3MFAA 2BNOA 4CE8A 1PO11 2RM21 4XCAA 1OKOA 2C24A 3AZVA 4CEWB 2B9UA 1KFUL 2AR6A 3OD0A 2DTWA 2B7YA 1YFUA 4NRQA 4E27A 2F4PA 3B9CA 1H8TB 3ZYRA 2ZCWA 4NWVA 2VZVA 4FPCA 5FMCA 4E2QA 3GJAA 3JUUA 1ZZ8A 2VMDA 4A42A 5F6LB 2YDEA 4K3UA 5CIRA 4Q4V1 2UURA 2YFUA 2ZAAA 1HDKA 1GP4A 3WCSA 1F35A 3KM5A 1N1TA 1AR83 2RG4A 4PDWC 4QKFA 1LHVA 1RUJ2 1W8OA 1A8DA 1PM7A 2CNAA 3NNGA 4FFGA 4KI5M 3LSEA 3PURA 4HMZA 2W08A 5ABJC 4I3GA 2OS2A 4QXBA 2W1SA 4M0NA 2IXKA 1WCDJ 3MGUA 1KD7A 4E4HA 1R1A3 4YW4A 4BLIA 5DDJ1 3VHOA 1HRI1 2RVAA 4YZ3A 3SMHA 2EXIA 1VLNA 3DPRB 5ACA3 3J7LA 1WZXA 2GC0A 4FSJA 4IEPA 1C4RA 3JD71 4CCDA 1EUTA 5EIYB 1HB1A 1GFF2 3HAGA 2DUPA 4XIOA 1BEV2 2ARBA 4H7MA 3T2PA 3ZYFA 4DFSA 1JZ4A 1J59A 5C3RA 3CJXA 2W5FA 5FYCA 1AYM1 2IFWA 4Y4YA 2BRTA 2N7GA 1WLWA 3GZAA 5T52A 4Y5SA 5FZDA 3WHUA 4QQPA 1K3IA 2VMHA 1HRV3 5FZ0A 5JMOA
chains in the Genus database with same CATH topology
3ZDSA 1CAUA 2V5YA 4YVSA 3DF0A 2WJSA 1XE8A 3GHMA 3JBG2 5FO7B 4AQ2A 2AGSA 3ZSKA 3A0NA 4AWDA 4DXZA 3VBSC 1N47A 3SH4A 4JDMA 2CAUA 1VRH3 5IT6A 3BIWE 1KDKA 1R092 4AGVA 5BNNB 1VBA3 2QVSB 1J3QA 3QCWA 3ROUA 3BODA 4L11A 5T5JA 3SCHA 3ZPYA 2ZAHA 4LBQB 2WFF1 4RL7A 2YYOA 4GA9A 3AB0A 1FOD1 1BMV2 3OBRA 4RS5C 2Y26A 1FI2A 2QZ2A 1W6OA 4LBQA 3WVJA 2WZR2 4Z07A 5FLIA 3TB0A 2PHUA 4ASLA 4AVVA 2VOWA 4Q0QA 3ZFGB 2AREA 1NXD1 1YHFA 1UW8A 4BYYA 2K2SA 4BIFA 4IQPA 1ENQA 3N4MA 3ZSJA 2H0VA 2ZMNA 5H9RA 5BXXA 1PHMA 1FX5A 4FPYA 4K20A 3VBUC 5L7OA 5BUVA 4Q27A 4ZU5A 4Y1UA 1Z7S2 1LOFC 1G9DA 2ZGLA 1VBD2 1LODA 2NQYA 5A32A 2R043 4HKWA 4KH9A 1DQ1A 1AYN1 1QJX2 4LO5B 4FAGA 3EHKA 4XMIA 1NCQA 4PLNA 4D69A 2XJRA 4KBBA 5DUWA 4AFCA 2GH2A 3ZFFB 4RHV2 1O5LA 2YGMA 3GZUC 3KB5A 4DRRA 4CTEA 1SEFA 3RJRA 4E4DX 1BBT1 4V1PA 3SH3A 3H8UA 4CDXB 2A70A 2XB6C 3ECQA 2FBEA 1X33A 2QE3A 2XJTA 5JZGB 3NJZA 4HK9A 4ONUA 1OD5A 1DYKA 5FMOS 2PA7A 5AVPA 1SBEA 5K7PA 4CDWB 1ULGA 4K9SA 3LA2A 2B39A 2NN8A 4HVQA 2VY0A 3FFQA 4HN0A 1ZZBA 3A4UA 4BWOA 4IESA 2G9FA 3VDDC 5BNOC 4DMIA 1MEC2 4AVCA 4DNYA 1IS4A 1UZZA 4QPGC 4KU7A 1D2SA 3POWA 1GQHA 5E89A 1XYNA 4HSLA 2D98A 2O8OA 4AFBA 2GMPA 1WLTA 3M4FA 4YGDA 1AR71 5I91A 1LGCA 3CO2A 1RUF1 1JW6A 4LO6B 1ENSA 1SBDA 2VVDA 4GALA 5LK5A 3E5UA 4C0BA 1W2UA 1OA4A 1R093 3VKLA 2PHDA 2V73A 3NO8A 1POV0 2MHFA 1RMU1 1KS4A 1D4M3 2XJPA 4ZXKA 1I3HA 2NYYA 2YGLA 5IK4A 3M2MA 1YFXA 2DU1A 5HI0A 4TWTA 2A6VA 4YRDA 2LM3A 4ITCA 3GBGA 5L36A 5F9TA 2GSYA 4B3NA 2WZR3 3DN7A 4Q0UA 4AHWA 3TOJA 2XBO3 4XE9A 1QJY3 3PLQA 5FOBB 4Z2WA 5I8YA 3VBRA 2GZWA 4I30A 1J58A 4AI1A 5C4WB 2MNGA 4S2GA 3LOBA 1Q5OA 1ZZ7A 4IEUA 2CGOA 2HWC1 2VOKA 2VPVA 4CZSA 4COVA 3JQXA 4JC1A 1MS9A 1LENA 4RR3B 5C4WA 2R061 4FOQA 1U5XA 1GBGA 4M01A 4CDUB 1AR92 3MDPA 1Y3TA 1RUC2 1QJX3 1DGRN 1BKZA 4RR3A 2WIIB 1RUI3 4UBGA 5EXOA 1AX1A 1JTZX 3ZYGA 5FPZA 1DZTA 3WW2A 4ZU7A 3IM0A 4RHV3 3H9AA 4MVTA 1AR62 3IMNA 4XFGA 4BZ4A 1PGW2 4XJAA 3RMXA 4OHYA 5KHHA 3RI9A 5GALA 5BYNA 5GZFA 3J8F1 2Y0OA 4U36A 2WS92 1KJRA 5H9QA 4IEXA 2XLAA 4JAAA 1H1AA 2PHFA 2UY8A 1HIXA 3UL2A 1PO13 1NCQC 2ZOEB 1DQ0A 3WG3A 4N43B 2D6KA 1OI6A 4IV3B 3WQ7A 4Y1VA 2PHLA 4YFZA 1QWRA 3E6BA 1DFQA 5EV7A 3M1HA 1WW7A 3WX5A 1PNFA 4XXPA 5A33A 4CP2A 5GLUA 2MEV1 2VW2A 4XETA 2UYBA 2QZ3A 1Y43B 3WDUA 4XZPA 3OY8B 3ACLA 4N90A 1DG6A 4WM8C 1ND2C 1ND3B 3ZXAC 2VULA 4P9LA 4XF9A 2D7FA 3AYDA 4IV1C 1SBFA 4JTNA 1VBC1 4EROA 1REDA 2PAKA 2VMIA 1A6CA 4Q0VA 2F6BA 3OYWA 4XFCA 1C1FA 4E2GA 3VKFC 2X5IC 3N7MA 1JBCA 4AHZA 1Q8QA 1HQLA 1S0JA 5FREA 5T50A 2BEOA 1V6MA 3TYJA 1TNRA 1V9U3 2RMU2 1IHMA 4NO4A 4X8NA 3AYCA 1F31A 1AYM3 3ILNA 5KXBA 3H7JA 3VBOA 1S0CA 3MF6A 2ZGNA 4C90A 5DXDA 4BIOA 2VQAA 4YVWA 2DFBA 1VBE1 2ZGSA 5KHGA 4K8FA 3RG0A 5JAXA 3UJOA 1CAXA 1KS5A 3UKTA 3VHNA 5IUQA 1ZBA2 1UIJA 2ZGOA 3WQ0A 2ZX4A 3TWIA 1IOAA 4XJ8A 1YFWA 4DOUA 4XPVA 1S0DA 4S2HA 1F2NA 1JHNA 1W39A 2A3YA 1NCRB 1RUH3 1FOD3 2PLV2 4HPKB 4MSVA 5K0UA 3T2TA 1RUOA 4AG4A 2E9QA 5CFCC 2WS93 4WVVA 3RRDA 4DS0A 3AP4A 4WM7C 4XMAA 1ASJ3 2HWB2 3HMYA 2QCSB 4AF9A 1FMD3 1UAIA 1CJPA 2VOXA 2AUYA 3FBYA 4AEJA 3NKGA 2OW4A 1ULFA 5D8AA 3PMSA 1WMDA 2UYAA 1K5MB 1S2KA 3LOIA 1CN1A 3KT1A 1Q8OA 1G9FA 1PIV2 2CAVA 2UWAA 2QNKA 2RJLA 3JB8A 2QKDA 1V6LA 3MFCA 4JRLA 4IEQA 1TNFA 4OUSA 4RGGA 1VIWB 1VAVA 2EA7A 1LCLA 4OI1A 2WNVB 3IT8A 4FOWA 5CFDB 2JJ6A 2QJVA 3RPQA 2IXCA 5IK5A 2C0ZA 4HANA 4Y20A 3R05A 1H1IA 4GMP0 1RVF1 1XNDA 2RJKA 2TEPA 1NXMA 2JEMA 4B7KA 4MLOA 5J3UA 4I0BA 2Z79A 3DKWA 1PO21 3KZ4C 2RMU3 2Z5WA 3FMGA 1H4GA 4QMAA 4XFIA 5AC92 4FBFA 3WP6A 4XTMA 2Q8OA 5FPXA 5FTTC 4IERA 1CAVA 4Q8LA 3VHRA 3VV1A 1ENRA 2BQPA 2DURA 1YO8A 3J9SA 1W6QB 2BTVC 3ZXKA 1ZNPA 2R16A 3LWCA 4WV8A 4GMP1 3MIHA 1V70A 3RMYA 3T1MA 1DF0A 4JGYC 5FMOL 5JSRA 1ZBA3 1ULEA 2HEVF 1TEIA 3MIDA 1C8M3 4M00A 2FHRA 4UW5A 4PIXA 3KT7A 1LOAA 1RHI1 2BFUS 1FAYA 1NA1B 2HWD3 3AMNA 3FLPA 5AVAA 3VBOC 2PLV3 3SHRA 2XLFA 3ZXDA 3IBMA 2CL2A 2NMNA 2D3SA 1OKQA 1RUE3 1QNYA 3KCCA 4YVWC 1QQP2 4PLOA 4PLMA 1OFSA 4N53C 3FUOA 4BH9A 4CDQA 4DPNA 5J96B 2NM1A 4Q2FA 1RITA 3V56A 4YYOA 4LBJA 1RB8G 4M0HA 3EJKA 5JWPA 4X6QB 2D6PA 4YW1A 1QGLA 4LBQD 2D3PA 5JPNB 2WQ4A 5KHJA 1Q8SA 3JZVA 3AKSA 5KXDA 5T5LA 3ZIWA 5F5QA 1SLTA 3ME2A 2YV8A 1XQNA 4OI4A 5BPXA 3CNAA 2JKBA 1OOPA 4Q1RA 2ZJCA 1BEV1 2E6VA 1LHOA 1U5YA 3PTYA 4GKXA 4H14A 4MXVA 5L73A 3O14A 4DINB 1I6XA 3AJZA 4Q4W3 1H4HA 2RS51 3J8F3 1R1A2 3ZX7A 5KC6A 4XEZA 4XF0A 3VBHB 1YNAA 2ET7A 1LULA 4FTEA 4BLJA 3JBG1 2RR11 4I02A 3ASIA 4LT5A 5JSPA 3NAPA 4QPIA 3L2HA 4FCAA 1COV2 2RS12 4WZCA 5CBLA 2LALA 2GMMA 5J7MA 4I0AA 1MVEA 4W6YA 4OFGA 4META 5C8CC 4ASMB 1R081 1PZ9A 1CD3G 4WVZA 3P3NA 5EFUA 4HVRA 5AC93 3O0XA 2OZ6A 1LOCA 4GKYA 1UF2C 3ZN4A 1BMV1 3MIGA 4NOTA 5JCTA 1LEDA 2NLRA 2R1BA 4M3CB 2DCYA 3PHMA 4JGZA 1YJLA 1W0PA 1VRH2 2NPIA 4J6GA 2MPFA 4A3XA 4AYUA 4OLLA 4KQ7A 1JYIA 3NW4A 3U07A 4B4PA 4Y22B 3D4KA 2ERFA 2JX9A 1ZVFA 4Q4Y3 2YUEA 1WA4A 4GH4A 1EP0A 2BGCA 4XW3A 1HV1A 5LEJA 2EXKA 4W65A 1WCSA 3AZYA 1EAH1 5FFOC 1Z7S1 2EXHA 1EY2A 1X7NA 1VBD1 1YLLA 4J1WA 3L9JT 2CY6A 2GU9A 3CJIB 3H7YA 4ZU4A 4GB31 3CJIA 3OGJA 4I0WB 4AEDC 2XPJA 4K40A 4AXOA 4Q4X2 2ZGPA 4XBLA 2XUMA 5J09A 1LJ7A 2R042 1BQPA 1PZ8A 1YI7A 1MZ6A 2D44A 3RWNA 5GKAC 5F6KA 4NVPA 4R52A 4CEWA 2JE7A 3KT4A 1VB4A 4CRQA 1O3SA 4FPLA 2XKPA 1TMF1 4FAHA 4AW7A 1BVP1 1H8TA 2RS31 3UJQA 2HWF2 4XQDA 3S0MA 3NKTA 3SH5A 3ES4A 1MZ5A 3ZXLA 2VUJA 5EYYA 1U0AA 5B2GB 4CDQC 4H7LA 4LHKA 5KHIA 4KNCA 5C9AB 1X50A 4QQ2A 3WXPA 1MEC1 3H3UA 4GULA 3TN91 1KQRA 2H6BA 2Z69A 5BNOB 3POYA 2WNUB 2EIGA 3IIAA 4QQHA 3PVBB 4QPGB 3RDIA 1KFXL 4LE4A 1CPNA 4FT8A 3I7DA 4BPZA 1I5ZA 1COV3 1S0GA 2RS13 3DPRA 1AL22 1MZFA 1DYPA 1UU5A 5CADA 5EZWA 4PF5A 1ZRRA 3I8TA 5E1RA 4W6WA 4XOGA 1KDMA 1PVC1 1ULCA 2P37A 1O4ZA 5HXVA 5HCBA 1ZREA 3X29B 1QMJA 3HT1A 3B5LB 4AE2A 5C6CA 2KA3A 2VNRA 2YMZA 3I54A 3B69A 3RNSA 3WG2A 3NV2A 4XFAA 4N9IA 2VU9A 1D4M2 2XVGA 1EV12 2QDNA 1H1MA 2D6LX 4D3WA 3ZMNA 4NR1A 5BNNA 4CP0A 3ZYIB 3B9IA 3J4UH 3N3HA 5JI7A 4HN1A 3PVNA 5I0UA 3WHTA 1IPKA 2CTVA 2WSUA 1C5IA 3DV8A 3EQEA 2XBO2 1AR91 1QJY2 5KBFA 1RUC1 3USUB 2LUWA 2CV6A 3AM2A 2WL1A 2R1DA 3L2YA 1GZWB 4LBOA 4XHXA 3ZSLA 1KRIA 1WCKA 1YJKA 3ZFGA 1QJU2 4BMEA 5T3NA 5JOZA 2PHRA 4DY3A 3USUA 5J48A 2DVAA 1AR61 1H2KA 4Q4X3 1PGW1 4FPFA 4HVOA 4Q29A 4D7SA 4Q8KA 2EXJA 2OZJA 4YGCA 1IKQA 4AFDA 4R9DA 4LHNA 1W6MB 5IK7A 1RUG2 4FQZA 1AXKA 2DCZA 2IXLA 3R4SA 1OHFA 1RUI2 5DG1A 2V09A 3B3QE 2D93A 4P5HA 2ZHMA 3GF6A 1A3KA 1UD1A 2HWF3 1C8NA 3VBFB 5JMCA 1S0FA 3VGIA 3WP5A 2ZGQA 1VAMA 3THTA 2XWJB 1VBB2 5EWSA 4QXKA 2JG8B 5FAXA 2XVLA 4EN9B 2PAMA 2ZX2A 3N35A 3ZFFA 2R0HA 2BW8A 4AI2A 3JB4C 2JG8A 3M3QA 4CDXA 3INAA 4D94A 2DVGA 2D5HA 2WLQA 3BOWA 5JZGA 1GSLA 3PNAA 5T54A 5CB7A 4CEWC 4N7UA 1PO12 4EN6B 3N36A 3DGTA 4B29A 1H8TC 1AL23 4CDWA 3B00A 5CVRA 1OMIA 4WM8B 1ND2B 3H1MA 4Y1XA 2ILMA 4H55A 2X29A 4IV1B 3NVCA 2BFUL 4C1WA 3O0VA 1WUVA 4HFSA 1HXS3 1QU0A 1MACA 1LOGA 4G3YC 2AZ5A 1RUNA 2R071 2XKOA 4Q4V2 1ZBE1 2K9ZA 3MF9A 2UU8A 4NN0A 3QH7A 4XHBA 4B4RA 1J3PA 2ZX0A 1PGL1 4HL0A 3HBZA 4FTBA 3DPRC 3RS6A 1AF9A 3KGLA 1EV13 5DDJ2 1WD3A 1HRI2 2I2SA 4P9JA 3IPVB 3M70A 4KWJA 2Q4SA 3O5SA 4LBKA 2BUKA 4YVSC 3FHIB 1VALA 2B5HA 1V9U2 4I09A 4A7KA 4XILA 1XNCA 4YG6A 5I8TA 1ZZ9A 3EXUA 1AYM2 4C1XA 2R6QA 3AKRA 3PJQA 4I01A 1FPN1 4GIQA 2A3XA 2XL7A 3GZTB 2ZMLA 4R8HA 3D8CA 5LRSA 1LB2A 2EAKA 1QJU3 1RTVA 1RJ8A 1POV1 1SCSA 1DBNA 2OA2A 1G9AA 2GN7A 2UWBA 1UKRA 1B09A 3B93A 4L97A 2IWGB 5DUVA 3WDTA 5BNNC 3WQ1A 1OQEA 2ATFA 2YPJA 2O1QA 1S2BA 2WA3A 4ES9A 1Q3EA 3ES1A 4F3JA 4P9IA 4AQTA 4Y1YA 1RUG3 2HJIA 2WZPP 5CFCB 4L9BA 1NQDA 1UPIA 4CDUA 2HWB1 4P9WA 2WFF2 3O12A 1VJ2A 1OSGA 3KCYA 4WM7B 1RUH2 1FOD2 2E7QA 2ZTNA 5FO9B 2Q5TA 2A6YA 1VBB3 2VH9A 5EJ3A 2QQPA 4B4QA 1MQTB 3JU9A 5L7OC 2GC3A 1GANA 1UL9A 1DQ5A 1BYHA 4RQPB 1PIV1 1XRUA 4S2DA 1SLCA 1VAKA 3BPZA 1ASJ2 1YCIA 4Q0SA 5I8SA 2GN3A 2JDZA 3WOGA 1FMD2 3HT2A 3BOPA 2NZ9A 4XJZA 4AHXA 2RM23 5LK7B 1NY71 5KWRA 1RUD1 1C28A 4XYXA 2AYHA 3AKTA 4H3WA 4IL7A 3MIEA 4YARA 3AMMA 4N43A 4QD2A 5I0RA 4FP2A 1R1ZA 4IV3A 1F8VA 4R9AA 5JOWA 3ZXEA 1TME1 1CONA 5F1RA 2GH8A 1AZDA 2RS33 3B02A 5TSWA 1DHKB 4L99A 4Q4V3 1W6NB 4CDXC 4YNIA 1XYPA 3AP9A 4FP3A 5JZGC 4CEYB 3OY8A 1BBT2 2QDRA 1NYWA 3NV1A 1B35B 1JOJA 4TSVA 1ND3A 3I2DA 3V0AB 2LTNA 5E88A 4CDWC 3WY6A 5DDJ3 1HRI3 4XJUA 3H1YA 3VUOA 3MIBA 3WG1A 2XHKA 1S0EA 3V0AA 1O91A 3AP5A 1ZZ6A 3JD73 3APBA 1RIRA 3WW1A 3MW4A 3E97A 4G4FA 1GQGA 5CU1A 4LA3A 3OD4A 4JGYB 3GBWA 4KG0A 5FBZA 3NWKA 4K6BA 3KLSA 2H0BA 4DRVA 3D5OA 4OVEA 5JOXA 3W9AA 2W39A 1GV9A 1I1EA 1SLLA 4LEJA 1ULDA 5FLHA 2HWE1 4YZ4A 1NG0A 3CU7A 4XFHA 2DTYA 3TBDA 3D6EA 4ISQA 4XQ4A 2NP0A 1QQP1 1C8M2 3N7LA 1BZWA 1A8MA 5BNPB 4Y24A 4FPEA 1RMU2 1DGLA 3WDXA 2P34A 1MS4A 2HWD2 2P3JA 2WFF3 3MYXA 4MXWB 2K0GA 5BNPA 4R4XA 3KD4A 1CAWB 2YY1A 3VBRC 2WT1A 3S7EA 1JXNA 3W58A 1RUE2 3SXWA 5C33A 3VLBB 1NCRA 3USSA 3ZN6B 4HPKA 3AZZA 1CAWA 5A3MA 1RINA 2IXJA 1AHSA 5C4WC 1Y9QA 2ARXA 1NE6A 2VECA 1H8VA 2FZ1A 2EF6A 4UW6A 1REEA 2FZ2A 3K51A 4RR3C 1AR81 1AVBA 1URXA 2QUOA 4COZA 1O5UA 4WVMB 4AHYA 2PELA 4CDUC 1DZQA 3FZ3A 4MGIE 2R062 1BK1A 1R1A1 3AMQA 1AYN3 1EPWA 1FYUA 1D4VB 4RGAA 1UN1A 2BVVA 2D40A 3BB6A 5ACA1 4XTPA 3ZFEB 1K5MA 1QXPA 4EN7B 2BYVE 1QHDA 4K21A 2OUJA 2XJUA 1N1YA 1GNZA 3NSTA 2E7TA 4LE3A 1BBT3 3WLUA 4PQ9A 2C9AA 1UIKA 4Q4W2 3J8F2 1N3QA 1MR5A 2WNVA 3FE5A 2I45A 1HRV1 4QM8A 5C8CB 2VXRA 3FLRA 1ZRFA 5CFDA 4HKLA 2W52A 1DIWA 2G9GA 3D0SA 4N43C 1FXZA 1VRH1 4Q26A 1Y7BA 4KGQA 4F7ZA 1VBA1 1DQ6A 1OLQA 1FNYA 1AJOA 3WUCA 1Q8PA 1CQ9A 2P3KA 2MEV2 4AEMA 1LEMA 2CWSA 2JG9B 4K1ZA 3MPPG 1ND3C 1AR73 2EAAA 1RUF3 4UBHA 1X8EA 1GLHA 4AFMA 4COUA 4E4ZA 4HZFA 1W6QA 1VBC2 2BNMA 2VMGA 1CJDA 1XNKA 1RMU3 3AZWA 4Q4Y2 4HT1T 2ZPXA 4MYEA 4XFFA 5FLJA 1LR5A 2PTMA 1PK6B 4QQLA 4AEDB 1LHNA 4XJWA 4OI0A 3QH6A 5HBAA 1NA1A 4C0HA 1C3HA 3V64A 2GNTA 1PK6A 2P17A 3V65A 1YRZA 3FFZA 2XH6A 5GLWA 4S2FA 1Z0HA 3PJYA 3SITA 4QT6A 2ZHKA 4EWDA 5FRAA 2DCKA 1C57A 1WW4A 1RUJ1 1VBE2 2HWC3 2XJQA 1NLRA 2DFCA 4PDWB 5FQ0B 3O0WA 4GWMA 2R063 4YW2A 4K7JA 5K0UC 1XU2A 1W0OA 2PHXA 4QQOA 5ABJB 2VW1A 4QU2A 5GLVA 1U12A 1S0BA 5SV5A 4BQ1A 5BNQA 3E5QA 1QOSA 1V00A 3AYAA 5ABJA 2KM2A 2A75A 2EVXA 4FXKB 2ZBJA 3P3PA 5GZEA 1WMEA 1QH6A 1TQ5A 4EWAA 3SNMA 4MUVA 2DU0A 4URTA 4Z8BA 3ATGA 4EJRA 2H6CA 1LOEA 3A0KA 3NL1A 5D8AC 3AP6A 3R4DB 3FJSA 3KMHA 2ZA9A 3BTAA 5GLTA 3M3EA 2YXSA 1X82A 3QOPA 1ZM1A 2XWBB 3VBHA 4LULA 4QGMA 4CP1A 5JLVA 1K5MC 1TE1B 2RE9A 3VZMA 1MS8A 1DGWX 1R091 5KC5A 3VBSB 1I9RA 2PN5A 4ISRA 4TLFA 1D0HA 1D4M1 3SLIA 3AXDA 2FQPA 2MEV3 4ES8A 3VBSA 3ILFA 2OUHA