1AYM2

Human rhinovirus 16 coat protein at high resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
b'SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym200
1H8TA 2R072 3ZFFA 3ZFFB 1NG0A 1V9U1 1C8NA 2WFF2 1GFF2 2PLV2 2WFF3 1NCQA 1NCQB 5C4WC 3VBFA 3VBFB 4CDQC 4Y5Z0 5ACA1 1VBE1 5AC92 4IV3A 4IV3B 1R091 2R042 4JGZC 1RVF2 4AEDC 2R043 2HWF3 1RVF3 4PDWA 2MEV2 3VBSC 1CJDA 4CDUC 2XBO1 1IHMA 3DPRA 3DPRB 3VBRC 1NY72 1AYM3 4YVWA 4YVWB 3VBHC 1RMU2 1X33A 3J8F2 4GB33 4Q4W2 2ZTNA 2WS93 1NA1A 1NA1B 3J8F3 3ZFGA 2WFF1 3ZFGB 2WZR3 4RR3C 5CFDC 5C4WA 5D8AB 4CDQA 1MQTB 1FOD3 3CJIC 1ND2C 2RMU2 2R041 1BBT2 4JGZA 1AR72 2RMU3 1RVF1 4RQPB 4AEDA 4CEYB 1AR73 4RS5B 4RHV3 2MEV1 3VBSA 3VBSB 1VBD2 4CDUA 3LOBA 4WM8A 4WM8B 2X5IC 1AYM1 3VBRA 1R1A3 1RUJ3 1VRH2 3M8LA 1NY71 1VAKA 4GB31 2WS91 4YVSC 1VRH3 3J8F1 2TBVA 1BMV2 2WZR1 2BUKA 1AR62 1RUF3 4RR3A 5CFDA 5C9AB 4SBVA 4Q4X3 1EAH2 1FOD1 4N53C 1QJX3 1RUG2 1EAH3 3CJIA 1F2NA 1ND2A 2RMU1 1RUG3 3JD72 1AR71 4RHV1 1RUI2 5J96B 1HRV3 1K5MA 1K5MB 3JD73 1R082 5JZGC 1RUI3 2RS33 5DDJ2 1AL22 1R083 1R1A1 1RUJ1 5C8CB 1RUE3 2X5IA 5DDJ3 1AL23 1B35A 1B35B 1FPN3 1VRH1 5LK7B 4GMP3 4YVSB 4YVSA 1VBC3 1BMV1 1RUF1 1SMVA 4Q4X1 3NAPB 1PGW2 1QJX1 1EAH1 4N53A 3ZFEC 1RUG1 1HRV1 3JD71 1QJY3 3FBMA 2Y26A 1RUI1 2WLPA 1TME2 2RS31 1R081 5JZGA 1ASJ2 1H8TB 1RUE1 5DDJ1 1AL21 2R073 1FPN1 2RS12 1DDLA 1RB8G 4GMP1 3TN92 1VBC1 2PLV3 4QPGC 4FSJA 4CEWC 5AC93 1QJU2 4RFT0 2DF7A 4BCUA 1PGW1 1QJU3 2BFUL 4PDWB 3ZFEA 5K0UC 2MEV3 2VQ0A 1QJY1 2RM22 1VB4A 4FTEA 5L7OC 1HXS2 2R071 1RMU3 4Q4W3 1AR92 2HWC2 1HXS3 4QPIC 1ZBA2 1QJZA 1PIV2 2PLV1 2HWC3 5J98B 5C4WB 1ZBA3 4CDQB 1ND3C 4WM7C 1C8M2 4LLFA 5AC91 4CEWA 4JGZB 1QJU1 2R062 1BBT3 4AEDB 4Q4Y2 1PO22 1W39A 4CDUB 5K0UA 4CDXC 1PO23 2RR12 1VBD3 3VBRB 1PO12 2ZZQA 3VBHA 1RMU1 3VBHB 4JGYC 4CDWC 4Q4W1 3VDDC 1HXS1 5ABJC 4EJRA 2HWC1 2HWE2 3JBG2 1OOPC 1ZBA1 4RR3B 2IZWA 1PIV1 5CFDB 4GH4C 1AR63 3JBG3 1Z7S2 4FTSA 1ND3A 4WM7B 4WM7A 2BBVA 5A33A 1Z7S3 3VBOC 1VBB2 3CJIB 1ND2B 1HRI2 1BBT1 5BNPC 1COV2 4Z92B 1RHI2 1AL0G 1COV3 1PO21 1POV0 5BNNC 1E57A 1VBD1 1POV3 2X5IB 4CDXA 3ZXAC 5BNOC 4GMP0 1PGL2 1HQNA 5FMOL 1OHFA 3VDDA 4IV1C 5ABJA 2HWB2 4N43C 1AR61 3JBG1 2BPA2 1OOPA 2HWB3 2RS52 1X36A 1Z7S1 2RS53 4N53B 3VBOA 3VBOB 5ACA2 1COV1 3VBUC 4IV3C 1R092 5JZGB 1D4M2 3JB4C 1TME3 1POV1 5BNNA 1ASJ3 1EV12 1D4M3 1EV13 2RS13 1AR82 1VB2A 3TN93 1AR83 4IV1A 4IV1B 2HWB1 2XPJA 4N43A 4YVWC 2RS51 1NA1C 4Q4V2 4Y4YA 3ZFGC 3ZFEB 4Q4V3 1BEV2 5D8AC 3S6PA 1MQTC 1FMD2 1BEV3 2RM23 1TME1 3VBUA 3VBUB 1FMD3 5FOJB 1ASJ1 1D4M1 2HWD2 1NCRC 2BFUS 2HWF2 4RQPC 1EV11 2RS11 2HWD3 3IDEA 4CEYC 1AR93 4RS5C 1QQP2 5A32A 5A32B 3TN91 1AR81 1PIV3 1QQP3 4WM8C 2FZ1A 2FZ2A 4QPGA 1HX6A 4QPGB 1AYM2 1C8M3 2ZAHA 5CFCC 4CEWB 4GB32 2WS92 1RUD2 1RUD3 2R063 2WZR2 4Q4V1 4Q4Y3 5K0UB 5C9AC 1AUYA 1BEV1 2RM21 1M06G 5D8AA 4FTBA 1FOD2 1FMD1 1MQTA 2RR13 5L7OA 1PO13 5L7OB 1ZBE2 2HWD1 1AR91 1NCRA 1NCRB 1ZBE3 4RHV2 1RUC2 2HWF1 4RQPA 1K5MC 4QPIA 4QPIB 4CEYA 1NOVA 4RS5A 1QQP1 2HWE3 1RUC3 1WCDJ 1ND3B 5C8CC 1MEC2 1R1A2 1RUJ2 1C8M1 2GSYA 5A33B 1PVC2 1MEC3 1B35C 5CFCA 5CFCB 1PVC3 1VBB3 1AYN2 1RUD1 2R061 1HRI3 1OPOA 1AYN3 1RUH2 4Q4Y1 1RUF2 1RHI3 1RUH3 4Q4X2 1VBA2 3NAPC 5C9AA 4CDXB 2RR11 1QJX2 1TMF2 1VBA3 1PO11 1CD3G 1TMF3 4JGYA 4JGYB 4CDWA 4CDWB 3VDDB 1ZBE1 1HRV2 5ABJB 2HWE1 1RUC1 2GH8A 1OOPB 2RS32 2QQPA 1H8TC 3ZFFC 4GH4A 1RUE2 4GH4B 4NWWA 1V9U2 1MEC1 5C8CA 1FPN2 1PVC1 3JB8A 1V9U3 1VBB1 1NCQC 1HRI1 5FMOS 3VBFC 1VBC2 1AYN1 5BNPA 1VBE2 5BNPB 5ACA3 1RHI1 1VBE3 1RUH1 3HAGA 5BNNB 1R093 1VBA1 4NWVA 3NAPA 4PDWC 1F8VA 1TMF1 5BNOA 5BNOB 1PGL1 1A6CA 3DPRC 2XBO2 5GKAC 2WWSA 1QJY2 2XBO3 4N43B
chains in the Genus database with same CATH superfamily
1YFWA 2CTVA 2KA3A 4I3GA 3T30A 4NIHA 4NHMA 4QU2A 2XB6C 3MO4A 4A6SA 1GFF2 1CPMA 4HT1T 2XWBB 2XDVA 1LHUA 2PLV2 5L73A 5KXEA 1NCQA 5C4WC 3IPVB 3VBFB 4CDQC 3HQRA 2K9ZA 1ZZ8A 2WAOA 3M3IA 1HV1A 4HETA 3TWIA 3LOIA 4DEQA 5CG8A 3H1WA 5AC92 3UKNA 3E97A 4IV3B 2OW4A 3POIA 1CAWB 4AWDA 4XFBA 3APBA 4AI1A 2OQ6A 5HV0A 3Q9OA 2GALA 2VH9A 1H9WA 3HVDA 4UW5A 4CTEA 5KR7A 2R043 3BPZA 4AAPA 4TSVA 4BOWA 2HWF3 4LBLA 4PDWA 1AJOA 5EV7A 3GF6A 1LODA 4ZXKA 2XBO1 3DPRB 5CBLA 3B93A 4OLLA 1LU1A 2A6WA 4XBLA 4D7SA 1BXHA 5IAXA 2IXLA 1A3KA 5FO7B 2G9GA 1IPKA 1AYM3 4N8MA 1MS5A 3PLQA 2CGOA 5FZOA 2O8OA 4EN8B 5C70A 3J8F2 4Q4W2 4WV8A 2AYHA 3PIJA 3OTFA 5FY1A 3GZEA 4QT6A 5T5JA 1W6MA 4FPOB 4L8QA 4MH0E 2Q8OA 4PLMA 2VMIA 2WFF1 3ATGA 1UQXA 3ZFGB 3ZO0B 1OQEA 1J1TA 2ILMA 3Q8EA 4Q0SA 5LA9A 5H9SA 2CWSA 2WJSA 4YRDA 5FJHA 4O9EA 1BYHA 5FXVA 1WLTA 5KHJA 4LKDA 2CYFA 4XTPA 4XURA 1XYNA 3AMHA 1W90A 3FWEA 4MO3M 1H2MA 4NN0A 4Q29A 5F2WA 5L9VA 3AMMA 1QDCA 1ND2C 1OFNA 3IT8A 4YNIA 4YZ2A 4UF0A 5C6CA 5F37A 4OHXA 3WF1A 2XJTA 2QZ2A 1RVF1 4YGDA 1UIKA 3CMGA 5LW9A 2XMLA 3R0RA 5FPLA 4LO8A 2B9VA 2YV8A 4BA6A 4CEYB 2WQ8A 4FPLA 3VBSB 2A5ZA 4YG3A 1O59A 5EHDA 3LOBA 4WM8A 5KBFA 2X5IC 4P9IA 5B4NA 1R1A3 3SH5A 4XW3A 5F3GA 1VRH2 1NY71 1C28A 5LY1A 1YQ5A 4K20A 1C4RA 3JCIA 1MS3A 3RWKX 2NYYA 4QKNA 4EWEA 4EZ4A 2ZGQA 2WZR1 3LA2A 3PVEA 2WQZC 4ASMB 3I97A 4HKLA 3RVHA 3EBRA 2BUKA 2G9ZA 1JZ2A 4YW6A 1RUF3 1YRZA 1RXFA 4XF4A 4ZPIA 5CFDA 1J3PA 4DXTA 3H3UA 2UYAA 5I0RA 5A3NA 1FOD1 4L9BA 4QWNA 1N47A 3N4MA 1RUG2 5T54A 1LOFC 3CJIA 4TLFA 1OUXA 4XPVA 4DQAA 2W2IA 5JR7B 3OGVA 3AZYA 4EQVA 2CL2A 2BVBA 2GNTA 5FZIA 4P9LA 2IFWA 5F7UA 1ZA7A 2ZGTA 1RUI3 4KG8A 3LF7A 1V70A 2V5DA 3E6CC 1OLME 5DDJ2 3MV11 1R083 2QQNA 5C8CB 3PVOA 3Q8FA 3K77A 4NROA 2JKXA 3AYAA 3FMGA 3AMQA 1B35A 2FCVA 2OT7A 2HLEA 3T2PA 1GWMA 4E8CA 5A6ZA 3AKQA 2P1BA 4IESA 4YVSA 2JE9A 4QQPA 2PXJA 3M2MA 2X09A 1OLMA 4LHLA 3ZN5A 4ES8A 4JTOA 1W9TA 1BMV1 1MACA 3OUJA 5I0SA 2AUYA 3VZKA 3SISA 1QDOA 1U5IA 1JHNA 3POSA 4K21A 1JZ8A 1BVP1 3I2JA 1WGPA 4Q4X1 4F3JA 4O61A 5LA0A 3UKVA 1GQGA 3BCWA 3TNPB 2YY1A 3ZFEC 3UNPA 3LEGA 3VZJA 2BNOA 1DIWA 4Q5OA 2YPJA 2JG9B 2ET1A 4FO9A 1HRV1 3JD71 5H9QA 4M01A 4QM9A 3OD4A 3WHUA 3FBMA 2WUHA 5APAA 1TME2 2VY0A 1G9FA 2J1AA 5FY8A 4AQ6A 3F95A 1XE8A 4LLOA 4S2GA 4W65A 4JHTA 3THTA 1CONA 1UYPA 3HQUA 3VZMA 1CAVB 1AL21 3JQXA 2JDPA 4HKWA 4QGLA 4JKMA 4PIXA 5DUWA 2VCCA 1Y43B 4Y1YA 5IATA 1DDLA 3E5QA 1YJKA 2H0BA 4GMP1 1Y9GA 4OUMA 3PL0A 4XETA 1ZM1A 1VBC1 2PLV3 3RZLA 4QKFA 1MZ6A 4LHNA 4QPGC 4FSJA 1XYOA 3BVCA 4V1PA 3H8XA 1UN1A 5AC93 1K5JA 1ACCA 2YB7A 3VD3A 3UL2A 3N9NA 4PI0A 3WW2A 1UZZA 3OUHA 3B94A 4YWAA 1LOAA 5FYYA 5EYYA 2JG8A 4PDWB 4CUGA 1IOAA 3TEYA 1EPWA 4LK7A 5C3QA 4QX0A 2FHRA 4XEZA 5I93A 4XE9A 2ZGUA 1W8UA 1XU2A 2SLIA 2ZEYA 1XNTA 3USUA 3WDWA 2JDHA 4QX7A 2EIDA 4UFHA 4FTEA 3PJQA 1UMHA 4A42A 1HXS2 4PQQA 1W2TA 1W6MB 2RDSA 1VRBA 3MGUA 5LBBA 4Q4W3 4I30A 1AR92 3S7EA 1OF3A 1X9PA 3NRUA 4AHWA 1UZYA 5J98B 2DURA 1T6BX 3L2HA 4XFFA 3VB9A 4E4DX 2RVAA 1GOGA 1U0AA 4A4AA 1IS6A 4QGMA 3UGFA 3C3VA 1IQAA 4KQ7A 3BOPA 3ZKYA 1A8DA 2P6HA 1QJU1 2Q8EA 3WNKA 2R062 3LE0A 2ZXQA 2XQRA 5HCBA 3WF3A 1LECA 1QOSA 4Q4Y2 4P9XA 1WCKA 3OEBA 3LKJA 3SCHA 2FBEA 1PO23 1L7LA 2PA7A 2ZHLA 3AKTA 1DHKB 4RGGA 4C0HA 3TYJA 1W0PA 1DLCA 3AP7A 4HBNA 4KL1A 1F5FA 4RD7A 4KGGA 4E4SA 5JZGA 1IGOA 3GYDA 1B09A 3W9AA 4QXBA 4AXOA 1V6OA 5FZEA 2PHRA 2XJVA 4JGYC 4QQHA 1H0BA 3VBHB 4CDWC 4COWA 4DFSA 3M70A 4LXLA 1QH6A 4QKDA 4DS0A 5ABJC 2W87A 4COYA 4R9BA 3HNYM 1QKQA 2ZGLA 2HWC1 1ZYBA 2J1EA 2PYTA 4LA3A 1CWPA 3JBG2 4GD4A 1ZBA1 1CAXA 4AGRA 1PIV1 5CFDB 1UPIA 4LORA 3K4AA 1SG3A 5JOYA 4WM7A 2BBVA 4I0AA 2YXSA 1EUUA 2IXHA 3GBGA 3CJIB 4CVUA 4JKLA 2VC9A 2QFEA 3ZKUA 2P3IA 5BNPC 3KLSA 5A3TA 4FOWA 5EXOA 4W6YA 2LW8A 2ADDA 4IEXA 5HXVA 2O8QA 3WXPA 1E57A 1X7NA 3ZDVA 4FPYA 2YFZA 5EFUA 1CX1A 5IK8A 4CDXA 1LHWA 1UKGA 2DVGA 2N7GA 3ZXAC 4XJZA 4GMP0 5HCHA 1NQJA 2VOVA 2JIJA 4OHZA 4QX2A 1HQNA 2Y34A 5DMYA 3IDCB 1OHFA 4LBOA 3VDDA 3DKWA 1YXWA 3FHAA 4HZFA 3T1LA 4FXKB 3ZPOA 2W39A 1W8NA 1JOJA 3MFCA 1F15A 1AR61 2CSGA 3WDTA 3V64A 2DFBA 5G05L 2BPA2 4BU2A 3THCA 5F3EA 5DG2A 1Z7S1 2QDRA 4LE4A 3HN1A 2AREA 2A3YA 4FFGA 4LIUA 3T4HB 2JWPA 4ZU5A 3U4SA 2VVEA 3U07A 3VBUC 1AJKA 4IV3C 1P8JA 2LTNA 2BV4A 4XOGA 5A3UA 1S0FA 5JZGB 1KS5A 1TME3 1POV1 5CYYA 2VTXJ 1YJLA 1EV12 1RITA 4QX8A 2BDRA 2ID4A 1H1IA 2XXZA 3CEWA 3D3AA 5FZDA 3ZLIA 5LZ6A 3AK0A 2ZGRA 5FMBA 2V4AA 1VB2A 5FYTA 1FV2A 3CZJA 4PF1A 1SLLA 5KC6A 1X9TA 4Y1XA 1RUNA 2W68A 2QZ3A 2VBBA 3BYWA 3MPBA 5FYSA 3N9OA 4HPKA 4IV1B 2HWB1 1X8EA 1LNSA 4OMDA 4ZY9A 4AGVA 5LBEA 4DB5A 5EWSA 3ON7A 3W21A 2A6XA 2WSVA 2E53A 3QOPA 3VKNA 2RS51 1GZCA 2R30A 1W8ZA 1LGNA 4Q4V2 2DV9A 4OZOA 4Y4YA 2PFWA 1SLAA 2WO2A 3ZFGC 3N9QA 4FFFA 3PUAA 4QX1A 1O8PA 1Q3EA 4J1XA 1AXYA 3S6PA 3AP5A 4LITA 3T3YA 3VDAA 2VVDA 2CV6A 3LDKA 1O3TA 1YEWA 2G1MA 1FMD3 5A7NA 4AHXA 4DIQA 4BMEA 4LBQB 1S1AA 2HYXA 1SDDB 3VHNA 4AVTA 1NCRC 2ERFA 2BBAA 2K46A 2ZEXA 3IDEA 2RS11 4P9JA 4Y22A 5DZFA 2FDFA 1KFUL 1AR93 4CEYC 4IEWA 3TRSB 4NOTA 5A32B 3TN91 3I7DA 5C3SA 5FYHA 1AR81 3FUQA 4W50A 2AENA 5F3CA 1NZCA 4MUVA 1QQP3 3RZMA 1YQCA 1QJEA 1VJ2A 4LNVA 1PMJX 4QPGA 5E16A 4R9AA 4LT5A 1DQ1A 1W9FA 2Q4SA 1JYNA 4B4RA 1ONAA 4K8FA 4XF0A 2EIBA 1VP6A 4XBQA 1RUD3 2R063 2WZR2 1DBNA 1URXA 3EXUA 3RRDA 1D0HA 3D8CA 4UYBA 1HW5A 2ARXA 4KNCA 1IZ3A 4Q4Y3 4QX3A 3SEEA 3V0AA 4YGBA 4NIAA 3ZDSA 1BEV1 2RM21 3SH3A 4EE2A 2WBKA 5A80A 1M06G 4FTBA 3VKFC 2Y33A 1FOD2 3VL8A 1G8WA 2BNNA 2LS6A 1LEMA 1I9RA 2QQUA 3G7DA 4UFMA 3MW2A 1UYXA 1EYBA 4G4FA 5L7OB 5ERLA 4FT8A 1PGSA 4W4ZA 2HWD1 4QXCA 3ZYGA 1PMIA 3KV9A 3H7JA 1DGLA 1KQRA 1NOVA 1RUC3 1O4YA 4TLGA 3BOWA 2JX9A 4AQSA 2YBPA 4KBZA 4PI2A 5I0TA 1BLZA 3RMYA 3TEXA 3WVJA 5C8CC 1LB2A 4XBNA 4AQTA 1CIWA 5DN2A 2VOXA 5FLJA 1O5UA 1UKRA 4LTAA 4OCTA 5CFCA 2Q8DA 1HN0A 3MLKA 1AYN2 3KWVA 3MHZA 3R4DB 3Q8CA 4C8DA 3T0DA 1SLIA 4OI2A 4PQ9A 2GMMA 3GBFA 2GZWA 4Q4X2 1TE1B 2VU9A 2VD7A 3QLQA 3PURA 3UYJA 4N7IA 4CDXB 1PO11 3FX3A 4Y5SA 2H0VA 4GKXA 5A7WB 4JGYA 4M00A 4CDWA 4GJZA 2EXKA 3VDDB 1ZBE1 1ZZ7A 2NMNA 1HRV2 2LRPA 4OI1A 3L9JT 3OBAA 1ENXA 2A3WA 3AJYA 1DF0A 3PUQA 1UW8A 3DV8A 5F5QA 1D2QA 2F17A 4S2HA 1OPMA 1YO8A 3ITQA 4J6GA 3V0BA 3ST7A 4GH4B 4NWWA 2ES3A 3ZYHA 1ULDA 1V9U2 4CP0A 4K6BA 1MEC1 4YZ3A 2F4PA 5CKQA 5JPNB 2VPVA 2FD8A 3HT1A 1S55A 4CCCA 2W47A 1NCQC 4IL7A 1YI9A 2JDYA 2GC0A 2VZPA 1VBC2 3SLIA 5BNPA 3SCGA 4AI2A 1DZQA 1RHI1 4CXXA 3N9PA 1MVEA 1RUH1 4P02B 2DUOA 2VOTA 4JDOA 2QQWA 2NZ9A 3FFZA 1PHMA 1VBA1 5FZLA 2G4IA 2XLFA 1E5HA 5IK4A 4D6QA 2FMYA 3BGAA 4PDWC 1SFNA 1F8VA 1TMF1 2R0HA 1REFA 2PHTA 4LO5B 5EYXA 1OLQA 2XVLA 3PU3A 1YC61 5FP8A 3U11A 4Q1RA 2VZVA 2P6CA 4G3YC 1CR7A 3HEIA 2F4LA 1XU1A 2AEYA 2B42B 2O1QA 2XBO3 1W6PB 4HPKB 4I01A 4YM0A 1QNYA 2JE7A 4P9GA 4GWIA 5FY0A 1CAUB 1WA6X 5F5IA 2YGMA 3P5BA 1S0BA 1XOYA 2J1SA 4Y1UA 3DGTA 5E89A 5T50A 5C5TA 4B1MA 4LBKA 1RJ7A 5C33A 3ZYJB 4QX5A 1WCQA 5HV4A 5C71A 5CG9A 4TTGA 5FO8B 5GLZA 3HWJA 2WFF3 3VD9A 3IPVA 3VBFA 5ACA1 4AI8A 4QPYA 3VLBB 4EN6B 5JMCA 4XJAA 2YUEA 1ZZ6A 2XL7A 2YGLA 5BPXA 5CEHA 1ZRIA 2ZMKA 5F39A 4IV3A 4OULA 2R042 4ARYA 1KDMA 1RL3A 3NJXA 4KWLA 1NLSA 1H9PA 1HJGA 3LEIA 2VBDA 2EIGA 3WNMA 1RVF3 2GH2A 4MGTA 1SLCA 4B29A 5CAZA 3U78A 1UYYA 5DUXA 3DPRA 1IHMA 4IE5A 4LKEA 1CZSA 1G86A 1W6OB 2QTWB 5T52A 2AEZA 4CP9A 1XJAA 3VBHC 2VG9A 1W28A 4ZXEA 1NZIA 2QNKA 2VJXA 2ZHMA 4ONUA 1NA1B 4YGEA 1GNZA 3FLPA 3V65A 5F5AA 2XJUA 3ZFGA 3Q8BA 2WZR3 3V0AB 1ZA4A 4PCRA 1WW4A 1JYCA 1MVQA 2OIIA 2V5YA 2VOKA 5CFDC 5IUQA 2ZGKA 2D6NA 4E8DA 2QCSB 1U5ZA 3HN3A 3KHBA 1W8TA 2VNGA 3ZXDA 3IB3A 4ZS2A 1FOD3 3CJIC 3HNMA 3NJZA 4FPJA 4AI9A 3KB5A 2J7MA 2XR4A 1NE6A 3JQWA 1QWRA 4JGZA 4NIIA 1G9CA 4AEDA 3OYWA 5LK5A 1MS9A 2C24A 5IWFA 3WF4A 4FPEA 2VZSA 2OPKA 2MEV1 1KITA 1OQDA 2WNUA 3N36A 3VBSA 2E9QA 4ES9A 1LULA 4Z8BA 3NKTA 3VHPA 1A34A 3S7IA 3A0KA 2D5FA 5FO9B 4R4XA 2JEMA 2W1SA 3VBRA 3M8LA 1VAKA 1NUKA 1CN1A 4H7LA 2WR9A 2WS91 2DTYA 2XQXA 3PUIA 2BOIA 3O5SA 2WFPA 4YVSC 3ZVXA 1ZREA 5BY5A 3PJYA 4J1WA 2A3XA 3K51A 3VHRA 4LIVA 5T55A 2W0XA 1TZOA 1TEIA 1W04A 2OQ7A 2E7QA 4PF5A 5GLTA 3PU8A 4RR3A 3WQ0A 1AR62 3NMBA 4OUSA 4W6WA 3GHMA 2Z2SB 3ILFA 4Q4X3 4YZ4A 5AFBA 3I49A 2FDGA 1ULCA 4NRQA 4NIGA 5FPZA 1STMA 4X8PA 1GOFA 4YM2A 2RMU1 3MDPA 4IEUA 2VUAA 5BNQA 2VTFA 2PHDA 2JIGA 3CIHA 3NKGA 3BODA 5T5LA 1AR71 1RUI2 2R0FA 5J96B 1HRV3 2Y38A 4GQ7A 1K5MB 3JD73 4UFKA 4ARXA 5CADA 3N7MA 1R082 1XYPA 2VZ3A 4HG6B 2ADEA 4AE2A 3SHRA 5FMDA 5JZGC 1OA2A 4AK3A 3VUOA 1RUJ1 4M0HA 4Y26A 3VD4A 1AL23 1LKNA 3WQBA 3CKHA 5FLHA 1NLRA 1K12A 1KGYA 4GMP3 3FC0A 4LBQD 1VBC3 2YDEA 4GWJA 5L36A 2UWBA 2NN8A 5DUVA 2PAEA 2ZGOA 4B4QA 2JDKA 4LEJA 2VZ1A 1WW6A 3VZOA 4XUTA 1PGW2 2Y6JA 2JG8C 1UZWA 1GZWB 3LEKA 1QJX1 2RDRA 1EAH1 3O12A 1VIWB 4INDA 1WW7A 3CLPA 5LRRA 1PX4A 1W05A 1WD3A 4YG0A 4CCKA 4D94A 3MUZ1 2JG9A 4HSLA 4FFHA 2J22A 3ORJA 4NR1A 2WN2A 2ZX1A 1OKQA 3FL7A 4X6RB 2HH9A 2WLPA 3S5AA 1QGLA 4H7MA 2RS31 1UZ0A 2H6BA 1KRIA 4UBGA 3L2YA 3KS7A 1RUE1 2B9UA 5D2AA 1CAVA 4M4PA 2X05A 1O3QA 4AHYA 3K48A 1FPN1 1XNBA 1ZZBA 2RS12 5LRSA 2WWJA 1D2SA 4HKOA 3QD6A 3TN92 4RGAA 5IK5A 2D3SA 1PZ9A 5LBFA 5KXCA 4P00B 3RMXA 3I59B 2GU9A 4DUWA 2QQIA 5AVAA 2WO3A 3BPSA 3LWCA 4RFT0 2DF7A 3I4IA 1QJU3 3B9CA 3K4DA 1N1YA 4BJ0A 3LPFA 1DZTA 3WW1A 4JHZA 2NP0A 4MGIE 1VAMA 1WCSA 4FFIA 4V2WA 5A7SA 3SXWA 4FVVA 1QJY1 2RM22 2A75A 2Q1FA 4JTNA 3OGGA 2D6LX 2Y0IA 4CP9B 3ETQA 1VALA 2E6VA 4BISA 5L7OC 1J3RA 2VZUA 2QDNA 1VMFA 2W1QA 1C5IA 3SC7X 2O0OA 4KBBA 5JI7A 4GKYA 1OBNA 3I2OA 4L0PA 5FXXA 5F6KA 3UETA 3UJQA 2YU2A 5LY2A 1QJZA 3H3LA 5FREA 1DQ4A 2HWC3 4UFJA 1ZBA3 2VNRA 5CIRA 4GALA 3EQEA 4MHRA 4NE9A 4WM7C 5FDBA 1DU3D 3ABZA 1KD7A 5SV5A 2IFRA 1BJQA 1HQWA 4JGZB 5JSPA 1QOOA 3H8RA 5GLVA 4XJUA 4AEDB 3OYWB 3OPWA 4FQ4A 1UL9A 2EALA 3RJRA 3ZIXA 5SV8A 1DQ2A 2WNUB 4U2AA 5KHKA 1PO22 2J1TA 4TYSA 3IZOA 2C5DA 4KH9A 1FAYA 4CDXC 2VE1A 3VBRB 3BALA 4XIKA 2VW2A 2BW8A 3MI8A 1PO12 1WKYA 1Z78A 4LUKA 4E4HA 3EO6A 5LWBA 3GZAA 1O3SA 3VBHA 1OD3A 3VDDC 4NPLA 2DCTA 2WC2A 4QHZA 4XDOA 5A3MA 2VCAA 3O0XA 3LSDA 4KMQA 4RR3B 4CPBD 3RFRA 4GH4C 1AR63 5KXBA 1GYKA 3VDBA 5FY9A 5C3RA 3HBZA 3LA7A 4FTSA 4AVBA 2XLGA 3WZ1A 1Z7S3 1AX1A 1JS9A 4MGZE 2E63A 2VCMA 1UY4A 2PAMA 3OBZA 2Y6LA 4D0QA 2UY9A 4LO6B 1BK1A 4CU8A 1RHI2 4HK9A 3DF0A 2Q30A 4V2VA 2PQSA 4PBPA 1MS1A 1UY1A 2YBKA 1POV3 3PUSA 4UFLA 4BH9A 4FOYA 1H6XA 1RUOA 2EIEA 4XUQA 5T5OA 1IKQA 2CDOA 4ZZ8A 1L7RA 4NMIA 2JKBA 3KD4A 5CVRA 5B4XA 1RC6A 3EMRA 3LIHA 5BV6A 4FAHA 1OOPA 2HWB3 1Y4WA 3ZXJA 2VZOA 3T4VA 2RS53 1QXPA 1XNKA 3NNGA 1NXD1 2JDMA 1QU0A 1O7FA 3D6EA 4K9SA 4MV2A 3VBOB 4NPMA 1JYVA 1YHFA 5ACA2 4ISQA 3K3OA 2YC0A 1UX6A 4HL0A 2XONA 1JOPA 1COV1 3KV6A 4AQ2A 5IVFA 1PM7A 1LOBA 3I2HA 3HOBA 3KCYA 5BNNA 4XQWA 1GZTA 1Q8OA 5FJKA 2Q8CA 4JX0A 2ZMNA 3R4UA 1OXCA 3K46A 4OHWA 3WX5A 3D0JA 2RS13 3AYCA 1NYWA 1D4VB 3RNSA 3BIWE 1OH4A 2WABA 2W3JA 4Y20A 3TN93 1AR83 5JXHA 4FI9A 2JB8A 5F9TA 3HPNA 3LZZA 3OY8A 2VUJA 2Z79A 3WLUA 4IV1A 4L92A 5A6QA 2DVBA 4RSUA 1GLHA 5GM0A 3BI3A 2DUQA 2PTMA 1NA1C 2BQPA 1ZRFA 4ISRA 2W95A 2DCZA 5HXMA 1F9KA 1NLQA 3T09A 4AFDA 2I45A 1SBDA 3NV1A 4XFIA 1OFSA 3AZVA 2PQQA 2D6MA 5FY4A 3S30A 4XHXA 4AG4A 2DWRA 1FMD2 1NKGA 3PNAA 1BEV3 2RM23 5DABA 2PMWB 2P17A 4XF3A 2R16A 4LBQA 3C7EA 1ASJ1 4OVEA 1D4M1 2Q1MA 2YZ4A 1UXXX 2WZ8A 4GAZA 5J7MA 2BFUS 2ZCWA 1DP0A 2ZX4A 4CU9A 2HWD3 1TNRA 1JU4A 1QQP2 2A71A 1W6QB 2XL9A 5FZ6A 2YG0A 4AEMA 5A32A 1SDWA 2BERA 4Q2FA 2HEWF 5TSWA 1HX6A 1JH5A 3B01A 2I74A 1JN2P 1BVVA 5CFCC 4MGYE 3ILRA 3LDRA 3H9AA 4E9KA 2WS92 2VECA 2GNBA 1RUD2 1S4CA 3BKZA 1DG6A 1NT0A 4Y33A 1YFXA 5M0TA 2HBTA 4X8NA 2YU1A 3DUIA 2K0GA 3OD0A 3NO8A 2EVXA 2E51A 1GBGA 1VMHA 4PLNA 2XJSA 1AUYA 3R05A 4E2GA 5FWJA 3I3DA 3AX4A 4YW5A 4QXKA 3ZR5A 1LR5A 5D8AA 5JOWA 3E6DA 2KXLA 3PIGA 5JVVA 1SZBA 3UK9A 4QDQA 3AXEA 3A7QA 2DVAA 4QB6A 2ETEA 5L7OA 1PO13 1D7PM 4A7KA 1GP4A 2AC1A 5FP7A 4IDZA 1ALYA 4WVZA 5FIXA 1ZBE3 2HWF1 1RUC2 1XSRA 2C6SA 4RQPA 1K5MC 1BCXA 3USSA 1PMHX 3N35A 1WCDJ 2BP6A 3W5MA 1R64A 2DUPA 5FZ3A 2G9FA 5ANQA 1RUJ2 4FXGB 4EZHA 1HIXA 3RI9A 1I1EA 2VR4A 1MEC3 5JPMB 5CKNA 3HD8B 2YYOA 1C5HA 2WNOA 2QQOA 3KVAA 4IGPA 5A7OA 3UKTA 1CPNA 1JHJA 1PM4A 3EHKA 1H2NA 1W0NA 2YC4A 3WP3A 4XACA 1UOBA 4DRVA 2OXBA 3NV4A 3IAPA 4NHLA 3MF9A 2RE9A 3O7OA 4FPKA 1RHI3 4JV4A 3O1SA 1WMFA 1RUH3 4D6SA 5C9AA 5FWEA 3I3EA 4LO4B 1DCSA 3AJZA 1DYOA 1QJX2 1VBA3 3CZUA 1N1VA 3LFMA 2JDZA 1GKBA 4LKSA 4XMAA 4CCLA 5A7WA 2EXJA 4D69A 4CUCA 1TMF3 2GNMA 3RZZA 1UCXA 4XXPA 3THDA 3KGLA 2CAUA 3D82A 3E5UA 1W06A 4L97A 4U36A 4ZKTB 4ZU7A 5FBZA 3ZSEA 1OOPB 2DBNA 2RS32 3IIAA 5I8YA 3TNQA 4GH4A 1RUE2 3OPZA 5FRAA 3JZVA 3N3HA 2RV9A 4DPNA 1W3XA 2J1VA 3T0BA 1FPN2 1PVC1 3JB8A 3OEAA 5AFEA 5LCWL 5IK7A 2EXHA 4AFCA 4K3UA 5FMOS 3VBFC 2O14A 4Z2AA 2DCKA 4LOTA 2Y6KA 4LMFA 4QDRA 4NUBA 5ACA3 1W2UA 3AFKA 4AI0A 5IVBA 1LHNA 3FJSA 4PIZA 1F5JA 2WQ4A 4M3CE 2RHPA 5BNNB 3U37A 2V09A 1I6XA 1U5YA 3NAPA 4IEVA 1MZ5A 4DO0A 2JXAA 4CPBA 1DGRN 1F4HA 1YQ2A 3GCWA 4IGQA 1L7QA 1LOCA 5BNOB 1PGL1 4AF9A 4OMCA 4WVWA 3DPRC 2XBO2 4Y20B 1DYPA 2BVVA 4M3CA 1QJY2 2BWCA 3OY8B 4AVCA 1OT5A 1W6PA 1OLRA 1UOFA 5GZDA 2ZS6B 3ALQA 1Q56A 4GWNA 4WVVA 3KZ4C 1V6KA 2E33A 1CAUA 5CA6A 4YM3A 1R1ZA 1TQ5A 1AX0A 2OZJA 2W5FA 3QACA 4PJYA 4BQ1A 5JIUA 5L19A 3H8OA 1H8TA 1BK0A 4PT6A 3ZFFB 1NG0A 2UYBA 2VL4A 2WZPP 3MEPA 1XNDA 1C8NA 1XE7A 2WFF2 3SMHA 2JE8A 3WP6A 2A6ZA 3ZYRA 1JTZX 3GCXA 3IDAA 4XC9A 2NQYA 3AP9A 4YYOA 4CCEA 2ZZJA 3NNJA 5FZ4A 1E5IA 1JU3A 1SLBA 2GP5A 4P9YA 1I5ZA 4Y5Z0 1JYTA 5J48A 2P3JA 4HK8A 1VBE1 3RYRA 2Y6FA 3DYMA 3H8UA 3P1IA 4BQWA 5FZAA 4XF9A 4YW7A 4HVQA 1HJFA 3WG2A 3HT2A 3LA3A 2XG3A 3NNFA 4JGZC 4H2AA 5F1RA 4TZDA 3KHCA 1TVGA 1RVF2 2V4VA 4AEDC 2ZMLA 1C1FA 1SCSA 2OX0A 2WNUC 3VBSC 3ACIA 3H0OA 3H1MA 4OUEA 1CJDA 4BHPA 3HIFA 4KI5M 1W6OA 3VBRC 1UD1A 3DYPA 4NHKA 3IAQA 4IETA 1NY72 3WF2A 3RDIA 4BMBA 4META 5CB7A 5EPAA 4QDSA 4HOOA 1GOHA 4YVWB 1D0GA 1N3OA 2WS93 1CZTA 1LTEA 2GC2A 2ZTNA 3R4SA 4UXAA 1NA1A 4CYDA 3U4XA 4YG6A 2I2SA 4RYDA 3THPA 1HLCA 3TAYA 4A3ZA 4RR3C 5JOXA 2WZEA 3IBMA 4XJ8A 4JZRA 2GMPA 2YC2A 2WWUA 2XKOA 5D8AB 2WNVA 1NQDA 4BIOA 2ZHNA 3OBRA 3BU0A 4Z82A 5JUVA 1NX9A 1SFPA 3QBQA 4A44A 3HR9A 1WA4A 4IERA 5EIYB 1SHWB 4LULA 1W8HA 1XC6A 4O7XA 4E4ZA 1JZ6A 1YIPA 3EYPA 5KHIA 4CCMA 1ULGA 5K4LA 3KVBA 4COUA 2RMU3 5FZ8A 2ZJCA 1QNWA 4RQPB 4UOJA 4BWOA 1AR73 4OQ9A 2VMDA 3WDXA 3H1YA 2CDPA 5FYIA 4OHYA 2VM9A 5E88A 4CDUA 1EPZA 5H9PA 1W03A 1RUJ3 3NVCA 3UESA 4GXLA 4GB31 2XUEA 4EN9B 2E7TA 1DGRA 5FZMA 2D44A 3J8F1 1PZ7A 3W5NA 4XQDA 2TBVA 5LB6A 1BMV2 2DTWA 4UI9L 3OGRA 1IQDC 1G6NA 4FPHA 5EZWA 4A7ZA 1DFQA 2Y60A 3BTYA 5FKCA 5FZKA 5C9AB 2OZ6A 2EAKA 5CNAA 4BDVB 1QXRA 1QIQA 1QJX3 1EAH3 4FP3A 3WG4A 2B8MA 2JG9C 2VMCA 3ROUA 1F2NA 4LKFA 4PIYA 3ECQA 3JD72 5FYCA 1H4HA 1MS0A 4RHV1 1UXZA 2X29A 4XYXA 5G04L 5LATA 1K5MA 4AI3A 3GXUA 4MG2A 1RINA 2LM3A 2RS33 2V72A 3C7HA 1AL22 4UBHA 1WZXA 2OKXA 2WIIB 1JODA 1RUE3 1KFXL 4Q0UA 4DZGA 1Y9MA 3SQOA 1FPN3 1VRH1 3CF6E 4UFIA 4CZSA 2IVIB 4JAAA 5A3WA 2W92A 1H2KA 2JDAA 2DCJA 3RZJA 1BZWA 1LU2A 3UT0A 1RTVA 5FP9A 1O4ZA 2JDNA 2CY6A 1MS8A 2R6QA 4EWDA 4DY3A 1US2A 5FBJA 3RJ2X 1LAJA 1W99A 3MICA 1VE0A 4LBNA 2ZX0A 3AMNA 1QEXA 3NAPB 3NNLA 2A7AA 3KQ4B 1GZWA 4L11A 2AACA 5KC5A 2WINB 2VUCA 5IAVA 3LFIA 4N53A 4K1YA 3VKOA 1RUG1 5FFOC 5FPVA 3KQRA 3KT4A 3V56A 1YUDA 2IXKA 4M3CB 3WW4A 3NWKA 4Q8LA 3ZPYA 4D7TA 4XJWA 4EN0A 3EJKA 4W8JA 4YW3A 3NJYA 1QJY3 1IKPA 1J3QA 2Y26A 2BRTA 4HVOA 2BOJA 2J42A 5FYUA 1ASJ2 1H8TB 1KEXA 3J9SA 1HDKA 2PHUA 2TEPA 3WNNA 1WMXA 4HVRA 5DDJ1 3PHMA 1UAIA 2Q1ZB 4I0WB 1WD4A 2IVJA 3IDBB 4DEVA 3MLJA 1RB8G 3O0WA 2PHFA 4O9GA 2OYZA 3BTZA 3PDQA 5DUUA 4IE7A 5FP3A 3N9LA 5F2SA 4ET7A 1GQPA 2DFCA 1OVSA 3I59A 1AXKA 1ULPA 2D6KA 3FFQA 2BGPA 2D7FA 4BQYA 1G7YA 4WVMA 1QJU2 1WW5A 1GQHA 2K2SA 4XILA 3RS6A 4BCUA 1W6NA 2EA7A 2HEYF 4B7KA 3E1F1 4WZCA 1S2BA 5A7QA 3RZGA 3SITA 3JXSA 1UY0A 1HN1A 3I2KA 5JMOA 3WP4A 2VQ0A 3TB0A 1Q8QA 1VB4A 3ZN6A 2WKKA 3PVNA 3K2OA 3O1VA 2VXJA 2ZEWA 4AYUA 2ARAA 4AAXA 3CBNA 4OFGA 4UW3A 3ZYIB 4JQRA 4XAEA 1H4GA 3WG1A 4MX3A 4P5YA 2R071 3WCSA 2HWC2 1EP0A 4AGGA 4JDNA 1ZBA2 4KWJA 1PIV2 5C8WA 2ZX2A 2P34A 2XVGA 3GBWA 4DMIA 2W9XA 1ZX5A 2UWCA 1WBFA 2WNVB 4UW6A 4AVSA 2VXRA 4AR2A 2TUNA 2ZKNA 5LEJA 2XOMA 2BTVC 1CZVA 1GV9A 1ULOA 1W0OA 3POJA 4CEWA 3CQOA 2VUDA 1BQPA 1FXZA 4GULA 2D97A 3H50A 1OUSA 2MHFA 2RDQA 2PN5A 5K8SA 2Z5WA 1W39A 2X53S 3C7GA 4CDUB 5K0UA 1MZFA 4Q0QA 2IUWA 3RZKA 3H42B 4MGSA 5F3IA 2EAAA 2ZZQA 4CXWA 1QH7A 4QKBA 1FT9A 2ORZA 3CNAA 1RMU1 1W2OA 2IC1A 1K45A 1I5PA 1HXS1 4S2FA 1S0IA 4B7EA 2YPDA 3O1TA 1LGCA 3WSOA 2HJIA 4BQ2A 1OOPC 4XAAA 4XMIA 3TEZA 4NHYA 1HB3A 5JI9A 1Z7S2 2CGPA 3AKSA 1ND3A 1JZ7A 2VTXA 5DQ0A 4GZ9A 3T08A 1XQNA 2JECA 4J25A 1UY3A 1AX2A 2ZHKA 1GP6A 1BBT1 1VLNA 3KT1A 4PLOA 4Q1PA 3ZM8A 5FZBA 5DAQA 4DNYA 4CSWA 5FQ0A 2IXIA 1K3IA 2R32A 1WCUA 2VULA 4ZHNA 4BPZA 5J1XA 1COV3 3VGIA 4CA9A 3MYXA 1LRHA 5A6XA 5BNNC 2JJ6A 3FZ3A 1UU4A 1VBD1 4MYEA 2MPFA 4HMZA 5FPXA 2WSUA 3F2ZA 1CESA 4P08A 4EWAA 2QQVA 1MPXA 1JYWA 4HSJA 5KHHA 5FAXA 5BNOC 1Q8SA 2J1RA 4AFBA 1PGL2 2W1WA 2D98A 2QUOA 4ZZ5A 3O1PA 1ZRDA 2EICA 3VD5A 1ULFA 4YPJA 1FNZA 3ZMNA 4XFAA 1N3PA 1S0JA 4QM8A 5IW0A 4IV1C 4CCJA 1DYKA 2HWB2 4LK6A 5DG1A 5FXZA 1JW6A 2IXCA 1KJLA 2W52A 5BYNA 2LALA 1HKDA 1RXGA 3JBG1 2ZEZA 2RS52 3A21A 1X36A 4IEQA 5L9BA 5HPOA 4LE3A 4N53B 2Y8KA 1OURA 1LCLA 2YFUA 1L3JA 4G9SB 1OC1A 1ST8A 4MLOA 3VBOA 3AMPA 4IEZA 2X10A 2QQJA 4P9WA 4KGQA 2MNGA 3AXDA 4DUXA 1TG7A 1ZZ9A 5FYZA 1O91A 1E5SA 2B7YA 1HB1A 1YCIA 3WNOA 3B7MA 4HANA 5FZGA 1ASJ3 2EXIA 1D4M3 1N1TA 2WA3A 4QXHA 1JI6A 1KS4A 3A23A 2XJQA 1AR82 2HYKA 3C2UA 4A7YA 2PAKA 2WYFA 5EP9A 3P3PA 1O6UA 4FOQA 1CQ9A 5HI0A 4Y3OA 3AYDA 1UU6A 4M4RA 4BM8A 4WVMB 2XPJA 4N43A 3BB6A 4Q27A 1S2EA 3A4UA 3NV3A 4YVWC 5GLWA 1W6NB 5C7GA 4LA2A 4XVHA 2PELA 3KSCA 3AFGA 4CU6A 3J7MA 5J3UA 3D5OA 4YZ1A 4JDMA 3SKVA 1BEV2 1X8MA 3RWNA 4Q8KA 5D8AC 4F8AA 3ZN6B 4FOVA 1OA4A 3POYA 4B3NA 3DXTA 3MW3A 4MXWB 4FCAA 3VBUB 4AW7A 1PK6A 4Y1ZA 5A3PA 5FOJB 1AZDA 1G9BA 1S0CA 2HWD2 2ARBA 3E6BA 2BGOA 1ULEA 3AZXA 3HQXA 4NHXA 3OCPA 2P5BA 3GDBA 1EV11 4RQPC 5I91A 4YW1A 4XFGA 2A6VA 2Y0OA 1W6QA 2D6OX 4XZUG 4LO7A 5L9RA 4HXCA 4BQXA 1PIV3 1NAEA 2OA2A 5JWPA 4MGQA 5K9YA 2FZ1A 2FZ2A 2VVFA 4FPFA 2E7AA 4DY5A 5FKBA 5FZHA 3T1MA 2B45X 2ZAHA 4CEWB 4F7ZA 4GB32 1A8MA 4IE0A 5I0DA 3LD8A 3P6BA 5FOBB 1UU5A 2DVDA 4FQZA 4Q4V1 2PHLA 2D3RA 3CJXA 1OKOA 3KCXA 4AOCA 4NIDA 1N1SA 2BYVE 3ZIWA 1VMJA 5K0UB 5C9AC 2R1BA 2VCBA 3WUCA 3VHOA 1MQTA 5FZ9A 2D93A 1JUIA 2DU0A 3I54A 5GJ6A 4EN7B 2FDKA 1GMMA 2QJVA 1RGSA 2UY8A 3PTYA 3O1MA 3IMNA 1ZBE2 1W9WA 1WWYA 2PHXA 2Y64A 3MFAA 4QAWA 4DINB 4JRLA 3DECA 4FP2A 1CJPA 1NCRB 1RIRA 4RHV2 4ZONA 3DN7A 3LB9A 4QPIB 3AZWA 4RS5A 1IPSA 4IW3A 1UY2A 4NPRA 2AZ5A 1XRUA 3GZUC 4MGKE 5DAXA 1ND3B 1MEC2 1TNFA 1C8M1 4YW2A 4XZPA 3H3ZA 2P3YA 4NRMA 3ELNA 4AEKA 1J84A 4LR4A 1W2AX 4ZS3A 4BLIA 1PVC3 1V6LA 5D1IA 1JYXA 3VL9A 5FQ0B 4LPLA 3LGRA 2XKPA 4ORFA 1Y3TA 1ZNPA 5J37A 2DU1A 1SPPA 3OBTA 1RUH2 4KWUA 1UNBA 1V6JA 1VBA2 3NAPC 2ZPXA 4E27A 3ZR6A 2RR11 4QPWA 1TMF2 2XVKA 1UOGA 4K1ZA 4H55A 1GU3A 4EV0A 2RJKA 5JXJA 3I2IA 3WEZA 5BUVA 1JOBA 1PNFA 4F83A 5BXXA 2DVFA 2VZRA 1XNAA 2GNDA 3UV9A 5IT6A 4I02A 4EROA 2HWE1 1H6YA 4B8EA 1H8TC 1AXZA 3I8TA 3KGZA 1ODMA 2ZA9A 1M4WA 3NV2A 3RGBA 2WT0A 4R4ZA 3GALA 3KV5A 5C3PA 1YFUA 3WR0A 2B46X 4NAOA 1VBB1 4Z1VA 5GALA 2OUHA 1HRI1 3WNPA 3H7YA 3LCPA 2VAUA 5IHRA 2GAUA 3E5XA 3VKLA 1JBCA 1AYN1 3I3MA 2D3PA 3QCWA 1XE0A 4XDPA 4P5HA 1FI2A 5CISA 2SBAA 2W94A 2E26A 1VBE3 3LEMA 3FHQA 4FPGA 3WD5A 4DRRA 5LEKA 4TN7A 1AHSA 1WLCA 1Q43A 2A73B 2EF6A 4OI4A 1WLWA 3M7AA 5D21A 3RQ0A 4KG0A 2LROA 2Q5TA 5BNOA 2ZGNA 4Q0VA 2B39A 1A6CA 2VZQA 3AL6A 5B2GB 4XUNA 5GZEA 5A7PA 1OI6A 4XHBA 5GZGA 4GWMA 2BGCA 3Q8AA 3GGLA 2XHKA 2FCUA 3WHTA 4D8MA 1JZ5A 5FPBA 1H8VA 1VPHA 1Q8VA 4N43B 3POWA 4A2UA 2CNAA 3ZOIA 3RI8A 2R072 3ZFFA 3O14A 1S0EA 5KWRA 3VZNA 1V9U1 5FY5A 2ZKLA 1YWKA 5JXGA 3FN9A 1GUIA 5A6YA 4OQ8A 4Y24A 3S0MA 1ODNA 1VAVA 1O4TA 1NCQB 5F32A 4COZA 1HB2A 1Y9QA 2WNVC 2XUMA 4QMAA 3ZXLA 1JZ3A 1H30A 2Y6HA 1UMIA 1UWWA 1PK6B 4QD2A 1R091 2WL1A 1PX3A 3GJBA 2VW1A 4BXSV 2WO7A 2WRAA 2DYCA 2ZGMA 2OPWA 3M4FA 1SFYA 3AB0A 1XSQA 3N7KA 3AVSA 4MADA 4ASLA 1HB4A 2QE3A 5LASA 5JSRA 4LUMA 1QXJA 3MBWA 1JUHA 2BJSA 4RL7A 5FUNA 4CU7A 2MEV2 3M3OA 2YBSA 1O8SA 1YQ6A 4XFCA 1GP5A 4C1WA 3IMMA 4CDUC 1AVBA 4DXRA 3I2DA 4QHBA 1FX5A 3FHIB 3WG3A 4C1XA 4HN1A 4QB1A 1KDKA 2P4EA 1J1LA 5CKMA 5FK7A 1MZEA 3SCFA 1OA3A 4YVWA 3ZSJA 5FZOB 1RMU2 2W91A 1X33A 4GB33 2RDNA 4XTMA 4TWTA 5T5PA 2UURA 3J8F3 1XXNA 2RG4A 4IE6A 3ILNA 1XB9A 1UIJA 3ZSLA 4I0BA 3NW4A 5C4WA 4MHUA 4A45A 4CDQA 4A6OA 1MQTB 3KF3A 3OPTA 1LEDA 4RA0A 5EJ1B 3AKPA 5H9RA 3LSEA 2RMU2 4ITCA 2R041 1BBT2 4UF0B 1DQ5A 1AR72 4MVTA 1JMUB 3OGJA 1RYYA 4CP2A 2XH6A 2Z4FA 3LAGA 3T2OA 5A1FA 3D0SA 4RS5B 4RHV3 1VR3A 3KT7A 3X29B 2J1UA 4LOSA 5I0UA 5CU1A 4CCNA 3POEA 1VBD2 1KJRA 2G19A 4WM8B 3HJRA 3PTRB 1GR3A 1AYM1 3AYEA 3K3NA 4AHZA 3DYOA 1GWLA 5LBCA 3BUCA 1J59A 3BU7A 5DPNA 2PHWA 3DEMA 5DZEA 2W08A 1VRH3 2VMGA 5A1AA 2VGDA 2HKXA 4UAPA 1LESA 1SPPB 3GM8A 3RYKA 1ZRRA 2WT2A 3ENRA 4K8RB 1T2XA 4YLZA 2XJRA 4YW4A 2XLAA 3CHXA 4D7YA 5EJZB 3B02A 4ATFA 3FLTA 4SBVA 4NVPA 1OH3A 3WNXA 1EAH2 4OYUA 2ARCA 4M0NA 4GJYA 4PBOA 4N53C 4X6QB 3B3QE 1CVNA 2JB4A 2BU9A 2YMZA 3CL1A 3WDYA 4WBBA 1UPSA 1ND2A 5DAVA 2TNFA 1RUG3 3MPPG 4A41A 5FCCA 3WV6A 3M3QA 4XCBA 4AVVA 1XBFA 2GDFA 3T0AA 5J09A 3CDZB 1WMEA 2BNMA 3AL5A 3O1UA 2D40A 1QJFA 4N9IA 3R6SA 1R1A1 1FYUA 4BQ5A 3I2FA 2C26A 2X5IA 1IS3A 4L2NA 5DDJ3 1J58A 5FP4A 3B00A 3HMYA 1B35B 5DAWA 2OVUA 4C90A 3N7LA 1J83A 4Y5TA 1OVPA 5LK7B 3B9IA 3C7OA 4YVSB 4IEPA 4MSVA 2LUWA 4FPCA 3WT3A 3J7LA 1GICA 2ZBJA 1YNAA 5GLUA 4MZUA 5FUIA 1RUF1 1SMVA 2WYSA 4QGNA 2WT1A 2ATFA 2QBXA 3AKRA 4IQPA 4WZFA 3AVRA 3ES1A 3MIEA 4HONA 4AVAA 4DXSA 5ISLA 4QU1A 1SLTA 1V6IA 1WLDA 3NSTA 3BTXA 2DBIA 2H6CA 5F8PA 2XGXA 1LOFA 1O5LA 1X50A 3ZXFA 4GIQA 1C57A 1ZVFA 5FTTC 2XJPA 2NLRA 3RG0A 3WY6A 5FXWA 3WUDA 3W58A 1RUI1 1YFYA 3ACLA 4L99A 5JAXA 4D3WA 4YSFA 1R081 4QB2A 3OGSA 2YROA 3U0ZA 2GP3A 5IVJA 4BK5A 3MIBA 3SEPA 2R073 1QF3A 2CWMA 2L9LA 1GNHA 2Y6GA 5FV3A 2WO1A 1LHVA 5JLVA 5JSOA 3N7JA 4AFMA 4B1LA 2RJLA 3VDCA 4BLJA 3MIGA 3NJVA 1UYZA 3BTAA 1GANA 2NM1A 4IUGA 1F4AA 3MV01 4XQ4A 2QQKA 3BN6A 3W20A 4CEWC 5FMCA 3MF6A 4LHSA 2ZGSA 4N7UA 3T2QA 4EYUA 3M1HA 4H14A 1IG0A 2VMFA 5FZ0A 5IVCA 5IFTA 1PGW1 5JXIA 5FY7A 2BFUL 2JG8B 2CU5A 5FYVA 3AZZA 3I3QA 1OSGA 1OF4A 2ZAAA 3FBYA 3KCCA 4RGKA 4XF1A 2MEV3 3ZFEA 1YIFA 4FBFA 1YYNA 3QH7A 5JR2A 5K0UC 2ZACA 4FAGA 5FZ1A 1XPWA 3USUB 2CAVA 4Q0PA 1X82A 4UW4A 2D6PA 5E1RA 1IS5A 3GJAA 2OUJA 2JDUA 5I8TA 4P14A 2ZOEB 3U75A 4ATEA 2BEOA 1RMU3 1YI7A 2ZX3A 1W8WA 4M3CF 5HBAA 1HXS3 4XCAA 4QPIC 1S2KA 5FZCA 5CZKA 3UGHA 3LQCA 5T3NA 2PLV1 4XUPA 3S57A 3IM0A 1JYIA 3FLRA 1APNA 5IVVA 3T2TA 5C4WB 4CUBA 4CDQB 5IVEA 1ND3C 4BE3A 3J26N 1C8M2 2WA4A 4LLFA 5AC91 2QKDA 4UWDA 1JZ4A 4DXZA 4YZ5A 3ZMOA 1REDA 1YLLA 3RSJA 3ZX7A 2YHJA 3MZHA 3M3EA 1BBT3 3U10A 1S0GA 2GN3A 3I3BA 4AFAA 3D4KA 4AL9A 3PMSA 2ORXA 2Z69A 4BQ3A 4E2SA 5A3LA 5C5UA 2AH2A 2RR12 4I2OA 1VBD3 2GMEA 4N9HA 1Z0HA 3IWZA 4QHOA 4IEYA 1V00A 2C4XA 2KD7A 4Q4W1 4YFZA 5FLIA 4RN5A 3MUY1 2C0ZA 4EJRA 1W8OA 3J7HA 2HWE2 5KHGA 1IS4A 3NL1A 1CAXB 2IZWA 5DZGA 5E6HA 5HCAA 5JCTA 3POGA 3FE5A 4Y4RA 5C3OA 3JBG3 5E8AA 2JD9A 2JENA 3ES4A 3I2GA 4HN0A 4OHVA 4WM7B 3ZN4A 5A33A 1W9SA 1W9YA 3JUUA 3VBOC 2QQLA 1VBB2 2VZTA 1C3HA 1CX4A 1DGWA 2VQTA 4AEJA 1ND2B 1HRI2 4N90A 2V73A 1MR5A 1V6NA 4LQRA 5FR3A 2BWAA 4CCDA 2FDIA 3FUOA 2IWGB 4BQ4A 1COV2 4C0BA 4Z92B 1LJ7A 3WF0A 1AL0G 3POFA 4I3PA 3CU7A 5FYMA 4MOAA 3WCRA 5EJ3A 1PO21 1POV0 4COVA 1UOJA 5GZCA 1UMZA 1CIYA 1SACA 2QQMA 2X5IB 4XUOA 5JDBA 3O1OA 1EUTA 2AR6A 1LGBA 1SBFA 3QH6A 2ET7A 5F5CA 5K7PA 1Q8PA 1FNYA 5FMOL 2JICA 5IYYA 3B5LB 4NAMA 2IXJA 4K40A 5ABJA 3O1RA 2Q0AA 2HEVF 4N43C 1MS4A 2A6YA 4ASKA 4JVAA 1E5RA 3ME2A 5I8SA 1PNGA 4LHKA 4CUAA 5JOZA 4JCKA 3HBKA 2VMEA 2P3KA 3ZYBA 2P37A 3POBA 3GHNA 4XFHA 3RYPA 1FV3A 4URAA 2E31A 2P2KA 1GWKA 1ENQA 1V0AA 2ZABA 1O3RA 3NQHA 5IFPA 2A70A 4Y1VA 1LHOA 1PK6C 3TEWA 1FATA 1WUVA 1R092 1H1MA 4R9CA 1D4M2 3JB4C 4R8HA 4E2QA 4HLTA 3VD7A 1YQ8A 1IG3A 3ASIA 1LOGA 3B69A 2F6BA 4Z07A 4B4PA 2FDHA 3MIHA 1US3A 4JQTA 1SQ4A 1EV13 3PVBB 4ZU4A 4DUVA 3KF5A 1HQLA 2R1DA 2W1UA 2WLQA 2FDJA 1S0DA 3KM5A 1K42A 1H2LA 1EY2A 1JXNA 2R49A 2XWJB 3DCQA 1DQ0A 4JKKA 5F6LB 4GA9A 2ZGPA 2BZDA 5A3OA 4NJ4A 3WW3A 3VZLA 3WINE 2B5HA 3IKWA 2DCYA 4LBJA 3GNEA 3UJOA 4URTA 3ZFEB 4Q4V3 3IN9A 3W59A 2VQAA 3O0VA 1HV0A 4KU8A 1T6GC 4KWKA 1MQTC 3WDVA 2Z42A 1W2NA 3VN4A 2D5HA 4MXVA 3AC0A 1TME1 1U12A 4MXWA 3VBUA 2VQUA 3CO2A 1GSLA 1CAWA 1SBEA 3WNLA 3OG2A 3K75B 1SCRA 1RJ8A 3WP5A 1PZ8A 4BYYA 3ZXGA 2HWF2 4AZZA 4Y22B 4YM1A 3RZHA 5GZFA 1QY4A 2QVSB 3MW4A 4RS5C 2WDBA 2WNEA 3K4ZA 1C1LA 1H1AA 3ZSKA 2B4KA 3PMEA 3TOJA 4CP1A 4IE4A 2R7EB 1ENRA 4WM8C 1SEFA 4W6XA 4QPGB 1QOTA 3M3CA 4BB3A 1GNYA 2E32A 3MIDA 1LOEA 1AYM2 1C8M3 5A70A 1W3VA 4C91A 3LIGA 4XXAA 1UO9A 3BIEA 4IEOA 5DXDA 1KXGA 1QMJA 2UU8A 3WQ7A 1ZRCA 3WOGA 2I07B 2GN7A 1WBLA 5FZ7A 1F35A 2VBPA 2AGSA 2CHHA 3A0NA 3OF1A 4H3WA 3RPQA 3NNMA 3VV1A 3ACGA 4QQOA 4RFRB 4UT5A 1FMD1 3J7NA 5J36A 3JU9A 1GZ9A 2RR13 3TBDA 1OMIA 4IGOA 4QQ2A 3SH4A 2OS2A 4IXLA 3A22A 1PVXA 1XNCA 1N3QA 1V6MA 4SLIA 1U5XA 3ACFA 3AM2A 2VW0A 1AR91 1NCRA 2C1FA 1UF2C 3LDBA 3OB8A 1POQA 5FK8A 1NE4A 4QPIA 5HCFA 2NPIA 5FUPA 3ZYFA 1DLLA 4CEYA 1QQP1 2HWE3 4CRQA 3OSDA 4DOUA 3ZYPA 1OQ1A 3C8XA 3INAA 1R1A2 4Q26A 2RJ2A 2GSYA 2WAAA 4TXWA 3ZXKA 1PVC2 2VNVA 5A33B 3SNMA 3U1XA 2HBUA 1CGPA 1B35C 1A78A 4OI0A 5CFCB 2A1XA 4I09A 4JRAA 4NO4A 2FMDA 1VBB3 2W46A 1RUD1 2R061 5LA2A 1AF9A 1HRI3 2D43A 4A3XA 4S2DA 1OPOA 2KM2A 2UWAA 1AYN3 3MLLA 1QHDA 4PHZA 4Q4Y1 4XJ9A 1RUF2 3ACHA 3DL3A 3VKMA 1UZVA 3ZXEA 1DZRA 5A1LA 2CGNA 3AP6A 4YARA 2VO5A 4XDQA 4BXFA 1ENSA 1BKZA 1DGWX 1DQ6A 2JD4A 2VMHA 4Z2WA 4LBMA 3U14A 1CD3G 1OD5A 1UX7A 3OUIA 3KMHA 2FQPA 4JGYB 4CDWB 1I3HA 4XIOA 3URFA 4CCOA 2C9AA 5ABJB 4BIFA 1G9AA 5IVYA 5DAPA 4YGCA 1RUC1 2X8KA 2GH8A 3J4UH 4OZXA 4BK4A 3EB7A 2KR2A 2QQPA 5FPUA 5IJRA 2WN3A 1Q5OA 3WDUA 4HFSA 3G6JB 3ZFFC 3S5QA 3WQ1A 3V0BB 5FZFA 3DKQA 1WMDA 5C8CA 2ENRA 4JC1A 5AVPA 1V9U3 3DXUA 2NMOA 5EQUA 5KXDA 4BZ4A 5BNPB 1VBE2 3LPGA 4KU7A 5ANNA 1W8FA 3OOXA 2VNOA 4O65A 2C9KA 4YFWA 3HAGA 4QQLA 5JIAA 4CXYA 2FCTA 1R093 1REEA 4R9DA 4LJHA 4NWVA 2DDUA 3AP4A 2GC3A 3HNBM 1BHGA 3OJBA 3MIFA 3PUHA 1ZZCA 4XABA 5FPAA 4CE8A 1IPJA 3GZTB 3IIIA 4K7JA 3SKJE 1Y7BA 2GC1A 3UGGA 1G9DA 2VOWA 5GKAC 5FYBA 2XHNA 2WWSA 1NXMA 3N9MA 4R52A 3P3NA 4NRPA 1LENA 3KV4A 3ZSMA 4D6RA 3ETPA 3C7FA 5LA1A 1F31A
chains in the Genus database with same CATH topology
1YFWA 2CTVA 2KA3A 4I3GA 4NHMA 4QU2A 2XB6C 1GFF2 1CPMA 4HT1T 2XWBB 5L73A 1LHUA 2PLV2 5KXEA 1NCQA 5C4WC 3IPVB 3VBFB 4CDQC 2K9ZA 1ZZ8A 3M3IA 3TWIA 1HV1A 4HETA 3LOIA 5CG8A 3H1WA 5AC92 3UKNA 3E97A 4IV3B 2OW4A 1CAWB 4AWDA 4XFBA 3APBA 4AI1A 3Q9OA 2GALA 2VH9A 1H9WA 4UW5A 4CTEA 2R043 3BPZA 4TSVA 4BOWA 2HWF3 4LBLA 4PDWA 1AJOA 5EV7A 3GF6A 1LODA 4ZXKA 2XBO1 3DPRB 5CBLA 3B93A 4OLLA 1LU1A 2A6WA 4XBLA 4D7SA 1BXHA 2IXLA 1A3KA 5FO7B 2G9GA 1IPKA 1AYM3 1MS5A 3PLQA 2CGOA 4EN8B 2O8OA 3J8F2 4Q4W2 4WV8A 2AYHA 3OTFA 4QT6A 5T5JA 1W6MA 4FPOB 4L8QA 4MH0E 2Q8OA 4PLMA 2VMIA 2WFF1 3ATGA 3ZFGB 3ZO0B 1OQEA 1J1TA 2ILMA 4Q0SA 5H9SA 2CWSA 2WJSA 4YRDA 4O9EA 1BYHA 5KHJA 1WLTA 4XTPA 2CYFA 1XYNA 3AMHA 3FWEA 4Q29A 1H2MA 4NN0A 3AMMA 1QDCA 1ND2C 1OFNA 3IT8A 4YNIA 4YZ2A 5C6CA 4OHXA 2XJTA 2QZ2A 1RVF1 4YGDA 1UIKA 3R0RA 4CEYB 4LO8A 4BA6A 2YV8A 4FPLA 3VBSB 2A5ZA 4YG3A 3LOBA 4WM8A 5KBFA 2X5IC 4P9IA 1R1A3 3SH5A 4XW3A 1VRH2 1NY71 1C28A 4K20A 1C4RA 3JCIA 1MS3A 2NYYA 4EWEA 2ZGQA 2WZR1 3LA2A 3PVEA 2WQZC 4ASMB 4HKLA 3EBRA 2BUKA 1RUF3 1YRZA 4XF4A 5CFDA 1J3PA 3H3UA 2UYAA 5I0RA 1FOD1 4L9BA 1N47A 3N4MA 1RUG2 5T54A 1LOFC 3CJIA 4TLFA 4XPVA 4DQAA 5JR7B 3AZYA 2CL2A 2BVBA 2GNTA 4P9LA 2IFWA 2ZGTA 1RUI3 4KG8A 3E6CC 1V70A 5DDJ2 1R083 5C8CB 3PVOA 3AYAA 3FMGA 3AMQA 1B35A 3AKQA 4IESA 4YVSA 2JE9A 4QQPA 3M2MA 4LHLA 3ZN5A 4ES8A 4JTOA 1BMV1 1MACA 5I0SA 2AUYA 3VZKA 3SISA 1QDOA 1U5IA 1JHNA 3POSA 4K21A 1BVP1 4Q4X1 1WGPA 4F3JA 3UKVA 1GQGA 3BCWA 3TNPB 2YY1A 3ZFEC 3VZJA 2BNOA 1DIWA 2YPJA 2JG9B 2ET1A 4FO9A 1HRV1 3JD71 5H9QA 4M01A 4QM9A 3OD4A 3WHUA 3FBMA 1TME2 2VY0A 1G9FA 4AQ6A 4W65A 1XE8A 4LLOA 4S2GA 3THTA 3VZMA 5JZGA 1CONA 1CAVB 1AL21 3JQXA 4HKWA 4QGLA 4PIXA 5DUWA 1DDLA 1Y43B 4Y1YA 3E5QA 1YJKA 2H0BA 4GMP1 4OUMA 4XETA 1ZM1A 1VBC1 2PLV3 1MZ6A 4LHNA 4QPGC 4FSJA 1XYOA 4V1PA 1UN1A 5AC93 3UL2A 3WW2A 1UZZA 3B94A 1LOAA 5EYYA 2JG8A 4PDWB 1IOAA 1EPWA 2FHRA 4XEZA 5I93A 4XE9A 2ZGUA 1XU2A 2SLIA 3USUA 3WDWA 4FTEA 3PJQA 1HXS2 3MGUA 1W6MB 4Q4W3 4I30A 1AR92 3S7EA 4AHWA 1UZYA 5J98B 2DURA 4XFFA 3L2HA 4E4DX 1U0AA 1IS6A 4QGMA 3C3VA 1IQAA 4KQ7A 3BOPA 1A8DA 1QJU1 2R062 5HCBA 1LECA 1QOSA 4Q4Y2 4P9XA 1WCKA 3LKJA 3SCHA 2FBEA 1PO23 2PA7A 2ZHLA 3AKTA 4RGGA 1DHKB 4C0HA 3TYJA 1W0PA 3AP7A 4HBNA 4KL1A 1F5FA 4RD7A 4KGGA 4E4SA 1IGOA 3GYDA 1B09A 3W9AA 4AXOA 1V6OA 3VBHB 2PHRA 2XJVA 4JGYC 4QQHA 1H0BA 4CDWC 4COWA 4DFSA 4DS0A 3M70A 1QH6A 5ABJC 4COYA 4R9BA 1QKQA 2ZGLA 2HWC1 1ZYBA 2PYTA 4LA3A 3JBG2 1ZBA1 1CAXA 4AGRA 1PIV1 5CFDB 1UPIA 5JOYA 4WM7A 2BBVA 4I0AA 2YXSA 3GBGA 2IXHA 3CJIB 2QFEA 2P3IA 5BNPC 3KLSA 4FOWA 5EXOA 4W6YA 4IEXA 5HXVA 2O8QA 3WXPA 1E57A 1X7NA 4FPYA 5EFUA 5IK8A 4CDXA 1LHWA 1UKGA 2DVGA 2N7GA 3ZXAC 4XJZA 4GMP0 1NQJA 2VOVA 4OHZA 1HQNA 3IDCB 1OHFA 4LBOA 3VDDA 3DKWA 1YXWA 4HZFA 3T1LA 4FXKB 2W39A 1JOJA 3MFCA 1AR61 3WDTA 3V64A 2DFBA 2BPA2 5DG2A 1Z7S1 2QDRA 4LE4A 3HN1A 2AREA 2A3YA 4ZU5A 2VVEA 3U07A 3VBUC 1AJKA 4IV3C 2LTNA 4XOGA 1S0FA 5JZGB 1KS5A 1TME3 1POV1 1YJLA 1EV12 1RITA 1H1IA 3CEWA 3AK0A 2ZGRA 1VB2A 1FV2A 1SLLA 5KC6A 4Y1XA 1RUNA 2W68A 2QZ3A 3MPBA 4C90A 4HPKA 4IV1B 2HWB1 1X8EA 4AGVA 4DB5A 5EWSA 2A6XA 2WSVA 2E53A 3QOPA 3VKNA 2RS51 1GZCA 2R30A 1LGNA 4Q4V2 2DV9A 4Y4YA 2PFWA 1SLAA 3ZFGC 4J1XA 1Q3EA 1AXYA 3S6PA 3AP5A 2VVDA 2CV6A 1O3TA 1FMD3 4AHXA 4BMEA 4LBQB 1S1AA 3VHNA 4AVTA 1NCRC 2ERFA 4P9JA 3IDEA 2RS11 4Y22A 5DZFA 1KFUL 1AR93 4CEYC 4IEWA 3TRSB 4NOTA 5A32B 3TN91 3I7DA 1AR81 3FUQA 2AENA 1NZCA 4MUVA 1QQP3 1VJ2A 4LNVA 4QPGA 5E16A 4LT5A 4R9AA 1DQ1A 2Q4SA 4B4RA 1ONAA 4K8FA 4XF0A 4XBQA 1VP6A 1RUD3 2R063 2WZR2 1DBNA 1URXA 3EXUA 3RRDA 1D0HA 3D8CA 1HW5A 2ARXA 4KNCA 1IZ3A 4Q4Y3 3V0AA 4YGBA 3ZDSA 1BEV1 2RM21 3SH3A 1M06G 4FTBA 3VKFC 1FOD2 3VL8A 1G8WA 2BNNA 1LEMA 1I9RA 3G7DA 3MW2A 4G4FA 1EYBA 5L7OB 4FT8A 1PGSA 2HWD1 3ZYGA 1PMIA 3H7JA 1DGLA 1KQRA 1NOVA 1RUC3 1O4YA 3BOWA 2JX9A 4AQSA 5I0TA 3WVJA 3RMYA 5C8CC 1LB2A 4XBNA 4AQTA 1CIWA 2VOXA 5FLJA 1O5UA 1UKRA 4LTAA 5CFCA 3MLKA 1AYN2 3R4DB 1SLIA 4OI2A 4PQ9A 2GMMA 3GBFA 2GZWA 4Q4X2 1TE1B 2VU9A 3QLQA 4CDXB 4N7IA 1PO11 3FX3A 2H0VA 4GKXA 4JGYA 4M00A 4CDWA 2EXKA 3VDDB 1ZBE1 1ZZ7A 2NMNA 1HRV2 4OI1A 3L9JT 1ENXA 2A3WA 3AJYA 1DF0A 1UW8A 3DV8A 5F5QA 1D2QA 4S2HA 1OPMA 1YO8A 4J6GA 3V0BA 3ST7A 4GH4B 4NWWA 2ES3A 1ULDA 1V9U2 4CP0A 4K6BA 1MEC1 4YZ3A 2F4PA 5JPNB 2VPVA 3HT1A 1S55A 1NCQC 4IL7A 1YI9A 2GC0A 1VBC2 3SLIA 5BNPA 3SCGA 4AI2A 1DZQA 1RHI1 1MVEA 1RUH1 2DUOA 4JDOA 2NZ9A 3FFZA 1PHMA 1VBA1 2G4IA 2XLFA 5IK4A 2FMYA 4PDWC 1F8VA 1SFNA 1TMF1 2R0HA 1REFA 2PHTA 4LO5B 5EYXA 1OLQA 2XVLA 4Q1RA 4G3YC 1CR7A 1XU1A 4I01A 2B42B 2O1QA 2XBO3 1W6PB 4HPKB 4YM0A 1QNYA 2JE7A 4P9GA 1CAUB 2YGMA 1S0BA 4Y1UA 3DGTA 5E89A 5T50A 4LBKA 1RJ7A 5C33A 3ZYJB 4QX5A 5CG9A 5FO8B 5GLZA 3HWJA 2WFF3 3IPVA 3VBFA 5ACA1 4AI8A 4QPYA 3VLBB 4EN6B 5JMCA 4XJAA 2YUEA 1ZZ6A 2XL7A 2YGLA 5BPXA 2ZMKA 4IV3A 4OULA 2R042 1KDMA 1RL3A 4KWLA 1NLSA 1H9PA 2EIGA 1RVF3 2GH2A 1SLCA 4B29A 5CAZA 5DUXA 3DPRA 1IHMA 1G86A 1W6OB 5T52A 3VBHC 2VG9A 2QNKA 2ZHMA 4ONUA 4YGEA 1NA1B 1GNZA 3FLPA 3V65A 2XJUA 3ZFGA 2WZR3 3V0AB 1ZA4A 4PCRA 1WW4A 1JYCA 1MVQA 2OIIA 2V5YA 2VOKA 5CFDC 5IUQA 2ZGKA 2D6NA 2QCSB 1U5ZA 3ZXDA 2VNGA 1FOD3 3CJIC 3NJZA 4FPJA 3KB5A 4JGZA 1NE6A 3JQWA 1QWRA 1G9CA 4AEDA 3OYWA 5LK5A 1MS9A 4FPEA 2OPKA 2MEV1 1KITA 1OQDA 2WNUA 3N36A 3VBSA 2E9QA 4ES9A 1LULA 4Z8BA 3NKTA 3VHPA 3S7IA 3A0KA 2D5FA 5FO9B 4R4XA 2JEMA 3VBRA 3M8LA 1VAKA 1CN1A 4H7LA 2WS91 2DTYA 4YVSC 3O5SA 1ZREA 2WFPA 3ZVXA 5BY5A 3PJYA 4J1WA 2A3XA 3K51A 3VHRA 5T55A 2W0XA 1TEIA 4PF5A 2E7QA 5GLTA 1AR62 3WQ0A 4RR3A 4OUSA 4W6WA 3GHMA 2Z2SB 3ILFA 4Q4X3 4YZ4A 5AFBA 1ULCA 5FPZA 4X8PA 5BNQA 4YM2A 2RMU1 3MDPA 4IEUA 2VUAA 2PHDA 5T5LA 3NKGA 3BODA 1AR71 1RUI2 2R0FA 5J96B 1HRV3 2Y38A 4GQ7A 1K5MB 3JD73 5CADA 3N7MA 1R082 1XYPA 5JZGC 4AE2A 3SHRA 3VUOA 1OA2A 4AK3A 1RUJ1 4M0HA 4Y26A 1LKNA 1AL23 5FLHA 1NLRA 4GMP3 3FC0A 4LBQD 1VBC3 2YDEA 5L36A 2UWBA 2NN8A 5DUVA 2PAEA 2ZGOA 4B4QA 4LEJA 1WW6A 3VZOA 1PGW2 2JG8C 1GZWB 1QJX1 4INDA 1EAH1 3O12A 1VIWB 3U11A 1WW7A 3CLPA 5LRRA 1WD3A 4YG0A 4D94A 2JG9A 4HSLA 4NR1A 2ZX1A 1OKQA 4X6RB 2WLPA 1QGLA 4H7MA 2RS31 2H6BA 1KRIA 4UBGA 3L2YA 3KS7A 1RUE1 2B9UA 1CAVA 1O3QA 4AHYA 3K48A 1FPN1 1XNBA 1ZZBA 2RS12 5LRSA 1D2SA 4HKOA 3QD6A 3TN92 4RGAA 5IK5A 2D3SA 1PZ9A 5KXCA 3RMXA 3I59B 2GU9A 5AVAA 3LWCA 4RFT0 2DF7A 3I4IA 1QJU3 3B9CA 1N1YA 1DZTA 3WW1A 2NP0A 4MGIE 1VAMA 1WCSA 3SXWA 4FVVA 1QJY1 2RM22 2A75A 4JTNA 3OGGA 2D6LX 2Y0IA 3ETQA 1VALA 2E6VA 5L7OC 1J3RA 2QDNA 1C5IA 2O0OA 4KBBA 5JI7A 4GKYA 5F6KA 3UJQA 1QJZA 5FREA 1DQ4A 2HWC3 1ZBA3 2VNRA 5CIRA 4GALA 3EQEA 4WM7C 5FDBA 1DU3D 1KD7A 5SV5A 2IFRA 1BJQA 1HQWA 4JGZB 5JSPA 1QOOA 5GLVA 4XJUA 4AEDB 3OYWB 4FQ4A 1UL9A 2EALA 3RJRA 3ZIXA 5SV8A 1DQ2A 2WNUB 4U2AA 5KHKA 1PO22 4TYSA 2C5DA 4KH9A 1FAYA 4CDXC 3VBRB 3BALA 4XIKA 2VW2A 2BW8A 3MI8A 1PO12 4LUKA 1Z78A 3EO6A 1O3SA 3GZAA 3VBHA 3VDDC 2DCTA 2WC2A 5A3MA 3O0XA 3LSDA 4RR3B 4GH4C 1AR63 5KXBA 1GYKA 3HBZA 3LA7A 4FTSA 4AVBA 2XLGA 3WZ1A 1Z7S3 1AX1A 4MGZE 2E63A 2PAMA 2UY9A 4LO6B 1BK1A 1RHI2 4HK9A 3DF0A 2Q30A 4PBPA 1MS1A 1POV3 4BH9A 4FOYA 1RUOA 5T5OA 1IKQA 2JKBA 3KD4A 5CVRA 1RC6A 5BV6A 4FAHA 1OOPA 2HWB3 3ZXJA 2RS53 1QXPA 1XNKA 1NXD1 3D6EA 1QU0A 1O7FA 4K9SA 4MV2A 3VBOB 1YHFA 5ACA2 4ISQA 2YC0A 1UX6A 4HL0A 1COV1 4AQ2A 1PM7A 1LOBA 3KCYA 5BNNA 4XQWA 1Q8OA 2ZMNA 3R4UA 4OHWA 3WX5A 3D0JA 2RS13 3AYCA 1NYWA 1D4VB 3RNSA 3BIWE 4Y20A 3TN93 1AR83 5F9TA 3LZZA 3OY8A 2VUJA 2Z79A 3WLUA 4IV1A 4L92A 2DVBA 4RSUA 1GLHA 5GM0A 2DUQA 2PTMA 1NA1C 2BQPA 1ZRFA 4ISRA 2DCZA 1F9KA 4AFDA 2I45A 1SBDA 3NV1A 4XFIA 1OFSA 3AZVA 2PQQA 2D6MA 3S30A 4XHXA 4AG4A 2DWRA 1FMD2 3PNAA 1BEV3 2RM23 2P17A 4XF3A 2R16A 4LBQA 1ASJ1 4OVEA 1D4M1 2Q1MA 2YZ4A 5J7MA 2BFUS 2ZCWA 2ZX4A 2HWD3 1TNRA 1QQP2 2A71A 4AEMA 1W6QB 2XL9A 5A32A 1SDWA 4Q2FA 2HEWF 5TSWA 1HX6A 1JH5A 3B01A 2I74A 1JN2P 1BVVA 5CFCC 4MGYE 3ILRA 4E9KA 3H9AA 2WS92 2VECA 2GNBA 1RUD2 1DG6A 1YFXA 4X8NA 3DUIA 2K0GA 3OD0A 3NO8A 2EVXA 2E51A 1GBGA 4PLNA 2XJSA 1AUYA 3R05A 4E2GA 3AX4A 4YW5A 4QXKA 5JOWA 1LR5A 5D8AA 3E6DA 2KXLA 5JVVA 3UK9A 3AXEA 2DVAA 2ETEA 5L7OA 1PO13 4A7KA 1ALYA 4WVZA 1ZBE3 1RUC2 2HWF1 4RQPA 1K5MC 1BCXA 3USSA 3N35A 1WCDJ 2DUPA 2G9FA 1RUJ2 4FXGB 1HIXA 3RI9A 1I1EA 1MEC3 5JPMB 3HD8B 2YYOA 1C5HA 3UKTA 1CPNA 3EHKA 1H2NA 3WP3A 4DRVA 3NV4A 4NHLA 3MF9A 2RE9A 3O7OA 4FPKA 1RHI3 4JV4A 1WMFA 1RUH3 5C9AA 4LO4B 3AJZA 1QJX2 1VBA3 1N1VA 2JDZA 1GKBA 4XMAA 4D69A 2EXJA 1TMF3 2GNMA 3RZZA 1UCXA 4XXPA 3KGLA 2CAUA 3D82A 3E5UA 4U36A 4L97A 4ZKTB 4ZU7A 5FBZA 3ZSEA 1OOPB 2RS32 3IIAA 5I8YA 3TNQA 4GH4A 1RUE2 3OPZA 5FRAA 3JZVA 3N3HA 4DPNA 1FPN2 1PVC1 3JB8A 5AFEA 5IK7A 2EXHA 4AFCA 4K3UA 5FMOS 3VBFC 2DCKA 5ACA3 1W2UA 3AFKA 4AI0A 1LHNA 3FJSA 4PIZA 1F5JA 2WQ4A 4M3CE 2RHPA 5BNNB 2V09A 1I6XA 1U5YA 3NAPA 4IEVA 1MZ5A 2JXAA 1DGRN 5BNOB 1PGL1 1LOCA 4AF9A 4WVWA 3DPRC 2XBO2 4Y20B 1DYPA 2BVVA 4M3CA 1QJY2 2BWCA 3OY8B 4AVCA 1W6PA 1OLRA 5GZDA 2ZS6B 3ALQA 1Q56A 4GWNA 4WVVA 3KZ4C 1V6KA 1CAUA 5CA6A 4YM3A 1R1ZA 1TQ5A 1AX0A 2OZJA 3QACA 4PJYA 4BQ1A 5JIUA 5L19A 1H8TA 3ZFFB 1NG0A 2UYBA 2WZPP 3MEPA 1XNDA 1C8NA 1XE7A 2WFF2 3SMHA 3WP6A 2A6ZA 3ZYRA 1JTZX 2NQYA 3AP9A 4YYOA 2ZZJA 1SLBA 4P9YA 4Y5Z0 1I5ZA 5J48A 2P3JA 4HK8A 1VBE1 3RYRA 3H8UA 4XF9A 4HVQA 3WG2A 3HT2A 3LA3A 2XG3A 4JGZC 5F1RA 4TZDA 1RVF2 4AEDC 2ZMLA 1C1FA 1SCSA 2WNUC 3VBSC 3H0OA 3H1MA 1CJDA 4BHPA 3HIFA 1W6OA 3VBRC 1UD1A 4NHKA 4IETA 1NY72 3RDIA 4BMBA 4META 5CB7A 4YVWB 1D0GA 1N3OA 2WS93 1LTEA 2GC2A 2ZTNA 3R4SA 4CYDA 4UXAA 1NA1A 3U4XA 4YG6A 2I2SA 3THPA 1HLCA 3TAYA 5JOXA 4RR3C 3IBMA 4XJ8A 2GMPA 2XKOA 5D8AB 2WNVA 1NQDA 4BIOA 2ZHNA 3OBRA 4Z82A 3QBQA 3HR9A 1WA4A 4IERA 4LULA 4E4ZA 1YIPA 5KHIA 1ULGA 4COUA 2RMU3 2ZJCA 1QNWA 4RQPB 4BWOA 1AR73 3WDXA 3H1YA 4OHYA 5E88A 4CDUA 1EPZA 5H9PA 3NVCA 1RUJ3 4GXLA 4GB31 4EN9B 2E7TA 1DGRA 2D44A 3J8F1 1PZ7A 4XQDA 2TBVA 1BMV2 2DTWA 1G6NA 4FPHA 4A7ZA 5EZWA 1DFQA 5C9AB 2OZ6A 2EAKA 5CNAA 1QXRA 1QJX3 1EAH3 4FP3A 3WG4A 2B8MA 2JG9C 3ROUA 1F2NA 4PIYA 3ECQA 3JD72 1H4HA 1MS0A 4RHV1 2X29A 4XYXA 4AI3A 1K5MA 1RINA 2LM3A 2RS33 4UBHA 1AL22 2WIIB 1RUE3 1KFXL 4Q0UA 4DZGA 1FPN3 1VRH1 3CF6E 4CZSA 4JAAA 1H2KA 2DCJA 1BZWA 1LU2A 1RTVA 1O4ZA 2CY6A 1MS8A 2R6QA 4EWDA 4DY3A 3RJ2X 3MICA 4LBNA 2ZX0A 3AMNA 3NAPB 2A7AA 1GZWA 4L11A 5KC5A 2WINB 4N53A 4K1YA 3VKOA 1RUG1 5FFOC 3KQRA 3KT4A 3V56A 1YUDA 2IXKA 4M3CB 3WW4A 3NWKA 4Q8LA 3ZPYA 4D7TA 4XJWA 4EN0A 3EJKA 4YW3A 1QJY3 1IKPA 1J3QA 2Y26A 4HVOA 1ASJ2 1H8TB 3J9SA 1HDKA 2PHUA 2TEPA 4HVRA 5DDJ1 3PHMA 1UAIA 2Q1ZB 4I0WB 1WD4A 3IDBB 3MLJA 1RB8G