1AYM2

Human rhinovirus 16 coat protein at high resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym200
1HRV1 4Q4X2 3ZXAC 3VBRA 3JBG1 5AC91 2RMU1 1RUF1 4GH4B 5ABJC 1RUJ3 1A6CA 1HXS1 2RS12 1RUI3 1VBE2 2HWD3 5C8CC 1HQNA 2PLV1 1RUE1 2R063 4BCUA 3VBSA 1C8M2 1K5MA 1RMU2 1ND2B 4JGYA 1PGW2 2HWB2 2BPA2 2WS92 4Q4Y1 1K5MC 1NCRA 5D8AA 3NAPC 1ZBE2 5ACA2 4JGYC 3CJIC 4NWVA 2BBVA 1VBC1 1RUH1 2RR13 1VBA1 1QQP2 4RR3C 1NCRC 5D8AC 1QJU2 1EAH3 2WZR3 1OHFA 1D4M1 1VBD1 4IV1A 1PGL1 5DDJ3 1MQTA 1BBT3 1RHI3 1HRI2 1FOD2 1RUC1 1TMF1 5BNNC 2R073 1R1A3 1ZBA2 4CDQA 1MQTC 1CD3G 1R092 2HWF2 1RVF3 2QQPA 4Q4X3 3CJIB 5JZGB 1IHMA 1AL0G 1AR92 1Z7S3 4YVWA 1R081 4RR3B 1FMD2 4CDQC 1AYN2 4WM8C 4RQPC 4AEDA 4CEYA 2RS13 3JD71 1VBE3 4YVWC 5J98B 3VBFC 4RHV1 1AR82 3J8F2 1PO22 5BNNB 3ZFEC 5J96B 1PO11 1V9U2 3TN93 1AR61 4N43C 1QJX2 2WS93 1PIV3 3IDEA 1ND3C 1HRV2 5ACA3 4GH4A 5A33B 3JBG2 1VRH1 1QQP3 2ZAHA 4QPGB 5C4WB 1QJU3 3VBFB 4FTEA 4GH4C 1HXS2 1FPN1 1OOPB 2PLV2 1RUE2 1ND2A 4EJRA 1FOD3 2RM21 4GMP3 2R041 4Q4W2 1B35B 2HWC2 1RUD1 1WCDJ 1ZBA3 1ND2C 1R093 1COV1 2HWF3 1BMV1 1AYM1 4GMP0 1AR93 2XBO1 1VBA2 1FMD3 1GFF2 3JB8A 1AYN3 1AR72 1RUJ1 5C8CA 1RUI1 2HWD1 1RUG1 3VDDB 1VAKA 1AL23 3FBMA 5FMOS 1D4M2 1VBD2 1AR83 5CFCB 1PGL2 4QPIB 1M06G 1F8VA 1DDLA 4SBVA 1PO23 1RUC2 3VBOC 2WWSA 2RS33 1CJDA 1ASJ1 1QJX3 1QJY2 4FTSA 3NAPA 2HWE3 4RS5B 3CJIA 5JZGA 3ZFFB 4Q4V3 4RR3A 2RR11 4PDWB 3JBG3 1NOVA 2BUKA 4YVSB 3S6PA 5JZGC 1HXS3 1C8NA 4RHV2 5BNOB 4Y4YA 5DDJ1 5L7OC 5BNNA 3VBOB 1QJZA 4LLFA 5CFDB 1NY71 2VQ0A 2R071 1R1A1 4Q4W3 2HWC3 2WFF3 1AR62 2IZWA 4GB31 4Q4X1 2X5IB 1Z7S1 5A33A 1VBB2 4WM8A 4RQPA 1VBA3 1VRH2 2MEV1 1AR73 3VBFA 2RS11 3JB4C 1VBE1 1OOPA 4QPGC 5FMOL 5C4WC 1FPN2 5L7OB 1D4M3 2WLPA 4JGZB 2RS51 1MEC1 1AUYA 3ZFEA 3VBSB 1OOPC 4N43A 4CDUB 3TN91 1B35A 1C8M3 1PGW1 1RMU3 1ND3A 1POV3 1PIV1 1QJY3 3VBHC 1F2NA 4WM7B 1COV2 2HWB3 5ACA1 5FOJB 1W39A 1AYM2 1B35C 1EV12 1QQP1 2GH8A 1OPOA 3LOBA 1POV0 1NCQB 2XBO2 3M8LA 1ZBE3 1NA1B 5A32B 5AC92 5BNPB 2RMU2 1RUF2 3VDDA 1TME1 1RUG2 4RHV3 4CDWB 5LK7B 4IV1B 3VDDC 1H8TC 1FOD1 4GMP1 4CDXA 1PVC1 5CFCC 3VBHB 4QPIC 1HRI3 4RS5A 1ASJ2 2HWF1 3ZFFA 2GSYA 4FSJA 1AR91 1BEV1 1VBB3 3DPRB 4Q4Y2 1FMD1 4RS5C 4YVSA 3VBUC 1RB8G 1VRH3 3ZFFC 2Y26A 1VBC2 1RUH2 2BFUS 4N53B 4PDWC 1AL21 3ZFGB 4YVSC 1H8TB 5DDJ2 3VBOA 2ZTNA 5CFDA 2R061 5BNOC 2RS31 1NY72 3J8F3 5C9AC 2HWE1 1TMF2 2X5IA 4GB32 1VB2A 5CFDC 1V9U3 1COV3 4CEWC 4Q4V1 1AYM3 4RFT0 1EV13 1Z7S2 3VBUB 4IV3B 1HRV3 2X5IC 2XBO3 4CDXC 5AC93 2MEV2 1R082 2RMU3 1RUF3 3VBRC 1RUG3 5L7OA 4JGZA 1EAH1 5K0UB 2WZR1 3JD72 1SMVA 2RS52 1MEC2 4CDUA 4Z92B 2PLV3 1RUE3 4JGZC 1BBT1 1RHI1 5C9AB 4Q4W1 3TN92 2HWC1 2WFF1 4WM7A 1PIV2 1ASJ3 3VBSC 4CEWB 4CDUC 1PO12 1RVF1 1VB4A 4Q4Y3 1NCQA 5ABJB 4WM7C 1HX6A 1NA1A 4Y5Z0 4CDXB 5A32A 1AR71 5BNPA 1VBC3 2BFUL 4QPGA 1E57A 1RUH3 3VBRB 5C4WA 4CDWA 1NCQC 5C8CB 1TME2 1NA1C 5BNPC 4FTBA 2FZ2A 1VBD3 4CDWC 3VBHA 1C8M1 1RMU1 1PVC2 4IV1C 1POV1 1QJY1 1K5MB 2DF7A 1RUC3 2RM22 1TMF3 4GB33 2HWB1 2R042 3NAPB 2WS91 3DPRA 4JGYB 1X33A 2ZZQA 1RUD2 1BEV2 1BMV2 5GKAC 1NCRB 1ZBE1 5D8AB 4N53A 2MEV3 1R083 3DPRC 3ZFGA 2TBVA 1AL22 1QJU1 1RUJ2 1H8TA 1RUI2 4N53C 2HWD2 3JD73 4AEDC 4CEYC 3ZFGC 2RS53 4NWWA 1MEC3 5CFCA 4QPIA 2R062 2RS32 1HRI1 1MQTB 2HWE2 1PO13 1ZBA1 1AR63 4Q4V2 1VBB1 1R091 3VBUA 4IV3A 4CDQB 4WM8B 4PDWA 2XPJA 4RQPB 2RR12 1X36A 4YVWB 1AYN1 4IV3C 2FZ1A 1TME3 5K0UA 1EAH2 5BNOA 4AEDB 4CEYB 2WZR2 1FPN3 1AR81 5C9AA 3ZFEB 5K0UC 3J8F1 1NG0A 1PVC3 1BBT2 1PO21 1RHI2 4N43B 2WFF2 4CEWA 2RM23 1ND3B 1V9U1 2R072 2R043 3HAGA 1QJX1 1R1A2 1EV11 1RUD3 5ABJA 1BEV3 1RVF2
chains in the Genus database with same CATH superfamily
2VGDA 5GALA 3ZN4A 4CSWA 3VZNA 4KWKA 4I3GA 3KCXA 3VBRA 5AC91 5L73A 1PNGA 1RUF1 3JZVA 4G3YC 3DKQA 4HN0A 4AHYA 5CIRA 4DRVA 1PHMA 3T4VA 3C7EA 4LUMA 4CVUA 1OLQA 2K9ZA 3C3VA 3LPFA 5A7SA 1RUI3 2VMEA 3ECQA 3OBAA 1CAVA 4OI1A 3A4UA 5FP3A 4A44A 3TB0A 1HQNA 2DCKA 1QXRA 3LWCA 5DABA 4XABA 1CX1A 1RUE1 3KGLA 4I2OA 4KNCA 2ERFA 2EXJA 3BCWA 4BZ4A 3W59A 4MGTA 3TEZA 2BW8A 2ZHKA 3MW2A 4PLOA 1PK6C 2XONA 2P3KA 2GZWA 4JGYA 4DXTA 3CNAA 5FY8A 2BPA2 3T0DA 1YFXA 2YBSA 2WS92 2NMOA 4Q4Y1 1K5MC 5A80A 2WO2A 4C0HA 1H9WA 5HCHA 4QHZA 1JYIA 3C2UA 3LE0A 5D8AA 3NAPC 4DY3A 4BIOA 4NPLA 3CJIC 2DDUA 3J7LA 1RUH1 3ST7A 1ODMA 3M1HA 1H2MA 5GLVA 4UW5A 1NCRC 5I8SA 3P3NA 3I2HA 3OTFA 5KXDA 2Q4SA 3PIJA 5FKCA 3A22A 2VY0A 3KQ4B 4XFHA 2NP0A 3IAQA 5LY1A 1DZTA 2EAAA 1FXZA 1MQTA 4QXCA 2WQ8A 4QU2A 5LBCA 4LBOA 4OUSA 4P9WA 3WP5A 1PMIA 2VBDA 4QX5A 4Y1VA 2J1AA 2R073 4X6QB 3AMMA 3AYCA 1UMIA 3T09A 3T08A 5JOZA 1HKDA 1W90A 1SBFA 1W8HA 3T0AA 1R092 3I59A 2CNAA 3TEWA 5A6YA 4FBFA 4MSVA 1IHMA 4PI0A 5G04L 1Z7S3 4IEOA 1DQ6A 2JDAA 4YVWA 2QFEA 3PUQA 1JN2P 4NHXA 5E16A 5LRSA 1KRIA 3MIHA 5FY7A 1FMD2 4QGMA 4CDQC 2LTNA 3FBYA 1ZREA 3KS7A 4XF1A 4Y20B 1W8NA 4Q0UA 4XFIA 3JD71 1LHOA 3NNJA 4ISQA 5EZWA 1AXYA 1UZVA 1TZOA 4RHV1 3GM8A 4ZS3A 5HXVA 3WHTA 3INAA 3DYMA 2DBIA 2TEPA 1W06A 1UIKA 1NT0A 3WEZA 2YC4A 1A3KA 3WNPA 5F1RA 1PO22 5BNNB 1SCSA 1WUVA 2WIIB 3HT2A 1LB2A 1DQ4A 1PO11 2XUEA 5LEJA 5I0TA 5IAXA 2E7QA 4PIYA 3MEPA 4NJ4A 3VDAA 1GYKA 4B1LA 1ND3C 5CNAA 4TLFA 1MS5A 2Y8KA 4Y3OA 2DYCA 4MV2A 3U4XA 4GH4A 5A33B 5FO8B 1AX2A 4LTAA 3ZXJA 3RZGA 1NXMA 2JG8C 5BXXA 2VE1A 1SFPA 5T5JA 4XDOA 3NW4A 4DS0A 2Z69A 3BN6A 3KCYA 1O4YA 5FZBA 1UYPA 3NV1A 4QPYA 1XBFA 5FMDA 1VRBA 4XHXA 5FZFA 2X29A 1HXS2 1WA6X 1Q5OA 4FP2A 1Z0HA 2BEOA 1UOFA 4W6WA 1QY4A 4MZUA 1LEMA 2PLV2 5DN2A 2AENA 2B42B 2WSVA 3USSA 5HPOA 3AMHA 5E89A 2C9AA 1YQCA 1YUDA 3PVEA 4AQSA 3ABZA 5DAQA 1GZWA 1W28A 3V0BB 2QUOA 1KFUL 1B35B 3RMXA 5L9VA 1RUD1 1E5IA 4EROA 1GMMA 4FPJA 2PXJA 1ND2C 2WAAA 5A7OA 1UQXA 3ORJA 4ISRA 3WNMA 4H2AA 1V70A 5A3LA 5JWPA 1AR93 4NPRA 5LY2A 4LLOA 4YNIA 3ZXFA 2XBO1 1VBA2 1S1AA 3DCQA 4Y24A 1CIWA 5CVRA 2IXLA 4L9BA 1RUJ1 1N1TA 3HPNA 5FYMA 3NWKA 2IFRA 4XBLA 2VW1A 5E6HA 1WMEA 1WW6A 2HWD1 3D8CA 4HK9A 4NN0A 3VDDB 1VAKA 3V0AB 3FBMA 4IEQA 4HKOA 3HN3A 3BGAA 4Q0SA 3BOPA 3S57A 1OD5A 2YFZA 5FZCA 2ORXA 2RDQA 1M06G 2K46A 3FL7A 2VG9A 3I3MA 2WZEA 4QB2A 1POQA 2G9FA 3I3BA 5F5CA 3U0ZA 1UXZA 5ERLA 3UL2A 2QDNA 4S2FA 4YM0A 4QX7A 4FTSA 1SZBA 2BJSA 3SLIA 2QDRA 3KVBA 3BTYA 4OFGA 1CZVA 4FPHA 2XVLA 2RR11 4AAXA 1RL3A 1DG6A 1W6PA 2BUKA 3POFA 3POWA 2OXBA 2C9KA 4XUOA 4YVSB 4YW5A 5JZGC 1C4RA 2GC3A 1XE8A 5FXZA 1LESA 2VAUA 3NV3A 3S7EA 1SBDA 5BNOB 5FPXA 1RIRA 3KF3A 3UKVA 4AAPA 1ZYBA 3LDRA 1X9TA 4XHBA 1US2A 5FK8A 2D6LX 4IETA 4LLFA 1MS4A 3MZHA 5CFDB 2VQ0A 4LKFA 2UYAA 2W9XA 1VR3A 3LAGA 3JU9A 1CAUA 4NHLA 4Q4W3 1AR62 4CCJA 3WW4A 1H0BA 2FMDA 3D3AA 4XE9A 5DZFA 2EF6A 2VZQA 5HV0A 3FHAA 1DGWA 3TRSB 3U10A 4V1PA 1JHJA 1J83A 2XVKA 1VBB2 1XNBA 4WM8A 4YGCA 2Y60A 3VKFC 4XJUA 2OPKA 4RQPA 4TXWA 1LOEA 5KBFA 5A3OA 5FFOC 4FI9A 3VBFA 3WQ7A 3O1UA 2RS11 5CKNA 4NIIA 3PTRB 3SKVA 5DAVA 1OOPA 5FMOL 4X8PA 3ZMOA 3FLPA 1FPN2 3RNSA 5FOBB 4E9KA 4JGZB 2WLPA 3MFAA 5FZGA 3NNMA 3O0VA 4COVA 4P14A 2Q0AA 1O8SA 1ZNPA 2YDEA 3Q8AA 5A3TA 2P3YA 4N43A 3TN91 4BPZA 1C8M3 4PQQA 1RMU3 3X29B 5HCAA 1QJY3 3AP4A 4AR2A 5C3QA 4WM7B 1QH7A 4FPCA 1COV2 1NUKA 5ACA1 5FOJB 1AYM2 1D0HA 2ZAAA 3BB6A 2FHRA 1POV0 1ZBE3 3H1YA 1R1ZA 1WKYA 4CP1A 5A1FA 5A32B 5AC92 5BNPB 3AL5A 1RUF2 2D44A 1T2XA 5CU1A 1TME1 2VQAA 3VV1A 3WY6A 3VZMA 4XAEA 3H1WA 4RHV3 4XJ8A 1ULOA 2VNOA 3LA2A 4CDWB 2GC1A 3EMRA 1Q8QA 1YJLA 4KWLA 4IV1B 3K2OA 1CAXB 4CCKA 2WRAA 3NV4A 1Q8VA 5F39A 1FOD1 2VZUA 1VLNA 3N9NA 4XZPA 2EA7A 4TTGA 4QDQA 1PVC1 3CF6E 4FPGA 4LXLA 2EXIA 4QPIC 1GOHA 3THCA 3C7GA 3UV9A 4RS5A 5FY9A 1SCRA 2UYBA 1T6BX 3LDKA 3OPTA 4I0BA 2HKXA 4R8HA 2VZ1A 4S2DA 5LBEA 3ZYGA 1D2QA 1ENQA 5B4NA 4HVRA 1QF3A 2V5YA 1BEV1 2CGOA 1NXD1 3DPRB 4Q4Y2 5BNQA 4XFGA 1JS9A 1UY0A 2NPIA 3ZFFC 2VXJA 1UNBA 1W6NA 1RUH2 2XWBB 4GZ9A 1UY3A 3I54A 2VVDA 4P5YA 3WX5A 3ZFGB 1NLRA 2QZ3A 4X6RB 2XG3A 2H0BA 1KS4A 2FDGA 1HDKA 1C3HA 3RJ2X 3VBOA 3AYEA 3POIA 3QH6A 1SLBA 1K5JA 3G7DA 5A7NA 3MYXA 3J8F3 3MIEA 4GWIA 5IFTA 3N7LA 1WCKA 4EN6B 3D5OA 1UMZA 2HWE1 1LU1A 1PX3A 1YNAA 3D6EA 3C7HA 1VPHA 4MLOA 1MS9A 4JTOA 5FY1A 3H42B 4AGRA 4AVBA 5L36A 3ACFA 5JLVA 2ZGRA 4RFT0 4CTEA 1H6XA 1RGSA 5T5LA 2OKXA 4RD7A 1APNA 3KCCA 2X5IC 1ZM1A 2XBO3 4R9AA 1NLSA 2ZEZA 2DVGA 2QBXA 5FREA 1ZRCA 2MEV2 4AHWA 3EO6A 5EP9A 1XJAA 1F5JA 3VBRC 4XJZA 1DQ2A 4LOTA 2JDMA 4MG2A 4AHXA 3KT4A 5K0UB 4A7ZA 3JD72 3T2TA 1H2KA 3OF1A 3MDPA 1MEC2 1S55A 4CDUA 3NNFA 1W0NA 2ZOEB 1K45A 4NHYA 4LBNA 1BBT1 3GHMA 5FQ0B 5C9AB 1GU3A 2HWC1 2WFF1 4LITA 4XUTA 4AEJA 3JQXA 2EICA 5A3NA 3I2JA 2BVBA 1WWYA 3OGGA 4CEWB 2OUHA 1CAWA 2VZRA 4SLIA 1PO12 1CN1A 4GIQA 5E88A 3WZ1A 4LIUA 1J59A 2UWBA 3ENRA 4Y1YA 4DO0A 2ZGUA 1ZZ7A 3GBGA 3WNLA 5FY4A 3OSDA 4Y5Z0 4ONUA 5C5UA 2I74A 3IPVA 3GYDA 4TSVA 5FZAA 3RI8A 3KHCA 4XQDA 2KA3A 1GZ9A 2B45X 1LNSA 3RSJA 2WNEA 5C4WA 4CE8A 2R7EB 3OYWA 1LHNA 1OQ1A 4MADA 5GZGA 5I8YA 1JZ3A 3H8UA 3MIDA 3MUY1 2AGSA 4AVSA 2XLAA 3ZXDA 3VKLA 4FFHA 1WLWA 1YC61 5F3IA 2JDUA 3KLSA 5IVJA 1G9CA 1Q8SA 1PK6B 1VALA 1WMXA 2PAKA 3I3QA 3MF9A 4HPKA 3VBHA 2FDFA 5DUXA 4FVVA 1POV1 1S0GA 1YIFA 4HVQA 1K5MB 1JZ7A 3E5UA 3OEAA 4GQ7A 3DXTA 3NAPB 2WS91 2WNUA 5FLIA 2UY9A 1KJLA 3AXDA 5IUQA 5KHJA 1RUD2 3KMHA 1C5HA 2FDJA 1NCRB 2UY8A 3T4HB 3ES4A 3ZXEA 1REFA 2PAEA 4CU6A 3AZYA 4NOTA 3UNPA 2TBVA 1AL22 4O9GA 3HNBM 2QQVA 2QQWA 4EV0A 1RUJ2 3HMYA 1OLME 2R30A 4N53C 1DQ5A 1TEIA 2EXKA 2HWD2 2VQTA 2Y34A 3PDQA 4XFAA 3DECA 1W8ZA 5FYBA 4NWWA 5J1XA 1ODNA 3OEBA 2QE3A 4MVTA 2YPDA 4YPJA 2RS32 2NYYA 2VNGA 2BVVA 1LGNA 2I2SA 3D4KA 4OULA 4CRQA 5D1IA 3UETA 1L7LA 4AOCA 1R091 2JKBA 3VHOA 4RGAA 4CDQB 4COZA 3NO8A 3EYPA 4FOQA 5JPNB 1O3QA 4PDWA 4FQ4A 2OQ6A 3CZJA 5BYNA 2RR12 4MGSA 1ZA4A 3WUCA 5C6CA 5EXOA 4IV3C 3OD0A 4TYSA 4HLTA 1TME3 2VTFA 5DPNA 3IKWA 3Q9OA 3I8TA 4CU7A 2BOIA 4ATFA 2WZR2 1QHDA 3NVCA 4I01A 1JOPA 2WT1A 5CFDA 2WLQA 2D6PA 4NIGA 1PVC3 1XQNA 1PO21 4KBBA 3ZIWA 4CUBA 1H6YA 2YC0A 1ND3B 2OUJA 2Z79A 2ZGOA 3CZUA 4KGGA 4YW4A 2X09A 5J3UA 4J1WA 1EV11 5ABJA 4WV8A 2JE9A 1YFUA 1BEV3 3MPPG 1SPPA 2IFWA 3R0RA 5KR7A 3O1PA 3ZXAC 2V4AA 1REDA 4QHOA 4EN8B 2QQNA 1H30A 4WVWA 4PF1A 4R9CA 3B69A 2DU0A 2YGLA 3BOWA 2W1SA 4FOVA 1N47A 4Q29A 1UPIA 5A1LA 2B5HA 3AKTA 1HXS1 1U5XA 2RS12 3KVAA 1ENXA 5JOWA 1OFNA 3DN7A 1DCSA 3E5XA 3AKQA 4UF0A 5FYIA 2PLV1 2O8QA 2BNMA 3ILFA 5CB7A 2Q8EA 2YC2A 5GJ6A 3VBSA 2E31A 3ME2A 1I3HA 5L9RA 4NROA 1ND2B 3B3QE 4YFWA 1NLQA 2HWB2 3FJSA 3BALA 3VKNA 1JZ5A 2WNVA 3KZ4C 2JJ6A 5FPAA 4EZHA 1KGYA 1WCUA 4OHZA 4INDA 2VZVA 3TBDA 5ACA2 3MPBA 1OUXA 1VBC1 1Y43B 3KHBA 4XILA 5FZ1A 1VBA1 5D21A 4XBQA 4AHZA 4Y22A 4NAOA 1ZRRA 4C8DA 4D7SA 2ILMA 2R1BA 5A70A 3T30A 2JECA 4QKDA 4BHPA 2FD8A 3M3EA 3PU8A 3KB5A 5JVVA 3KV6A 2D98A 2DCYA 3HBZA 1A8DA 2PHTA 1CPNA 4DMIA 1D7PM 4IGPA 4MGKE 1S0FA 2VVFA 4YLZA 3GDBA 1CQ9A 2JB8A 5DDJ3 3AYDA 2E7TA 5CG9A 1BBT3 2VXRA 1W6OB 1HRI2 1FOD2 3B94A 4Y5TA 4LO7A 1JYXA 5FZ8A 4HANA 4AZZA 1JYCA 2VTXA 1R1A3 1IQAA 4RA0A 3MUZ1 1DYOA 1ZBA2 4PI2A 5F2SA 3WP6A 3LB9A 4CU9A 2Y6JA 2WQ4A 4XQ4A 2QQPA 2GMMA 2YV8A 5JZGB 4D7YA 4YM3A 1HV0A 1O5LA 5LBBA 4CCLA 1PM4A 4IE0A 1MVEA 2P5BA 4RR3B 5E8AA 4QGNA 4M0NA 4BLJA 4CPBD 4JCKA 4WM8C 4BH9A 1W6MA 1WBLA 4RQPC 2LALA 4AEDA 5FZ4A 5FK7A 4ZZ8A 2FDKA 3VBFC 1RINA 4IEYA 3B5LB 4P00B 4XJ9A 5FPLA 1LODA 4N90A 3IM0A 4LO8A 5JXIA 1F15A 4MHRA 3FLTA 4UWDA 4QM9A 3N9QA 4IEWA 5FPZA 4TN7A 3H3UA 2GAUA 1AR61 2D6MA 2XJRA 4N43C 2WS93 2A71A 5FXXA 1PIV3 3IDEA 5CISA 2A3XA 2DCJA 3RPQA 2W5FA 3USUB 5EFUA 4IEUA 4PIZA 3R4SA 4MUVA 5FYHA 4CP0A 1HRV2 5BV6A 4PCRA 2ZXQA 3PVBB 3RYPA 1ALYA 5CKMA 5JI7A 2D97A 3JBG2 3BPZA 3DL3A 2ZX3A 4IEPA 4OHVA 1OI6A 1ZRDA 3L2YA 1IZ3A 4DXRA 1LGBA 2VUCA 3FFQA 3P3PA 3THDA 1FPN1 4B4PA 4BK5A 1LHUA 2WQZC 2E32A 4M0HA 1QOTA 2QNKA 3H9AA 4AEKA 1CJPA 4CUCA 4K8FA 2XJPA 4EJRA 1OFSA 2QTWB 2Z4FA 1UU4A 2OX0A 4GMP3 4UFJA 2JIGA 5EYYA 5TSWA 2W52A 2R041 4LHKA 3PJYA 3WNOA 1V6IA 2XH6A 2B9UA 5FPBA 2HWC2 4PQ9A 3HD8B 2C5DA 2VL4A 4FPOB 4YZ4A 4K20A 4A4AA 1R093 1COV1 3ILNA 1NZIA 1YQ5A 2VMHA 2XKPA 2K0GA 3IZOA 1AYM1 4MGIE 5FPUA 1X7NA 1U5ZA 3EJKA 1GBGA 5JXHA 1JYWA 1W8OA 3UGGA 1GNHA 1LECA 2J1UA 3AP9A 1FMD3 5FPVA 2ZMLA 3CEWA 3POSA 3U07A 1H2NA 5C8CA 4FP3A 3VB9A 2GP3A 1OKQA 1GWMA 1OMIA 3QBQA 5FMOS 2AC1A 4YM2A 2XHKA 1D4M2 1VBD2 3K4ZA 4XZUG 2W3JA 3SCGA 1CGPA 1LU2A 3SXWA 1PGL2 1UWWA 4K3UA 1LKNA 4QPIB 3AXEA 1PO23 2VOXA 1RUC2 2VC9A 3VBOC 1Y9QA 2LUWA 1AX0A 1U5YA 2HEWF 1YQ2A 2XQXA 5FMCA 3ZVXA 1W2TA 4RGGA 1CJDA 3G6JB 2IUWA 2VMGA 4KQ7A 3TEXA 4B4QA 4ZONA 3SKJE 4NRQA 2QQLA 5JR2A 2WN3A 4LO6B 1NAEA 2JD4A 2XXZA 3TAYA 4Q4V3 3ZFFB 2X05A 5JPMB 3IMMA 1V6KA 3N7JA 2E53A 2GN3A 1NOVA 3WDTA 1XE0A 1I5ZA 5FLHA 4F7ZA 1XNTA 5FTTC 4ZZ5A 2HH9A 3NV2A 3GXUA 2J1SA 2OS2A 4Y20A 1GLHA 4CYDA 2J1TA 3T2OA 3ZN6B 1HXS3 1W99A 4ET7A 4XFFA 2EXHA 3WDWA 4V2WA 4BM8A 2J42A 2JEMA 4CCNA 2VPVA 1Y9MA 5A6QA 4YW2A 5BNNA 3U75A 5JSRA 3O1MA 2ZGPA 4XXAA 4UI9L 3VLBB 4EWAA 1GV9A 3BYWA 4MHUA 4UBHA 1IG3A 1IS6A 2R32A 5F2WA 1AXKA 2XJSA 4HSJA 1SLCA 2Y0OA 4GJZA 1X8EA 2R16A 4AE2A 4CXXA 4LHLA 4Q4X1 5JAXA 2X5IB 3TNQA 4XCAA 3LIGA 5A33A 3M3IA 2GNTA 3LEMA 5LK5A 1V6MA 2G9ZA 1VBA3 3F2ZA 3N9MA 1KQRA 5LCWL 1VRH2 3HQRA 3IDBB 1O3SA 2MEV1 3H7YA 1TQ5A 3MHZA 1H1MA 5T50A 3UESA 4LA3A 3T0BA 1VBE1 4B8EA 4DZGA 4EQVA 3IDCB 4NUBA 2CDPA 3VD9A 1Q8PA 2VZOA 2OT7A 3SISA 5C4WC 1CAVB 5KXCA 3APBA 4A2UA 1H1AA 1QJFA 2WZ8A 5L7OB 2B39A 1O3RA 1GUIA 1MEC1 1AUYA 1OLRA 2D5FA 3ZFEA 2ZABA 4L92A 5AFBA 2V72A 5B2GB 4BK4A 3V0BA 1B35A 1YWKA 4AI3A 4GXLA 2H0VA 3KV4A 3POYA 4XDQA 1YFYA 3VBHC 3WW1A 4M4RA 3ZIXA 1F2NA 1GNZA 4W65A 4OMCA 1EP0A 5DQ0A 4YG3A 1URXA 2GDFA 2QQOA 2R49A 4XFBA 3NJVA 3SH3A 4H7MA 1A78A 1EV12 1UZZA 3MIBA 4E4ZA 4RSUA 5B4XA 3VHNA 1QQP1 2WNUC 1JH5A 1HQLA 4FPLA 2VH9A 1FYUA 5H9SA 1OLMA 3V0AA 1U0AA 2OPWA 3FWEA 3VDDA 2A6XA 2PHUA 5T54A 4GWJA 4A45A 1OVSA 1RUG2 1IS5A 4IERA 2JG9A 4W8JA 3WG3A 1O59A 3AX4A 2OVUA 2Y33A 3MI8A 1GKBA 5A7WB 1K12A 2CY6A 5A6ZA 1UO9A 4Q1PA 2FCTA 4N9IA 3BVCA 5C33A 5IVVA 2D3RA 3CBNA 3NRUA 4XYXA 2HEYF 3UJQA 1NQJA 4XUQA 2NM1A 4DQAA 3ZSKA 4CP9B 2D93A 3OGSA 1YO8A 4LKDA 1W9YA 4R9DA 3VDCA 2A6YA 2Y6GA 3O14A 2HWF1 4Z82A 3RYRA 3ZOIA 4Z8BA 3AZXA 3LEIA 3MO4A 2WWUA 4O61A 1RITA 3I59B 3N9LA 5IATA 3J7HA 2B4KA 1VBB3 2GN7A 4JV4A 1TE1B 4YVSA 5DAWA 1NZCA 2XOMA 4UFMA 3NNLA 2W2IA 3B7MA 3ZYIB 3O1SA 3NJYA 3WUDA 2VMFA 1VBC2 2ZEYA 3N35A 4N53B 4PDWC 3B01A 1OH3A 1UW8A 3AZWA 1AL21 1ULFA 4EE2A 4QQLA 2V09A 4BQYA 3KF5A 3AP7A 3PUIA 4P5HA 2E7AA 1H8TB 4L0PA 5EJ3A 1BK1A 1ULCA 4XF4A 5FYYA 1G6NA 2DVFA 1QEXA 2A75A 2QZ2A 3AK0A 2A6WA 4MX3A 5LBFA 2RS31 4PT6A 1N3QA 1NY72 1W6QA 1C28A 1XPWA 2LS6A 4Y33A 3ZYFA 1QGLA 1UX6A 2P37A 5F7UA 3E6CC 1UYYA 1HB3A 3DKWA 2GMEA 4AL9A 3ROUA 1WCQA 1V9U3 1W9FA 3H50A 4MGQA 1COV3 5FO9B 3WINE 4UFHA 1AYM3 2RDRA 3HNYM 3I2FA 4LULA 2Q8DA 1Z7S2 2YU1A 3WDVA 1WD3A 4DY5A 3VBUB 4IV3B 1ZVFA 2JWPA 3GBFA 1DGRN 2ZMKA 4FFFA 1UY1A 3RWKX 4L11A 5AC93 4XUPA 5FCCA 1RUF3 1KEXA 3IMNA 4BMBA 2DCTA 3RZJA 2QQMA 1Q56A 4RL7A 3H3LA 4CCEA 1JTZX 3I2KA 4JGZA 1CZTA 1VE0A 4LK6A 3JQWA 1J1LA 1ST8A 2WZR1 3AKRA 3PHMA 4Y1XA 3R4DB 2P3IA 4QB6A 1NE6A 2RS52 3MIFA 4Z92B 1W2AX 2J1VA 1RUE3 4HG6B 4Y26A 2D6KA 1SLLA 2XJQA 1O3TA 3V64A 1FV2A 2D43A 3K3OA 4LO4B 4WM7A 5LB6A 3N4MA 1GZWB 1MR5A 4GKXA 5FYZA 5IW0A 4AW7A 3VBSC 4D6QA 4QQOA 5FAXA 2PHFA 2W87A 3PNAA 5KWRA 3LEKA 3HQUA 4JDOA 4BISA 4BU2A 4QX8A 1H1IA 2HLEA 3FX3A 1K3IA 4Q4Y3 1VB4A 3B00A 1DZRA 4AYUA 1XU1A 2WNVC 4XUNA 4CDXB 1AR71 5A32A 5BNPA 4HVOA 2DV9A 4BQ2A 2BFUL 4IE7A 4QPGA 1RUH3 3M3QA 1OQEA 3GZUC 4CDWA 1NCQC 4J25A 4YG6A 1NA1C 1JMUB 4P9YA 1W0OA 4CCMA 1IKPA 4KG0A 1LOBA 4CXYA 3LGRA 5GLWA 5C5TA 4KI5M 5A3UA 1CPMA 4E8DA 1DF0A 1UXXX 3WDXA 1HJGA 5F5QA 3WDYA 1PVXA 4ZU5A 4ZS2A 1MPXA 1HIXA 2YU2A 2NQYA 5C3RA 4KL1A 4CUAA 1YJKA 1W3VA 3LFIA 1UPSA 2KM2A 4XTMA 2HWB1 1IPSA 1S2EA 2R042 5FMBA 3CHXA 3DPRA 1QH6A 3PMEA 3SHRA 1QDOA 4YSFA 4BXSV 1E5RA 4AFBA 1W9WA 3OGVA 4KBZA 4QKBA 5JIUA 4TWTA 4UYBA 1JZ4A 2MEV3 1XC6A 3ZFGA 2GALA 3THTA 5IYYA 2HYKA 2DVAA 4QXBA 4URTA 1E5SA 1JW6A 2J1EA 3KV9A 1V6LA 2BNNA 1HV1A 4UW3A 3CMGA 4UOJA 1YI7A 4XXPA 5GLZA 1AZDA 3JD73 4M3CB 1LULA 4ES8A 2QCSB 5A3MA 4AEDC 5CFCA 1MEC3 3H8OA 4BQ3A 2R062 3ZX7A 1DLLA 5IVYA 5LA0A 2WFPA 1WA4A 1AVBA 1DZQA 1N1VA 4XMAA 4AVCA 1HRI1 5APAA 4E2QA 1J58A 4PF5A 4E4HA 4AGVA 4S2HA 1CAUB 3ZYJB 4EN9B 2JXAA 1CX4A 2YPJA 3A0KA 3LCPA 1PO13 1SDDB 1ZBA1 4PLNA 4KH9A 5FZEA 4AFCA 1G9BA 5IK4A 2AZ5A 1UZWA 2CDOA 1W03A 5FZOB 4WM8B 4EWEA 2XPJA 2QQUA 4RQPB 3UGHA 5FR3A 4FAGA 1PGSA 2Q1ZB 2G9GA 4TZDA 3FHIB 2FZ1A 2GMPA 5K0UA 2BOJA 3N7KA 1VAVA 4XF9A 2Z5WA 3QCWA 2FCVA 1EAH2 3VL8A 2PTMA 3K75B 3AB0A 3BTAA 4XBNA 3RG0A 3ZR5A 4AK3A 4CEYB 2ZS6B 5J09A 5KXEA 4Y4RA 4LHSA 4DINB 5C9AA 5FQ0A 4P9IA 2BGOA 2CYFA 1NG0A 1XE7A 3NSTA 1RHI2 1UF2C 4N43B 3HWJA 3MF6A 4CEWA 3SCHA 3OPWA 1WZXA 3D0SA 4OQ8A 3M3OA 3LQCA 5DAPA 4DEVA 1RUD3 3BPSA 3T1MA 5J7MA 1OF4A 1QOOA 3WG4A 4AG4A 2ZGQA 1RVF2 5K7PA 5KC5A 4I3PA 1HRV1 4Q4X2 4AGGA 5HI0A 3OOXA 3JBG1 2CAUA 2RMU1 4XJAA 3H7JA 3C7OA 3VZOA 3ATGA 3OY8B 4QKNA 5LA2A 3SEEA 3I2DA 1OURA 4YW3A 1G8WA 3LD8A 4R9BA 1RUJ3 4HETA 2C1FA 3RQ0A 1JOBA 1UZ0A 4R52A 1VBE2 3ETQA 2HWD3 3LF7A 4G4FA 5C8CC 5CEHA 3WLUA 1BYHA 1RYYA 2ZACA 4DUXA 5DG2A 3M2MA 2WKKA 4BCUA 3RVHA 4XDPA 3ZN5A 1C8M2 1K5MA 5EV7A 1LAJA 1RMU2 2DTYA 1G7YA 4DRRA 2VECA 1HB2A 1DYKA 4ZPIA 5FJHA 1SG3A 5T52A 4GULA 4LT5A 3DYPA 4JDMA 4META 1CR7A 1NCRA 4WZFA 3C8XA 2ZZJA 1YYNA 4YGBA 4JC1A 5EWSA 4WVMA 4IGQA 2EVXA 4MXVA 2CSGA 1ZBE2 2RG4A 4JGYC 4NWVA 5FJKA 2BBVA 2V73A 4XJWA 2RR13 4HT1T 2D6NA 4XAAA 4A7KA 1QXJA 1JUHA 1QQP2 4AI2A 4XIKA 4CZSA 2WYFA 1ZRFA 4Q8KA 5HBAA 5D8AC 3VDBA 4QQHA 1QJU2 3EHKA 2QQKA 4ASKA 5C7GA 4LE3A 4UFKA 2WZR3 1OHFA 1C1FA 1D4M1 1VBD1 3GJAA 3J4UH 1PGL1 4QX2A 3K3NA 4H3WA 3MICA 2IXIA 4Q0VA 2LW8A 2TUNA 2WDBA 1RUC1 1XNDA 1TMF1 2KR2A 4OVEA 3ZLIA 5IVCA 1Y9GA 5BNNC 5LEKA 3WCRA 3ZYBA 1DLCA 2WZPP 3N3HA 5FZ9A 2PHDA 1FNYA 4CDQA 5DMYA 1MQTC 4LUKA 2VOWA 4OI2A 4Y1ZA 1QOSA 2HWF2 5A3WA 4HL0A 3U14A 3VGIA 3ZDSA 3CJIB 1AL0G 3JUUA 3WF1A 1R081 1RJ7A 4P08A 1K42A 3PTYA 3I7DA 3UJOA 3L9JT 1W3XA 1AYN2 1J3QA 4YW7A 3FUOA 2CGNA 3POBA 1QNWA 2AR6A 4ZY9A 4ATEA 4FT8A 1RUNA 4O9EA 1V00A 1AJKA 2RS13 4YVWC 1BLZA 2A7AA 4QWNA 3HOBA 5K4LA 1YEWA 2JDHA 4FOYA 1AHSA 3M7AA 4WZCA 3VD3A 2TNFA 1AR82 3FN9A 3RDIA 3J8F2 2YGMA 2BTVC 3IN9A 3W58A 1R64A 1S2BA 1N3OA 4WVZA 2ZGLA 2XLFA 3ZFEC 5CAZA 5DZEA 4Z2AA 3TN93 3OCPA 4KMQA 1OPMA 3BIWE 1QJX2 2G19A 5JI9A 4XCBA 3KQRA 3I2IA 3ZSMA 2XUMA 5IK8A 4AI8A 5SV8A 2CAVA 5ACA3 5F37A 2Y6HA 3D0JA 4NPMA 1VRH1 2ZAHA 2JICA 5CA6A 1WCSA 2E63A 3GALA 5C4WB 4A42A 3KV5A 4HN1A 3GCWA 3W20A 5T55A 4GH4C 4L97A 2GNDA 4K6BA 4QMAA 5LA9A 2D40A 1H9PA 2BP6A 3RFRA 2JG9C 3PUHA 1ND2A 1I1EA 4AVAA 2RDNA 1FOD3 2RM21 3NL1A 4MH0E 3ZSEA 2XGXA 1WD4A 5FBJA 5IHRA 5JMCA 4NHKA 3AP6A 1UKGA 2WJSA 3EQEA 3S5QA 1WCDJ 4HFSA 1ZBA3 2DUPA 2YUEA 1S0JA 3MGUA 1O4ZA 1BVVA 2YYOA 3B93A 2ZX0A 4LK7A 3GZAA 2HEVF 4JKMA 3UK9A 5J37A 2JG8B 4H55A 3CDZB 2BV4A 2W95A 2Z2SB 2JENA 3AMQA 3OG2A 4GWMA 3WF3A 3WT3A 4QM8A 3WW3A 5C3PA 5FWJA 1VAMA 3CLPA 3FMGA 1AR72 2RV9A 1XYNA 1ENRA 1RUI1 4LMFA 1RUG1 2YXSA 2F4PA 1F31A 3VD7A 2WNOA 1FNZA 2C6SA 3O0WA 4QB1A 1W6OA 2IXCA 5F8PA 2DU1A 1LOFA 3E6BA 5A7QA 1UX7A 1KDMA 1SLAA 3U1XA 1RTVA 2YBKA 5FZHA 4YZ1A 2VMIA 3BTZA 3GCXA 2W1UA 2D3PA 1V6JA 1BKZA 2VCCA 4IGOA 1YLLA 4LKSA 4RFRB 2HWE3 1LHVA 4QU1A 5HCBA 5JZGA 4XQWA 5K8SA 1ENSA 1ZZBA 1O8PA 3CQOA 4RR3A 2Y6LA 4FQZA 4K8RB 3JBG3 3PUAA 2VD7A 3AC0A 3O5SA 4PDWB 4ASMB 1JXNA 3BU0A 2Q1MA 3M4FA 1BQPA 3VZJA 4O65A 1QJEA 2P1BA 3S6PA 2PQQA 3MIGA 3SCFA 1C57A 3N9OA 2R6QA 5F3EA 2FMYA 3VKOA 2JKXA 4JDNA 1UU5A 1YCIA 2CWMA 1WMFA 4Y5SA 3ZXLA 1S0CA 1DGWX 1ULEA 4M3CE 3WV6A 5AVAA 1QJZA 4E27A 4ZXEA 3MW3A 1NY71 2R071 3AP5A 3EB7A 3NJZA 3LKJA 2HWC3 2WFF3 4K1YA 4LBKA 3USUA 4BA6A 2IZWA 4OHXA 3P5BA 5BPXA 3L2HA 4BIFA 3WNXA 1GP4A 4IESA 1HW5A 4LPLA 1Z7S1 1SPPB 2ZBJA 3PLQA 2K2SA 3FC0A 2BGPA 5AVPA 1JU3A 3S7IA 3ZDVA 4FPKA 3RZHA 2WR9A 1ULPA 1UY2A 2C26A 3E6DA 3JB4C 3OPZA 4LQRA 2VUAA 1GNYA 1LJ7A 1YIPA 2EALA 3PL0A 4QPGC 1UD1A 5A3PA 3ZXGA 1D4M3 1S0EA 2VVEA 4LBQD 4ORFA 4M4PA 5DAXA 3N36A 5EPAA 5IK5A 2P6HA 2RS51 2JIJA 1IPJA 2RE9A 4IDZA 3WCSA 3ZYHA 3WNNA 4DEQA 3VBSB 2Q8OA 1OOPC 4P9XA 1PGW1 3TEYA 1POV3 3IDAA 3NKTA 4Q5OA 2IXKA 5C71A 1KJRA 5ANQA 2WNVB 4P9LA 1BVP1 3PVOA 3TWIA 3SC7X 1W39A 3K46A 4COWA 4CCCA 1A34A 1YQ6A 1FI2A 1UOJA 3UKTA 3GNEA 1EUUA 1LOGA 5I0SA 1NCQB 3M8LA 3POEA 2W1QA 4AVVA 1NA1B 3BUCA 2QVSB 3BIEA 1RJ8A 2RMU2 4X8NA 1OT5A 2XWJB 4ITCA 3O1OA 2EIGA 2OQ7A 5FKBA 3J9SA 5FYSA 3K48A 3TOJA 1JYVA 2VOVA 4JTNA 5LK7B 2B46X 3Q8BA 4JRAA 1QDCA 2DCZA 3O7OA 5FLJA 4QD2A 4ARYA 1ZA7A 4WVVA 3WXPA 4D3WA 3N7MA 1JUIA 1W05A 3S30A 1YXWA 5CFCC 2I45A 2OA2A 4AQ6A 2AREA 2H6BA 1XXNA 4UT5A 5I91A 2UWCA 3T2QA 2PFWA 3S5AA 1ASJ2 3ZFFA 1BJQA 2GSYA 4GWNA 4FSJA 2NN8A 1PZ7A 1ZZ9A 1AR91 3UGFA 1YFWA 2ZHNA 4FFIA 4HZFA 5DUUA 5C3SA 2VR4A 1W9TA 4W50A 4P9JA 1Y7BA 1NYWA 4RS5C 2J1RA 2OZ6A 5H9QA 4RGKA 1RB8G 1VRH3 1X8MA 2VCBA 1QU0A 5F6KA 3QH7A 2BFUS 3ZN6A 3BTXA 4GAZA 3OD4A 1CWPA 1XYPA 4IW3A 2W46A 1SLIA 5CZKA 4EYUA 3GZTB 2IVIB 2PAMA 2VNVA 1VIWB 5FYVA 5DDJ2 3RGBA 3DXUA 1RXGA 2R061 3DGTA 3QACA 5FZDA 4DFSA 2FQPA 2ATFA 2JB4A 4IQPA 5IAVA 3I2OA 5C9AC 3KT1A 5C3OA 1TMF2 2X5IA 4GB32 1GSLA 1SBEA 1VB2A 5CYYA 1F35A 4CCDA 4CEWC 5FZ0A 3CKHA 3RI9A 3Q8FA 4LEJA 4NIDA 4Q8LA 1EV13 3MLJA 1Z78A 2W08A 4JAAA 1DGLA 2VUJA 4YGDA 4F3JA 4YGEA 5F3CA 1H2LA 3LOIA 1JU4A 3HN1A 3F95A 3LA7A 5FP8A 5FZ3A 4K7JA 3K77A 1R082 1SLTA 1I5PA 4LKEA 4C0BA 1RUG3 2ARCA 1X50A 3B9CA 4M3CF 5L7OA 1EAH1 2PN5A 3ASIA 5KHHA 2MHFA 2VQUA 1D4VB 1JZ6A 4JVAA 2GNMA 1C1LA 4IUGA 3UKNA 4AWDA 4CU8A 3O1VA 2BWCA 2YY1A 2XL9A 3ZPYA 4B29A 2VW2A 2PLV3 1W04A 4LBQB 5IT6A 1UY4A 1RHI1 3ZKUA 1GWKA 3PU3A 4I30A 4Q4W1 2ZCWA 4QHBA 3TNPB 4MXWB 1DYPA 1W2OA 2RVAA 1XNCA 2IXHA 2UURA 1PIV2 1Y4WA 3U37A 4AFAA 3MLKA 4DXSA 2GP5A 3WR0A 4CDUC 3R6SA 3NMBA 3I97A 4QXKA 1OVPA 2C4XA 3IAPA 1KDKA 1RVF1 3RYKA 2DUQA 1G9AA 4NIAA 1ULDA 1HX6A 1N1YA 3QLQA 1QWRA 1F5FA 2ZEXA 3SQOA 4Y1UA 3WQ0A 2F17A 1VBC3 2VMCA 5FP4A 3VBRB 3TYJA 2ENRA 1S2KA 1OF3A 4M00A 2GU9A 5FXWA 5H9PA 3IWZA 5A7WA 1SHWB 5C8CB 1TVGA 3I4IA 4DXZA 4D6SA 1XNKA 3AZVA 5DZGA 3ZKYA 5JCTA 2BERA 2KXLA 3SNMA 3BODA 5FZIA 4I02A 1S0DA 4EN0A 5I0UA 2A3WA 4FTBA 2P17A 3A21A 3DUIA 4N9HA 3WF2A 4CP9A 4XURA 3ZR6A 4Q27A 4OMDA 1C8M1 3DV8A 4QT6A 1RMU1 4B7KA 2VOKA 4H14A 5HV4A 1QJY1 2ZX2A 2WYSA 4GA9A 3WF0A 2RM22 3AZZA 2ADDA 4IEVA 4IL7A 2VCMA 4D6RA 4KWJA 4D69A 1GR3A 1JI6A 2DVDA 4JGYB 4E4DX 5ISLA 2ZZQA 2E33A 4NAMA 2DURA 3I3DA 5G05L 2VZ3A 3W21A 1NQDA 5GKAC 1ZBE1 3VKMA 1MVQA 1TNRA 5D8AB 4B3NA 2WO1A 4N53A 1DGRA 5CKQA 5D2AA 2ZX4A 4U36A 2XHNA 4AFMA 5A1AA 1I6XA 2ZPXA 2ZKNA 1ZRIA 5FUIA 1JHNA 1LENA 2AUYA 2CTVA 3PMSA 1QJU1 1VMHA 1ACCA 1O91A 1QMJA 3D82A 1CIYA 1H8TA 1RUI2 2XQRA 2VW0A 4UAPA 3ELNA 2HBUA 2RS53 1V6OA 2H6CA 4FXGB 2R0HA 4W6YA 1O7FA 3C7FA 5JIAA 2QQIA 2ZKLA 5JSOA 1A8MA 4NIHA 1DHKB 1J3PA 1MQTB 2BU9A 5GZCA 1MZ5A 5FYUA 3WG1A 2Y38A 4K9SA 4HXCA 3WOGA 1US3A 4D7TA 5IVFA 5JUVA 1WBFA 3NQHA 4KU7A 1AR63 4XFCA 5LZ6A 4OYUA 4Q4V2 4UW4A 2QKDA 5F5AA 3VBUA 4IV3A 3LZZA 4QKFA 4M01A 4YWAA 3VD5A 4QDSA 3HT1A 1LTEA 2SBAA 3OGRA 1UN1A 2HBTA 4A3XA 1VP6A 4LIVA 4RN5A 4UXAA 4YVWB 3PVNA 5CG8A 1AYN1 1I9RA 2F4LA 2G4IA 2JDKA 3ACLA 1F4AA 2B7YA 2O8OA 3B9IA 2W68A 4G9SB 4IE5A 5F3GA 4DIQA 5BNOA 3ZYPA 3BKZA 2JE8A 3H1MA 1DFQA 1ONAA 2JDPA 3CO2A 2XJUA 1FPN3 2VULA 3HIFA 3I3EA 1AR81 1UZYA 4XETA 3T1LA 3ZFEB 2ETEA 4HKWA 1YRZA 3BI3A 3J8F1 3NJXA 5EJ1B 1IS4A 4OZOA 4JHZA 3RZZA 2GC0A 3DF0A 2CL2A 5JXJA 1FX5A 2DFBA 4XPVA 2LM3A 2R072 2R043 3HAGA 1QJX1 4DUVA 2V5DA 5GLUA 2EIBA 1G9FA 4YYOA 2WO7A 4O7XA 4YARA 1CESA 4D8MA 2VZSA 4CDXA 2VO5A 1F4HA 1WW7A 3U11A 1RUOA 2MPFA 1JYTA 4HSLA 4FFGA 4OLLA 4GH4B 1LOAA 4CUGA 1GQPA 1UL9A 4DOUA 5ABJC 1W9SA 1O5UA 3ACGA 4NHMA 3SEPA 4Q26A 1G86A 2JG9B 3WDUA 1A6CA 5I0RA 2JDNA 4CA9A 4QQPA 1UMHA 2RDSA 2AH2A 1QXPA 1FATA 2R063 1J84A 1W2NA 4NRMA 1FAYA 5BY5A 3P6BA 1MS1A 4XW3A 1OH4A 4NO4A 1F9KA 4XF0A 1LOFC 1UU6A 2WA4A 1IGOA 1S0IA 2LRPA 4UFLA 1OXCA 3O0XA 5E1RA 2VBBA 4JX0A 1PGW2 3OGJA 2JD9A 4UBGA 2WA3A 3FZ3A 3CIHA 4QX3A 4L2NA 4MGZE 4E2SA 4ES9A 2LROA 1T6GC 1DP0A 3CJXA 2I07B 2NLRA 2BWAA 2X10A 4RR3C 2BGCA 3AFKA 1PNFA 3I49A 4XEZA 3WQBA 2QQJA 5HXMA 2CU5A 1EAH3 2CHHA 4J1XA 4M3CA 4B1MA 4JRLA 3W9AA 2PHXA 2FDHA 1RC6A 1PZ9A 1GQGA 2ZGSA 1O4TA 4IV1A 1CAXA 3ZXKA 2ZA9A 4R4XA 1GP5A 2ZGMA 3A23A 3WHUA 2SLIA 5C8WA 1MS8A 1RHI3 3IIAA 2VZPA 3POGA 1W6QB 4QXHA 5CADA 4BOWA 3H8XA 5CBLA 1W8UA 1WMDA 4OI0A 3PURA 3GF6A 2YB7A 3POJA 4XOGA 1CD3G 5FZOA 3RS6A 3PUSA 2XJVA 4BYYA 1RVF3 4TLGA 4Q4X3 2Q5TA 1AR92 1M4WA 3WF4A 4KU8A 1D2SA 2NMNA 4OI4A 5I8TA 5JDBA 4XF3A 1BK0A 3RZKA 1W6PB 4Z07A 1U12A 5JR7B 5GZFA 4CEYA 5IWFA 2L9LA 5J98B 1VBE3 5FZ7A 3ITQA 5FYCA 4WBBA 1KXGA 2OZJA 5T5PA 4NMIA 4E4SA 3V56A 2MNGA 1LGCA 1LRHA 1QKQA 2NZ9A 4Q1RA 1ULGA 1JZ8A 1X9PA 4C1XA 1IOAA 4OZXA 5J96B 1V9U2 5FO7B 3WSOA 4YRDA 2Z42A 5KHIA 3SMHA 3LA3A 3RMYA 2ET1A 4J6GA 1YI9A 2XKOA 3AKSA 5T5OA 4MGYE 1GICA 4S2GA 3VHPA 4MOAA 1E5HA 3OY8A 4YG0A 2WL1A 1HLCA 1W0PA 1QQP3 2O1QA 3FFZA 5FXVA 5L19A 5SV5A 1O6UA 2J7MA 4QPGB 5K9YA 2P34A 1V6NA 3EXUA 4V2VA 3AVSA 4FPYA 5GZEA 3LSEA 1QJU3 1AX1A 5FP9A 3VBFB 2BNOA 4FTEA 3ZYRA 4W6XA 1EPZA 4QGLA 1W8WA 1XSQA 5FZLA 4R4ZA 1OOPB 4IE6A 4L99A 3ZMNA 1SDWA 4K1ZA 4LO5B 2AYHA 1RUE2 1BXHA 3J7NA 1UOBA 3HEIA 3AL6A 3JCIA 1FV3A 3JXSA 4ZHNA 1OA2A 1SEFA 1OUSA 1DU3D 1UAIA 2RJKA 4NVPA 4Q4W2 3HJRA 4XC9A 2G1MA 2E51A 2HWF3 4HOOA 3V65A 3K4AA 1BMV1 2EAKA 5AFEA 3WP4A 1HB1A 4GMP0 4K40A 1W8FA 4RYDA 5FZKA 2WSUA 4I0WB 3ETPA 4QAWA 3OUHA 3QD6A 2BQPA 5JXGA 1GFF2 1WLDA 3AJYA 3ILRA 3JB8A 3ZSLA 2R1DA 4AEMA 1AYN3 2E26A 2XMLA 4C91A 2W0XA 4YZ5A 1KFXL 1H4GA 1TG7A 2YG0A 3AYAA 3LEGA 1AL23 2W92A 4BLIA 1U5IA 1AR83 4ZU4A 4ASLA 5CFCB 3WP3A 3E97A 1PK6A 1F8VA 3KSCA 1DDLA 2ZX1A 4SBVA 3J7MA 4BB3A 4ZKTB 3MBWA 2DUOA 3KT7A 1ZX5A 4LNVA 4AVTA 4DNYA 2WWSA 2RS33 1V0AA 2XR4A 2ARBA 4OHYA 1ASJ1 1QJX3 1QJY2 2OIIA 3NAPA 5IJRA 4A7YA 4EN7B 2E9QA 2KD7A 1PMJX 1QNYA 2VU9A 2ZEWA 3CJIA 3NNGA 4RS5B 3GZEA 5EYXA 1UYZA 3DYOA 3SITA 4A6SA 1EUTA 2A73B 4MYEA 4EWDA 4Z1VA 3P1IA 1UYXA 2VCAA 1Y3TA 2FCUA 3FHQA 5EIYB 4AFDA 2F6BA 1STMA 1J1TA 1IQDC 2YMZA 5F32A 3ZO0B 1YQ8A 2WC2A 5A7PA 5LASA 2PHRA 3WNKA 4Z2WA 1W6NB 2ES3A 3MV11 1C8NA 2WBKA 2W94A 1P8JA 4RHV2 5FV3A 3VL9A 4F83A 3T3YA 2ZGKA 1BZWA 4Y4YA 5IVBA 3E1F1 1OBNA 5DDJ1 2ADEA 5L7OC 4OQ9A 1L7RA 3VBOB 2P2KA 2YBPA 1C5IA 2X8KA 5L9BA 2VTXJ 2BBAA 3KD4A 2VZTA 3ON7A 3VZLA 1R1A1 4ARXA 3N9PA 3MV01 3K51A 2JE7A 2JX9A 3HR9A 3LPGA 4GB31 3MLLA 4JQRA 1HJFA 3HNMA 4FAHA 5IFPA 2WN2A 1UKRA 2B9VA 2Q30A 3Q8EA 5FY0A 3WG2A 5T3NA 4URAA 4D94A 3WD5A 4YFZA 2DFCA 5FIXA 3CU7A 5KXBA 2IWGB 2A1XA 4DPNA 2WO3A 4AI0A 1AR73 2XVGA 5FYTA 2A70A 1MZFA 4BJ0A 2RHPA 4QX1A 3LDBA 2GNBA 4U2AA 2DBNA 2R0FA 1EYBA 2AEZA 1JODA 2A6ZA 3H0OA 3R4UA 4COUA 4OCTA 3H3ZA 2GC2A 4GJYA 2UWAA 4LA2A 1PX4A 4E8CA 1L7QA 1Q8OA 1ZZCA 2D5HA 1EPWA 2PELA 2JDYA 4YW6A 5A6XA 2YROA 4CDUB 1IS3A 1OKOA 1XU2A 1JOJA 1IPKA 1BHGA 1ND3A 1PIV1 3O12A 5GLTA 4I09A 1GOFA 3ACIA 3OBRA 5FUPA 3RZLA 5LW9A 2XDVA 1VMJA 2HWB3 1GZCA 2JG8A 2VUDA 1DIWA 1CAWB 2Q1FA 2WT0A 1B35C 3ES1A 2VOTA 2ZHLA 4NR1A 3KWVA 4WVMB 1X82A 3IBMA 3M70A 2CWSA 1OPOA 2GH8A 2X53S 3VN4A 3LOBA 4AQ2A 4BQ4A 1VMFA 2XBO2 4AXOA 1CZSA 1JBCA 4N8MA 4UW6A 5EHDA 4LBJA 1UCXA 3IPVB 4LE4A 1XSRA 5FUNA 4FXKB 2Y64A 5J36A 1WW5A 1REEA 3OYWB 4QDRA 3NKGA 2QJVA 3RWNA 2EIEA 1KD7A 1L3JA 1Q3EA 1H8VA 3VZKA 4BDVB 3U78A 4DB5A 4H7LA 4JKKA 4OHWA 2ZGNA 2PHLA 3ACHA 3VDDC 1H8TC 5DG1A 4BXFA 4GMP1 1J3RA 3Q8CA 1IKQA 2WINB 5EJZB 2VBPA 3O1TA 1JYNA 4HPKB 2ZGTA 2ZJCA 5LATA 3GBWA 3VBHB 1HRI3 2AEYA 1RXFA 1OSGA 1IG0A 4FPFA 1FT9A 1LCLA 4PHZA 4AF9A 3BU7A 1PMHX 3GHNA 1YHFA 2Q8CA 5HCFA 4L8QA 5DUWA 5LRRA 2WNUB 5GM0A 3FUQA 4YM1A 5JOYA 1MACA 4A3ZA 5F6LB 2BDRA 1FMD1 2W39A 1DQ1A 4FOWA 3VBUC 4YW1A 3VUOA 3ZM8A 5LA1A 2P6CA 2ET7A 2Y26A 1PM7A 2VMDA 5LWBA 1SQ4A 4GD4A 4JHTA 1XYOA 1MS0A 4YZ2A 2DWRA 4XVHA 5KHKA 4XIOA 5JSPA 4YVSC 1NX9A 4BE3A 4OUMA 4AI1A 5FZMA 5FWEA 1AXZA 1HB4A 4BWOA 4COYA 5I93A 1GWLA 1SFYA 3GGLA 1D0GA 3WVJA 2IXJA 2ZTNA 4MO3M 2Y6KA 2WUHA 5BNOC 1GANA 3MFCA 2VNRA 1MS3A 1MZEA 2VM9A 1DBNA 2A6VA 2N7GA 2ZHMA 4EZ4A 2E6VA 5FDBA 1S0BA 1BCXA 3OBTA 5CFDC 2A3YA 2FBEA 3CL1A 3PJQA 2GH2A 4Q4V1 2W91A 3B02A 3IB3A 4IEXA 4JKLA 3THPA 3UT0A 1G9DA 2RJLA 4XMIA 4HK8A 1HRV3 3W5MA 3FE5A 4B4RA 1KITA 2YHJA 3H8RA 3GJBA 4CDXC 1AJOA 3HQXA 2RMU3 2WAOA 2ARXA 3AFGA 1WLTA 2EIDA 3SH5A 1N3PA 3T2PA 2PYTA 2OW4A 1HN0A 5FZ6A 1KS5A 2HJIA 1EY2A 4IXLA 4CXWA 2WWJA 4A6OA 1SMVA 4GKYA 3VHRA 2XLGA 3AMPA 3OUJA 4FPEA 2HYXA 4A41A 4Q0QA 4PJYA 4JGZC 4QPWA 2ORZA 2W47A 4YZ3A 2YFUA 2BRTA 1SFNA 3TN92 3I2GA 5IK7A 4K21A 1XRUA 3WW2A 2WABA 4LJHA 1ASJ3 2PQSA 5FRAA 4NE9A 5DUVA 4PLMA 5M0TA 2XB6C 4QQ2A 4OUEA 1OQDA 1ZZ6A 3A0NA 2Y0IA 1NCQA 5ABJB 4WM7C 1NA1A 2J22A 5JOXA 4Q2FA 3IIIA 4KWUA 2DTWA 2CGPA 1HQWA 1XOYA 3EBRA 3KGZA 1E57A 2YZ4A 1LR5A 4DUWA 3SH4A 1TME2 4FCAA 4KGQA 5I0DA 2A5ZA 4NRPA 5BNPC 2FDIA 5EQUA 5H9RA 4C90A 4LORA 4F8AA 2DVBA 2FZ2A 4XACA 1VBD3 4CDWC 3E5QA 3R05A 1NE4A 1AF9A 3PIGA 4UF0B 2CV6A 4HMZA 4IV1C 1PVC2 2O0OA 1GP6A 4LBMA 3M3CA 1OA4A 4N7IA 1CONA 1GQHA 2DF7A 1RUC3 4E2GA 4KG8A 1TMF3 2C0ZA 4GB33 4QX0A 3S0MA 3ZPOA 3OB8A 3RJRA 2BZDA 1X33A 5JMOA 2BYVE 4CCOA 4B7EA 4LR4A 1BEV2 4IEZA 3RRDA 3W5NA 3FLRA 3LFMA 5IVEA 1BMV2 3LSDA 1H4HA 1XB9A 1B09A 1R083 3DPRC 2C24A 5ANNA 4AI9A 1VJ2A 2ARAA 2JDZA 3OUIA 4LBLA 2O14A 4Y22B 1NKGA 4LOSA 2D7FA 1W8TA 1CVNA 3MW4A 1GOGA 2W1WA 4I0AA 2D3SA 2IC1A 3UYJA 3ZSJA 4CP2A 2UU8A 1UIJA 4JZRA 4BMEA 3HVDA 4CEYC 3ZFGC 5KHGA 2OYZA 4LHNA 4PIXA 4QPIA 3J26N 3U4SA 4FO9A 5C70A 4BQXA 1OC1A 1WW4A 1Q43A 2PMWB 2P4EA 4C1WA 4BQ1A 2RJ2A 3AKPA 2HWE2 4BQWA 3K4DA 2VJXA 4BQ5A 2Y6FA 1JZ2A 5BUVA 4Q0PA 3DEMA 1VBB1 4D0QA 5F5IA 2ZMNA 2B8MA 4HBNA 3QOPA 2IVJA 5GZDA 5KC6A 4HKLA 5F9TA 1WLCA 1X36A 1S4CA 2WT2A 5FBZA 2PA7A 3HBKA 3RZMA 3O1RA 1PZ8A 3OJBA 1LOCA 4AQTA 4CPBA 1N1SA 1UOGA 1W6MB 1ZZ8A 2XJTA 2XL7A 4GALA 4PBOA 1LEDA 4AEDB 2D6OX 1HN1A 3AJZA 3A7QA 3ALQA 3AVRA 4JQTA 4LBQA 3AM2A 4PBPA 3URFA 3WQ1A 5K0UC 1GZTA 3AMNA 1OA3A 4MXWA 3OBZA 4P9GA 5DXDA 1BBT2 4N7UA 1TNFA 4P02B 5FY5A 1QIQA 2P3JA 1SACA 2WFF2 3VD4A 1WGPA 2RM23 1OD3A 1V9U1 4W4ZA 1MZ6A 1W2UA 4UFIA 1LHWA 1R1A2 2AACA 2ID4A 5FP7A 4ZU7A 1DQ0A 5J48A 2PHWA 2V4VA 3IT8A 3LIHA 1XNAA 4ZXKA 4IE4A 3KM5A 4HONA 4XTPA
chains in the Genus database with same CATH topology
2VGDA 5GALA 3ZN4A 3VZNA 4KWKA 4I3GA 3KCXA 3VBRA 5AC91 5L73A 1PNGA 1RUF1 3JZVA 4G3YC 4HN0A 4AHYA 5CIRA 4DRVA 1PHMA 4LUMA 1OLQA 2K9ZA 3C3VA 1RUI3 3ECQA 4OI1A 1CAVA 3A4UA 3TB0A 1HQNA 2DCKA 1QXRA 3LWCA 1RUE1 3KGLA 4I2OA 4KNCA 2ERFA 2EXJA 3BCWA 4BZ4A 3W59A 2BW8A 2ZHKA 3MW2A 4PLOA 1PK6C 2P3KA 2GZWA 4JGYA 3CNAA 2BPA2 1YFXA 2WS92 2NMOA 4Q4Y1 1K5MC 4C0HA 1H9WA 1JYIA 3C2UA 5D8AA 3NAPC 4DY3A 4BIOA 3CJIC 1RUH1 3ST7A 3M1HA 1H2MA 5GLVA 4UW5A 1NCRC 5I8SA 3P3NA 3OTFA 5KXDA 2Q4SA 2VY0A 4XFHA 2NP0A 1DZTA 2EAAA 1FXZA 1MQTA 4QU2A 4LBOA 4OUSA 4P9WA 3WP5A 1PMIA 4QX5A 4Y1VA 2R073 4X6QB 3AMMA 3AYCA 5JOZA 1HKDA 1SBFA 1R092 3I59A 2CNAA 4FBFA 4MSVA 1IHMA 1Z7S3 4IEOA 1DQ6A 4YVWA 2QFEA 5E16A 1JN2P 5LRSA 1KRIA 3MIHA 1FMD2 4QGMA 4CDQC 2LTNA 3FBYA 1ZREA 3KS7A 4XF1A 4Y20B 4Q0UA 4XFIA 4Z2WA 3JD71 1LHOA 4ISQA 5EZWA 5HXVA 1AXYA 4RHV1 3WHTA 3INAA 2TEPA 1UIKA 1A3KA 5F1RA 1PO22 5BNNB 1SCSA 1WUVA 2WIIB 3HT2A 1LB2A 1DQ4A 1PO11 5LEJA 5I0TA 2E7QA 4PIYA 3MEPA 1GYKA 1ND3C 5CNAA 4TLFA 1MS5A 2DYCA 4MV2A 3U4XA 4GH4A 5A33B 5FO8B 1AX2A 4LTAA 3ZXJA 1NXMA 2JG8C 5BXXA 5T5JA 3NW4A 4DS0A 2Z69A 3KCYA 1O4YA 3NV1A 4QPYA 4XHXA 2X29A 1HXS2 4FP2A 1Q5OA 1Z0HA 2BEOA 4W6WA 1QY4A 4MZUA 1LEMA 2PLV2 2AENA 2B42B 2WSVA 3USSA 3AMHA 5E89A 2C9AA 1YUDA 3PVEA 4AQSA 1GZWA 3V0BB 2QUOA 1KFUL 1B35B 3RMXA 1RUD1 4EROA 4FPJA 1ND2C 4ISRA 1V70A 5A3LA 5JWPA 1AR93 4NPRA 4LLOA 4YNIA 3ZXFA 2XBO1 1VBA2 1S1AA 4Y24A 1CIWA 5CVRA 2IXLA 4L9BA 1RUJ1 1N1TA 3NWKA 2IFRA 4XBLA 2VW1A 3V0AB 1WMEA 1WW6A 2HWD1 3D8CA 4HK9A 4NN0A 3VDDB 1VAKA 3FBMA 4IEQA 4HKOA 4Q0SA 3BOPA 1OD5A 1M06G 2VG9A 2G9FA 3U0ZA 3UL2A 2QDNA 4S2FA 4YM0A 4FTSA 3SLIA 2QDRA 4OFGA 4FPHA 2XVLA 2RR11 1RL3A 1DG6A 1W6PA 2BUKA 3POWA 4YVSB 5JZGC 4YW5A 1C4RA 2GC3A 1XE8A 1LESA 3NV3A 3S7EA 1SBDA 5BNOB 5FPXA 1RIRA 3UKVA 1ZYBA 4XHBA 2D6LX 4IETA 4LLFA 1MS4A 3MZHA 5CFDB 2VQ0A 2UYAA 1VR3A 3LAGA 3JU9A 1CAUA 4NHLA 4Q4W3 1AR62 3WW4A 1H0BA 2FMDA 4XE9A 5DZFA 2EF6A 3TRSB 1DGWA 3U10A 4V1PA 2XVKA 1VBB2 1XNBA 4WM8A 4YGCA 3VKFC 4XJUA 2OPKA 4RQPA 1LOEA 5KBFA 5FFOC 3VBFA 3WQ7A 2RS11 1OOPA 5FMOL 4X8PA 3ZMOA 3FLPA 1FPN2 3RNSA 5FOBB 4E9KA 4JGZB 2WLPA 3MFAA 3O0VA 4COVA 4P14A 2Q0AA 1ZNPA 2YDEA 4N43A 3TN91 4BPZA 1C8M3 1RMU3 3X29B 5HCAA 1QJY3 3AP4A 4WM7B 1QH7A 4FPCA 1COV2 5ACA1 5FOJB 1AYM2 1D0HA 2ZAAA 3BB6A 2FHRA 1POV0 1ZBE3 3H1YA 1R1ZA 4CP1A 5A32B 5AC92 5BNPB 1RUF2 2D44A 5CU1A 1TME1 2VQAA 3VV1A 3WY6A 3VZMA 3H1WA 4RHV3 4XJ8A 2VNOA 4CDWB 3LA2A 2GC1A 1Q8QA 1YJLA 4KWLA 4IV1B 1CAXB 3NV4A 1Q8VA 1FOD1 1VLNA 4XZPA 2EA7A 1PVC1 3CF6E 4FPGA 2EXIA 4QPIC 3UV9A 4RS5A 1SCRA 2UYBA 4R8HA 4I0BA 3ZYGA 2HKXA 4S2DA 1D2QA 1ENQA 4HVRA 1QF3A 2V5YA 1BEV1 2CGOA 1NXD1 3DPRB 4Q4Y2 5BNQA 4XFGA 2NPIA 3ZFFC 2XWBB 1W6NA 1RUH2 3I54A 2VVDA 3WX5A 3ZFGB 1NLRA 2QZ3A 4X6RB 2XG3A 2H0BA 1KS4A 1HDKA 1C3HA 3RJ2X 3VBOA 3AYEA 3QH6A 1SLBA 3G7DA 3MYXA 3J8F3 3MIEA 3N7LA 1WCKA 4EN6B 3D5OA 1UMZA 2HWE1 1LU1A 3D6EA 1YNAA 4MLOA 1MS9A 4JTOA 4AGRA 4AVBA 5L36A 5JLVA 2ZGRA 4RFT0 4CTEA 5T5LA 1RGSA 4RD7A 1APNA 3KCCA 2X5IC 1ZM1A 2XBO3 4R9AA 1NLSA 2DVGA 5FREA 1ZRCA 2MEV2 4AHWA 3EO6A 1F5JA 3VBRC 4XJZA 1DQ2A 4AHXA 3KT4A 5K0UB 4A7ZA 3JD72 3T2TA 1H2KA 3OF1A 3MDPA 1MEC2 1S55A 4CDUA 2ZOEB 4LBNA 1BBT1 3GHMA 5FQ0B 5C9AB 2HWC1 2WFF1 4AEJA 3JQXA 2BVBA 3OGGA 4CEWB 2OUHA 1CAWA 4SLIA 5E88A 1PO12 1CN1A 4GIQA 3WZ1A 1J59A 2UWBA 3ENRA 4Y1YA 2ZGUA 1ZZ7A 3GBGA 4Y5Z0 4ONUA 2I74A 3IPVA 3GYDA 4TSVA 3RI8A 4XQDA 2KA3A 1GZ9A 2B45X 3RSJA 2WNEA 5C4WA 3OYWA 1LHNA 1OQ1A 5GZGA 5I8YA 3H8UA 3MIDA 2AGSA 4AVSA 2XLAA 3ZXDA 3VKLA 1WLWA 3KLSA 1G9CA 1Q8SA 1PK6B 1VALA 2PAKA 3MF9A 4HPKA 3VBHA 5DUXA 4FVVA 1POV1 1S0GA 1YIFA 4HVQA 1K5MB 3E5UA 4GQ7A 3NAPB 2WS91 2WNUA 5FLIA 2UY9A 1KJLA 3AXDA 5IUQA 5KHJA 1RUD2 3KMHA 1C5HA 1NCRB 2UY8A 3ES4A 3ZXEA 1REFA 2PAEA 3AZYA 4NOTA 2TBVA 1AL22 4O9GA 4EV0A 1RUJ2 3HMYA 2R30A 4N53C 1DQ5A 1TEIA 2EXKA 2HWD2 4XFAA 4NWWA 2QE3A 4MVTA 2RS32 2VNGA 2NYYA 2BVVA 1LGNA 2I2SA 3D4KA 4OULA 4CRQA 5D1IA 1R091 2JKBA 3VHOA 4RGAA 4CDQB 4COZA 3NO8A 4FOQA 5JPNB 1O3QA 4PDWA 4FQ4A 5BYNA 2RR12 1ZA4A 3WUCA 5C6CA 5EXOA 4IV3C 3OD0A 4TYSA 4HLTA 1TME3 3IKWA 3Q9OA 3I8TA 4ATFA 2WZR2 1QHDA 3NVCA 4I01A 2WT1A 2WLQA 2D6PA 1PVC3 1XQNA 1PO21 4KBBA 3ZIWA 2YC0A 1ND3B 2OUJA 2Z79A 2ZGOA 4KGGA 4YW4A 5J3UA 4J1WA 1EV11 5ABJA 4WV8A 2JE9A 1YFUA 1BEV3 3MPPG 2IFWA 3R0RA 3ZXAC 1REDA 4EN8B 1H30A 4WVWA 4R9CA 3B69A 2DU0A 2YGLA 3BOWA 4FOVA 1N47A 4Q29A 1UPIA 2B5HA 3AKTA 1HXS1 1U5XA 2RS12 1ENXA 5JOWA 1OFNA 3DN7A 3E5XA 3AKQA 2PLV1 2O8QA 2BNMA 3ILFA 5CB7A 5GJ6A 3VBSA 3ME2A 1I3HA 1ND2B 3B3QE 4YFWA 2HWB2 3FJSA 3BALA 3VKNA 2WNVA 3KZ4C 2JJ6A 4OHZA 4INDA 3TBDA 5ACA2 3MPBA 1VBC1 1Y43B 4XILA 1VBA1 4XBQA 4AHZA 4Y22A 1ZRRA 4D7SA 2ILMA 2R1BA 2JECA 4BHPA 3M3EA 5JVVA 3KB5A 2D98A 2DCYA 3HBZA 1A8DA 2PHTA 1CPNA 4DMIA 4MGKE 1S0FA 2VVFA 4YLZA 1CQ9A 5DDJ3 3AYDA 2E7TA 5CG9A 1BBT3 2VXRA 1W6OB 1HRI2 1FOD2 3B94A 4LO7A 4HANA 1JYCA 1R1A3 1IQAA 4RA0A 1ZBA2 3WP6A 3LB9A 4XQ4A 2WQ4A 2QQPA 2GMMA 2YV8A 5JZGB 4D7YA 4YM3A 1HV0A 1O5LA 4RR3B 1MVEA 5E8AA 4QGNA 4M0NA 4BLJA 4JCKA 4WM8C 4BH9A 1W6MA 1WBLA 4RQPC 2LALA 4AEDA 3VBFC 1RINA 4IEYA 3B5LB 4XJ9A 1LODA 4N90A 3IM0A 4LO8A 3FLTA 4QM9A 4IEWA 5FPZA 3H3UA 2GAUA 1AR61 2D6MA 2XJRA 4N43C 2WS93 2A71A 1PIV3 3IDEA 2A3XA 2DCJA 3RPQA 3USUB 5EFUA 4IEUA 4PIZA 3R4SA 4MUVA 4CP0A 1HRV2 5BV6A 4PCRA 3PVBB 3RYPA 1ALYA 5JI7A 2D97A 3JBG2 3BPZA 3DL3A 2ZX3A 4IEPA 4OHVA 1OI6A 1ZRDA 3L2YA 1IZ3A 1LGBA 3FFQA 3P3PA 1FPN1 4B4PA 1LHUA 2WQZC 4M0HA 1QOTA 2QNKA 3H9AA 4AEKA 1CJPA 4K8FA 2XJPA 4EJRA 1OFSA 4GMP3 1UU4A 5EYYA 5TSWA 2W52A 2R041 4LHKA 3PJYA 1V6IA 2XH6A 2B9UA 2HWC2 4PQ9A 3HD8B 2C5DA 4YZ4A 4FPOB 4K20A 1R093 1COV1 3ILNA 4MGIE 2VMHA 2XKPA 2K0GA 1AYM1 1X7NA 1U5ZA 3EJKA 1GBGA 1GNHA 1LECA 3AP9A 1FMD3 2ZMLA 3CEWA 3POSA 3U07A 1H2NA 5C8CA 4FP3A 1OKQA 1OMIA 3QBQA 5FMOS 4YM2A 2XHKA 1D4M2 1VBD2 3SCGA 1CGPA 1LU2A 3SXWA 1PGL2 4K3UA 4QPIB 1LKNA 3AXEA 1PO23 2VOXA 1RUC2 3VBOC 1Y9QA 2LUWA 1AX0A 1U5YA 2HEWF 3ZVXA 4RGGA 1CJDA 3G6JB 2VMGA 4KQ7A 4B4QA 4LO6B 3TAYA 3ZFFB 2JD4A 5JPMB 4Q4V3 1V6KA 3N7JA 2E53A 2GN3A 1NOVA 3WDTA 1I5ZA 5FLHA 4F7ZA 5FTTC 3NV2A 4Y20A 1GLHA 4CYDA 3ZN6B 1HXS3 4XFFA 2EXHA 3WDWA 4BM8A 2JEMA 2VPVA 4YW2A 5BNNA 5JSRA 2ZGPA 4XXAA 3VLBB 4EWAA 1GV9A 4UBHA 1IS6A 2R32A 1AXKA 2XJSA 4HSJA 1SLCA 2Y0OA 1X8EA 2R16A 4AE2A 4LHLA 4Q4X1 5JAXA 2X5IB 3TNQA 5A33A 3M3IA 2GNTA 5LK5A 1V6MA 1VBA3 1KQRA 1VRH2 3IDBB 1O3SA 2MEV1 3H7YA 1TQ5A 1H1MA 4LA3A 4B8EA 1VBE1 4DZGA 3IDCB 1Q8PA 3SISA 5C4WC 1CAVB 5KXCA 3APBA 4A2UA 1H1AA 5L7OB 2B39A 1O3RA 2D5FA 1MEC1 1AUYA 1OLRA 3ZFEA 2ZABA 4L92A 5AFBA 5B2GB 3V0BA 1B35A 1YWKA 4AI3A 4GXLA 2H0VA 3POYA 4XDQA 1YFYA 3VBHC 3WW1A 3ZIXA 1F2NA 1GNZA 4W65A 1EP0A 4YG3A 1URXA 2GDFA 4XFBA 2R49A 3SH3A 4H7MA 1A78A 1EV12 1UZZA 3MIBA 4E4ZA 4RSUA 3VHNA 1QQP1 2WNUC 1JH5A 1HQLA 4FPLA 2VH9A 1FYUA 5H9SA 3V0AA 1U0AA 3FWEA 3VDDA 2A6XA 2PHUA 5T54A 4IERA 1RUG2 1IS5A 3WG3A 2JG9A 3AX4A 2OVUA 3MI8A 1GKBA 2CY6A 4Q1PA 4N9IA 2D3RA 4XYXA 2HEYF 3UJQA 1NQJA 2NM1A 4DQAA 3ZSKA 2D93A 1YO8A 4R9DA 2A6YA 3O14A 3RYRA 2HWF1 4Z8BA 3AZXA 1RITA 3I59B 1VBB3 2GN7A 4JV4A 1TE1B 4YVSA 1NZCA 3ZYIB 3B7MA 3WUDA 1VBC2 3N35A 4N53B 4PDWC 3B01A 3AZWA 1UW8A 1AL21 1ULFA 4QQLA 2V09A 3AP7A 4P5HA 2E7AA 1H8TB 5EJ3A 1BK1A 1ULCA 4XF4A 5CFDA 1G6NA 2DVFA 2QZ2A 2A75A 3AK0A 4MX3A 2A6WA 2RS31 1N3QA 1NY72 1W6QA 1C28A 1QGLA 1UX6A 2P37A 3E6CC 3DKWA 2GMEA 3ROUA 1V9U3 3H50A 1COV3 5FO9B 3WINE 1AYM3 4LULA 3WDVA 1Z7S2 1WD3A 4DY5A 3VBUB 4IV3B 1ZVFA 3GBFA 1DGRN 2ZMKA 4L11A 5AC93 5FCCA 1RUF3 3IMNA 4BMBA 2DCTA 1Q56A 4RL7A 1JTZX 4JGZA 3JQWA 1J1LA 2WZR1 3AKRA 3PHMA 4Y1XA 3R4DB 2P3IA 1NE6A 2RS52 3MIFA 4Z92B 1RUE3 4Y26A 2D6KA 1SLLA 2XJQA 1O3TA 3V64A 1FV2A 2D43A 3N4MA 4LO4B 4WM7A 1GZWB 1MR5A 4GKXA 5F9TA 4AW7A 3VBSC 4QQOA 5FAXA 2PHFA 5KWRA 3PNAA 4JDOA 1H1IA 3FX3A 4Q4Y3 1VB4A 3B00A 1DZRA 4AYUA 1XU1A 2WNVC 4CDXB 5A32A 1AR71 5BNPA 4HVOA 2DV9A 2BFUL 4QPGA 1RUH3 3M3QA 1OQEA 3GZUC 4CDWA 1NCQC 4YG6A 1NA1C 4P9YA 1W0OA 1IKPA 4KG0A 1LOBA 3LGRA 5GLWA 1CPMA 1DF0A 3WDXA 5F5QA 3WDYA 1PVXA 4ZU5A 1HIXA 2NQYA 4KL1A 1YJKA 1UPSA 2KM2A 4XTMA 2HWB1 2R042 3DPRA 1QH6A 3PMEA 3SHRA 1QDOA 4YSFA 4AFBA 5JIUA 4TWTA 2MEV3 3ZFGA 2GALA 3THTA 2HYKA 2DVAA 4URTA 1JW6A 1V6LA 2BNNA 1HV1A 4UW3A 5GLZA 1YI7A 4XXPA 1AZDA 3JD73 4M3CB 1LULA 4ES8A 2QCSB 5A3MA 4AEDC 5CFCA 1MEC3 2R062 3ZX7A 1DLLA 2WFPA 1WA4A 1AVBA 1DZQA 1N1VA 4XMAA 4AVCA 1HRI1 4E2QA 1J58A 4PF5A 4AGVA 4S2HA 1CAUB 3ZYJB 4EN9B 2JXAA 1CX4A 2YPJA 3A0KA 3LCPA 1PO13 4PLNA 1ZBA1 4AFCA 4KH9A 1G9BA 5IK4A 2AZ5A 4WM8B 4EWEA 2XPJA 4RQPB 4FAGA 1PGSA 2Q1ZB 2G9GA 4TZDA 3FHIB 2FZ1A 2GMPA 5K0UA 3N7KA 1VAVA 4XF9A 2Z5WA 3QCWA 3VL8A 1EAH2 4AK3A 2PTMA 3AB0A 3BTAA 4XBNA 3RG0A 4CEYB 2ZS6B 5J09A 5KXEA 4DINB 5C9AA 5FQ0A 4P9IA 2CYFA 1NG0A 1XE7A 3NSTA 1RHI2 1UF2C 4N43B 3HWJA 3MF6A 4CEWA 3SCHA 3D0SA 3M3OA 5J7MA 1RUD3 3T1MA 1QOOA 3WG4A 4AG4A 2ZGQA 1RVF2 5K7PA 5KC5A 4I3PA 1HRV1 4Q4X2 4AGGA 5HI0A 3JBG1 2CAUA 2RMU1 4XJAA 3H7JA 3VZOA 3ATGA 3OY8B 3I2DA 4YW3A 1G8WA 4R9BA 1RUJ3 4HETA 2C1FA 3RQ0A 4R52A 1VBE2 3ETQA 2HWD3 4G4FA 5C8CC 3WLUA 1BYHA 2ZACA 5DG2A 3M2MA 2WKKA 4BCUA 3ZN5A 1C8M2 1K5MA 5EV7A 1RMU2 2DTYA 1G7YA 4DRRA 2VECA 1DYKA 5T52A 4GULA 4LT5A 4JDMA 4META 1CR7A 1NCRA 4WZFA 2ZZJA 1YYNA 4YGBA 4JC1A 5EWSA 4WVMA 2EVXA 4MXVA 1ZBE2 2BBVA 4JGYC 4NWVA 2V73A 4XJWA 2RR13 4HT1T 2D6NA 4A7KA 1QXJA 1JUHA 1QQP2 4AI2A 4XIKA 4CZSA 1ZRFA 4Q8KA 5HBAA 5D8AC 4QQHA 1QJU2 3EHKA 4LE3A 2WZR3 1OHFA 1C1FA 1D4M1 1VBD1 3J4UH 1PGL1 4H3WA 3MICA 2IXIA 4Q0VA 2TUNA 1RUC1 1XNDA 1TMF1 4OVEA 5BNNC 5LEKA 3WCRA 2WZPP 3N3HA 2PHDA 1FNYA 4CDQA 1MQTC 4LUKA 2VOWA 4OI2A 4Y1ZA 1QOSA 2HWF2 3VGIA 4HL0A 3ZDSA 3CJIB 1AL0G 3JUUA 1R081 1RJ7A 3PTYA 3I7DA 3UJOA 3L9JT 1AYN2 1J3QA 3FUOA 2CGNA 4ATEA 1QNWA 2AR6A 4FT8A 1RUNA 4O9EA 1V00A 1AJKA 2RS13 4YVWC 2A7AA 4FOYA 1AHSA 3M7AA 4WZCA 2TNFA 1AR82 3RDIA 3J8F2 2YGMA 2BTVC 3IN9A 3W58A 1S2BA 1N3OA 4WVZA 2ZGLA 2XLFA 3ZFEC 5CAZA 5DZEA 3TN93 3OCPA 1OPMA 3BIWE 1QJX2 5JI9A 3KQRA 3ZSMA 2XUMA 5IK8A 4AI8A 5SV8A 2CAVA 5ACA3 3D0JA 1VRH1 2ZAHA 2JICA 5CA6A 1WCSA 2E63A 3GALA 5C4WB 4HN1A 5T55A 4GH4C 4L97A 2GNDA 4K6BA 4QMAA 2D40A 1H9PA 2JG9C 1ND2A 1I1EA 4AVAA 1FOD3 2RM21 3NL1A 4MH0E 3ZSEA 2XGXA 1WD4A 5JMCA 4NHKA 3AP6A 1UKGA 2WJSA 3EQEA 1WCDJ 4HFSA 1ZBA3 2DUPA 2YUEA 1S0JA 3MGUA 1O4ZA 1BVVA 2YYOA 3B93A 2ZX0A 3GZAA 2HEVF 3UK9A 5J37A 2JG8B 4H55A 2Z2SB 3AMQA 2JENA 3WT3A 3WW3A 4GWMA 3ZMNA 4QM8A 1VAMA 3CLPA 3FMGA 1AR72 1XYNA 1ENRA 1RUI1 1RUG1 2YXSA 2F4PA 1F31A 1FNZA 3O0WA 1W6OA 2IXCA