1AZ8A

Bovine trypsin complexed to bis-phenylamidine inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Unexpected Binding Mode of a Bis-Phenylamidine Factor Xa Inhibitor Complexed to Bovine Trypsin
rcsb
molecule tags Serine protease
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A02
1ABIH 1DE7H 4JZDH 1Z6JH 1PQ8A 1EXFA 4I7YH 1SQAA 1F92A 1O2MA 1S0RA 2JH6D 4GLYA 1F5KU 4Y7AA 1OSSA 1DY9A 1DLKB 1TGCA 1KXEA 3QN7A 4BTTB 2Z3EA 1BT7A 1IQHA 1E0FD 1XX9A 3A83A 1XM1A 5DP9A 1TE0A 2GD4B 3TJOA 5A0CA 1W12U 4NWLA 2ALPA 1K21H 4X0WU 3D23A 1GMHF 1UMAH 2XYAA 1YM0A 3DUXH 4JMYA 2FOHA 4INHA 2PKSC 1G3EA 3BG4B 3ZZ6A 4O3TA 1AZZA 3QDZB 4O3UA 1G30B 3ZZ8A 4AG2A 1FLEE 2RDLA 1QB1A 1ORFA 1Y3WA 2Q6FA 1ACBE 1EX3A 2JETB 4K1SA 2ANKH 4Z6AH 1EKBB 1GI3A 4JZIA 1NO9H 3GCNA 1NFYA 4R0IA 3ITIA 1LKBA 1ARCA 3GCHB 2LPRA 1GMDF 1P9UA 2ZHDA 4X1RU 3MOCA 1KDQB 4KELA 1O37A 1O2TA 3ZZ3A 1SGNE 4RN6A 1GJ9B 5DP6A 5FBEA 2H9TH 1WU1A 1BMNH 2VB0A 3RXKA 1AKSB 3W94A 4XDEA 3EYDA 4ASHA 2FI4E 3IITA 4E05H 5EODA 1XXFA 4CBOA 2SGEE 3RXDA 1UJ1A 2VVVA 1K1LA 1P04A 2V3HH 4I8LA 1BUIA 3SQHE 2H9EH 1Z8RA 1TX8A 2HNTF 2FI5E 1RS0A 2GDDA 2OQ5A 2SGDE 1PQ5A 3STIA 3SN8A 3PMHB 1PPHE 2BQ7B 1P01A 5EQRA 1JIMA 1FDPA 5AVDA 1FPHH 1PPEE 4ZXXH 1RXPA 5LPRA 1YCPK 3MO9A 4JZEH 4B1TA 1ZSLA 1NROH 2BLWA 3M7TA 1SSXA 3RC6A 1K28D 4H6SB 1FI8A 3DFLA 3P8FA 2OLGA 4LZ1H 1GDNA 1PYTC 4JYUH 1T8NA 2EI7A 1V2UT 4B2CA 4Y11E 1YBWA 4UFDH 2HVXA 2BMGB 2BD5A 2BY5X 3UR9A 4WF8A 2ANYA 4MVNA 3ATWA 5AFYH 3UNSA 2QCYA 4WH8A 1C1MA 1SG8B 1C5ZB 4Y10E 2PSXA 1ARBA 1P9SA 2BXUH 2UWOA 5SGAE 2O8WA 1C9TA 2KAIA 1Y3UA 2PV9B 4Y7BA 3KQCA 3DA9B 1OP8A 1UVPA 3B23B 4Y8ZA 5TJXA 1MBMA 2W7SA 3L6PA 2EEKA 1ELTA 1OWKA 1TIOA 2OP9A 3ZVDA 1JWTA 4CR5A 2GZ9A 3LGYA 1SB1H 3UIRA 3SI3H 2QN5T 5FCKA 3FVFB 5E8EH 1PYTD 2GMTC 4UONA 3TGJE 1EJAA 1TBZH 4MNWA 4OS7A 1C5RA 1S84A 2EA3A 1ZMJA 4Q80A 4I8KA 1O5EH 4IN1A 1NTPA 4WMFA 2XBYA 2ZFSA 3PLBA 4WXIA 4GPGA 4MDSA 1BHXF 2BLQA 4A92A 5F8TA 1NRSH 1W2KH 1JXPA 5PTPA 1TMTH 1DWEH 1HAZB 3BN9A 3F9FA 1KXAA 4ZKSU 3ZZBA 1W7XH 2XCFA 3ZZ9A 3L33A 4MLFB 4AZ2B 2BLVA 2I6QA 4DW2U 1O2SA 2B8OH 3P17H 1KXDA 4ABDA 3A7ZA 2QY0B 1GHXH 6CHAC 3SU1A 2ZI2H 2GZ8A 1G37A 2XBVA 7GCHF 5CHAB 1NRQH 3M7QA 1GI8B 1FIWA 1E35B 5JPMH 2CHAB 5FXLA 2GCHG 4X1QU 4ZMAH 1L1JA 2VINA 4E06H 1FONA 1LVMA 5GCHG 1T8LA 1ESBA 1GJ8B 1K22H 4X6NA 1C1QA 1KXFA 1ZHPA 2PKAA 4X6OA 2ZC9H 2VGCB 2GTBA 1YC0A 2PGQB 1C2FA 1PQAA 3ZVFA 1AGJA 1MU6B 3R3GB 2XC5A 3M5OA 5C67A 2BD9A 3RMLH 1TNHA 4NA8A 3RXSA 1EPTB 5JBAS 1NFUA 2BD2A 1PQ7A 2WINI 2V6NA 2CF8H 1GJCB 2GGVB 1CQQA 4XSKU 1A0HB 1C1VH 1Y5BT 1HJ8A 2H6MA 3GY6A 2FYQA 1Q2WA 2HNTE 1S6FA 1SLWB 1SPJA 1ZPZA 1SLVB 3A8BA 2Z3CA 3RC5A 1Y3VA 1QY6A 2D26C 4MPUA 5FPTA 3ZVEA 2XRCA 3P70B 2J38A 2YNBA 4MPWA 2ZA5A 1QHRB 3EDXB 1NESE 5LPEA 3KEEA 1O2ZA 1UVOA 2CMYA 2QXHA 4D9QA 1ZJKA 4WVPE 5G4BA 4OS1A 1QL7A 1TRMA 3MMGA 1EP5A 3SUEA 1DX5M 2R9PA 4OGXA 1SL3A 3PO1B 1UTNA 1ETRH 3LU9B 4E7NA 4SGBE 1GBHA 1A5IA 3F1SB 1ZOMA 3RXIA 4B2AA 2OCVB 4JK5A 8LPRA 1ZGVA 1EUFA 1OOKB 5FX5A 3A80A 4FUJA 1LKAA 1V2ST 4FUDA 1HAGE 3TH4H 1N8OB 2Z7FE 2Y5HA 3Q76A 1HAOH 1SOTA 1HDTH 1WV7H 3GDSA 4K1TA 1C5QA 3E91A 3NWUA 2C4FH 1O2HA 3SV9A 2BY6X 1EZXC 3BIVH 2SNWA 1AFQB 3GY4A 2ZECA 3U8OH 3F6UH 4YT7H 1YPEH 2SGFE 1C1UH 4K3JA 4ZUHA 2BTCE 2BVRH 4GSOA 1BRUP 3LGTA 1LVYA 3BEFB 3UQOA 4CREA 4AYVB 4XFQA 1UO6A 3UTUH 3M3TA 5K0HA 1ELCA 2TBSA 3HATH 1ABJH 2UUJB 3OTJE 1HRTH 1BTHH 2O8LA 1OX1A 5EQQA 5GIBA 1L0ZA 1J15A 2AS9A 2F9PA 3LGUA 5F6MA 3BEIB 4FVDA 3LOXA 1C1SA 1UTQA 2V3OH 1S82A 4KGAA 1HUTH 4DT7B 4KP0A 4ZH8A 4BAOB 3GYMA 3MHWU 3SV6A 2A32A 2VIPA 1QURH 2ZEBA 2Q6DA 3KIDU 2A7JA 5CE1A 1INCA 1PJPA 1HB0B 1SGFA 2ZU4A 1FPCH 1ZLRA 4X1NU 2ZCKP 4J2YB 1P2OA 5F8XA 2VWOA 1HJ9A 2Q6GA 1UK4A 3RXAA 3V0XA 3RU4T 1ESAA 2ZPSA 3C27B 1C4V2 2AGIX 1Y3XA 2J92A 1GI0A 3MYWA 1RRKA 1ELGA 4FU8A 4IMQA 1DM4B 2A1DB 4OS5A 5DGJA 3KF2A 1UTOA 1CE5A 1GHWH 3GYLB 5T3HA 1QNJA 1W0YH 4GVUA 1GHBG 1O36A 3TU7H 1C5PA 1QQUA 2BZ6H 1V2QT 2XNIA 4ABGA 3IG6B 1H1BA 4ISNA 2BDAA 4X1SU 1GGDC 2GCTB 4D9RA 1V2LT 1Z71A 1LDTT 3V3MA 1BITA 2FOGA 1ZMNA 2H2ZA 3A86A 3SV2H 7LPRA 2FMJA 2PFEA 4GCHF 4NIYA 2D2DA 2GV7A 5C1YA 2XXLA 3EE0B 3SUDA 1MAYA 2ZQ1A 1MTNB 4OS4A 1NZQH 5JB9S 4TWWA 1C5SA 1QTFA 7ESTE 3STJA 2BDIA 1YF4A 1DOJA 5T6DA 4CBNA 1C2EA 1DICA 2ZU2A 1NFWA 3QX5H 1QA0A 3BG8A 1XKAC 4X6MA 4BAMB 1BHXB 5E2OA 1CHOF 4XBBA 1O3MA 4YM9A 4NSYA 2ZFRH 3NKKA 1V2OT 2Y82A 1EATA 4NZQA 3RXHA 2Z9LA 3S7HB 3M37A 1NRNH 5C5OA 1O5AB 4UFEH 3SJ8A 3MU0A 4HZHA 2ZPQA 3GDVA 1SFIA 2VIDA 1O3LA 1TWXB 4FU9A 3RMMH 1GG6B 3FZZA 2AIQA 4DIIH 3K65B 1EAXA 5K7RA 2ZKSA 1TPSA 1MAXA 1O2QA 3TK6A 2PWXA 5A8XA 4IMZA 2ZGJA 1O5BB 1KDQA 1BRBE 3URCA 5J4SA 1YCPM 1MD7A 3S9CA 2QXGA 1GBKA 1DUEA 5C1XA 1AKSA 1TPOA 2VNTA 3ATKA 1UTJA 1W10U 2Z3DA 1P2MA 1NM6A 1V2RT 2H5CA 1OS8A 8ESTE 1TNIA 5C2ZA 1AZ8A 3S7KB 1AO5A 1C2KA 3I78A 1YPGH 2VIOA 1TPPA 2F3CE 1IQGA 1TOMH 2SGQE 4Y0YE 4ABAA 2DE9A 1OPHB 4X1PU 4AFUA 3P92A 2ODYB 5EW2H 2ZIQH 1HGTH 1V2MT 3A7VA 1TX6A 2Z94A 1BBRK 3F9GA 2RG3A 2STBE 1O3DA 4D7GA 1LPGB 3URDA 4ISOA 1A4WH 4ABJA 1VITF 5IYTA 3D49H 5JBCS 1ZYOA 3HPTB 3EA7A 2P8OC 1GBLA 1MKWK 4H6TA 2FTMA 4ZKRU 2UWPA 4TPIZ 1UTLM 3MNXA 2HLCA 4PROA 3MTYA 3RXRA 1K1IA 1H8DH 2V0BA 5E0HA 1EZSC 1Z8GA 1CA0B 3RXCA 1OYTH 1SHYA 2BX3A 3SNAA 2JETC 1VGCC 1VITH 4NA9H 1GI6A 1NRRH 2FTLE 3EA8A 1GMCG 1K1MA 1D6WA 1UVSH 1GDUA 2WV5A 2GT7A 3SO3A 1Y3YA 1NU7B 3FP8E 3JZ2B 3UNQA 1XUJA 4GHTA 4K69A 3ESTA 5FCRA 2C8XB 3KQBA 1VCQA 5HGGA 2CGAA 5A0AE 1IAUA 1O2RA 3V12A 2AGEX 2FOBA 5EGMA 1J9CH 4GAWA 1KLJH 1DUAA 2ZHWH 1VZQH 5F03A 3K6YA 3OSYA 5EQSA 1IQFA 5HM2A 2R0LA 2FYRA 3QLPH 1C5NH 1T32A 3CS7A 1ZSKA 4B2BA 4UD9H 1ANDA 3Q3YA 5FPSA 1ZPCA 3DD2H 1ZRKA 2NU2E 7KMEH 4WMEA 2Y7XA 1VJ9U 4MQAA 3H7OA 2Y7ZA 1CGIE 3T27A 4Q2KA 4ZAEA 5JYIA 1K1OA 1QL8A 1YPKH 3BTKE 1IHSH 3PYHA 2OUAA 3NK8A 1IQIA 1O2OA 1UVUH 5A8YA 3BF6H 3GDUA 3E6PH 3UOUA 4NFEA 1D3DB 1TX7A 4YTAA 2O8UA 5A09A 5GJ4B 1UTMA 3PWBA 2GZ7A 1SLXB 1KYNA 3PB1E 2FM2A 2F9BH 2W26A 1O0DH 1MH0A 4KTSA 4Q7YA 3CENA 4AFZA 1NC6A 4ZHMU 1MTUA 2WPJS 4K1EA 4I31A 1ANBA 4YLUA 1MZDA 3ZZ5A 1NFXA 4DVAU 3VB7A 5ABWA 1O3FA 1C2HA 2ZGCA 3OYPA 1S5SA 3AW1A 4ISHH 4LK4A 5GXPA 4IW4E 1UK3A 1GJBB 2BM2A 2HWLB 4R8TB 5E2PA 1SMFE 3ODFA 4X8TH 3F68H 1WQSA 4CHAC 1BTWA 1EPTA 2AMPA 5AHGH 3EAJA 1O3PB 1T7CA 2PKSB 1MMJN 2ZFFH 2ANWA 1FXYA 1CBWC 2G5NA 1GMHG 4RKJB 3OY6U 3E0NB 4X2XA 2BX4A 1TA6A 1DSTA 3ZV8A 1O3NA 4AFSA 3SV8A 1TRNA 4UFGH 1TGNA 2P3UB 1SGTA 3HGPA 2RA0A 2FLRH 3QUMP 3MO6A 3UREA 1DXPA 1OP0A 2J34A 3AW0A 3ZVGA 5JBBS 2BDYA 3GCTF 1GI4A 3RLYH 2BDCA 2FZZA 5DP7A 3SJOA 4NCYA 1QJ1B 1SGPE 1C5UA 2AH4X 4XOJA 3UY9A 1YCPH 3ZZ7A 3LC3A 1TPAE 2ULLA 2G4UA 1RJXB 1BBRE 5DK1A 2GCHF 1MTVA 1HV7A 1UCYK 2C3SA 4TY7A 3RXEA 4UEHH 4A1VA 1GBJA 4IGDA 1BB0B 5EXNA 1G36A 1XUIA 3LPRA 1GBAA 5GCHF 5L6NH 1H9IE 5CHAC 3TVJB 2TIOA 3ZYEA 3OX7U 5C5NA 4ABFA 2CHAC 2BHGA 3LGIA 4DY7B 2JH5D 2F9OA 3OY5U 4ZKNU 2STAE 4DGJA 1DT2A 2GT8A 4IC5A 4INLA 1EB2A 1O35A 1ZHMA 2C8ZB 2ZU5A 1HAXB 2VGCC 3VGCC 1E36B 1WUNH 1IQKA 1U6QA 1MUEB 4I8JA 2F9UA 1AE8H 5L2ZH 2VIWA 1EPTC 1NY22 1O3OA 4Y76A 1ETTH 2G55A 5C3NA 2WYJA 3ZZAA 1IQJA 1H9LB 1C2LA 3ZVAA 3TGKE 2FESH 1BMMH 3SQEE 3BSQA 1LHFH 1TONA 1CHGA 1D3QB 3Q00A 1GBDA 4TYDA 1G3DA 2FOFA 3RMOH 1QRXA 3IWMA 1M9UA 1HAPH 2PUXB 3LT3A 3SU6A 1V2NT 3P6ZB 4F4OC 1MCTA 3KNXA 1CGHA 4HI3A 2P94A 2YNAA 3TJNA 1CSOE 4B71A 4AGKA 2ZNKH 2GMTB 3QWCH 1FZZA 1O3JA 1P3CA 3RDZA 1OWDA 1THRH 3UWJH 3GY3A 1JBUH 1TNKA 1WCZA 3RXMA 4ZKOU 1EZUC 3AVZA 1DVAH 1EOJA 1TAWA 8KME2 1MU8B 4ABIA 3RXGA 1A1RA 1BCUH 1C5VA 1ZRBA 1FIZA 1N1LA 2XTTB 1N8OC 1HJAC 3KGPA 1BTYA 3A85A 2ZZUH 2ANMH 5DO4H 3TLOA 2WPHS 2GDEH 1AB9C 1GVLA 4JYTA 1AWFH 4I32A 1P12E 1LMWB 2HRVA 4YESB 4Z0KA 3S9BA 1BTZA 6CHAB 3RXOA 1C1TA 1C2GA 1ANCA 3I77A 4VGCC 1QBVH 1WOFA 2W7UA 5DP4A 2ZCHP 1O2NA 3TK9A 4HFPB 2SNVA 3SHCH 3ZV9A 5HXFA 1BIOA 1DLEA 4X2WA 4MNVA 1HIAA 1SHHB 2FOCA 2BLOA 1YKTA 7GCHG 3SGAE 4Y79A 2P3TB 4A1TA 1Z8JB 2FDAA 1C4U2 1H4WA 3C1KA 4DCDA 5TCCA 4BANB 1GI2A 2TGPZ 2IOTA 2LNCA 1C1NA 1Z1IA 3K6ZA 1P06A 2J4IA 1YYY1 3A7YA 4BXSA 1O3CA 4MPVA 3HGNA 1BTUA 2OD3B 1GI1A 1CO7E 1XVMA 1SGFG 1AUJA 5C1UA 1XVOA 2BD3A 1O3KA 2QC2A 3GY5A 3DT0H 4Y0ZE 1E38B 2A7HA 2J9NA 1GI9B 1LVBA 1JMOH 3SHAH 1QFKH 2OC0A 1OWJA 4CRCA 1LPZB 3MFJA 1UCYE 2B7DH 2WPKS 3T26A 1GBIA 2EC9H 4MNYA 1ZR0A 1ID5H 2Y80A 2OQUA 1LHCH 3K2UA 3Q3KA 1TABE 1YP9A 2A0QB 2HOBA 2D1JA 2W3IA 3KQDA 4H42U 2ZGHA 2G00A 1EZQA 1QB9A 3O8DA 3BTHE 2Y81A 2AGGX 1B0EA 2ZU3A 3A88A 1SBWA 1TFXA 1G3CA 1QGFA 1O34A 1A2CH 1GWAA 2Y5GA 1O38A 1O3GA 1O32A 1HXFH 1KTTB 1DY8A 2QIQA 2VIQA 5DPAA 1OKXA 1LCYA 4HGCA 2B9LA 2GCTC 1UHBB 1RIWC 2ZFQH 1Y5UT 3UWIA 4CH2B 2QF3A 1LPKB 3SW2B 2BQWB 1A5HA 1P2JA 1C2MA 1ELBA 1BOQA 2ODPA 1W0ZU 1DDJA 4I8GA 1MTNC 1QQ4A 5I46H 1A7SA 3FANA 2Y6TA 3UOPA 1EASA 4AFQA 2THFB 3QTVH 5E0GA 3SU4A 2VVUA 1V2KT 1GBCA 1PPZA 4ABBA 4Q7XA 3RXJA 1SQTA 3E8LA 1BQYA 1YLCA 3U69H 1Y59T 1P09A 3SGBE 1PPGE 2ZQ2A 1ESTA 1L2EA 3SJIA 4DIHH 3UQVA 1ZMLA 5EW1H 1TQ7B 1P2QA 1HNEE 1WSSH 2W5EA 2XWBI 4FUFA 6ESTA 1A3EH 9ESTA 2M5TA 1BTPA 4BAQB 8GCHF 4B76A 2QXJA 2JH0D 1UTPA 3TH2H 4THNH 1G9IE 1Q31A 3BTGE 3RUOA 1AQ7A 2HGTH 3LH3A 1FNIA 1GG6C 3PMJA 3PROA 3QZQA 1IQNA 1MKXH 4AGJA 1FY8E 3E3TA 3A8CA 1EB1H 1C5OH 1QR3E 3ZVBA 1TALA 4D76A 1S6HA 1O2LA 2BVSH 3SNBA 2FS9A 1RTFB 1DFPA 1GJ5H 1LO6A 4NSVA 1F0SA 2AERH 3TIUA 3V7TA 3MH7A 2C8WB 4NIXA 5FAHA 1P8VC 1ELDE 2O8MA 3ATMA 4H4FA 2BVXH 2O9QA 3VB5A 1D9IA 2FP7B 1P57B 2XW9A 1F7ZA 1NU9A 3M5NA 2FX4A 1AD8H 2JKHA 2AFQB 1ELVA 1J17T 3UNRA 1SOZA 3FAOA 4U32A 4INKA 4CR9A 3E16B 2QGRA 1SFQB 3OU0A 1GGDB 3PTNA 1BA8B 3BTWE 1F5RA 1FY4A 4DG4A 2GV6A 1TMBH 3D62A 2BB4A 4AORA 1HYLA 1O5FH 1N6XA 3TJVA 1GCTC 5ESTE 1IHTH 3KHVA 1YPHE 4Y8YA 2BDGA 2ZF0H 1DANH 4AN7A 4FUHA 4NWKA 4OGYA 1L1NA 3PLKA 2FOEA 2VJ1A 1XMNB 2BZAA 4LXBH 4WXVA 2A45B 3SGQE 1O2XA 2BY7X 2GX4A 5DJ7A 4MTBA 1HAIH 1GMCF 3TNSA 1CA0C 5DP3A 1V2PT 1O3BA 4TPYA 5HYOA 3BTQE 5A8ZA 2ZDNA 1P2NA 4CRGA 2ZDKA 3O8BA 1Z7KA 4YLQH 1S85A 1EP6A 3PTBA 1QCPA 1Z6EA 1GHZA 1BJVA 1KXBA 1ZTJA 1W7GH 2V35A 2G4TA 1NT1A 1YPHC 4BTUB 1UK2A 3U98H 1CT0E 4BAKB 2RCEA 4K60A 2J2UA 3RLWH 2H1UA 2F9NA 3MNCA 3HKJB 3ODDA 3U8RH 1XUKA 2VWNA 3MI4A 1TOCB 4LOYH 1J16A 4O97A 1C5XB 1IOEA 2BD7A 3RMNH 3GCOA 3A84A 4NG9H 3A82A 3BG4C 3FP7E 2ZGBH 2IN2A 4U01A 2P59A 3PV4A 2D8WA 2BD4A 4WJG2 1YPMH 1UTKA 4CRBA 4FU7A 4U2WA 6GCHG 1GBEA 1Z1JA 5L30H 5JB8S 1B0FA 3M3SA 1W14U 3QTOH 1TA2A 1V3XA 3GCHC 3SNCA 1BBRH 1O2GH 3V13A 2PHBA 1BMLA 1RFNA 1WTHD 2ZU1A 3AAVA 4ABHA 1KTSB 3ELAH 2ZCLP 1C2JA 1EJNA 1GBMA 5LPFA 2OC8A 3EA9A 2QAAA 2CN0H 3LH1A 3LJJA 1MKWH 2P3FH 3QK1A 3MU1A 1T8MA 5EG4A 3HK6B 5E0JA 3RP2A 1GI5A 4M7GA 1NPMA 1V2WT 3RXUA 1O3EA 4X2VA 4XE4A 1GBTA 5FHTA 2A4OA 2AEIH 3VB6A 3ZYDA 1GBBA 1FY3A 1C5LH 1EQ9A 2R0KA 1JRTA 3BV9B 4UFFH 3SOSA 1GPZA 2XC4A 2ZGXH 4FUBA 2FPZA 2A7CA 1E34B 2BOKA 1A61H 2P8OB 2PTCE 4BTIB 1HCGA 2RA3A 2C8YB 4GUXA 3LIWA 2VIVA 1BMAA 2WYGA 2Y5FA 1HLTH 4I33A 1F0UA 2VU8E 1P2IA 1GL1A 1T31A 2W3KA 3BTME 2XBXA 3HKIB 4FUCA 2ZP0H 5FBIA 1FUJA 1IQMA 1VITG 4U30A 1Y5AT 2TRMA 2OC7A 3NZIA 5A2MH 1ELAA 4DJZB 1VGCB 1BDAA 3W95A 1KIGH 4AG1A 1P05A 1QBOA 4YOJA 1GHAG 3SBKA 4NIVA 3ENSB 4TWYA 4YOIA 1SC8U 1H8IH 4BXWA 1FAXA 2OC1A 2PR3A 2QF0A 3TGIE 1X7AC 1DITH 1GHYH 3QZRA 3TH3H 2H9HA 3GY7A 4IBLH 4UE7H 1P11E 2ZHEH 1IQLA 1CVWH 4RSPA 4Y8XA 4ESTE 1V6DA 1O2VA 1TNJA 4WH6A 3LC5A 4NZLA 4AX9H 1ETSH 2BOHB 3P95A 1K1JA 1C4Y2 2F91A 2OTVA 1O2PA 1HAVB 3Q77A 4TY6A 2AIPA 2Q1JA 4BNRA 2GP9B 5J4QA 3QO6A 3A89A 1CU1A 1W11U 1WBGB 1MQ6A 1B7XB 2R2WU 3A7TA 1YLDA 2FEQH 4MNXA 4NFFA 4NA7A 2Z9GA 1L1GA 4JZ1A 2GKVE 1ZHRA 1CGJE 5EOKA 4X2YA 3BTDE 5GDSH 4IN2A 5F8ZA 3RXLA 2TPIZ 3FP6E 1LQDB 1SGYE 2YOLA 3P8OA 1GMDG 3PWCA 2B0FA 1TNGA 3A8DA 1AY6H 3KQEA 1IQEA 4OS2A 4K5ZA 2ZDMA 4JYVH 1O33A 4O03A 1FN8A 1ELFA 4X8UH 2ZDVH 3A81A 1TGSZ 1GDQA 1KLTA 9LPRA 2ZDAH 3A87A 1OXGA 4GHQA 4NGAH 1ELEE 1O5GH 2ASUB 1YPJH 2FLBH 1O39A 3WY8A 1AHTH 1K1PA 1V2VT 4CHAB 2F9VA 1QB6A 1NRPH 1W13U 1TBRH 3PM3A 4QT8C 2TGTA 1O5DH 3D65E 2F83A 5EXLA 2QXIA 1CBWB 3SU3A 4JCNA 1D3PB 1Q3XA 1HAHH 3GOVB 5DP5A 1TQ0B 3B8JA 1AMHA 4FXGH 3DFJA 4E7RG 2O8TA 3M36A 1P02A 3UFAA 5C20A 3HK3B 3GY8A 4ZHAA 1UCYH 3T2NA 2OXSA 3LKWA 4YOGA 1SR5C 3M5LA 3VB3A 5LGOA 4AOQA 2NU1E 3MO3A 1AE5A 3U8TH 3U1IB 2J94A 3SJKA 1PFXC 1L4ZA 2A5AA 3M7UA 4FUGA 2VVCA 3UUZA 3S0NA 4I8HA 4B75A 1GCDA 3H5CB 1FV9A 4F49A 3GCTG 2NU4E 1AVXA 1TBQH 5I25A 4K8BA 2FS8A 4CRAA 1XXDA 2A5KA 4AYYB 5T6FA 1CA8B 1D6RA 4JK6A 4MG3A 1MZAA 3SNDA 1GL0E 4A5TS 3VXFH 1S81A 1G32B 1UHBA 1FJSA 5EPYA 1AI8H 3MH6A 1S83A 1BRCE 4WY3A 1J8AA 2SGAA 3VFEA 2BYAX 5T6GA 4JZFH 2ZFPH 4FUEA 2HPQH 4NIWA 1RGQA 2AMQA 1FAKH 3RC4A 1HFDA 3PO1C 2PUQH 1AFEH 3E90B 2XBWA 3BTEE 2G81E 2WUCA 5CMXH 1WQVH 1QJ7B 2PW8H 3TNTA 1EAUA 2FWWA 4HTCH 3VGCB 2SGPE 5LH8A 1WYKA 3VB4A 4CRDA 4ABEA 1QJ6B 1Z8IB 1QL9A 3NXPA 4ISLA 1MQ5A 1O2KA 3UR6A 2ILNA 4A1XA 2ZO3H 1GBFA 5HM9A 4Y6DA 1XKBC 3MWIU 1C5TA 2ZTZA 1F0TA 1KY9A 1C1PA 1AFQC 2Z6BD 2H5DA 2VWLA 2BDHA 1MTWA 2XC0A 3FFGA 2BXTH 2WUBA 1ZJDA 1K1NA 1O2JA 1EAWA 1TNLA 1A0LA 1G3BA 1AVGH 1W8BH 1GJ7B 3TJUA 1K9OE 1QRZA 1ANEA 1NS3A 1MCVA 4AB9A 2NWNA 4KTUA 2I6SA 2Z9IA 3BTTE 4YT6H 1OWIA 1P2KA 3MU8A 2CF9H 1A3BH 2KAIB 3VXEH 1T4UH 4ISIH 3SU5A 1WTGH 2A5IA 4LZ4B 1MTSA 1SI5H 3F9EA 1Y8TA 5DG6A 2A4GA 2C90B 2HPPH 4ZROA 2A2XH 2DUCA 3U1JB 3RXFA 3QGJA 2PTNA 1GI7B 5DP8A 1SLUB 4K8YA 5ETXA 5GWZA 4O9VA 2UUFB 1A0JA 1TLDA 1HPGA 2HNTC 3RXBA 1C9PA 1SQOA 1HJAB 1V2TT 1G2LA 2R3YA 3M3VA 1LHDH 3MH5A 3BIUH 3SUFA 1AB9B 2P16A 2J95A 1GHBF 3PMBB 4J1YA 3UPEA 1XUHA 3MU4A 4Y71A 2R3UA 1O3IA 1XUGA 2WPLS 2SFAA 3MH4A 4VGCB 4DURA 1AVWA 1C5YB 1C1WH 3CP7A 2IPHA 1MBQA 1LHEH 1RTKA 2CXVA 3QGNB 4CRFA 3M5MA 1DPOA 1F0RA 3I29A 1PPBH 5IDKA 2R2MB 2QA9E 3T25A 2AYWA 1EAIA 1O31A 1O3HA 2WPMS 1FN6A 3TK5A 1C2IA 3E0PB 3B9FH 3T62A 1O30A 1O2UA 1F2SE 2FIRH 1JIRA 3NCLA 3LDXH 1QRWA 1TGBA 4FUIA 5EXMA 1CT4E 2FODA 5H4IB 5BRRE 1P03A 1TMUH 5B6OA 1D3TB 1QBNA 1KSNA 1O2WA 2PGBB 1UVTH 3M61U 1SGCA 1BRAA 2QV1A 5AF9H 1FY5A 1G2MA 1QA7A 2IJOB 2ZHFH 2ESTE 2ZTYA 2HALA 3T28A 2UUYA 2BQ6B 2PKAB 2BY9X 3MNBA 2XCNA 1BTXA 4BOHA 1ZPBA 1OP2A 3TITA 2FOAA 3TPIZ 1LQEA 1XUFA 1HBTH 3VPKA 1L4DA 2ZDLA 4Q7ZA 5TCAA 3JZ1B 3O8RA 4RKOB 3VEQB 1GJDB 2XWAA 3RXPA 1D4PB 1N6YA 5DKMA 4D8NA 1S0QA 1O5CB 3SZNA 4KTCA 1SGRE 3G01A 2A4QA 5FPYA 1EOLA 1GVZA 2FOMB 3P8GA 1OYQA 1MKXK 2TGDA 3E1XB 1CT2E 1FY1A 1BZXE 1GVKB 3SORA 1FQ3A 1GJAB 2ZTXA 3ZZCA 3NUMA 2BD8A 3S69A 4YZUA 3SJ9A 1BJUA 1A5GH 1SVPA 2ZPRA 1EJMA 4X8SH 2G5VA 5JDUB 1NN6A 1LVOA 3KL6A 1E37B 1AU8A 4XBDA 1MD8A 2ZG0H 2OBQA 2OINA 4X6PA 1TRYA 1THSH 1RIWB 3KN2A 3A7XA 1DS2E 1GJ6A 1O3AA 1V2JT 1A46H 1B5GH 3RU4E 1ZTKA 3LONA 1VJAU 2EI6A 5AFZH 2ODQA 1HIAB 5HMAA 3MU5A 4XBCA 3N7OA 1T8OA 1PPFE 4CH8B 3RM2H 1GHVH 1QIXB 3CS0A 2A31A 2QYIA 2FXRA 3NPSA 4OS6A 3Q3XA 2K1QA 1J14A 4IS5A 1TYNA 2A4RA 1RD3B 2Z9KA 2BY8X 2PLXA 1SGEE 4K2YA 2AMDA 3KCGH 1FMGA 1C2DA 1PPCE 2FO9A 4A7IB 2ZHQH 1HXEH 1JOUB 2G52A 3FZDA 4YO9A 1T4VH 3BTFE 3SUGA 5L2YH 3SV7A 2PSYA 1SGQE 2WPIS 3LGVA 3AAUA 1AIXH 1O2IA 1ZTLA 2CV3A 2P95A 4WMDA 4UDWH 1SGDE 3AASA 1DWDH 2ZFTA 2VWMA 1P0SH 3H7TA 3K9XB 3RXQA 2ZWLH 1YPLH 1JRSA 3M35A 4B73A 4DOQA 3SNEA 1C1RA 1VCWA 1YGCH 4WWYA 5A0BA 1DXWA 4A6LA 8GCHG 1P10A 4GCHG 6GCHF 1AN1E 2DE8A 3PLPA 5EPNA 1ZGIA 1C1OA 2G8TA 1THPB 1TB6H 3ATLA 1H9HE 2B5TB 3GY2A 4SGAE 3EGKH 4IC6A 2ALVA 1LHGH 2A2QH 3A8AA 4X8VH 2UUKB 2CJIA 3PMAB 3S9AA 1DSUA 3BEUA 3F9HA 3GISB 4MPXA 3LJOA 1O2YA 5FX6A 2P93A 1CHOG 3ATIA 3RU4D 3GICB 2GVFA 5ESBA 3RXVA 2VH6A 1GJ4H 1C5MD 2NU3E 4B74A 1SGIB 1HAVA 2OBOA 1ZSJA 3RM0H 4KKDA 3T5FH 5BPEA 5JBTA 3LGWA 6LPRA 4FVBA 1W3CA 2FX6A 3RXTA 3O8CA 1RTLA 1GCTB 2FI3E 1AWHB 5GPIB 3L3TA 3A7WA 1OWEA 4BAHB 2EI8A 3MNSA 1OWHA 2WV4A 2BDBA 1VR1H 3ZZ4A 3P8NA 4D7FA 1LTOA 3DHKH 2VH0A 4ZXYH 4AB8A 4ZHLU 3ZVCA 3ZZDA 2Z9JA 5EU8A 1DWCH 3T29A 1F5LA 1ZZZA 1C5WB 1K2I1 2NU0E 2TGAA 1P3EA 1WAYB 3R0FA 3SI4H 1AUTC 2G51A 3EQ0H 1KXCA 1HAYB 1VCPA 3SU0A 3U9AH 1GHAF 1DWBH 3SU2A 2C93B 2UWLA 1KLIH 1TGTA
chains in the Genus database with same CATH superfamily
1ABIH 1DE7H 4JZDH 1Z6JH 1PQ8A 1EXFA 4I7YH 1SQAA 1F92A 1O2MA 1S0RA 2JH6D 4GLYA 1F5KU 4Y7AA 1OSSA 1DY9A 1DLKB 1TGCA 3F0PA 1KXEA 3QN7A 4BTTB 2Z3EA 4XD7D 1BT7A 1YY3A 1IQHA 2V7QD 1E0FD 1XX9A 3A83A 1E1RD 1XM1A 5DP9A 1TE0A 2GD4B 3TJOA 3WWFA 5A0CA 1W12U 4NWLA 2ALPA 1K21H 4X0WU 3D23A 1GMHF 1UMAH 2XYAA 1YM0A 3DUXH 4JMYA 2FOHA 4INHA 2PKSC 1G3EA 3BG4B 3ZZ6A 4O3TA 1AZZA 3QDZB 5C17A 4O3UA 1G30B 3ZZ8A 4AG2A 1FLEE 2RDLA 3DSGA 1QB1A 1ORFA 1Y3WA 2Q6FA 1ACBE 1EX3A 2JETB 4K1SA 2ANKH 4Z6AH 1EKBB 1GI3A 4JZIA 1NO9H 3GCNA 1NFYA 4R0IA 3ITIA 1LKBA 1ARCA 3GCHB 2LPRA 1GMDF 1P9UA 2ZHDA 4X1RU 3MOCA 4Q4LA 1KDQB 4KELA 1O37A 1O2TA 3ZZ3A 1SGNE 4RN6A 1GJ9B 5DP6A 5FBEA 2H9TH 1WU1A 1BMNH 2VB0A 3RXKA 1AKSB 3W94A 4XDEA 3EYDA 4ASHA 2FI4E 3IITA 4E05H 5EODA 1XXFA 4CBOA 2SGEE 3RXDA 1UJ1A 2VVVA 1K1LA 1P04A 2V3HH 4I8LA 1BUIA 3SQHE 2H9EH 1Z8RA 1TX8A 2HNTF 2FI5E 1RS0A 2GDDA 2OQ5A 2SGDE 1PQ5A 3STIA 3SN8A 3PMHB 1PPHE 2BQ7B 1P01A 5EQRA 1JIMA 1FDPA 5AVDA 1FPHH 1PPEE 4ZXXH 1RXPA 5LPRA 1YCPK 3MO9A 4JZEH 4B1TA 1ZSLA 1NROH 2BLWA 3M7TA 2RDEA 1SSXA 3RC6A 1K28D 4H6SB 1FI8A 3DFLA 3P8FA 2OLGA 4LZ1H 1GDNA 1PYTC 4JYUH 1T8NA 2EI7A 1V2UT 4B2CA 4Y11E 1YBWA 4UFDH 2HVXA 2BMGB 2BD5A 2BY5X 3UR9A 4WF8A 2ANYA 2EY4C 4MVNA 4OM9A 3ATWA 1FX0B 5AFYH 3UNSA 2QCYA 4WH8A 1C1MA 1SG8B 1C5ZB 4Y10E 2PSXA 1ARBA 1P9SA 2BXUH 2UWOA 5SGAE 2O8WA 1C9TA 2KAIA 1Y3UA 2PV9B 4Y7BA 3KQCA 3DA9B 1OP8A 1UVPA 3B23B 4Y8ZA 5TJXA 1MBMA 2W7SA 3L6PA 2EEKA 3PRBA 1VKYA 1ELTA 1OWKA 1TIOA 2OP9A 3ZVDA 1JWTA 4CR5A 2GZ9A 3LGYA 1SB1H 3UIRA 3SI3H 2QN5T 5FCKA 3FVFB 5E8EH 1PYTD 2GMTC 4UONA 3TGJE 1EJAA 1TBZH 4MNWA 4OS7A 1C5RA 3UB0A 1S84A 2EA3A 1ZMJA 4Q80A 4I8KA 1O5EH 4IN1A 1NTPA 4WMFA 2XBYA 2ZFSA 3PLBA 4WXIA 5EJZA 3DSOA 3KQ5A 4GPGA 4MDSA 1BHXF 2BLQA 4A92A 5F8TA 1NRSH 1W2KH 1JXPA 2K8IA 5T1VA 5PTPA 1TMTH 1DWEH 1HAZB 3BN9A 3F9FA 1KXAA 4ZKSU 3ZZBA 1W7XH 2XCFA 3ZZ9A 3L33A 4MLFB 4AZ2B 2BLVA 2I6QA 3WWBA 4DW2U 1E79D 1O2SA 2B8OH 3P17H 1KXDA 4ABDA 3A7ZA 2QY0B 1GHXH 6CHAC 3SU1A 3NRLA 2ZI2H 2GZ8A 1G37A 2XBVA 7GCHF 5CHAB 1NRQH 3M7QA 1GI8B 1H8HD 1FIWA 1E35B 5JPMH 2CHAB 5FXLA 2GCHG 3W1EA 4X1QU 4ZMAH 1L1JA 2VINA 4E06H 1FONA 1LVMA 5GCHG 1T8LA 3F0OA 1ESBA 1GJ8B 1K22H 4X6NA 1C1QA 1KXFA 1ZHPA 2PKAA 4X6OA 2ZC9H 2VGCB 2GTBA 1YC0A 2PGQB 1C2FA 1PQAA 3ZVFA 1AGJA 1MU6B 3R3GB 2XC5A 3M5OA 5C67A 2BD9A 3RMLH 1TNHA 4NA8A 3RXSA 1EPTB 5JBAS 1NFUA 2BD2A 1PQ7A 2WINI 2V6NA 2CF8H 1GJCB 2GGVB 1CQQA 4XSKU 1A0HB 1C1VH 1Y5BT 1HJ8A 2H6MA 3GY6A 2FYQA 1Q2WA 2HNTE 1S6FA 1SLWB 1SPJA 1ZPZA 1SLVB 3A8BA 2Z3CA 3RC5A 1Y3VA 1QY6A 2D26C 4MPUA 4HG6A 5FPTA 3ZVEA 2XRCA 3P70B 2J38A 2YNBA 4MPWA 2ZA5A 1QHRB 3EDXB 1NESE 5LPEA 3KEEA 1O2ZA 1UVOA 2CMYA 2QXHA 4D9QA 1ZJKA 4WVPE 5G4BA 4OS1A 1QL7A 1TRMA 3MMGA 1EP5A 3SUEA 1DX5M 2R9PA 4OGXA 1SL3A 3PO1B 1UTNA 4I86A 1ETRH 3LU9B 4E7NA 4SGBE 1A5IA 1GBHA 3F1SB 1ZOMA 3RXIA 4B2AA 2OCVB 4JK5A 5DN6D 8LPRA 1ZGVA 1EUFA 1OOKB 5FX5A 3A80A 4FUJA 1LKAA 1V2ST 4FUDA 1HAGE 3TH4H 4RT1A 1N8OB 2Z7FE 2Y5HA 3Q76A 1HAOH 1SOTA 1HDTH 1WV7H 3GDSA 4K1TA 1C5QA 3E91A 3NWUA 2C4FH 1O2HA 4AC9A 2BY6X 3SV9A 1EZXC 3BIVH 2SNWA 3N99A 1AFQB 3GY4A 2ZECA 2HLDD 3F6UH 3U8OH 4YT7H 1YPEH 2SGFE 1C1UH 4K3JA 4ZUHA 2BTCE 2BVRH 4GSOA 1BRUP 3LGTA 1LVYA 3BEFB 3UQOA 4CREA 4AYVB 4XFQA 1UO6A 3UTUH 3M3TA 5K0HA 1ELCA 2TBSA 3HATH 1NBME 1ABJH 2UUJB 3OTJE 1HRTH 1BTHH 1OX1A 2O8LA 5EQQA 5GIBA 1L0ZA 1J15A 2AS9A 2F9PA 3LGUA 5F6MA 3BEIB 4FVDA 3LOXA 1C1SA 1UTQA 2V3OH 1S82A 4KGAA 4F48B 1HUTH 4DT7B 4KP0A 4ZH8A 4BAOB 3GYMA 3MHWU 3SV6A 2A32A 2VIPA 1QURH 2ZEBA 2Q6DA 3KIDU 2A7JA 5CE1A 1INCA 1PJPA 1HB0B 1SGFA 2ZU4A 3ZIAD 1FPCH 1ZLRA 4X1NU 2ZCKP 4J2YB 1P2OA 5F8XA 2VWOA 1HJ9A 2Q6GA 1UK4A 3RXAA 3V0XA 3RU4T 1ESAA 2ZPSA 3C27B 1C4V2 2AGIX 1Y3XA 2J92A 1GI0A 3MYWA 1RRKA 1ELGA 4FU8A 4IMQA 1DM4B 2A1DB 4OS5A 5DGJA 1BMFD 3KF2A 1UTOA 1CE5A 1GHWH 3GYLB 5T3HA 1QNJA 1W0YH 4GVUA 1GHBG 1O36A 3TU7H 1C5PA 2IPQX 1QQUA 2BZ6H 1V2QT 2XNIA 1W0JD 4ABGA 3IG6B 4Z1MD 2J98B 1H1BA 4ISNA 2BDAA 4X1SU 1GGDC 2GCTB 4D9RA 1V2LT 1Z71A 2LP6A 1LDTT 3V3MA 1BITA 2FOGA 1ZMNA 2H2ZA 3A86A 3UAIC 3OE7D 1SKYE 3SV2H 7LPRA 2FMJA 2PFEA 4GCHF 4NIYA 3SZEA 2D2DA 2GV7A 5C1YA 2XXLA 4P02A 3EE0B 3SUDA 3DSPA 1MAYA 1NBMD 2ZQ1A 1MTNB 4OS4A 1NZQH 5JB9S 4TWWA 5DSFA 1C5SA 1QTFA 7ESTE 3STJA 2BDIA 1YF4A 1DOJA 5T6DA 4CBNA 1C2EA 1DICA 2ZU2A 1NFWA 1W0KD 3QX5H 1QA0A 3BG8A 1XKAC 4X6MA 4BAMB 4YXWD 1BHXB 5E2OA 1CHOF 4XBBA 1O3MA 4YM9A 2KX4A 4NSYA 1WDIA 2ZFRH 3NKKA 2KCPA 1V2OT 2Y82A 1EATA 4NZQA 3RXHA 2Z9LA 3S7HB 3M37A 1NRNH 5C5OA 1O5AB 4UFEH 3SJ8A 3MU0A 4HZHA 2WSSD 2ZPQA 3GDVA 1SFIA 2VIDA 1O3LA 1TWXB 4FU9A 3RMMH 1GG6B 3FZZA 2AIQA 2IJD1 4DIIH 3K65B 1EAXA 5K7RA 2ZKSA 1TPSA 1MAXA 1O2QA 3PV5A 3TK6A 2PWXA 5A8XA 4IMZA 2ZGJA 1O5BB 1KDQA 1EFRD 1BRBE 3URCA 5J4SA 1YCPM 1MD7A 3S9CA 2QXGA 1GBKA 1DUEA 5C1XA 1AKSA 1TPOA 2VNTA 3ATKA 1UTJA 1W10U 2Z3DA 1P2MA 3H09A 1NM6A 2LELA 1V2RT 2H5CA 1OS8A 8ESTE 1TNIA 5C2ZA 1AZ8A 3S7KB 1AO5A 1C2KA 3I78A 1YPGH 2VIOA 1TPPA 2F3CE 1IQGA 1TOMH 2SGQE 2V3MA 4Y0YE 4ABAA 2DE9A 1OPHB 4X1PU 4AFUA 3P92A 2ODYB 5EW2H 2ZIQH 1HGTH 1V2MT 3A7VA 1TX6A 2Z94A 1BBRK 3F9GA 2QE7D 5C94A 2WV9A 2F43B 2RG3A 2STBE 1O3DA 4D7GA 1LPGB 3URDA 4ISOA 1A4WH 4ABJA 1VITF 5IYTA 3D49H 5JBCS 1ZYOA 3HPTB 3EA7A 2KCOA 2P8OC 1GBLA 1MKWK 4H6TA 2FTMA 4ZKRU 2UWPA 4TPIZ 1UTLM 3MNXA 2HLCA 4PROA 3MTYA 3RXRA 1K1IA 1H8DH 2V0BA 5E0HA 1EZSC 1Z8GA 1CA0B 2XOKD 3RXCA 5KECA 1OYTH 1SHYA 2BX3A 3SNAA 2JETC 1VGCC 1VITH 4NA9H 1GI6A 1NRRH 2FTLE 3EA8A 1GMCG 1K1MA 2YMSC 1D6WA 1UVSH 1GDUA 2WV5A 2GT7A 3SO3A 1Y3YA 1NU7B 3FP8E 3JZ2B 3UNQA 2L74A 1XUJA 4GHTA 4K69A 3ESTA 5FCRA 2C8XB 3PRDA 3KQBA 1VCQA 5HGGA 2CGAA 5A0AE 1IAUA 1O2RA 3V12A 2AGEX 2FOBA 5EGMA 3KYFA 1J9CH 4GAWA 1KLJH 1DUAA 2ZHWH 1VZQH 5F03A 3K6YA 3OSYA 5EQSA 1IQFA 5HM2A 2R0LA 2FYRA 3QLPH 1C5NH 1T32A 3CS7A 1ZSKA 4B2BA 4UD9H 1ANDA 3Q3YA 5FPSA 1ZPCA 3DD2H 1ZRKA 2NU2E 7KMEH 4WMEA 2Y7XA 1VJ9U 4MQAA 2YMSD 2Y7ZA 1CGIE 3H7OA 3T27A 4Q2KA 4ZAEA 5JYIA 1K1OA 1QL8A 1YPKH 3BTKE 1IHSH 3PYHA 2OUAA 3NK8A 1IQIA 1O2OA 1UVUH 5A8YA 3BF6H 3GDUA 3E6PH 3UOUA 2KFWA 4NFEA 1D3DB 1TX7A 1E1QD 1QZ8A 4YTAA 2WZQA 2O8UA 5A09A 5GJ4B 1UTMA 3PWBA 2GZ7A 3F2HA 1SLXB 1KYNA 3PB1E 2FM2A 2F9BH 2W26A 1O0DH 1MH0A 4KTSA 4Q7YA 3CENA 4AFZA 1NC6A 4ZHMU 1MTUA 2WPJS 4K1EA 4I31A 1ANBA 4YLUA 1MZDA 3ZZ5A 1NFXA 4DVAU 3VB7A 5ABWA 1O3FA 1C2HA 2ZGCA 3OYPA 1S5SA 3AW1A 4ISHH 4LK4A 5GXPA 4IW4E 2J5UA 1UK3A 1GJBB 2BM2A 2HWLB 4R8TB 5E2PA 1SMFE 3ODFA 4X8TH 3F68H 1WQSA 4CHAC 1BTWA 1EPTA 2AMPA 5AHGH 3EAJA 1O3PB 1T7CA 2PKSB 3F2GA 1MMJN 2ZFFH 2ANWA 1FXYA 1CBWC 2G5NA 1GMHG 4RKJB 3OY6U 3E0NB 4X2XA 2BX4A 1TA6A 1DSTA 3ZV8A 5B6LA 1O3NA 4AFSA 3SV8A 1TRNA 4UFGH 1TGNA 2P3UB 1SGTA 3HGPA 2RA0A 2FLRH 3QUMP 3MO6A 3UREA 1DXPA 1OP0A 2J34A 3AW0A 3ZVGA 2KR7A 5JBBS 2BDYA 3GCTF 1GI4A 3RLYH 2BDCA 2FZZA 5DP7A 3SJOA 4NCYA 1QJ1B 1SGPE 1C5UA 2AH4X 4XOJA 3UY9A 1YCPH 3ZZ7A 3LC3A 1TPAE 2ULLA 2G4UA 1RJXB 1BBRE 5DK1A 2GCHF 1MTVA 1HV7A 1UCYK 2C3SA 4TY7A 3RXEA 4B6EA 4UEHH 4A1VA 1GBJA 4IGDA 1BB0B 5EXNA 1G36A 1XUIA 3LPRA 1GBAA 5GCHF 5L6NH 1H9IE 5CHAC 3TVJB 2TIOA 3ZYEA 1YWUA 3OX7U 3N7DA 5C5NA 4ABFA 2CHAC 2BHGA 3LGIA 4M9FA 4DY7B 2JH5D 2F9OA 3OY5U 4ZKNU 2STAE 4DGJA 1DT2A 2GT8A 4IC5A 4INLA 1EB2A 1O35A 1ZHMA 2C8ZB 2ZU5A 1HAXB 2VGCC 3VGCC 1E36B 2XNDD 1WUNH 1IQKA 1U6QA 1MUEB 4I8JA 2F9UA 1AE8H 5L2ZH 2VIWA 1EPTC 1NY22 1O3OA 4Y76A 1ETTH 2G55A 5C3NA 2WYJA 3ZZAA 1YLNA 1IQJA 1H9LB 1C2LA 3ZVAA 3TGKE 2FESH 1BMMH 3SQEE 3BSQA 1LHFH 1TONA 1CHGA 1D3QB 3Q00A 1GBDA 4TYDA 1G3DA 2FOFA 3RMOH 1QRXA 3IWMA 1M9UA 1HAPH 2PUXB 3LT3A 3SU6A 1V2NT 3P6ZB 4F4OC 1MCTA 3KNXA 1CGHA 4HI3A 2P94A 2YNAA 3TJNA 1CSOE 5GNDA 4B71A 4F55A 4AGKA 2ZNKH 2GMTB 3QWCH 1FZZA 1O3JA 1P3CA 3RDZA 1OWDA 1THRH 3UWJH 3GY3A 1JBUH 1TNKA 1K0HA 1WCZA 3RXMA 4ZKOU 1SQRA 1EZUC 3AVZA 1DVAH 1EOJA 1TAWA 8KME2 5F53A 5CHBA 1MU8B 4ABIA 3RXGA 1A1RA 1BCUH 1C5VA 1ZRBA 1FIZA 1N1LA 4Q63A 2XTTB 1N8OC 1HJAC 3KGPA 1BTYA 3A85A 2ZZUH 2ANMH 5DO4H 3TLOA 2WPHS 2GDEH 1AB9C 1GVLA 4JYTA 1AWFH 4I32A 1P12E 1LMWB 2HRVA 4YESB 4Z0KA 3S9BA 1BTZA 6CHAB 3RXOA 1C1TA 1C2GA 1ANCA 3I77A 4VGCC 2J98A 1QBVH 1WOFA 2W7UA 5DP4A 2ZCHP 1O2NA 3TK9A 4HFPB 2SNVA 3SHCH 3ZV9A 4ACAA 1MABB 1BIOA 5HXFA 1DLEA 4X2WA 2KZ4A 4MNVA 1HIAA 1SHHB 2FOCA 2BLOA 1YKTA 7GCHG 3SGAE 4Y79A 2P3TB 4A1TA 1Z8JB 2FDAA 1C4U2 1H4WA 3C1KA 4DCDA 2L6OA 5TCCA 2PP6A 4BANB 1GI2A 2TGPZ 2IOTA 2LNCA 1S6LA 1C1NA 1Z1IA 3K6ZA 1P06A 2J4IA 1YYY1 3A7YA 4BXSA 1O3CA 4MPVA 3HGNA 1BTUA 2OD3B 1GI1A 1CO7E 5EIYA 1XVMA 1SGFG 1AUJA 1UW7A 5C1UA 1XVOA 2BD3A 1O3KA 2QC2A 3GY5A 3DT0H 4Y0ZE 1E38B 2A7HA 2J9NA 1GI9B 1LVBA 1JMOH 3SHAH 1QFKH 2OC0A 1OWJA 4CRCA 1LPZB 3MFJA 1UCYE 2B7DH 2WPKS 3T26A 1GBIA 2EC9H 4MNYA 1ZR0A 1ID5H 2Y80A 2OQUA 1LHCH 3K2UA 3Q3KA 1TABE 1YP9A 2A0QB 2HOBA 2D1JA 2W3IA 3KQDA 4H42U 2ZGHA 2G00A 1EZQA 1QB9A 3O8DA 3BTHE 2Y81A 2AGGX 1B0EA 2ZU3A 3A88A 1SBWA 1TFXA 1G3CA 1QGFA 1O34A 1A2CH 1GWAA 2Y5GA 2HVYB 1O38A 1O3GA 1O32A 1HXFH 1KTTB 1DY8A 2QIQA 2VIQA 5DPAA 3EE7A 1OKXA 1LCYA 4HGCA 3WW7A 2B9LA 2GCTC 1UHBB 1RIWC 2ZFQH 1Y5UT 3UWIA 4CH2B 2QF3A 1LPKB 3SW2B 2BQWB 1A5HA 1P2JA 1C2MA 1ELBA 1BOQA 2ODPA 1W0ZU 1DDJA 4I8GA 1MTNC 1QQ4A 5I46H 1A7SA 3FANA 2Y6TA 3UOPA 1EASA 4AFQA 2THFB 3QTVH 5E0GA 3SU4A 4RI0A 2VVUA 1V2KT 1GBCA 1PPZA 4ABBA 4Q7XA 3RXJA 1SQTA 3E8LA 1BQYA 1YLCA 3U69H 1Y59T 1P09A 3SGBE 1PPGE 2ZQ2A 1ESTA 3VG8A 1L2EA 3SJIA 4DIHH 3UQVA 1ZMLA 5EW1H 1TQ7B 1P2QA 1HNEE 1WSSH 2W5EA 2XWBI 4FUFA 6ESTA 1A3EH 9ESTA 2M5TA 1BTPA 4BAQB 8GCHF 4B76A 2QXJA 2JH0D 1UTPA 3TH2H 4THNH 1G9IE 1Q31A 3BTGE 3RUOA 1AQ7A 2HGTH 3LH3A 1FNIA 1GG6C 3PMJA 3PROA 3QZQA 1IQNA 1MKXH 4AGJA 1FY8E 3E3TA 3A8CA 1EB1H 2JDID 1C5OH 1QR3E 3ZVBA 1TALA 4D76A 1S6HA 1KMHB 1O2LA 3KYGA 2BVSH 3SNBA 2FS9A 1RTFB 1DFPA 2KCAA 1GJ5H 1LO6A 4NSVA 4RT0A 1F0SA 2AERH 3TIUA 3V7TA 3MH7A 2C8WB 4NIXA 5FAHA 1P8VC 1ELDE 2O8MA 3ATMA 5C0UA 4H4FA 2BVXH 2O9QA 3VB5A 1D9IA 2FP7B 1P57B 2XW9A 1F7ZA 1NU9A 3M5NA 2FX4A 1AD8H 2JKHA 2AFQB 1ELVA 1J17T 4ZCNA 3UNRA 1SOZA 3FAOA 4U32A 4INKA 4CR9A 3E16B 2QGRA 1SFQB 3OU0A 1GGDB 3PTNA 1BA8B 3BTWE 1F5RA 1FY4A 4DG4A 2GV6A 1TMBH 3D62A 2VBCA 2BB4A 4AORA 1HYLA 1O5FH 1N6XA 3TJVA 1GCTC 5ESTE 4ACBA 1IHTH 3KHVA 1YPHE 4Y8YA 2BDGA 3FOAA 2ZF0H 1DANH 4AN7A 4FUHA 4NWKA 4OGYA 1L1NA 3PLKA 2FOEA 2VJ1A 1XMNB 2BZAA 4LXBH 4WXVA 2A45B 3SGQE 1O2XA 2BY7X 2GX4A 5DJ7A 4MTBA 1HAIH 1GMCF 3TNSA 1CA0C 5DP3A 1V2PT 1O3BA 4TPYA 5HYOA 3BTQE 5A8ZA 2ZDNA 1P2NA 4CRGA 2ZDKA 3O8BA 1Z7KA 4ASUD 4YLQH 2WHXA 1S85A 1EP6A 3PTBA 1QCPA 1Z6EA 1GHZA 1BJVA 1KXBA 1ZTJA 1W7GH 2V35A 2G4TA 1NT1A 1YPHC 4BTUB 1UK2A 3OEHD 3U98H 1CT0E 4BAKB 2RCEA 4K60A 2J2UA 3RLWH 2H1UA 2F9NA 3FN8A 3MNCA 3HKJB 3ODDA 3U8RH 1XUKA 2VWNA 3MI4A 1TOCB 4LOYH 1J16A 4O97A 1C5XB 1IOEA 2BD7A 3RMNH 3GCOA 3A84A 4NG9H 3A82A 3BG4C 3OEED 3FP7E 2ZGBH 2IN2A 4U01A 2P59A 3PV4A 2D8WA 2BD4A 4WJG2 1YPMH 1UTKA 4CRBA 3F2FA 4FU7A 4U2WA 6GCHG 1GBEA 1Z1JA 5L30H 5JB8S 1B0FA 3M3SA 1W14U 3QTOH 1TA2A 1V3XA 3GCHC 3SNCA 1BBRH 1O2GH 3V13A 1RFNA 1BMLA 1WTHD 2PHBA 2ZU1A 3AAVA 4ABHA 1KTSB 3ELAH 2ZCLP 1C2JA 1EJNA 1GBMA 5LPFA 2OC8A 3EA9A 2QAAA 2CN0H 3LH1A 3LJJA 1MKWH 2P3FH 3QK1A 3MU1A 1T8MA 5EG4A 3HK6B 5E0JA 3RP2A 1GI5A 4M7GA 1NPMA 1V2WT 3RXUA 1O3EA 4X2VA 4XE4A 1GBTA 5FHTA 2A4OA 2AEIH 3VB6A 3ZYDA 1GBBA 1FY3A 1C5LH 1EQ9A 2R0KA 1JRTA 3BV9B 4UFFH 3SOSA 1GPZA 2XC4A 2ZGXH 5KEDA 4FUBA 2FPZA 2A7CA 1E34B 2BOKA 1A61H 2P8OB 2PTCE 4BTIB 3CNRA 1COWD 1HCGA 2C8YB 2RA3A 4GUXA 3LIWA 2VIVA 1BMAA 2WYGA 2Y5FA 1HLTH 4I33A 1F0UA 2VU8E 1P2IA 1GL1A 1T31A 2W3KA 3BTME 2XBXA 3HKIB 4FUCA 2ZP0H 5FBIA 1FUJA 1IQMA 1VITG 4U30A 1Y5AT 2TRMA 2OC7A 3NZIA 5A2MH 1ELAA 4DJZB 1VGCB 5EJLA 2OK5A 1BDAA 3W95A 1KIGH 4AG1A 2YMSB 1P05A 1QBOA 4YOJA 1GHAG 3SBKA 4P00A 4NIVA 3ENSB 4TWYA 4YOIA 1SC8U 1H8IH 4BXWA 1FAXA 2OC1A 2W6ID 2PR3A 2QF0A 3TGIE 1X7AC 1DITH 1GHYH 3QZRA 3TH3H 4XRNA 2H9HA 3GY7A 4IBLH 2KCYA 4UE7H 1P11E 2ZHEH 1IQLA 1CVWH 4RSPA 4Y8XA 4ESTE 1V6DA 1O2VA 1TNJA 4WH6A 3LC5A 4NZLA 4AX9H 1ETSH 2BOHB 3P95A 1K1JA 1C4Y2 2F91A 2OTVA 1O2PA 1HAVB 3Q77A 4TY6A 2AIPA 2Q1JA 4BNRA 5EJ1A 2GP9B 5J4QA 2WPDD 3QO6A 3A89A 1CU1A 1W11U 1WBGB 1MQ6A 1B7XB 2R2WU 3A7TA 1YLDA 2FEQH 4MNXA 4NFFA 4NA7A 2Z9GA 1L1GA 4JZ1A 2GKVE 1ZHRA 1CGJE 5EOKA 2KM0A 4X2YA 3BTDE 5GDSH 4IN2A 5F8ZA 3RXLA 2TPIZ 3FP6E 1LQDB 1SGYE 2YOLA 3P8OA 1GMDG 3PWCA 2B0FA 1TNGA 1WXRA 3A8DA 1AY6H 3KQEA 1IQEA 4OS2A 4K5ZA 2ZDMA 4JYVH 1O33A 4O03A 1FN8A 1ELFA 4X8UH 2ZDVH 3A81A 1TGSZ 1GDQA 1KLTA 9LPRA 2ZDAH 3A87A 1OXGA 2W6JD 4GHQA 4NGAH 1ELEE 1O5GH 2ASUB 1YPJH 2FLBH 1O39A 3WY8A 1AHTH 1K1PA 1V2VT 4CHAB 2JJ2D 2F9VA 1QB6A 1NRPH 1W13U 1TBRH 5HIZA 3GS9A 3PM3A 4QT8C 2TGTA 1O5DH 3D65E 2F83A 5EXLA 3AK5A 2QXIA 1CBWB 3SU3A 4JCNA 1D3PB 1Q3XA 1HAHH 3GOVB 5DP5A 1TQ0B 3B8JA 1AMHA 4FXGH 3DFJA 4E7RG 2O8TA 3M36A 1P02A 3UFAA 5IK2D 5C20A 3HK3B 3GY8A 4ZHAA 1UCYH 3T2NA 2OXSA 3LKWA 4YOGA 1SR5C 3M5LA 3VB3A 5LGOA 4AOQA 2NU1E 3MO3A 1AE5A 3U8TH 3U1IB 2GJGA 2J94A 5HIYA 3N7EA 3SJKA 1PFXC 1L4ZA 2A5AA 3M7UA 4FUGA 2VVCA 3UUZA 3S0NA 4I8HA 4B75A 1GCDA 3H5CB 1FV9A 4F49A 3GCTG 2NU4E 1AVXA 1TBQH 5I25A 4K8BA 2FS8A 4CRAA 1XXDA 2A5KA 4AYYB 5T6FA 1CA8B 1D6RA 3SYJA 4JK6A 4MG3A 1MZAA 3SNDA 1GL0E 2M2AA 3VXFH 1S81A 4A5TS 1G32B 1UHBA 1FJSA 5EPYA 1AI8H 3MH6A 1S83A 1BRCE 4WY3A 1J8AA 2SGAA 3VFEA 2BYAX 5T6GA 4JZFH 2ZFPH 4FUEA 2HPQH 4NIWA 1RGQA 2AMQA 1FAKH 3RC4A 1HFDA 3PO1C 2PUQH 1AFEH 3E90B 2XBWA 3BTEE 2G81E 2WUCA 2CK3D 2JIZD 5CMXH 1WQVH 1QJ7B 2PW8H 3TNTA 4B6FA 1EAUA 2FWWA 4HTCH 3VGCB 2SGPE 4TT3D 5LH8A 1WYKA 3VB4A 4CRDA 2F4LA 4ABEA 5KGOA 1QJ6B 1Z8IB 1QL9A 3NXPA 4ISLA 1MQ5A 1O2KA 3UR6A 2ILNA 4A1XA 2ZO3H 1GBFA 5HM9A 4Y6DA 1XKBC 3MWIU 1C5TA 2ZTZA 1F0TA 1KY9A 1C1PA 1AFQC 2Z6BD 2H5DA 2VWLA 2BDHA 1MTWA 2XC0A 3FFGA 2BXTH 2WUBA 1ZJDA 1K1NA 1O2JA 1EAWA 1TNLA 1A0LA 1G3BA 1AVGH 1W8BH 1GJ7B 3TJUA 1K9OE 1QRZA 1ANEA 1NS3A 1MCVA 4AB9A 2NWNA 4KTUA 3FKSD 2I6SA 2Z9IA 3BTTE 4YT6H 1OWIA 1P2KA 3MU8A 2CF9H 1A3BH 2KAIB 3VXEH 1T4UH 4ISIH 3SU5A 1WTGH 2A5IA 4LZ4B 1MTSA 1SI5H 3F9EA 1Y8TA 5DG6A 2A4GA 2C90B 2HPPH 4ZROA 2A2XH 2DUCA 3U1JB 3RXFA 3QGJA 2PTNA 1GI7B 5DP8A 1SLUB 4K8YA 5ETXA 5GWZA 4O9VA 2UUFB 1A0JA 1TLDA 1HPGA 2HNTC 3RXBA 1C9PA 1SQOA 1HJAB 1V2TT 1G2LA 2R3YA 3M3VA 1LHDH 3MH5A 3BIUH 3SUFA 1AB9B 2P16A 2J95A 1GHBF 3PMBB 4J1YA 3UPEA 1XUHA 3MU4A 4Y71A 2R3UA 1O3IA 1XUGA 2WPLS 2SFAA 3MH4A 4VGCB 4DURA 1AVWA 3OAAD 1C5YB 1C1WH 3CP7A 2IPHA 1MBQA 2QF4A 1LHEH 1RTKA 2CXVA 3QGNB 4CRFA 3M5MA 1DPOA 1F0RA 3I29A 1PPBH 1H8ED 2R2MB 5IDKA 2QA9E 3T25A 2AYWA 1EAIA 1O31A 1O3HA 2WPMS 1FN6A 3TK5A 1C2IA 3E0PB 3B9FH 3T62A 1O30A 1O2UA 1F2SE 2FIRH 2AHME 1JIRA 3NCLA 3LDXH 1QRWA 3MQKC 1TGBA 4FUIA 5EXMA 1CT4E 2FODA 5H4IB 5BRRE 2EQNA 1P03A 1TMUH 5B6OA 1D3TB 1QBNA 1OHHD 1KSNA 1O2WA 2PGBB 1UVTH 3M61U 1SGCA 1BRAA 2QV1A 5AF9H 1FY5A 1G2MA 1QA7A 2IJOB 2ZHFH 2ESTE 2ZTYA 2HALA 3T28A 2RFKC 2UUYA 2BQ6B 2PKAB 2BY9X 3MNBA 2XCNA 1BTXA 4BOHA 1ZPBA 1OP2A 3TITA 2FOAA 3TPIZ 1LQEA 1XUFA 1HBTH 3VPKA 1L4DA 2ZDLA 4Q7ZA 5TCAA 3JZ1B 3O8RA 4RKOB 3VEQB 2K0QA 1GJDB 3OTPA 3U28C 2XWAA 3RXPA 1D4PB 1N6YA 5DKMA 4D8NA 1S0QA 1O5CB 3SZNA 4KTCA 1SGRE 3G01A 2A4QA 5FPYA 1EOLA 1GVZA 2FOMB 3FO8D 3P8GA 1OYQA 1MKXK 2TGDA 3E1XB 1CT2E 5CDFE 1FY1A 1BZXE 1GVKB 3SORA 1FQ3A 1GJAB 2ZTXA 3ZZCA 3NUMA 2BD8A 3S69A 4YZUA 3SJ9A 1BJUA 1A5GH 1SVPA 2ZPRA 1EJMA 4X8SH 2G5VA 5JDUB 1NN6A 1LVOA 3KL6A 1E37B 1AU8A 4XBDA 5FL7D 3OFND 1MD8A 2ZG0H 2OBQA 2OINA 4X6PA 1TRYA 2J97A 1THSH 1RIWB 3KN2A 3A7XA 1DS2E 1GJ6A 1O3AA 3F3BA 1V2JT 1A46H 1B5GH 3RU4E 1ZTKA 3LONA 1VJAU 2EI6A 5AFZH 2ODQA 1HIAB 5HMAA 3MU5A 4XBCA 3N7OA 1T8OA 1PPFE 4CH8B 3RM2H 1GHVH 1QIXB 3CS0A 2A31A 2QYIA 2FXRA 3NPSA 4OS6A 3Q3XA 2K1QA 1J14A 4IS5A 1TYNA 2A4RA 1RD3B 2Z9KA 2BY8X 2PLXA 1SGEE 4K2YA 2AMDA 3KCGH 1FMGA 1C2DA 1PPCE 2FO9A 4A7IB 2ZHQH 1HXEH 1JOUB 2G52A 3FZDA 4YO9A 1T4VH 3BTFE 3SUGA 5L2YH 4TSFD 3SV7A 2PSYA 1SGQE 2WPIS 5C0TA 3LGVA 3AAUA 1AIXH 1O2IA 1ZTLA 2CV3A 2P95A 2QF5A 4WMDA 4UDWH 1SGDE 3AASA 1DWDH 2ZFTA 2VWMA 1P0SH 3H7TA 3K9XB 3RXQA 2ZWLH 1YPLH 1JRSA 3M35A 4B73A 4DOQA 3SNEA 1C1RA 1VCWA 1YGCH 4WWYA 5A0BA 1DXWA 4A6LA 8GCHG 1P10A 4GCHG 6GCHF 1AN1E 2DE8A 3PLPA 4FOUC 5EPNA 1ZGIA 1C1OA 2G8TA 3PV2A 1THPB 1TB6H 3ATLA 1H9HE 2B5TB 3GY2A 4SGAE 3EGKH 4IC6A 2ALVA 1LHGH 2A2QH 3A8AA 4X8VH 2UUKB 2CJIA 3PMAB 3S9AA 1DSUA 3BEUA 3F9HA 3GISB 4MPXA 3LJOA 1O2YA 5FX6A 2P93A 1CHOG 3ATIA 3RU4D 3GICB 2GVFA 5ESBA 3RXVA 2VH6A 1GJ4H 1C5MD 2NU3E 4B74A 1SGIB 1HAVA 2OBOA 1ZSJA 3RM0H 4KKDA 3T5FH 5BPEA 5JBTA 3LGWA 6LPRA 4FVBA 1W3CA 2FX6A 3RXTA 3O8CA 1RTLA 1GCTB 2FI3E 1AWHB 5GPIB 3L3TA 3A7WA 1OWEA 4BAHB 2EI8A 3MNSA 1OWHA 2WV4A 2BDBA 1VR1H 3ZZ4A 3P8NA 4D7FA 1LTOA 3DHKH 2VH0A 4ZXYH 4AB8A 4ZHLU 3ZVCA 3ZZDA 2Z9JA 5EU8A 1DWCH 3T29A 5HKKD 4FETA 1F5LA 1ZZZA 1C5WB 1K2I1 2NU0E 2TGAA 1P3EA 1WAYB 3R0FA 3SI4H 2JJ1D 1AUTC 2G51A 3DCLA 3EQ0H 1KXCA 1HAYB 1VCPA 3SU0A 3U9AH 1GHAF 1DWBH 3SU2A 2C93B 2UWLA 1KLIH 4DT4A 1TGTA
chains in the Genus database with same CATH topology
1ABIH 1DE7H 4JZDH 1Z6JH 1PQ8A 1EXFA 4I7YH 1SQAA 1F92A 1O2MA 1S0RA 2JH6D 4GLYA 1F5KU 4Y7AA 1OSSA 1DY9A 1DLKB 1TGCA 1KXEA 3QN7A 4BTTB 2Z3EA 1BT7A 1IQHA 1E0FD 1XX9A 3A83A 1XM1A 5DP9A 1TE0A 2GD4B 3TJOA 5A0CA 1W12U 4NWLA 2ALPA 1K21H 4X0WU 3D23A 1GMHF 1UMAH 2XYAA 1YM0A 3DUXH 4JMYA 2FOHA 4INHA 2PKSC 1G3EA 3BG4B 3ZZ6A 4O3TA 1AZZA 3QDZB 4O3UA 1G30B 3ZZ8A 4AG2A 1FLEE 2RDLA 1QB1A 1ORFA 1Y3WA 2Q6FA 1ACBE 1EX3A 2JETB 4K1SA 2ANKH 4Z6AH 1EKBB 1GI3A 4JZIA 1NO9H 3GCNA 1NFYA 4R0IA 3ITIA 1LKBA 1ARCA 3GCHB 2LPRA 1GMDF 1P9UA 2ZHDA 4X1RU 3MOCA 1KDQB 4KELA 1O37A 1O2TA 3ZZ3A 1SGNE 4RN6A 1GJ9B 5DP6A 5FBEA 2H9TH 1WU1A 1BMNH 2VB0A 3RXKA 1AKSB 3W94A 4XDEA 3EYDA 4ASHA 2FI4E 3IITA 4E05H 5EODA 1XXFA 4CBOA 2SGEE 3RXDA 1UJ1A 2VVVA 1K1LA 1P04A 2V3HH 4I8LA 1BUIA 3SQHE 2H9EH 1Z8RA 1TX8A 2HNTF 2FI5E 1RS0A 2GDDA 2OQ5A 2SGDE 1PQ5A 3STIA 3SN8A 3PMHB 1PPHE 2BQ7B 1P01A 5EQRA 1JIMA 1FDPA 5AVDA 1FPHH 1PPEE 4ZXXH 1RXPA 5LPRA 1YCPK 3MO9A 4JZEH 4B1TA 1ZSLA 1NROH 2BLWA 3M7TA 1SSXA 3RC6A 1K28D 4H6SB 1FI8A 3DFLA 3P8FA 2OLGA 4LZ1H 1GDNA 1PYTC 4JYUH 1T8NA 2EI7A 1V2UT 4B2CA 4Y11E 1YBWA 4UFDH 2HVXA 2BMGB 2BD5A 2BY5X 3UR9A 4WF8A 2ANYA 4MVNA 3ATWA 5AFYH 3UNSA 2QCYA 4WH8A 1C1MA 1SG8B 1C5ZB 4Y10E 2PSXA 1ARBA 1P9SA 2BXUH 2UWOA 5SGAE 2O8WA 1C9TA 2KAIA 1Y3UA 2PV9B 4Y7BA 3KQCA 3DA9B 1OP8A 1UVPA 3B23B 4Y8ZA 5TJXA 1MBMA 2W7SA 3L6PA 2EEKA 1ELTA 1OWKA 1TIOA 2OP9A 3ZVDA 1JWTA 4CR5A 2GZ9A 3LGYA 1SB1H 3UIRA 3SI3H 2QN5T 5FCKA 3FVFB 5E8EH 1PYTD 2GMTC 4UONA 3TGJE 1EJAA 1TBZH 4MNWA 4OS7A 1C5RA 1S84A 2EA3A 1ZMJA 4Q80A 4I8KA 1O5EH 4IN1A 1NTPA 4WMFA 2XBYA 2ZFSA 3PLBA 4WXIA 4GPGA 4MDSA 1BHXF 2BLQA 4A92A 5F8TA 1NRSH 1W2KH 1JXPA 5PTPA 1TMTH 1DWEH 1HAZB 3BN9A 3F9FA 1KXAA 4ZKSU 3ZZBA 1W7XH 2XCFA 3ZZ9A 3L33A 4MLFB 4AZ2B 2BLVA 2I6QA 4DW2U 1O2SA 2B8OH 3P17H 1KXDA 4ABDA 3A7ZA 2QY0B 1GHXH 6CHAC 3SU1A 2ZI2H 2GZ8A 1G37A 2XBVA 7GCHF 5CHAB 1NRQH 3M7QA 1GI8B 1FIWA 1E35B 5JPMH 2CHAB 5FXLA 2GCHG 4X1QU 4ZMAH 1L1JA 2VINA 4E06H 1FONA 1LVMA 5GCHG 1T8LA 1ESBA 1GJ8B 1K22H 4X6NA 1C1QA 1KXFA 1ZHPA 2PKAA 4X6OA 2ZC9H 2VGCB 2GTBA 1YC0A 2PGQB 1C2FA 1PQAA 3ZVFA 1AGJA 1MU6B 3R3GB 2XC5A 3M5OA 5C67A 2BD9A 3RMLH 1TNHA 4NA8A 3RXSA 1EPTB 5JBAS 1NFUA 2BD2A 1PQ7A 2WINI 2V6NA 2CF8H 1GJCB 2GGVB 1CQQA 4XSKU 1A0HB 1C1VH 1Y5BT 1HJ8A 2H6MA 3GY6A 2FYQA 1Q2WA 2HNTE 1S6FA 1SLWB 1SPJA 1ZPZA 1SLVB 3A8BA 2Z3CA 3RC5A 1Y3VA 1QY6A 2D26C 4MPUA 5FPTA 3ZVEA 2XRCA 3P70B 2J38A 2YNBA 4MPWA 2ZA5A 1QHRB 3EDXB 1NESE 5LPEA 3KEEA 1O2ZA 1UVOA 2CMYA 2QXHA 4D9QA 1ZJKA 4WVPE 5G4BA 4OS1A 1QL7A 1TRMA 3MMGA 1EP5A 3SUEA 1DX5M 2R9PA 4OGXA 1SL3A 3PO1B 1UTNA 1ETRH 3LU9B 4E7NA 4SGBE 1GBHA 1A5IA 3F1SB 1ZOMA 3RXIA 4B2AA 2OCVB 4JK5A 8LPRA 1ZGVA 1EUFA 1OOKB 5FX5A 3A80A 4FUJA 1LKAA 1V2ST 4FUDA 1HAGE 3TH4H 1N8OB 2Z7FE 2Y5HA 3Q76A 1HAOH 1SOTA 1HDTH 1WV7H 3GDSA 4K1TA 1C5QA 3E91A 3NWUA 2C4FH 1O2HA 3SV9A 2BY6X 1EZXC 3BIVH 2SNWA 1AFQB 3GY4A 2ZECA 3U8OH 3F6UH 4YT7H 1YPEH 2SGFE 1C1UH 4K3JA 4ZUHA 2BTCE 2BVRH 4GSOA 1BRUP 3LGTA 1LVYA 3BEFB 3UQOA 4CREA 4AYVB 4XFQA 1UO6A 3UTUH 3M3TA 5K0HA 1ELCA 2TBSA 3HATH 1ABJH 2UUJB 3OTJE 1HRTH 1BTHH 2O8LA 1OX1A 5EQQA 5GIBA 1L0ZA 1J15A 2AS9A 2F9PA 3LGUA 5F6MA 3BEIB 4FVDA 3LOXA 1C1SA 1UTQA 2V3OH 1S82A 4KGAA 1HUTH 4DT7B 4KP0A 4ZH8A 4BAOB 3GYMA 3MHWU 3SV6A 2A32A 2VIPA 1QURH 2ZEBA 2Q6DA 3KIDU 2A7JA 5CE1A 1INCA 1PJPA 1HB0B 1SGFA 2ZU4A 1FPCH 1ZLRA 4X1NU 2ZCKP 4J2YB 1P2OA 5F8XA 2VWOA 1HJ9A 2Q6GA 1UK4A 3RXAA 3V0XA 3RU4T 1ESAA 2ZPSA 3C27B 1C4V2 2AGIX 1Y3XA 2J92A 1GI0A 3MYWA 1RRKA 1ELGA 4FU8A 4IMQA 1DM4B 2A1DB 4OS5A 5DGJA 3KF2A 1UTOA 1CE5A 1GHWH 3GYLB 5T3HA 1QNJA 1W0YH 4GVUA 1GHBG 1O36A 3TU7H 1C5PA 1QQUA 2BZ6H 1V2QT 2XNIA 4ABGA 3IG6B 1H1BA 4ISNA 2BDAA 4X1SU 1GGDC 2GCTB 4D9RA 1V2LT 1Z71A 1LDTT 3V3MA 1BITA 2FOGA 1ZMNA 2H2ZA 3A86A 3SV2H 7LPRA 2FMJA 2PFEA 4GCHF 4NIYA 2D2DA 2GV7A 5C1YA 2XXLA 3EE0B 3SUDA 1MAYA 2ZQ1A 1MTNB 4OS4A 1NZQH 5JB9S 4TWWA 1C5SA 1QTFA 7ESTE 3STJA 2BDIA 1YF4A 1DOJA 5T6DA 4CBNA 1C2EA 1DICA 2ZU2A 1NFWA 3QX5H 1QA0A 3BG8A 1XKAC 4X6MA 4BAMB 1BHXB 5E2OA 1CHOF 4XBBA 1O3MA 4YM9A 4NSYA 2ZFRH 3NKKA 1V2OT 2Y82A 1EATA 4NZQA 3RXHA 2Z9LA 3S7HB 3M37A 1NRNH 5C5OA 1O5AB 4UFEH 3SJ8A 3MU0A 4HZHA 2ZPQA 3GDVA 1SFIA 2VIDA 1O3LA 1TWXB 4FU9A 3RMMH 1GG6B 3FZZA 2AIQA 4DIIH 3K65B 1EAXA 5K7RA 2ZKSA 1TPSA 1MAXA 1O2QA 3TK6A 2PWXA 5A8XA 4IMZA 2ZGJA 1O5BB 1KDQA 1BRBE 3URCA 5J4SA 1YCPM 1MD7A 3S9CA 2QXGA 1GBKA 1DUEA 5C1XA 1AKSA 1TPOA 2VNTA 3ATKA 1UTJA 1W10U 2Z3DA 1P2MA 1NM6A 1V2RT 2H5CA 1OS8A 8ESTE 1TNIA 5C2ZA 1AZ8A 3S7KB 1AO5A 1C2KA 3I78A 1YPGH 2VIOA 1TPPA 2F3CE 1IQGA 1TOMH 2SGQE 4Y0YE 4ABAA 2DE9A 1OPHB 4X1PU 4AFUA 3P92A 2ODYB 5EW2H 2ZIQH 1HGTH 1V2MT 3A7VA 1TX6A 2Z94A 1BBRK 3F9GA 2RG3A 2STBE 1O3DA 4D7GA 1LPGB 3URDA 4ISOA 1A4WH 4ABJA 1VITF 5IYTA 3D49H 5JBCS 1ZYOA 3HPTB 3EA7A 2P8OC 1GBLA 1MKWK 4H6TA 2FTMA 4ZKRU 2UWPA 4TPIZ 1UTLM 3MNXA 2HLCA 4PROA 3MTYA 3RXRA 1K1IA 1H8DH 2V0BA 5E0HA 1EZSC 1Z8GA 1CA0B 3RXCA 1OYTH 1SHYA 2BX3A 3SNAA 2JETC 1VGCC 1VITH 4NA9H 1GI6A 1NRRH 2FTLE 3EA8A 1GMCG 1K1MA 1D6WA 1UVSH 1GDUA 2WV5A 2GT7A 3SO3A 1Y3YA 1NU7B 3FP8E 3JZ2B 3UNQA 1XUJA 4GHTA 4K69A 3ESTA 5FCRA 2C8XB 3KQBA 1VCQA 5HGGA 2CGAA 5A0AE 1IAUA 1O2RA 3V12A 2AGEX 2FOBA 5EGMA 1J9CH 4GAWA 1KLJH 1DUAA 2ZHWH 1VZQH 5F03A 3K6YA 3OSYA 5EQSA 1IQFA 5HM2A 2R0LA 2FYRA 3QLPH 1C5NH 1T32A 3CS7A 1ZSKA 4B2BA 4UD9H 1ANDA 3Q3YA 5FPSA 1ZPCA 3DD2H 1ZRKA 2NU2E 7KMEH 4WMEA 2Y7XA 1VJ9U 4MQAA 3H7OA 2Y7ZA 1CGIE 3T27A 4Q2KA 4ZAEA 5JYIA 1K1OA 1QL8A 1YPKH 3BTKE 1IHSH 3PYHA 2OUAA 3NK8A 1IQIA 1O2OA 1UVUH 5A8YA 3BF6H 3GDUA 3E6PH 3UOUA 4NFEA 1D3DB 1TX7A 4YTAA 2O8UA 5A09A 5GJ4B 1UTMA 3PWBA 2GZ7A 1SLXB 1KYNA 3PB1E 2FM2A 2F9BH 2W26A 1O0DH 1MH0A 4KTSA 4Q7YA 3CENA 4AFZA 1NC6A 4ZHMU 1MTUA 2WPJS 4K1EA 4I31A 1ANBA 4YLUA 1MZDA 3ZZ5A 1NFXA 4DVAU 3VB7A 5ABWA 1O3FA 1C2HA 2ZGCA 3OYPA 1S5SA 3AW1A 4ISHH 4LK4A 5GXPA 4IW4E 1UK3A 1GJBB 2BM2A 2HWLB 4R8TB 5E2PA 1SMFE 3ODFA 4X8TH 3F68H 1WQSA 4CHAC 1BTWA 1EPTA 2AMPA 5AHGH 3EAJA 1O3PB 1T7CA 2PKSB 1MMJN 2ZFFH 2ANWA 1FXYA 1CBWC 2G5NA 1GMHG 4RKJB 3OY6U 3E0NB 4X2XA 2BX4A 1TA6A 1DSTA 3ZV8A 1O3NA 4AFSA 3SV8A 1TRNA 4UFGH 1TGNA 2P3UB 1SGTA 3HGPA 2RA0A 2FLRH 3QUMP 3MO6A 3UREA 1DXPA 1OP0A 2J34A 3AW0A 3ZVGA 5JBBS 2BDYA 3GCTF 1GI4A 3RLYH 2BDCA 2FZZA 5DP7A 3SJOA 4NCYA 1QJ1B 1SGPE 1C5UA 2AH4X 4XOJA 3UY9A 1YCPH 3ZZ7A 3LC3A 1TPAE 2ULLA 2G4UA 1RJXB 1BBRE 5DK1A 2GCHF 1MTVA 1HV7A 1UCYK 2C3SA 4TY7A 3RXEA 4UEHH 4A1VA 1GBJA 4IGDA 1BB0B 5EXNA 1G36A 1XUIA 3LPRA 1GBAA 5GCHF 5L6NH 1H9IE 5CHAC 3TVJB 2TIOA 3ZYEA 3OX7U 5C5NA 4ABFA 2CHAC 2BHGA 3LGIA 4DY7B 2JH5D 2F9OA 3OY5U 4ZKNU 2STAE 4DGJA 1DT2A 2GT8A 4IC5A 4INLA 1EB2A 1O35A 1ZHMA 2C8ZB 2ZU5A 1HAXB 2VGCC 3VGCC 1E36B 1WUNH 1IQKA 1U6QA 1MUEB 4I8JA 2F9UA 1AE8H 5L2ZH 2VIWA 1EPTC 1NY22 1O3OA 4Y76A 1ETTH 2G55A 5C3NA 2WYJA 3ZZAA 1IQJA 1H9LB 1C2LA 3ZVAA 3TGKE 2FESH 1BMMH 3SQEE 3BSQA 1LHFH 1TONA 1CHGA 1D3QB 3Q00A 1GBDA 4TYDA 1G3DA 2FOFA 3RMOH 1QRXA 3IWMA 1M9UA 1HAPH 2PUXB 3LT3A 3SU6A 1V2NT 3P6ZB 4F4OC 1MCTA 3KNXA 1CGHA 4HI3A 2P94A 2YNAA 3TJNA 1CSOE 4B71A 4AGKA 2ZNKH 2GMTB 3QWCH 1FZZA 1O3JA 1P3CA 3RDZA 1OWDA 1THRH 3UWJH 3GY3A 1JBUH 1TNKA 1WCZA 3RXMA 4ZKOU 1EZUC 3AVZA 1DVAH 1EOJA 1TAWA 8KME2 1MU8B 4ABIA 3RXGA 1A1RA 1BCUH 1C5VA 1ZRBA 1FIZA 1N1LA 2XTTB 1N8OC 1HJAC 3KGPA 1BTYA 3A85A 2ZZUH 2ANMH 5DO4H 3TLOA 2WPHS 2GDEH 1AB9C 1GVLA 4JYTA 1AWFH 4I32A 1P12E 1LMWB 2HRVA 4YESB 4Z0KA 3S9BA 1BTZA 6CHAB 3RXOA 1C1TA 1C2GA 1ANCA 3I77A 4VGCC 1QBVH 1WOFA 2W7UA 5DP4A 2ZCHP 1O2NA 3TK9A 4HFPB 2SNVA 3SHCH 3ZV9A 5HXFA 1BIOA 1DLEA 4X2WA 4MNVA 1HIAA 1SHHB 2FOCA 2BLOA 1YKTA 7GCHG 3SGAE 4Y79A 2P3TB 4A1TA 1Z8JB 2FDAA 1C4U2 1H4WA 3C1KA 4DCDA 5TCCA 4BANB 1GI2A 2TGPZ 2IOTA 2LNCA 1C1NA 1Z1IA 3K6ZA 1P06A 2J4IA 1YYY1 3A7YA 4BXSA 1O3CA 4MPVA 3HGNA 1BTUA 2OD3B 1GI1A 1CO7E 1XVMA 1SGFG 1AUJA 5C1UA 1XVOA 2BD3A 1O3KA 2QC2A 3GY5A 3DT0H 4Y0ZE 1E38B 2A7HA 2J9NA 1GI9B 1LVBA 1JMOH 3SHAH 1QFKH 2OC0A 1OWJA 4CRCA 1LPZB 3MFJA 1UCYE 2B7DH 2WPKS 3T26A 1GBIA 2EC9H 4MNYA 1ZR0A 1ID5H 2Y80A 2OQUA 1LHCH 3K2UA