1AZ8A

Bovine trypsin complexed to bis-phenylamidine inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Binding Mode of a Bis-Phenylamidine Factor Xa Inhibitor Complexed to Bovine Trypsin
rcsb
molecule tags Serine protease
molecule keywords TRYPSIN
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A02
4U2WA 1DVAH 1GMDF 3KGPA 2QV1A 1GCTC 4FU8A 1O36A 2PTNA 3F9FA 5GPIB 1P3CA 4AB8A 3I77A 3UTUH 3URDA 3OTJE 1KXDA 3KN2A 4MG3A 4WJG2 1MKXK 3RXBA 1SG8B 4B74A 2BX3A 2OC0A 1ZMLA 5GWZA 1GI1A 1O2QA 5JB9S 1PQAA 5FBEA 1NFWA 2C4FH 1SQAA 4Y8ZA 3PV4A 1C5SA 1EP5A 2H9EH 3A81A 4D9RA 3ZVAA 5L30H 2SNWA 1EASA 3T62A 1O5BB 2HOBA 3GICB 4TPYA 2OTVA 1O2ZA 1QY6A 3ATLA 2OD3B 1P04A 5EODA 1O0DH 1G3BA 5CHAC 5HM2A 1KXAA 1KIGH 3EYDA 2G8TA 4BTIB 2WYJA 2UWPA 3M5MA 3P6ZB 1SGFA 5B6OA 3V13A 2J94A 1BTYA 1BMMH 1GJ4H 1GJ7B 1ETTH 2FPZA 4M7GA 1MU6B 3F68H 1DY8A 1VCWA 3BTEE 1DSUA 4Y71A 3SV6A 1SQTA 3A87A 1SL3A 4CRCA 1K2I1 2G55A 4NA7A 3SV9A 2BD5A 4DGJA 1OWDA 4CBNA 4GSOA 3ATKA 2B9LA 3TGKE 2XC5A 2ZPSA 1OX1A 2ZC9H 1UVTH 3RXOA 2C8XB 1O5CB 1GDQA 2HNTC 5DP5A 1QIXB 3O8BA 1ANDA 1FY1A 1ZJDA 5FAHA 5C5NA 1SSXA 1BMNH 1P8VC 2C3SA 1G37A 2G5NA 5EW1H 1C1QA 3QTOH 3D65E 1V2WT 4IS5A 3RXFA 1E0FD 1O5AB 2FXRA 2ZHWH 4MNWA 4OS6A 4ABGA 3ZVBA 4ISLA 2PSYA 2WPKS 1UTJA 3CS0A 3AAVA 1SR5C 1YPEH 3TH2H 2J9NA 1VGCB 1O2MA 2Q1JA 1ARBA 2A32A 3DFJA 1Y3UA 4RKJB 2FODA 1SC8U 3SUGA 4NWLA 1A5HA 2BLQA 3M3SA 1XUJA 2BHGA 2RDLA 1L4ZA 1GDUA 5GCHG 4ZXXH 3PLPA 4WH6A 1RD3B 1VJAU 4ZKNU 1AVGH 2O8WA 1CA0B 1SGTA 4ISOA 2ZHEH 3SQEE 1UTLM 1KLJH 3RLYH 1HPGA 1GMCG 2ZU4A 1O5DH 3RXSA 4AFSA 1O3EA 4TPIZ 4ZKOU 1TIOA 3SU2A 1OWKA 5EXMA 4A1VA 2W7SA 1GJDB 3MNBA 1KTTB 4H6TA 5EQRA 1K9OE 1MBMA 3T27A 4NA9H 5FXLA 1MCVA 5EPYA 2FOGA 5GCHF 1A1RA 2A2QH 3FZDA 1EUFA 1HYLA 4FU7A 3U8TH 1KY9A 1Y59T 4JK6A 4I31A 1C5LH 2UUYA 1O2KA 4FVBA 3GYMA 1C1PA 1GL0E 2PHBA 3HKJB 5ABWA 1G36A 4X6OA 5C20A 1HAVB 2F3CE 1UMAH 1Y5UT 1GMHF 5ESBA 3ZZ3A 1AE5A 2R9PA 2BLWA 1J9CH 2P8OB 3IG6B 4IN1A 1XUFA 1ESBA 1XVOA 1BOQA 3BF6H 5A0CA 1F2SE 2QC2A 2ZA5A 1HDTH 2ZKSA 3RMOH 1UTMA 3MOCA 2BZAA 2G00A 2ZDKA 3FZZA 1EZSC 3LH1A 3VFEA 1SFQB 4ABAA 1OWHA 3SQHE 4X2VA 1KDQB 5LGOA 1C5YB 2VU8E 2Y5HA 4WY3A 5DGJA 1TYNA 3FP6E 3MWIU 2G4UA 5A8YA 1NRPH 3U8OH 3KNXA 1HJ9A 2A5AA 1EJAA 1GBLA 1UVOA 3PWBA 4NWKA 2CMYA 2PGQB 3GCTG 1Z1JA 1D3QB 3LDXH 4JZFH 1O32A 1Z71A 3QGJA 4LZ4B 4JMYA 1C5ZB 2AERH 1QBVH 2BD3A 3D49H 2VH6A 1E35B 2FX6A 3RXDA 4TY7A 1LQDB 2ZU2A 4ZMAH 1P57B 1Y5BT 2ZFTA 3S9AA 4CBOA 1O2PA 1P2IA 1SLXB 4UE7H 2HRVA 4B75A 1ZTJA 1PYTC 2QXIA 1EP6A 1CA8B 1VZQH 3PMBB 1UCYK 3RC4A 1CHOG 2OC1A 2AMDA 3HGNA 3ZZ7A 4K60A 2TGTA 2SNVA 1TPSA 4Z0KA 4BXWA 2WPLS 3AW1A 1PPZA 4F4OC 1TBQH 4E7RG 1NTPA 1ZHMA 1A0JA 2BDBA 3BTGE 2BQ7B 1CBWB 1FN8A 2XWAA 2Z3EA 3MO6A 2ZGJA 3PM3A 1L1NA 2PGBB 2BOHB 4D7GA 5J4QA 1T8MA 2NWNA 3AW0A 1QL7A 1UTPA 2QYIA 2R0LA 3MI4A 1QJ1B 1PPHE 2BQWB 3EA9A 4KTCA 3KQEA 2R3YA 3NKKA 1TGSZ 3UNSA 1HGTH 1SB1H 3GCHB 3M3VA 1GI2A 4X1PU 3UNRA 1K28D 1GBAA 1PQ7A 1G3CA 1V2OT 2A1DB 1XKBC 2VWLA 1T8NA 4OGXA 1Y3XA 5AHGH 2W26A 4I8JA 3U8RH 3BV9B 2D26C 1G3DA 1AZZA 1EPTB 3C27B 1C5UA 4O9VA 3NK8A 4MPVA 2BDGA 2Z6BD 4X2XA 1TMTH 3UR6A 1IQNA 1K1IA 1W0ZU 5K7RA 3ATMA 1C4U2 1NO9H 5E8EH 2LPRA 3M37A 1WV7H 1AGJA 1GHYH 3P17H 1W11U 1TLDA 4CRAA 4ZXYH 2ZFSA 4HFPB 1OWJA 2WINI 4BAOB 1O3NA 1SMFE 4IGDA 1EB1H 1BTUA 1GI7B 2VWOA 2STBE 3ZZ4A 1O37A 2WPIS 1NZQH 3S0NA 1M9UA 2ZNKH 1WCZA 3KCGH 1ZPCA 1C2EA 4FVDA 9LPRA 1BRCE 3A7XA 1HBTH 6GCHF 2TGDA 1GI6A 3MU1A 1EOLA 2PKAA 1T31A 2JKHA 1IQJA 1OSSA 1GI8B 1AKSB 4Y7BA 3GY7A 1NU9A 5K0HA 4I7YH 2DE9A 1EQ9A 1HIAA 2CHAB 2P16A 2PV9B 3SJOA 3SGQE 1O2XA 4ZHAA 8GCHF 4E06H 2HPQH 3M35A 2ZTZA 2GDDA 1LQEA 2ZFQH 1P06A 3AAUA 1ZSKA 2GT8A 4D8NA 4K3JA 2J4IA 1CA0C 1OWEA 2GCTB 1QB1A 2VIOA 3A8CA 1J15A 1E36B 5BPEA 2W7UA 1H9LB 1QA0A 1CE5A 3E1XB 2CXVA 2HNTE 1YPHC 5LPFA 1OPHB 1QL9A 2AIPA 3TPIZ 2OCVB 3T5FH 2ZO3H 3BG8A 2QF3A 1DLEA 3GY4A 3UWIA 2EC9H 4BNRA 1QRWA 2UWOA 5EXNA 2NU3E 5F8XA 3RXJA 4AFUA 4LK4A 5TJXA 4JZ1A 1OWIA 3PTBA 1C1UH 3MO3A 3RXRA 3SUEA 4LZ1H 5T6GA 1GG6B 2FI5E 2RG3A 1BHXF 1F92A 4A92A 1O3FA 4RN6A 4INHA 2FI4E 2CV3A 4WMFA 3L6PA 1THPB 4IC5A 2ZDAH 2ODPA 1V2MT 2VIVA 2ANMH 1DWCH 2J34A 2HALA 1O3JA 1UO6A 4O3UA 4CHAC 4CHAB 1TWXB 3H5CB 5EXLA 1GVZA 1MKXH 1UTQA 3BEIB 1W0YH 4ABJA 2FWWA 1P2KA 3TVJB 3STIA 1YP9A 2RCEA 3SHAH 3HK3B 1CU1A 1LVMA 1UTKA 2H9HA 4CRBA 3PROA 1RXPA 2XBWA 4ZH8A 1KXCA 4WF8A 3RMLH 4X6MA 1A4WH 4UEHH 3EAJA 2D8WA 1GI3A 2ZGXH 7LPRA 3M7QA 3U9AH 2VJ1A 5DP7A 1AN1E 2ASUB 2A4QA 2FZZA 2ILNA 2OC8A 3MHWU 1P2NA 1O2UA 1W14U 1QRZA 2VIWA 4JCNA 1F0TA 1W7XH 1INCA 1BQYA 3S69A 1DITH 5SGAE 1ZTLA 1L4DA 4INKA 3URCA 3SNCA 1HAOH 3P92A 1LHGH 5A8XA 2ZFRH 2EI6A 1NESE 1K1LA 1VCQA 3TIUA 4LOYH 2FOFA 1C5NH 1L2EA 1EPTA 1F0UA 1H8IH 3S9CA 1XXDA 2ZU1A 5EOKA 1DLKB 3DHKH 1MQ5A 3LT3A 1FY5A 2H2ZA 1GBIA 1VITH 3VPKA 1ETRH 3RU4T 5GXPA 1YBWA 5A2MH 2VH0A 2Z3CA 2BD4A 3KQCA 1BJUA 1MD8A 1AFEH 1IQHA 2Y5GA 4Y8XA 1WTGH 4KTSA 2F91A 3GOVB 2BQ6B 1ZR0A 2BD7A 1MAYA 1TGNA 1Z8JB 4DVAU 3NPSA 3ATIA 1FNIA 1AB9C 5IYTA 1MTSA 4MLFB 1EX3A 4BAQB 5GDSH 1O2HA 1MBQA 3KIDU 3RU4D 3S9BA 2B7DH 3QGNB 1AWFH 1TNJA 1AKSA 1GCTB 1D3TB 3ENSB 4UD9H 4RSPA 4B1TA 2HLCA 1Q3XA 4CRGA 4X6NA 4GCHF 1ZRBA 3SU0A 1AMHA 2CJIA 1N1LA 1U6QA 2BYAX 4A1XA 1CO7E 1Y3YA 2BXTH 1O2VA 3UY9A 3ATWA 1C9PA 1LTOA 1FDPA 1BRUP 1FQ3A 3MH4A 1GL1A 3U98H 1O2YA 1MH0A 2ZFFH 4YLQH 3PO1C 2JH0D 4AOQA 1GHAG 4ZAEA 2GT7A 4CREA 2FX4A 3RUOA 1G2MA 3ITIA 1TPOA 4O97A 4Q7ZA 2PKAB 1O2JA 4DCDA 2ZP0H 2NU0E 4XDEA 1GBKA 3TNTA 4FUCA 1P2OA 2GX4A 2PFEA 3E90B 2QY0B 1E37B 1ELBA 3P8OA 3F6UH 3ZZ9A 1S5SA 4D76A 3BN9A 1FPHH 2PUQH 2SGEE 1YPKH 2FYRA 2ZFPH 1G2LA 2SGPE 1YKTA 5JBCS 2OXSA 1HRTH 1P03A 4GLYA 1FLEE 3PO1B 4XBDA 1YM0A 4HTCH 1UTNA 4MNXA 2FOHA 4DW2U 1ZYOA 1ELCA 1EPTC 2ULLA 9ESTA 3O8RA 1O3OA 1GVLA 2VGCC 1ELAA 2I6QA 1GGDB 2P93A 5EQSA 5FPYA 5FCKA 4K1EA 1PPGE 1TGCA 2FS8A 3SI3H 1EOJA 1HFDA 4YTAA 1PPEE 4A7IB 1NT1A 2SGFE 3UQVA 1L0ZA 1TPAE 1TNIA 1MMJN 1OYTH 1QCPA 2PR3A 3D62A 1EJMA 1D9IA 3PYHA 5EU8A 1FMGA 5CE1A 5DJ7A 1QBOA 3TITA 4X8TH 1FIWA 4IMZA 3GCTF 1GJ6A 1YPJH 2F9VA 2ZHQH 4GPGA 4NG9H 4YO9A 2WV4A 3ZYDA 1BA8B 4BTTB 3RXTA 1ZSJA 4ZKSU 3Q77A 1F7ZA 1SGPE 3VB5A 5DO4H 3QUMP 1C5PA 3E0NB 1GBEA 1GBBA 2XXLA 1AB9B 1PYTD 4WXVA 1GJBB 4UFFH 1DT2A 1ZGVA 3UREA 1TGTA 4X2YA 3SBKA 3SGAE 3UWJH 1NRSH 2ZDLA 5C1XA 3PB1E 3RXPA 3LGYA 5DP8A 3RXQA 4A5TS 1C5WB 1EAUA 4K2YA 3LGUA 1HJ8A 4X1RU 2A45B 3MYWA 1FJSA 3ZZAA 3SNBA 2A0QB 1GG6C 1QBNA 4OS5A 1DUEA 3PTNA 1K22H 1AD8H 6GCHG 1IAUA 4UONA 1JBUH 3N7OA 1NS3A 1XXFA 5A8ZA 5FX6A 1V6DA 1ZOMA 3EA8A 1F5LA 1O2NA 1V2VT 5HXFA 1B0FA 1ZPBA 1ORFA 1MTNC 1TNHA 2V3HH 2FP7B 3GYLB 1C2MA 3LU9B 2GP9B 1DOJA 1C1SA 2PKSC 4CRFA 2A4GA 4MVNA 1V2KT 4NFFA 3TNSA 4H4FA 1WQSA 3M5OA 1CHOF 1S0RA 1XMNB 2Z9GA 3BTDE 1H9IE 3IWMA 4KTUA 1DWBH 2WYGA 1T8OA 1BTZA 2HPPH 4NCYA 1GHBF 1ZZZA 2ZGBH 1ID5H 1IQGA 5A09A 1CVWH 3P8NA 1ANBA 2H9TH 2ZF0H 1NRRH 2WV5A 2F9BH 2AFQB 2GMTC 4NIVA 1C2JA 1UVPA 4U30A 1UK4A 3RXEA 1EB2A 4YOJA 4MTBA 4FUFA 2WPMS 1K1NA 3EE0B 4DOQA 1C1TA 1S0QA 3OU0A 1O2IA 4AN7A 2Y5FA 1GI0A 2AH4X 4X8UH 1KTSB 1DUAA 1JIMA 5C1UA 1O3LA 4K1SA 4WMDA 2W5EA 1WU1A 2UUJB 3ODDA 3VGCC 2BY6X 5I25A 1XKAC 1WSSH 1HCGA 3UIRA 2V3OH 2C93B 1LHDH 1O3GA 3M61U 2RA3A 1H8DH 2VIDA 1FI8A 1TB6H 2EI7A 1GBHA 2BY7X 4KGAA 1SBWA 4A1TA 5F03A 1GHVH 3ZVCA 2FESH 3M3TA 1D6RA 4ISNA 3RDZA 2J92A 2IJOB 5L2ZH 3OX7U 4JYVH 4XFQA 3SNEA 2GTBA 3BTKE 3FP7E 1K1MA 1DY9A 1THSH 2XCNA 4AFZA 4DJZB 1V3XA 1CSOE 2O8UA 1CHGA 2CF8H 3NXPA 5PTPA 3SV8A 6CHAC 4U32A 5BRRE 1P0SH 1IOEA 3A7WA 1O5GH 1YPHE 4GAWA 1EAIA 3UPEA 1QQUA 1AIXH 3O8CA 3MH5A 3OY6U 2AGEX 3LIWA 1ELVA 1VCPA 4WWYA 1KLTA 2C8WB 1AUJA 4AB9A 1BTHH 1IHSH 1LPGB 3RM2H 4BTUB 3CS7A 1OKXA 3LH3A 2WUBA 2Y7ZA 4Q7XA 2XBXA 2GD4B 2ZECA 1Z6EA 2ZQ2A 1LHEH 1V2LT 1TX6A 3S7HB 1BZXE 1C5RA 3PMJA 2XBYA 4Y76A 3ZVFA 4THNH 3E8LA 1AHTH 1SGDE 3P70B 3MO9A 2ZU5A 3MFJA 2Z7FE 4R8TB 2BVRH 1SGIB 3I78A 1TBRH 2OINA 3UR9A 3E6PH 4X1SU 4X0WU 1W12U 1MAXA 3STJA 3K2UA 5EGMA 2GVFA 1WBGB 1Z8RA 2AYWA 1MCTA 1P2JA 2M5TA 2VWMA 1DPOA 1GHWH 4FUIA 2ZCKP 5C3NA 1DICA 1ELGA 1ANCA 5ESTE 1DXPA 1FY8E 1FV9A 3GY6A 5F8ZA 1L1GA 4RKOB 3SU1A 2STAE 1NC6A 1CT0E 2F9OA 4TWWA 4B76A 2Y81A 2FI3E 5FCRA 4MNYA 4NZQA 1A61H 1LCYA 4B2AA 5C67A 3BIVH 3TK9A 5E0GA 1IQIA 2BY9X 1YCPH 1GHZA 3A7YA 1OS8A 1C2FA 1TNGA 3V3MA 2KAIA 1C1OA 3QK1A 2BVXH 6CHAB 2EEKA 1EJNA 1LPZB 1EZXC 2BDAA 4ZROA 3T26A 1HJAB 1PPBH 2A4OA 2JH5D 1O3BA 5JYIA 1ZMNA 3CENA 1TGBA 2ODYB 3VB7A 1N6XA 3A7VA 1C5XB 1D3DB 3UOPA 1O33A 2FOMB 3SN8A 7GCHG 4OS2A 1JMOH 4DY7B 1FAKH 1NY22 1XX9A 1ETSH 4J2YB 2PLXA 1E34B 1UHBB 1K1PA 1OXGA 1WUNH 1C1WH 4BAKB 3RMNH 1AY6H 4E7NA 1F0RA 1HAVA 2AS9A 1X7AC 3MNSA 3UNQA 1O2RA 1XUIA 4XSKU 1UVUH 1GJAB 1P09A 4I32A 2A2XH 2G51A 2JH6D 5DP4A 4D9QA 4OS7A 1NFUA 3FVFB 5EQQA 4GVUA 3M5LA 1HAPH 3ZZBA 2O8MA 1AVWA 3SHCH 5EW2H 3BIUH 1O2TA 1OP2A 2SGQE 4XE4A 1TAWA 3TH4H 2VB0A 4UFGH 3TH3H 1VITG 4IW4E 1O3PB 4IN2A 4JYUH 4Y6DA 4DIHH 3I29A 3A83A 1BTXA 1HAIH 5HMAA 4VGCC 2Y7XA 3TGJE 4ABDA 1A0HB 1GBMA 1GBFA 3KEEA 2R0KA 2P94A 1BTPA 2Y80A 1J17T 4GCHG 1BDAA 1EZUC 1C1VH 3O8DA 4Y7AA 1Y5AT 2P95A 3GCNA 1TRYA 4YM9A 4NGAH 2FOEA 4O3TA 2AGGX 4YOGA 3ESTA 1SLUB 1SGYE 2A5IA 1RTFB 1RTLA 2GMTB 2WPJS 3LGWA 3RC6A 3NWUA 2XWBI 1LKBA 2GZ7A 2A7HA 1B5GH 1DX5M 1AO5A 4INLA 1B7XB 1IQKA 2HWLB 1KXEA 2GCHG 3SW2B 3RXVA 1C2DA 2ZPRA 3SOSA 1MTUA 4I8KA 1O3IA 3HGPA 1N6YA 2BLOA 2AMPA 4OS1A 1KXBA 1TFXA 3SUDA 4K1TA 1P9UA 3GCHC 3E16B 5E2PA 4WMEA 1GHAF 1LVBA 1PPFE 2ZI2H 3L3TA 2BZ6H 2BXUH 1YCPK 4GUXA 2FLRH 1QA7A 3NZIA 2A7CA 3R0FA 2H5CA 4A6LA 3PLBA 2DE8A 4X6PA 1ZHPA 2GCHF 3RLWH 1DANH 3ZZCA 2F83A 4UFEH 1Y3VA 3U1IB 2PWXA 1RIWB 1DE7H 2CHAC 5L2YH 1GJ5H 3ZVDA 3RXAA 4FU9A 4NA8A 1MD7A 2Z9JA 4WXIA 1HLTH 1SGEE 1WOFA 4ISIH 3V0XA 8LPRA 1SI5H 1SFIA 3GCOA 5T3HA 3TK5A 1HNEE 2BY5X 5T6FA 1S84A 1E38B 1KXFA 3A88A 2EI8A 2J2UA 1S6HA 1AQ7A 2OLGA 1BMLA 3M36A 2Z9IA 1SOZA 1GJ8B 1ESAA 3KL6A 4ABEA 1QL8A 1A3BH 2O9QA 5DK1A 2BB4A 4GHQA 2BM2A 2BVSH 3MU5A 3BSQA 3Q00A 1QNJA 2W3IA 3SNAA 2BTCE 2GCTC 3SU5A 1SGQE 1MTNB 5TCAA 1ELDE 1UHBA 1PQ8A 2ZPQA 3E3TA 2FOCA 2P3UB 1Y3WA 3TJNA 1CT4E 2TRMA 1O3HA 4FUGA 5HGGA 1HV7A 1D3PB 1L1JA 3VB3A 1NU7B 2HVXA 5L6NH 1C5VA 3FANA 3GDUA 2ANWA 1BCUH 1LHFH 3MU0A 1H4WA 1BHXB 1C9TA 2FYQA 1TX7A 4Q80A 3PLKA 2ZIQH 1F5KU 2A5KA 2ZQ1A 2QXHA 4FUDA 2YNAA 3H7OA 4Y8YA 1N8OC 1BBRH 1XVMA 1GGDC 1YPLH 2BDHA 3SO3A 2R3UA 4D7FA 1J8AA 1UTOA 2WPHS 1GMHG 1ANEA 1P10A 1TOCB 1O31A 5E2OA 3ZYEA 1LHCH 1TBZH 4K8BA 4KELA 2HNTF 3MH6A 2CN0H 1FY3A 1GBCA 1PFXC 2XNIA 2P3FH 2A7JA 2OC7A 1HAHH 1MUEB 1W13U 4YT7H 2ZHDA 4KP0A 3TJUA 4IC6A 1IQMA 1BB0B 4Y11E 1VITF 1YPMH 3F9GA 4K5ZA 4YOIA 2QXJA 3LGTA 3RXIA 2G52A 2ODQA 1RIWC 2NU2E 3KF2A 3IITA 4I8LA 5DP6A 1C2KA 1BMAA 3QTVH 2OUAA 3ZZ8A 3E91A 5CHAB 1SGNE 1QGFA 3KQDA 1MKWH 2TBSA 2SFAA 4MPWA 2XYAA 1AZ8A 3OY5U 2CGAA 2ZTYA 2Z9KA 2G4TA 3GDVA 2EA3A 1BIOA 3MNXA 1PQ5A 2F9NA 4O03A 1HXEH 2ZZUH 3BG4B 1YCPM 1ZLRA 2XW9A 2VVUA 2Y6TA 4FUHA 1ZSLA 3F9EA 3HATH 3LOXA 2KAIB 1K1JA 1JRTA 2PTCE 3G01A 1YGCH 4ABIA 2B5TB 2ANKH 5FX5A 3RP2A 2HGTH 2FO9A 1EAXA 1TRMA 3BTME 4CR9A 2ANYA 4DURA 3B23B 1XUGA 4SGBE 1FXYA 4ABBA 1P12E 1D4PB 1GJ9B 4J1YA 3A82A 5F6MA 2FIRH 1BBRE 2ALVA 4NZLA 3V12A 2FS9A 2OBQA 4ASHA 2ZDVH 1O35A 1V2NT 4JZIA 2QAAA 4I8GA 3MU8A 4VGCB 1TRNA 3RC5A 1JXPA 2VIPA 3QO6A 3QZQA 3T2NA 4BAMB 2IN2A 1TNKA 3ZV8A 2ZCLP 2O8TA 3UFAA 1GWAA 4AFQA 1MQ6A 1V2ST 5EPNA 3OYPA 1EXFA 3SU3A 1ZRKA 1N8OB 2FLBH 2GZ9A 4XOJA 3BTHE 2ZU3A 3SU6A 1ZJKA 1OP8A 1TA6A 3ZZ6A 1WYKA 4AGJA 1XUHA 1HAXB 1XUKA 4X2WA 4Y10E 3ZVEA 4YESB 5FHTA 1ELFA 3GY2A 5A0BA 1S81A 5G4BA 1G9IE 5DP9A 1YC0A 3SU4A 3DD2H 1ZHRA 1PPCE 1TQ0B 1CGHA 2ZG0H 1H1BA 1BUIA 3TK6A 2UWLA 4DIIH 2J38A 3H7TA 8GCHG 2O8LA 1SGRE 3TJVA 1O2WA 2B8OH 1SLWB 5DP3A 1EAWA 1CGJE 1GHXH 3P95A 4CRDA 3A7TA 2VNTA 1HB0B 4H6SB 4YZUA 3MU4A 2FEQH 1O2GH 3F9HA 3F1SB 4TYDA 4DT7B 1ZMJA 1C2LA 3UUZA 3SGBE 2VVCA 1C1RA 2SGDE 1LPKB 1YPGH 5FPSA 1GMDG 2PUXB 2GV6A 2NU1E 1BRBE 2NU4E 1AUTC 3LONA 1VJ9U 1GBTA 2GKVE 1V2UT 4B2BA 5C2ZA 4YLUA 2QF0A 3FAOA 3SJ8A 4ZKRU 3AVZA 4BXSA 1GCDA 4ZUHA 1GVKB 1TMUH 2ZDNA 1MU8B 3Q76A 1C4V2 1NFXA 3A89A 1FAXA 1NN6A 4ABHA 1TX8A 4Q2KA 2ALPA 1A3EH 4ABFA 4AGKA 2YOLA 2BDCA 3AASA 2Z3DA 8KME2 2SGAA 5JBBS 2QIQA 3P8FA 1QB6A 1P3EA 2ZHFH 4ZHMU 1MZAA 2ZGCA 1LO6A 1TABE 2XRCA 3BG4C 3EGKH 3EQ0H 4X8SH 1QHRB 1DFPA 2ZWLH 1SOTA 4I33A 2XCFA 1VR1H 3HKIB 1FZZA 1NPMA 1QJ7B 3LGIA 4B2CA 2A31A 4CH8B 1GPZA 1TONA 1V2JT 1W7GH 1OP0A 1TNLA 3L33A 4GHTA 2OQ5A 1TALA 1O2SA 1WTHD 3TGIE 3SUFA 2Q6FA 2WUCA 1MTWA 2BD2A 1T4VH 2H5DA 2XC4A 1QRXA 1UVSH 4WVPE 4B73A 1SQOA 1RRKA 1KYNA 2IPHA 3LKWA 2JETC 5DKMA 1BITA 2ZCHP 1O2LA 3QDZB 2VINA 1Q2WA 3LJOA 5AFYH 2B0FA 1QR3E 1TPPA 2VGCB 5E0HA 1UK2A 1FPCH 4IMQA 4UFDH 4K8YA 1AWHB 4MPUA 2QA9E 4Z6AH 4H42U 2GDEH 3Q3KA 1DXWA 1DSTA 5JBAS 1QFKH 2OBOA 1Y8TA 2UUKB 2Z9LA 5EG4A 1BTWA 3A86A 1GJCB 3SNDA 1BBRK 1P02A 1V2PT 1ABIH 1UCYE 2THFB 3FP8E 2GZ8A 4NIWA 7KMEH 3RU4E 1Z8GA 1T7CA 1RTKA 1HAGE 2FTMA 1C5QA 2OQUA 3A8BA 4F49A 3V7TA 2A4RA 4NIYA 1FUJA 3M7UA 2XTTB 3T25A 5JPMH 4OS4A 2BD8A 5I46H 4SGAE 3OSYA 4X1NU 1QQ4A 4BAHB 2FOAA 1O39A 2ZEBA 4IBLH 3UQOA 1QB9A 2PKSB 4NSYA 2F9UA 3B9FH 3SI4H 3TLOA 1AU8A 1J14A 1O34A 3MTYA 1O3CA 5JB8S 3UOUA 2R2MB 5E0JA 1DM4B 5A0AE 2Q6DA 2QXGA 3SJIA 1C5OH 3NUMA 3PMHB 5FBIA 2CF9H 4AYYB 5LPRA 4TY6A 5DPAA 2P3TB 3ELAH 1KLIH 3ZV9A 1HIAB 3M5NA 4MPXA 4X8VH 1P2MA 1JWTA 4JYTA 1P05A 2D1JA 3K9XB 1O30A 5HM9A 1SGCA 1WQVH 5JBTA 3GISB 5LPEA 1IQFA 3LGVA 4PROA 3VGCB 3ZZDA 3LJJA 3LPRA 3RXHA 5C5OA 3Q3YA 1TQ7B 1K1OA 4TWYA 1ZPZA 1SGFG 2QCYA 1A5IA 1ELEE 1VGCC 5AFZH 4MNVA 1ZTKA 2LNCA 1J16A 3QZRA 2Z94A 1MZDA 2ESTE 5AVDA 1HAZB 1JRSA 1GDNA 1W2KH 4QT8C 1S82A 1GI4A 3BEUA 3VB6A 1ABJH 5JDUB 4Y0ZE 4FUBA 4ISHH 1TE0A 1O3MA 1AFQC 4FUJA 2TGPZ 1FONA 2OP9A 1HUTH 2C90B 3Q3XA 4XBBA 4ESTE 4CH2B 1C1MA 2BOKA 3CP7A 3QWCH 4MDSA 1S6FA 2JETB 3MMGA 1XM1A 3GY3A 1SHYA 1BJVA 1NM6A 1GMCF 2ZGHA 2AIQA 3WY8A 3S7KB 4YT6H 3RXLA 1O38A 3GDSA 3T28A 1C2HA 1C2GA 1AE8H 1Z6JH 1HXFH 4B71A 3JZ2B 1Q31A 1GBJA 5TCCA 1ELTA 2F9PA 2V35A 3SORA 1O2OA 2Y82A 3DFLA 1HAYB 4NSVA 4WH8A 2BMGB 3SZNA 2FOBA 3EA7A 1DDJA 4JZDH 4NIXA 5IDKA 4JZEH 3VXFH 3GY5A 3LC3A 1C2IA 1ARCA 1RS0A 1PJPA 1GI9B 1RJXB 5DG6A 4HZHA 3W94A 1G30B 1C5TA 3T29A 1P9SA 1Z8IB 1THRH 3B8JA 3VXEH 1LVYA 2G5VA 1QJ6B 4BANB 1A0LA 1NROH 3DT0H 1QURH 3RXGA 1A46H 4DG4A 1S85A 3EDXB 2I6SA 1TA2A 1UCYH 3LC5A 3A84A 4LXBH 1AI8H 2BX4A 3M7TA 1EZQA 3ODFA 1OOKB 3P8GA 1RFNA 2ZTXA 2RA0A 3HK6B 2W3KA 1V2QT 1ACBE 1YLCA 1UK3A 1F5RA 1EKBB 5ETXA 4R0IA 3PWCA 4AZ2B 5F8TA 1BT7A 2VIQA 4U01A 2TGAA 2QGRA 4UDWH 2K1QA 3JZ1B 3D23A 3A7ZA 1JOUB 4AG2A 5H4IB 3VEQB 3A85A 4X1QU 2XC0A 3K6YA 3BEFB 1T4UH 2FM2A 2D2DA 1Z7KA 3A80A 1Z1IA 3R3GB 4I8HA 3U1JB 1DS2E 1WAYB 2BDIA 4CR5A 1JIRA 2TIOA 2G81E 4BOHA 2YNBA 2C8YB 5T6DA 1GBDA 3SJ9A 3RM0H 4FUEA 3RXKA 2Q6GA 3PMAB 4AYVB 1DWEH 4Y79A 4MQAA 2GV7A 1A2CH 2PSXA 3K6ZA 1P01A 1P11E 1MTVA 1NRNH 1C5MD 5HYOA 3GY8A 2BY8X 1CGIE 1K21H 4ZHLU 3QX5H 3A8DA 1YF4A 2PW8H 2P8OC 3SV7A 3MNCA 3SJKA 2BDYA 1LMWB 2FTLE 1UJ1A 3HPTB 2H1UA 1FY4A 4OGYA 1OYQA 1G32B 1O3DA 2UUFB 2AEIH 3BTTE 5AF9H 1YLDA 1CBWC 4Y0YE 1AFQB 3C1KA 1SLVB 3MH7A 2BD9A 4JK5A 2V6NA 3TJOA 1C4Y2 5LH8A 1W10U 1S83A 8ESTE 3ZZ5A 1G3EA 2GGVB 1GHBG 1SPJA 1D6WA 2AMQA 1O3KA 2R2WU 1HJAC 1LDTT 1O3AA 5J4SA 3BTWE 3KHVA 1IQEA 5C1YA 1O5FH 3QN7A 1V2RT 2C8ZB 4Q7YA 1EATA 1FIZA 1FN6A 1ESTA 3BTFE 4HGCA 1H9HE 4FXGH 2VVVA 5GIBA 2XBVA 1T8LA 3K65B 1T32A 1IQLA 1CQQA 4HI3A 3ZVGA 1AVXA 1SVPA 4AG1A 3FFGA 1V2TT 2ZDMA 7GCHF 2AGIX 3BTQE 3RXCA 1IHTH 1LKAA 2VWNA 3NCLA 1SHHB 3A8AA 4K69A 1A7SA 2BLVA 1B0EA 1NRQH 1LVOA 3RMMH 3VB4A 1F0SA 1A5GH 3RXMA 1CT2E 2H6MA 1TMBH 1YYY1 3RXUA 4AX9H 5CMXH 1P2QA 3KQBA 7ESTE 2DUCA 4KKDA 2V0BA 1KDQA 1W3CA 4XBCA 1ZGIA 6LPRA 1QTFA 1NFYA 6ESTA 3U69H 2J95A 1O5EH 3DUXH 3W95A 2P59A 1GI5A 4E05H 1BRAA 2QN5T 1KSNA 1DWDH 1W8BH 2FDAA 2FMJA 1C1NA 5FPTA 1MKWK 3TU7H 3QLPH 1TOMH 5GJ4B 4AORA 3SV2H 3E0PB 4NFEA 2TPIZ 2IOTA 1RGQA 3DA9B
chains in the Genus database with same CATH superfamily
4U2WA 1DVAH 1GMDF 3KGPA 2QV1A 3WWBA 1GCTC 4FU8A 1O36A 1E1QD 2PTNA 3F9FA 5GPIB 1P3CA 4AB8A 5DN6D 3I77A 3UTUH 3URDA 3OTJE 1KXDA 3KN2A 4MG3A 4WJG2 1MKXK 3RXBA 1SG8B 4B74A 2BX3A 2OC0A 1ZMLA 5GWZA 1GI1A 1O2QA 5JB9S 1PQAA 5FBEA 1NFWA 4P02A 2C4FH 1SQAA 4Y8ZA 3PV4A 1C5SA 1EP5A 2H9EH 3A81A 4D9RA 3ZVAA 5L30H 2SNWA 1EASA 3T62A 1O5BB 2HOBA 3GICB 4TPYA 2OTVA 1O2ZA 1QY6A 3ATLA 2OD3B 1P04A 3DSGA 5EODA 1O0DH 1G3BA 5CHAC 5HM2A 1KXAA 1KIGH 3EYDA 2G8TA 4BTIB 2WYJA 2UWPA 3M5MA 3P6ZB 1SGFA 5B6OA 3V13A 2J94A 1BTYA 1BMMH 1GJ4H 1GJ7B 1ETTH 2FPZA 4M7GA 1MU6B 3F68H 1DY8A 1VCWA 3BTEE 1DSUA 4XD7D 4Y71A 3SV6A 1SQTA 3A87A 1SL3A 4CRCA 1K2I1 3OE7D 2G55A 4NA7A 3SV9A 2BD5A 4DGJA 1OWDA 4CBNA 4GSOA 3ATKA 2B9LA 3TGKE 2XC5A 2ZPSA 1OX1A 2ZC9H 1UVTH 3RXOA 3F2FA 2C8XB 1O5CB 1GDQA 2HNTC 5DP5A 1QIXB 3O8BA 1ANDA 1FY1A 1ZJDA 5FAHA 5C5NA 1SSXA 1BMNH 1P8VC 2C3SA 1G37A 2G5NA 5EW1H 1C1QA 3QTOH 3D65E 1V2WT 4IS5A 3RXFA 1E0FD 1O5AB 2FXRA 2ZHWH 4MNWA 4OS6A 4ABGA 3ZVBA 4ISLA 2PSYA 2WPKS 1UTJA 3CS0A 3AAVA 1SR5C 1YPEH 3TH2H 2J9NA 1VGCB 1O2MA 2Q1JA 1ARBA 2A32A 3DFJA 1Y3UA 4RKJB 2FODA 1SC8U 3SUGA 4NWLA 1A5HA 2BLQA 3M3SA 1XUJA 2BHGA 2RDLA 1L4ZA 1GDUA 5GCHG 4ZXXH 3PLPA 4WH6A 1RD3B 1VJAU 4ZKNU 1AVGH 3GS9A 2O8WA 1CA0B 1SGTA 4ISOA 2ZHEH 3SQEE 1UTLM 1KLJH 3RLYH 1HPGA 1GMCG 2ZU4A 1O5DH 3RXSA 4AFSA 1O3EA 4TPIZ 4ZKOU 1TIOA 3SU2A 1OWKA 5EXMA 4A1VA 2W7SA 2J97A 1GJDB 3MNBA 1KTTB 4H6TA 5EQRA 1K9OE 1MBMA 3T27A 4NA9H 5FXLA 1MCVA 5EPYA 2FOGA 5GCHF 1A1RA 2A2QH 3FZDA 1EUFA 1HYLA 4FU7A 3U8TH 1KY9A 1Y59T 4JK6A 4I31A 1C5LH 2UUYA 1O2KA 4FVBA 3GYMA 1C1PA 1GL0E 2PHBA 3HKJB 5ABWA 1G36A 4X6OA 5C20A 1HAVB 2F3CE 1UMAH 1Y5UT 1GMHF 5ESBA 3ZZ3A 1AE5A 2R9PA 2BLWA 1J9CH 2P8OB 3IG6B 4IN1A 5CDFE 1XUFA 1ESBA 1FX0B 1XVOA 1BOQA 3BF6H 5A0CA 1F2SE 2QC2A 2ZA5A 1HDTH 4XRNA 2ZKSA 3RMOH 1UTMA 3MOCA 2BZAA 2G00A 2ZDKA 3FZZA 1EZSC 3LH1A 3VFEA 1SFQB 4ABAA 1OWHA 3SQHE 4X2VA 1KDQB 5LGOA 1C5YB 2VU8E 2Y5HA 4WY3A 5DGJA 4ACAA 1TYNA 3FP6E 3MWIU 2G4UA 5A8YA 1NRPH 3U8OH 4F55A 3KNXA 1HJ9A 2A5AA 1EJAA 1GBLA 1UVOA 3PWBA 4NWKA 2CMYA 2QE7D 2PGQB 3GCTG 1Z1JA 1D3QB 3LDXH 4JZFH 1O32A 1Z71A 3QGJA 3F2GA 4LZ4B 4JMYA 1C5ZB 3DSPA 2AERH 1QBVH 2BD3A 1OHHD 3D49H 2VH6A 1E35B 2FX6A 3RXDA 4TY7A 1LQDB 2ZU2A 4ZMAH 1P57B 1Y5BT 2ZFTA 3S9AA 4CBOA 1O2PA 1P2IA 1SLXB 4UE7H 3OTPA 2HRVA 4B75A 1ZTJA 1PYTC 2QXIA 3OFND 1EP6A 1CA8B 1VZQH 3PMBB 1UCYK 3RC4A 1CHOG 2OC1A 2AMDA 1SQRA 3HGNA 3ZZ7A 4K60A 2TGTA 2SNVA 1TPSA 4Z0KA 4BXWA 2WPLS 3AW1A 1PPZA 4F4OC 1TBQH 4E7RG 1NTPA 1ZHMA 1A0JA 2BDBA 3BTGE 2BQ7B 1CBWB 1FN8A 2KCAA 2XWAA 2Z3EA 3MO6A 2ZGJA 4Q63A 3PM3A 1L1NA 2PGBB 2BOHB 2RDEA 5HIYA 1T8MA 4D7GA 5J4QA 2NWNA 3EE7A 3AW0A 1QL7A 1UTPA 2QYIA 2R0LA 3MI4A 1QJ1B 1PPHE 2BQWB 3EA9A 4KTCA 3KQEA 2R3YA 3NKKA 1TGSZ 3UNSA 1HGTH 1SB1H 3GCHB 3M3VA 1GI2A 4X1PU 3UNRA 1K28D 1GBAA 1PQ7A 1G3CA 1V2OT 2A1DB 1XKBC 2VWLA 1T8NA 3H09A 1Y3XA 4OGXA 2W26A 4I8JA 5AHGH 3U8RH 3BV9B 2D26C 1G3DA 1AZZA 1EPTB 3C27B 1C5UA 4O9VA 3NK8A 4MPVA 2BDGA 2Z6BD 4X2XA 1TMTH 3UR6A 1IQNA 1K1IA 1W0ZU 5K7RA 3ATMA 1C4U2 1NO9H 5E8EH 2LPRA 3M37A 1WV7H 1AGJA 1GHYH 4ASUD 3P17H 1W11U 1TLDA 4CRAA 4ZXYH 2ZFSA 4HFPB 1OWJA 2WINI 4BAOB 1O3NA 1SMFE 4IGDA 1EB1H 1BTUA 1GI7B 2VWOA 2STBE 3ZZ4A 1O37A 2WPIS 1NZQH 3S0NA 1M9UA 2ZNKH 1WCZA 3KCGH 1ZPCA 1C2EA 4FVDA 9LPRA 2K8IA 1BRCE 3A7XA 1HBTH 2WSSD 6GCHF 2TGDA 1GI6A 3MU1A 1EOLA 2PKAA 1T31A 2JKHA 1IQJA 1OSSA 1GI8B 1AKSB 2L6OA 3GY7A 4Y7BA 1NU9A 4ZCNA 5K0HA 4I7YH 2DE9A 1EQ9A 1HIAA 5IK2D 2CHAB 2P16A 2PV9B 3SJOA 3SGQE 5C17A 1O2XA 4ZHAA 8GCHF 4E06H 2HPQH 4M9FA 3M35A 2ZTZA 2GDDA 1LQEA 2ZFQH 1P06A 3AAUA 1ZSKA 2GT8A 2YMSD 3FKSD 5T1VA 4D8NA 4K3JA 2J4IA 1CA0C 1OWEA 2GCTB 1QB1A 2VIOA 3A8CA 1J15A 1E36B 4YXWD 5BPEA 2W7UA 1H9LB 1QA0A 1CE5A 3E1XB 2CXVA 2HNTE 1YPHC 5LPFA 1OPHB 1QL9A 2AIPA 3TPIZ 2OCVB 3T5FH 2ZO3H 3BG8A 2QF3A 1DLEA 3GY4A 3UWIA 2EC9H 4BNRA 1QRWA 2UWOA 5EXNA 2NU3E 5F8XA 3RXJA 4AFUA 1E79D 4LK4A 5TJXA 4JZ1A 1OWIA 4RT1A 3PTBA 1C1UH 3MO3A 3RXRA 3SUEA 5KEDA 4LZ1H 5T6GA 1GG6B 2FI5E 2RG3A 1BHXF 1F92A 4A92A 1O3FA 4RN6A 4INHA 2FI4E 2CV3A 4WMFA 3L6PA 1THPB 4IC5A 2ZDAH 2ODPA 3F3BA 1V2MT 2VIVA 2ANMH 1DWCH 2KCOA 2J34A 2HALA 1O3JA 1UO6A 4O3UA 4CHAC 4CHAB 1TWXB 3H5CB 5EXLA 1GVZA 1MKXH 1UTQA 3BEIB 1W0YH 4ABJA 2FWWA 1P2KA 3TVJB 3STIA 1YP9A 2RFKC 2RCEA 3SHAH 3HK3B 1CU1A 1LVMA 1UTKA 2H9HA 4CRBA 3PROA 1RXPA 2XBWA 4ZH8A 1KXCA 4WF8A 3RMLH 4X6MA 1A4WH 4UEHH 3EAJA 2D8WA 3F0PA 1GI3A 2ZGXH 7LPRA 3M7QA 3U9AH 2VJ1A 5DP7A 1AN1E 2ASUB 2A4QA 2FZZA 2ILNA 2OC8A 3MHWU 1P2NA 1O2UA 1W14U 1QRZA 2VIWA 4JCNA 1F0TA 1W7XH 1INCA 3NRLA 1BQYA 3S69A 1DITH 5SGAE 1ZTLA 1L4DA 4INKA 3URCA 3SNCA 1HAOH 2JJ1D 3P92A 2KFWA 1LHGH 1W0JD 2QF5A 2ZFRH 5A8XA 2EI6A 2XNDD 1NESE 1K1LA 1VCQA 3TIUA 4LOYH 2FOFA 1C5NH 1L2EA 1EPTA 1F0UA 1H8IH 3S9CA 1XXDA 1UW7A 2ZU1A 5EOKA 1DLKB 3DHKH 1MQ5A 3LT3A 1FY5A 2H2ZA 1GBIA 1VITH 3VPKA 1ETRH 3RU4T 5GXPA 1YBWA 5A2MH 2VH0A 2Z3CA 2BD4A 3KQCA 1BJUA 1MD8A 1AFEH 1IQHA 2Y5GA 4Y8XA 1WTGH 4KTSA 2F91A 3FOAA 3GOVB 2BQ6B 1ZR0A 2BD7A 1MAYA 1TGNA 1Z8JB 4DVAU 3NPSA 3PV2A 3ATIA 1FNIA 1AB9C 5IYTA 1MTSA 1YLNA 4MLFB 1EX3A 4BAQB 2J98B 5GDSH 1O2HA 1MBQA 3KIDU 3RU4D 3S9BA 2B7DH 3QGNB 1AWFH 1TNJA 1AKSA 1GCTB 1D3TB 3ENSB 4UD9H 4RSPA 4B1TA 2HLCA 1Q3XA 4CRGA 4X6NA 4GCHF 1ZRBA 3SU0A 1QZ8A 1AMHA 2CJIA 1N1LA 1U6QA 2BYAX 4A1XA 1CO7E 1Y3YA 2BXTH 2YMSC 1O2VA 3UY9A 3ATWA 1C9PA 1LTOA 1FDPA 1BRUP 3F0OA 4F48B 2HVYB 1FQ3A 4AC9A 3MH4A 1GL1A 3U98H 1O2YA 1MH0A 2ZFFH 4YLQH 3PO1C 2JH0D 4AOQA 1GHAG 4ZAEA 2GT7A 4CREA 2FX4A 3RUOA 1G2MA 3ITIA 1TPOA 2WPDD 4O97A 4Q7ZA 2PKAB 1O2JA 4DCDA 2ZP0H 2NU0E 4XDEA 1GBKA 3TNTA 4FUCA 1P2OA 2GX4A 2PFEA 3E90B 2QY0B 1E37B 1ELBA 3P8OA 3F6UH 3ZZ9A 1S5SA 4D76A 3BN9A 1FPHH 2PUQH 2SGEE 1YPKH 2JJ2D 3KYGA 2FYRA 4DT4A 2ZFPH 1G2LA 2SGPE 1YKTA 5JBCS 2OXSA 1HRTH 1P03A 4GLYA 1FLEE 3PO1B 4XBDA 1YM0A 4HTCH 1UTNA 4MNXA 2FOHA 2IJD1 4DW2U 1ZYOA 1ELCA 1EPTC 2ULLA 9ESTA 3O8RA 1O3OA 1GVLA 2VGCC 1ELAA 2I6QA 1GGDB 2P93A 5EQSA 5FPYA 5FCKA 4K1EA 1PPGE 1TGCA 2FS8A 1KMHB 3SI3H 1EOJA 1HFDA 4YTAA 1PPEE 4A7IB 1NT1A 2SGFE 3UQVA 1L0ZA 1TPAE 1TNIA 1MMJN 1OYTH 1QCPA 2PR3A 3D62A 1EJMA 1D9IA 2JDID 3PYHA 5EU8A 1FMGA 5CE1A 5DJ7A 1QBOA 3TITA 4X8TH 1FIWA 4IMZA 3GCTF 1GJ6A 1YPJH 3SYJA 2F9VA 2ZHQH 4GPGA 2LP6A 4NG9H 4YO9A 2WV4A 3ZYDA 1BA8B 4OM9A 1NBME 4BTTB 3RXTA 1ZSJA 4ZKSU 3Q77A 1F7ZA 1SGPE 3VB5A 5DO4H 3QUMP 1C5PA 2K0QA 3E0NB 1GBEA 1GBBA 2XXLA 4RT0A 1AB9B 1PYTD 4WXVA 1GJBB 4UFFH 1DT2A 1ZGVA 3UREA 1TGTA 4X2YA 3SBKA 3SGAE 3UWJH 1NRSH 2ZDLA 5C1XA 3PB1E 3RXPA 3LGYA 5DP8A 3RXQA 4A5TS 1C5WB 3DCLA 1EAUA 2F43B 4K2YA 3LGUA 1HJ8A 2KCYA 4X1RU 2A45B 3MYWA 1FJSA 3ZZAA 3SNBA 2A0QB 1GG6C 1QBNA 4OS5A 1DUEA 3PTNA 1K22H 1AD8H 6GCHG 1IAUA 4UONA 1JBUH 3N7OA 1NS3A 1XXFA 5A8ZA 5FX6A 1NBMD 1V6DA 2AHME 1ZOMA 3EA8A 1F5LA 1O2NA 1V2VT 5HXFA 1B0FA 1ZPBA 1ORFA 1MTNC 1TNHA 2V3HH 2FP7B 3GYLB 1C2MA 3LU9B 2GP9B 1DOJA 1C1SA 2PKSC 4CRFA 2A4GA 4MVNA 1V2KT 4NFFA 3TNSA 4H4FA 1WQSA 3M5OA 1CHOF 1S0RA 4FOUC 1XMNB 2Z9GA 3BTDE 1H9IE 3IWMA 4KTUA 1DWBH 2WYGA 1T8OA 1BTZA 2HPPH 4NCYA 1GHBF 1ZZZA 3WW7A 2ZGBH 1ID5H 1IQGA 5A09A 1CVWH 3P8NA 1ANBA 1K0HA 2H9TH 2ZF0H 1NRRH 2WV5A 2F9BH 2AFQB 2GMTC 1H8ED 4NIVA 1C2JA 1UVPA 4U30A 1UK4A 3RXEA 1EB2A 3KQ5A 4YOJA 4MTBA 1SKYE 4FUFA 2WPMS 1K1NA 3EE0B 4DOQA 1C1TA 1S0QA 3OU0A 1O2IA 4AN7A 1GI0A 2Y5FA 2AH4X 4X8UH 1KTSB 1DUAA 1JIMA 5C1UA 1O3LA 4K1SA 4WMDA 2W5EA 1WU1A 2UUJB 3ODDA 3VGCC 3VG8A 5CHBA 2BY6X 5I25A 1XKAC 1WSSH 1HCGA 3UIRA 2V3OH 2C93B 2XOKD 1LHDH 1O3GA 3M61U 2RA3A 1H8DH 1FI8A 1TB6H 2VIDA 2EI7A 3F2HA 1GBHA 2BY7X 4KGAA 1SBWA 4A1TA 5F03A 1GHVH 3ZVCA 2FESH 3M3TA 1D6RA 4ISNA 1E1RD 2J92A 3RDZA 2IJOB 5L2ZH 3OX7U 4JYVH 4XFQA 3SNEA 2GTBA 3BTKE 3FP7E 1K1MA 4B6EA 1DY9A 1THSH 2XCNA 4AFZA 4DJZB 1V3XA 1CSOE 2O8UA 1CHGA 2CF8H 3NXPA 5PTPA 3SV8A 6CHAC 4U32A 5BRRE 1P0SH 1IOEA 3A7WA 1O5GH 1YPHE 4GAWA 1EAIA 3UPEA 1QQUA 1AIXH 3O8CA 3MH5A 3OY6U 2CK3D 2AGEX 3LIWA 1ELVA 1VCPA 3KYFA 4WWYA 1KLTA 2C8WB 1AUJA 4AB9A 5EJ1A 1BTHH 1IHSH 1LPGB 3RM2H 4BTUB 3CS7A 1OKXA 3LH3A 2WUBA 2Y7ZA 4Q7XA 2XBXA 2GD4B 2ZECA 1Z6EA 2ZQ2A 1LHEH 1V2LT 1TX6A 3S7HB 1BZXE 1C5RA 3PMJA 2XBYA 4Y76A 3ZVFA 3SZEA 4THNH 3E8LA 1AHTH 1SGDE 3P70B 3MO9A 2ZU5A 3MFJA 2Z7FE 4R8TB 2BVRH 1SGIB 3I78A 1TBRH 2OINA 3UR9A 3E6PH 4X1SU 4X0WU 1W12U 1MAXA 3STJA 3K2UA 5EGMA 2GVFA 1WBGB 1Z8RA 2AYWA 1MCTA 1P2JA 2M5TA 2VWMA 1DPOA 1GHWH 4FUIA 2ZCKP 5C3NA 1DICA 2J5UA 1ELGA 1ANCA 5ESTE 5KGOA 1DXPA 1FY8E 1FV9A 3GY6A 5F8ZA 1L1GA 4RKOB 3SU1A 2STAE 3CNRA 1NC6A 1CT0E 2F9OA 4TWWA 4B76A 2Y81A 2FI3E 5FCRA 4MNYA 4NZQA 1A61H 1LCYA 4B2AA 5C67A 3BIVH 3TK9A 5E0GA 1IQIA 2BY9X 2VBCA 1YCPH 1GHZA 3A7YA 1OS8A 1C2FA 1TNGA 3V3MA 2KAIA 1C1OA 3QK1A 2BVXH 6CHAB 2EEKA 1EJNA 1LPZB 1EZXC 2BDAA 4ZROA 3T26A 1HJAB 1PPBH 2A4OA 2JH5D 1O3BA 5JYIA 1ZMNA 3CENA 1TGBA 2ODYB 3VB7A 1N6XA 2WV9A 3A7VA 1C5XB 1D3DB 3UOPA 1O33A 2FOMB 1W0KD 3SN8A 7GCHG 4OS2A 1JMOH 4DY7B 1FAKH 1COWD 1NY22 1XX9A 2EY4C 1ETSH 3N7DA 4J2YB 2PLXA 1E34B 1UHBB 1K1PA 1OXGA 1WUNH 1C1WH 5DSFA 3RMNH 4BAKB 1AY6H 4E7NA 1F0RA 1HAVA 2AS9A 1X7AC 3MNSA 3UNQA 1VKYA 2JIZD 3UB0A 1O2RA 1XUIA 4XSKU 4ACBA 1UVUH 1GJAB 1P09A 4I32A 2A2XH 2G51A 2JH6D 2V7QD 5DP4A 4D9QA 4OS7A 1NFUA 3FVFB 5EQQA 4GVUA 3M5LA 1HAPH 3ZZBA 2O8MA 1AVWA 3SHCH 5EW2H 3BIUH 1O2TA 1OP2A 2SGQE 4XE4A 1TAWA 3TH4H 2VB0A 4UFGH 3TH3H 1VITG 4IW4E 1O3PB 4IN2A 4JYUH 4Y6DA 4DIHH 3I29A 3A83A 1BTXA 1HAIH 5HMAA 4VGCC 2Y7XA 3TGJE 4ABDA 1A0HB 1GBMA 1GBFA 3KEEA 2R0KA 2P94A 1BTPA 2Y80A 1J17T 3U28C 4GCHG 1BDAA 1EZUC 1WDIA 1C1VH 3O8DA 4Y7AA 1Y5AT 2P95A 3GCNA 1TRYA 4YM9A 4NGAH 2FOEA 4O3TA 2AGGX 4YOGA 3ESTA 1SLUB 1SGYE 2A5IA 1RTFB 1RTLA 2GMTB 2WPJS 3LGWA 3RC6A 3NWUA 2XWBI 1LKBA 2GZ7A 2A7HA 1B5GH 1DX5M 1AO5A 4INLA 1B7XB 1IQKA 2HWLB 1KXEA 2GCHG 2WZQA 3SW2B 3RXVA 1C2DA 2ZPRA 3SOSA 1MTUA 4I8KA 1O3IA 3HGPA 2V3MA 1N6YA 2BLOA 2AMPA 4OS1A 1KXBA 1TFXA 3SUDA 5B6LA 4K1TA 1P9UA 3GCHC 3E16B 5E2PA 4WMEA 1GHAF 1LVBA 1PPFE 2ZI2H 3L3TA 2BZ6H 2BXUH 1YCPK 4GUXA 2FLRH 1QA7A 3NZIA 2A7CA 3R0FA 2H5CA 4A6LA 3PLBA 2DE8A 4X6PA 1ZHPA 2GCHF 3RLWH 1DANH 3ZZCA 2F83A 4UFEH 1Y3VA 3U1IB 2PWXA 1RIWB 1DE7H 2CHAC 5L2YH 1GJ5H 3ZVDA 3RXAA 4FU9A 4NA8A 1MD7A 2Z9JA 4WXIA 1HLTH 1SGEE 1WOFA 4ISIH 3V0XA 8LPRA 1SI5H 1SFIA 3GCOA 5T3HA 3TK5A 1HNEE 2BY5X 5T6FA 1S84A 1E38B 1KXFA 3A88A 1YY3A 2EI8A 2J2UA 1S6HA 1AQ7A 2OLGA 1BMLA 3M36A 2Z9IA 1SOZA 1GJ8B 1ESAA 3KL6A 4ABEA 1QL8A 1A3BH 2O9QA 5DK1A 2BB4A 4GHQA 2BM2A 2BVSH 3MU5A 3FO8D 3BSQA 3Q00A 1QNJA 2W3IA 3SNAA 2BTCE 2GCTC 3SU5A 1SGQE 1MTNB 5TCAA 1ELDE 1UHBA 1PQ8A 2ZPQA 3E3TA 2FOCA 2P3UB 1Y3WA 3TJNA 1CT4E 2TRMA 1O3HA 4FUGA 5HGGA 1HV7A 4RI0A 1D3PB 1L1JA 3VB3A 1NU7B 2HVXA 5L6NH 1C5VA 3FANA 3GDUA 2ANWA 1BCUH 3OAAD 1LHFH 3MU0A 1H4WA 1BHXB 1C9TA 2FYQA 1TX7A 4Q80A 3PLKA 3ZIAD 2ZIQH 1F5KU 2A5KA 2ZQ1A 2QXHA 4FUDA 2YNAA 5HIZA 3H7OA 4Y8YA 1N8OC 1BBRH 1XVMA 1GGDC 1YPLH 2BDHA 2J98A 3SO3A 2R3UA 4D7FA 1J8AA 4Z1MD 1UTOA 2WPHS 1GMHG 1ANEA 1P10A 1TOCB 1O31A 5E2OA 3ZYEA 1LHCH 1TBZH 4K8BA 4KELA 2HNTF 3MH6A 2CN0H 1FY3A 1GBCA 1PFXC 2XNIA 2P3FH 2A7JA 5FL7D 2OC7A 1HAHH 1MUEB 1W13U 4YT7H 2ZHDA 4KP0A 3TJUA 4IC6A 1IQMA 1BB0B 4Y11E 1VITF 1YPMH 3F9GA 4K5ZA 4YOIA 2QXJA 3LGTA 3RXIA 2G52A 2ODQA 1RIWC 2NU2E 3KF2A 3IITA 4I8LA 5DP6A 1C2KA 1BMAA 3QTVH 2OUAA 3ZZ8A 3E91A 5CHAB 1SGNE 1QGFA 3KQDA 1MKWH 2TBSA 2SFAA 4MPWA 2XYAA 1AZ8A 3OY5U 2CGAA 2ZTYA 2Z9KA 2G4TA 3GDVA 2EA3A 1BIOA 3MNXA 5EIYA 1PQ5A 2F9NA 4O03A 1HXEH 2ZZUH 3BG4B 1YCPM 1ZLRA 2XW9A 2VVUA 2Y6TA 4FUHA 1ZSLA 3F9EA 3HATH 3LOXA 2KAIB 1K1JA 1JRTA 2PTCE 3G01A 1YGCH 5C94A 4ABIA 2B5TB 2ANKH 5FX5A 3RP2A 2HGTH 2FO9A 1EAXA 1TRMA 3BTME 4CR9A 2ANYA 4DURA 3B23B 1XUGA 4SGBE 1FXYA 4ABBA 4TSFD 1P12E 1D4PB 1GJ9B 4J1YA 3A82A 5F6MA 2FIRH 1BBRE 2ALVA 4NZLA 3V12A 2FS9A 2OBQA 4ASHA 4TT3D 2ZDVH 1O35A 1V2NT 4JZIA 2QAAA 4I8GA 3MU8A 4VGCB 1TRNA 3RC5A 1JXPA 2VIPA 3QO6A 3QZQA 3T2NA 4BAMB 2IN2A 1TNKA 3ZV8A 2ZCLP 2O8TA 3UFAA 1GWAA 4AFQA 1MQ6A 1V2ST 5EPNA 3OYPA 1EXFA 3SU3A 1ZRKA 1YWUA 1N8OB 2FLBH 2GZ9A 4XOJA 3BTHE 2ZU3A 5KECA 3SU6A 1ZJKA 1OP8A 1TA6A 3ZZ6A 1WYKA 4AGJA 1XUHA 1HAXB 1XUKA 4X2WA 4Y10E 3ZVEA 4YESB 5FHTA 1ELFA 3GY2A 3FN8A 5A0BA 1S81A 5G4BA 4B6FA 1G9IE 5DP9A 1YC0A 3SU4A 3DD2H 1ZHRA 1PPCE 1TQ0B 1CGHA 2ZG0H 1H1BA 1BUIA 3TK6A 2UWLA 4DIIH 2J38A 3H7TA 8GCHG 2O8LA 1SGRE 3TJVA 1O2WA 2B8OH 1SLWB 5DP3A 1EAWA 1CGJE 1GHXH 3P95A 4CRDA 3A7TA 2VNTA 1HB0B 4H6SB 4YZUA 3MU4A 2FEQH 1O2GH 3F9HA 3F1SB 4TYDA 4DT7B 1ZMJA 1C2LA 3UUZA 3SGBE 2VVCA 1C1RA 2SGDE 1LPKB 1YPGH 5FPSA 1GMDG 2PUXB 2GV6A 2NU1E 1BRBE 2NU4E 1AUTC 3LONA 1VJ9U 1GBTA 2GKVE 1V2UT 4B2BA 5C2ZA 4YLUA 2QF0A 3FAOA 3SJ8A 4ZKRU 3AVZA 4BXSA 1GCDA 4ZUHA 1GVKB 1TMUH 2ZDNA 1MU8B 3Q76A 1C4V2 1NFXA 3A89A 1FAXA 1NN6A 4ABHA 1TX8A 4Q2KA 2ALPA 1A3EH 4ABFA 4AGKA 2YOLA 2BDCA 3AASA 2Z3DA 8KME2 2SGAA 5JBBS 2QIQA 3P8FA 1QB6A 1P3EA 2ZHFH 2F4LA 1WXRA 4FETA 4ZHMU 1MZAA 2ZGCA 1LO6A 1TABE 2XRCA 3BG4C 3EGKH 3EQ0H 4X8SH 1QHRB 1DFPA 2ZWLH 1SOTA 4I33A 2XCFA 1VR1H 3HKIB 1FZZA 2W6ID 1NPMA 1QJ7B 2KR7A 3LGIA 4B2CA 2A31A 2QF4A 4CH8B 1GPZA 1TONA 1V2JT 1W7GH 1OP0A 1TNLA 3L33A 4GHTA 2OQ5A 1TALA 1O2SA 1WTHD 3TGIE 3SUFA 2Q6FA 2WUCA 2KM0A 1MTWA 2BD2A 1T4VH 2H5DA 2XC4A 1QRXA 1UVSH 4WVPE 4B73A 1SQOA 1RRKA 3W1EA 1KYNA 2IPHA 2WHXA 3LKWA 2JETC 5DKMA 1BITA 2ZCHP 1O2LA 3QDZB 2VINA 1Q2WA 3LJOA 5AFYH 2B0FA 2EQNA 1QR3E 1TPPA 2VGCB 5E0HA 1UK2A 1FPCH 4IMQA 4UFDH 4K8YA 1BMFD 1AWHB 4MPUA 2QA9E 4Z6AH 4H42U 2GDEH 3Q3KA 1DXWA 1DSTA 5JBAS 1QFKH 2OBOA 1Y8TA 2UUKB 4I86A 2PP6A 2Z9LA 5EG4A 1BTWA 3A86A 1GJCB 3SNDA 1BBRK 1P02A 1V2PT 1ABIH 1UCYE 2THFB 3FP8E 2GZ8A 4HG6A 4NIWA 7KMEH 3RU4E 1Z8GA 1T7CA 1RTKA 1HAGE 2FTMA 1C5QA 2OQUA 3A8BA 4F49A 3V7TA 2A4RA 4NIYA 4P00A 1FUJA 3M7UA 2XTTB 3T25A 5JPMH 4OS4A 2BD8A 5I46H 4SGAE 3OSYA 2IPQX 4X1NU 1QQ4A 4BAHB 2FOAA 1O39A 2ZEBA 4IBLH 3UQOA 1QB9A 2PKSB 4NSYA 5EJZA 2F9UA 3B9FH 3SI4H 3TLOA 1AU8A 1J14A 1O34A 3MTYA 1O3CA 5JB8S 3UOUA 2R2MB 2L74A 5E0JA 1DM4B 5A0AE 2Q6DA 2QXGA 3AK5A 3SJIA 1C5OH 3NUMA 3PMHB 5FBIA 2CF9H 4AYYB 5LPRA 4TY6A 5DPAA 2P3TB 3ELAH 1KLIH 3ZV9A 1HIAB 3M5NA 3PV5A 4MPXA 4X8VH 1P2MA 1JWTA 4JYTA 1P05A 2D1JA 3K9XB 1O30A 5HM9A 1SGCA 1WQVH 2KCPA 3GISB 5JBTA 5LPEA 1IQFA 3LGVA 4PROA 3VGCB 3ZZDA 3LJJA 3LPRA 3RXHA 5C5OA 3Q3YA 1TQ7B 1K1OA 4TWYA 1ZPZA 1SGFG 2QCYA 1A5IA 5EJLA 1ELEE 1VGCC 1H8HD 5AFZH 4MNVA 1ZTKA 2LNCA 1J16A 3QZRA 2Z94A 5HKKD 1MZDA 2ESTE 5AVDA 1HAZB 3PRDA 1JRSA 2KZ4A 1GDNA 1W2KH 4QT8C 1S82A 1GI4A 3BEUA 3VB6A 1ABJH 5JDUB 4Y0ZE 4FUBA 4ISHH 1TE0A 1O3MA 1AFQC 4FUJA 2TGPZ 1FONA 2OP9A 1HUTH 2C90B 3Q3XA 4XBBA 4ESTE 4CH2B 1C1MA 2BOKA 1S6LA 3CP7A 3QWCH 4MDSA 1S6FA 2JETB 3MMGA 3WWFA 1XM1A 3GY3A 1SHYA 5C0UA 1BJVA 1NM6A 1GMCF 2ZGHA 2AIQA 3WY8A 3S7KB 4YT6H 3PRBA 3RXLA 1O38A 3GDSA 2LELA 1C2HA 3T28A 1C2GA 1AE8H 1Z6JH 1HXFH 4B71A 3JZ2B 1Q31A 1GBJA 5TCCA 1ELTA 2F9PA 2V35A 3SORA 1O2OA 2Y82A 3DFLA 1HAYB 4NSVA 4WH8A 2BMGB 3SZNA 2FOBA 3EA7A 1DDJA 4JZDH 2YMSB 4NIXA 5IDKA 4JZEH 3VXFH 3GY5A 3LC3A 5C0TA 1C2IA 1ARCA 1RS0A 2M2AA 1PJPA 1GI9B 1RJXB 5DG6A 2GJGA 4HZHA 3W94A 1G30B 1C5TA 3T29A 1P9SA 1Z8IB 1THRH 3B8JA 3VXEH 1LVYA 2G5VA 1QJ6B 4BANB 1A0LA 2OK5A 1NROH 3DT0H 1QURH 3RXGA 1A46H 4DG4A 1S85A 3EDXB 3N7EA 2I6SA 1TA2A 1UCYH 3N99A 3LC5A 3A84A 4LXBH 1AI8H 2BX4A 3M7TA 1EZQA 3ODFA 1OOKB 1EFRD 3P8GA 1RFNA 2ZTXA 2RA0A 3HK6B 2W3KA 1V2QT 1ACBE 1YLCA 1UK3A 1F5RA 1EKBB 5ETXA 4R0IA 3PWCA 4AZ2B 5F8TA 1BT7A 2VIQA 4U01A 2TGAA 2QGRA 4UDWH 2K1QA 3JZ1B 3D23A 3A7ZA 1JOUB 4AG2A 5H4IB 3VEQB 5F53A 3A85A 4X1QU 2XC0A 2W6JD 3K6YA 3BEFB 1T4UH 2FM2A 2D2DA 1Z7KA 3A80A 1Z1IA 3R3GB 4I8HA 3U1JB 1DS2E 1WAYB 2BDIA 4CR5A 1JIRA 3OEHD 2TIOA 2G81E 4BOHA 2YNBA 2C8YB 5T6DA 1GBDA 3SJ9A 3RM0H 4FUEA 3RXKA 2Q6GA 3PMAB 4AYVB 1DWEH 4Y79A 4MQAA 2GV7A 1A2CH 2PSXA 3K6ZA 1P01A 1P11E 1MTVA 1NRNH 1C5MD 5HYOA 3GY8A 2BY8X 1CGIE 1K21H 4ZHLU 3QX5H 3A8DA 3UAIC 1YF4A 2PW8H 2P8OC 3SV7A 3MNCA 3SJKA 2BDYA 1LMWB 2FTLE 1UJ1A 3HPTB 2H1UA 1FY4A 4OGYA 1OYQA 1G32B 1O3DA 2UUFB 2AEIH 3BTTE 5AF9H 1YLDA 1CBWC 4Y0YE 1AFQB 3C1KA 1SLVB 3MH7A 2BD9A 4JK5A 2V6NA 3DSOA 3TJOA 1C4Y2 5LH8A 1W10U 5GNDA 1S83A 2HLDD 8ESTE 3ZZ5A 1G3EA 2GGVB 1GHBG 1SPJA 1D6WA 2AMQA 1O3KA 2R2WU 1HJAC 1LDTT 1O3AA 5J4SA 3BTWE 3KHVA 1IQEA 5C1YA 1O5FH 3QN7A 1V2RT 2C8ZB 4Q7YA 1EATA 1FIZA 1FN6A 1ESTA 3BTFE 1MABB 4HGCA 1H9HE 4FXGH 2VVVA 5GIBA 2XBVA 1T8LA 3K65B 1T32A 1IQLA 1CQQA 4HI3A 3ZVGA 1AVXA 1SVPA 4AG1A 3FFGA 1V2TT 2ZDMA 7GCHF 2AGIX 3BTQE 3RXCA 3MQKC 1IHTH 1LKAA 2VWNA 3NCLA 1SHHB 3A8AA 4K69A 1A7SA 2BLVA 1B0EA 1NRQH 1LVOA 3RMMH 3VB4A 1F0SA 1A5GH 3RXMA 1CT2E 2H6MA 1TMBH 1YYY1 3RXUA 4AX9H 5CMXH 1P2QA 3KQBA 7ESTE 2DUCA 4KKDA 2V0BA 1KDQA 1W3CA 4XBCA 1ZGIA 6LPRA 1QTFA 1NFYA 6ESTA 3U69H 2J95A 1O5EH 3DUXH 3W95A 2P59A 3OEED 1GI5A 4E05H 1BRAA 2QN5T 1KSNA 1DWDH 1W8BH 2FDAA 2FMJA 1C1NA 5FPTA 1MKWK 3TU7H 3QLPH 1TOMH 5GJ4B 4AORA 3SV2H 3E0PB 4NFEA 2TPIZ 2KX4A 2IOTA 4Q4LA 1RGQA 3DA9B
chains in the Genus database with same CATH topology
4U2WA 1DVAH 1GMDF 3KGPA 2QV1A 1GCTC 4FU8A 1O36A 2PTNA 3F9FA 5GPIB 1P3CA 4AB8A 3I77A 3UTUH 3URDA 3OTJE 1KXDA 3KN2A 4MG3A 4WJG2 1MKXK 3RXBA 1SG8B 4B74A 2BX3A 2OC0A 1ZMLA 5GWZA 1GI1A 1O2QA 5JB9S 1PQAA 5FBEA 1NFWA 2C4FH 1SQAA 4Y8ZA 3PV4A 1C5SA 1EP5A 2H9EH 3A81A 4D9RA 3ZVAA 5L30H 2SNWA 1EASA 3T62A 1O5BB 2HOBA 3GICB 4TPYA 2OTVA 1O2ZA 1QY6A 3ATLA 2OD3B 1P04A 5EODA 1O0DH 1G3BA 5CHAC 5HM2A 1KXAA 1KIGH 3EYDA 2G8TA 4BTIB 2WYJA 2UWPA 3M5MA 3P6ZB 1SGFA 5B6OA 3V13A 2J94A 1BTYA 1BMMH 1GJ4H 1GJ7B 1ETTH 2FPZA 4M7GA 1MU6B 3F68H 1DY8A 1VCWA 3BTEE 1DSUA 4Y71A 3SV6A 1SQTA 3A87A 1SL3A 4CRCA 1K2I1 2G55A 4NA7A 3SV9A 2BD5A 4DGJA 1OWDA 4CBNA 4GSOA 3ATKA 2B9LA 3TGKE 2XC5A 2ZPSA 1OX1A 2ZC9H 1UVTH 3RXOA 2C8XB 1O5CB 1GDQA 2HNTC 5DP5A 1QIXB 3O8BA 1ANDA 1FY1A 1ZJDA 5FAHA 5C5NA 1SSXA 1BMNH 1P8VC 2C3SA 1G37A 2G5NA 5EW1H 1C1QA 3QTOH 3D65E 1V2WT 4IS5A 3RXFA 1E0FD 1O5AB 2FXRA 2ZHWH 4MNWA 4OS6A 4ABGA 3ZVBA 4ISLA 2PSYA 2WPKS 1UTJA 3CS0A 3AAVA 1SR5C 1YPEH 3TH2H 2J9NA 1VGCB 1O2MA 2Q1JA 1ARBA 2A32A 3DFJA 1Y3UA 4RKJB 2FODA 1SC8U 3SUGA 4NWLA 1A5HA 2BLQA 3M3SA 1XUJA 2BHGA 2RDLA 1L4ZA 1GDUA 5GCHG 4ZXXH 3PLPA 4WH6A 1RD3B 1VJAU 4ZKNU 1AVGH 2O8WA 1CA0B 1SGTA 4ISOA 2ZHEH 3SQEE 1UTLM 1KLJH 3RLYH 1HPGA 1GMCG 2ZU4A 1O5DH 3RXSA 4AFSA 1O3EA 4TPIZ 4ZKOU 1TIOA 3SU2A 1OWKA 5EXMA 4A1VA 2W7SA 1GJDB 3MNBA 1KTTB 4H6TA 5EQRA 1K9OE 1MBMA 3T27A 4NA9H 5FXLA 1MCVA 5EPYA 2FOGA 5GCHF 1A1RA 2A2QH 3FZDA 1EUFA 1HYLA 4FU7A 3U8TH 1KY9A 1Y59T 4JK6A 4I31A 1C5LH 2UUYA 1O2KA 4FVBA 3GYMA 1C1PA 1GL0E 2PHBA 3HKJB 5ABWA 1G36A 4X6OA 5C20A 1HAVB 2F3CE 1UMAH 1Y5UT 1GMHF 5ESBA 3ZZ3A 1AE5A 2R9PA 2BLWA 1J9CH 2P8OB 3IG6B 4IN1A 1XUFA 1ESBA 1XVOA 1BOQA 3BF6H 5A0CA 1F2SE 2QC2A 2ZA5A 1HDTH 2ZKSA 3RMOH 1UTMA 3MOCA 2BZAA 2G00A 2ZDKA 3FZZA 1EZSC 3LH1A 3VFEA 1SFQB 4ABAA 1OWHA 3SQHE 4X2VA 1KDQB 5LGOA 1C5YB 2VU8E 2Y5HA 4WY3A 5DGJA 1TYNA 3FP6E 3MWIU 2G4UA 5A8YA 1NRPH 3U8OH 3KNXA 1HJ9A 2A5AA 1EJAA 1GBLA 1UVOA 3PWBA 4NWKA 2CMYA 2PGQB 3GCTG 1Z1JA 1D3QB 3LDXH 4JZFH 1O32A 1Z71A 3QGJA 4LZ4B 4JMYA 1C5ZB 2AERH 1QBVH 2BD3A 3D49H 2VH6A 1E35B 2FX6A 3RXDA 4TY7A 1LQDB 2ZU2A 4ZMAH 1P57B 1Y5BT 2ZFTA 3S9AA 4CBOA 1O2PA 1P2IA 1SLXB 4UE7H 2HRVA 4B75A 1ZTJA 1PYTC 2QXIA 1EP6A 1CA8B 1VZQH 3PMBB 1UCYK 3RC4A 1CHOG 2OC1A 2AMDA 3HGNA 3ZZ7A 4K60A 2TGTA 2SNVA 1TPSA 4Z0KA 4BXWA 2WPLS 3AW1A 1PPZA 4F4OC 1TBQH 4E7RG 1NTPA 1ZHMA 1A0JA 2BDBA 3BTGE 2BQ7B 1CBWB 1FN8A 2XWAA 2Z3EA 3MO6A 2ZGJA 3PM3A 1L1NA 2PGBB 2BOHB 4D7GA 5J4QA 1T8MA 2NWNA 3AW0A 1QL7A 1UTPA 2QYIA 2R0LA 3MI4A 1QJ1B 1PPHE 2BQWB 3EA9A 4KTCA 3KQEA 2R3YA 3NKKA 1TGSZ 3UNSA 1HGTH 1SB1H 3GCHB 3M3VA 1GI2A 4X1PU 3UNRA 1K28D 1GBAA 1PQ7A 1G3CA 1V2OT 2A1DB 1XKBC 2VWLA 1T8NA 4OGXA 1Y3XA 5AHGH 2W26A 4I8JA 3U8RH 3BV9B 2D26C 1G3DA 1AZZA 1EPTB 3C27B 1C5UA 4O9VA 3NK8A 4MPVA 2BDGA 2Z6BD 4X2XA 1TMTH 3UR6A 1IQNA 1K1IA 1W0ZU 5K7RA 3ATMA 1C4U2 1NO9H 5E8EH 2LPRA 3M37A 1WV7H 1AGJA 1GHYH 3P17H 1W11U 1TLDA 4CRAA 4ZXYH 2ZFSA 4HFPB 1OWJA 2WINI 4BAOB 1O3NA 1SMFE 4IGDA 1EB1H 1BTUA 1GI7B 2VWOA 2STBE 3ZZ4A 1O37A 2WPIS 1NZQH 3S0NA 1M9UA 2ZNKH 1WCZA 3KCGH 1ZPCA 1C2EA 4FVDA 9LPRA 1BRCE 3A7XA 1HBTH 6GCHF 2TGDA 1GI6A 3MU1A 1EOLA 2PKAA 1T31A 2JKHA 1IQJA 1OSSA 1GI8B 1AKSB 4Y7BA 3GY7A 1NU9A 5K0HA 4I7YH 2DE9A 1EQ9A 1HIAA 2CHAB 2P16A 2PV9B 3SJOA 3SGQE 1O2XA 4ZHAA 8GCHF 4E06H 2HPQH 3M35A 2ZTZA 2GDDA 1LQEA 2ZFQH 1P06A 3AAUA 1ZSKA 2GT8A 4D8NA 4K3JA 2J4IA 1CA0C 1OWEA 2GCTB 1QB1A 2VIOA 3A8CA 1J15A 1E36B 5BPEA 2W7UA 1H9LB 1QA0A 1CE5A 3E1XB 2CXVA 2HNTE 1YPHC 5LPFA 1OPHB 1QL9A 2AIPA 3TPIZ 2OCVB 3T5FH 2ZO3H 3BG8A 2QF3A 1DLEA 3GY4A 3UWIA 2EC9H 4BNRA 1QRWA 2UWOA 5EXNA 2NU3E 5F8XA 3RXJA 4AFUA 4LK4A 5TJXA 4JZ1A 1OWIA 3PTBA 1C1UH 3MO3A 3RXRA 3SUEA 4LZ1H 5T6GA 1GG6B 2FI5E 2RG3A 1BHXF 1F92A 4A92A 1O3FA 4RN6A 4INHA 2FI4E 2CV3A 4WMFA 3L6PA 1THPB 4IC5A 2ZDAH 2ODPA 1V2MT 2VIVA 2ANMH 1DWCH 2J34A 2HALA 1O3JA 1UO6A 4O3UA 4CHAC 4CHAB 1TWXB 3H5CB 5EXLA 1GVZA 1MKXH 1UTQA 3BEIB 1W0YH 4ABJA 2FWWA 1P2KA 3TVJB 3STIA 1YP9A 2RCEA 3SHAH 3HK3B 1CU1A 1LVMA 1UTKA 2H9HA 4CRBA 3PROA 1RXPA 2XBWA 4ZH8A 1KXCA 4WF8A 3RMLH 4X6MA 1A4WH 4UEHH 3EAJA 2D8WA 1GI3A 2ZGXH 7LPRA 3M7QA 3U9AH 2VJ1A 5DP7A 1AN1E 2ASUB 2A4QA 2FZZA 2ILNA 2OC8A 3MHWU 1P2NA 1O2UA 1W14U 1QRZA 2VIWA 4JCNA 1F0TA 1W7XH 1INCA 1BQYA 3S69A 1DITH 5SGAE 1ZTLA 1L4DA 4INKA 3URCA 3SNCA 1HAOH 3P92A 1LHGH 5A8XA 2ZFRH 2EI6A 1NESE 1K1LA 1VCQA 3TIUA 4LOYH 2FOFA 1C5NH 1L2EA 1EPTA 1F0UA 1H8IH 3S9CA 1XXDA 2ZU1A 5EOKA 1DLKB 3DHKH 1MQ5A 3LT3A 1FY5A 2H2ZA 1GBIA 1VITH 3VPKA 1ETRH 3RU4T 5GXPA 1YBWA 5A2MH 2VH0A 2Z3CA 2BD4A 3KQCA 1BJUA 1MD8A 1AFEH 1IQHA 2Y5GA 4Y8XA 1WTGH 4KTSA 2F91A 3GOVB 2BQ6B 1ZR0A 2BD7A 1MAYA 1TGNA 1Z8JB 4DVAU 3NPSA 3ATIA 1FNIA 1AB9C 5IYTA 1MTSA 4MLFB 1EX3A 4BAQB 5GDSH 1O2HA 1MBQA 3KIDU 3RU4D 3S9BA 2B7DH 3QGNB 1AWFH 1TNJA 1AKSA 1GCTB 1D3TB 3ENSB 4UD9H 4RSPA 4B1TA 2HLCA 1Q3XA 4CRGA 4X6NA 4GCHF 1ZRBA 3SU0A 1AMHA 2CJIA 1N1LA 1U6QA 2BYAX 4A1XA 1CO7E 1Y3YA 2BXTH 1O2VA 3UY9A 3ATWA 1C9PA 1LTOA 1FDPA 1BRUP 1FQ3A 3MH4A 1GL1A 3U98H 1O2YA 1MH0A 2ZFFH 4YLQH 3PO1C 2JH0D 4AOQA 1GHAG 4ZAEA 2GT7A 4CREA 2FX4A 3RUOA 1G2MA 3ITIA 1TPOA 4O97A 4Q7ZA 2PKAB 1O2JA 4DCDA 2ZP0H 2NU0E 4XDEA 1GBKA 3TNTA 4FUCA 1P2OA 2GX4A 2PFEA 3E90B 2QY0B 1E37B 1ELBA 3P8OA 3F6UH 3ZZ9A 1S5SA 4D76A 3BN9A 1FPHH 2PUQH 2SGEE 1YPKH 2FYRA 2ZFPH 1G2LA 2SGPE 1YKTA 5JBCS 2OXSA 1HRTH 1P03A 4GLYA 1FLEE 3PO1B 4XBDA 1YM0A 4HTCH 1UTNA 4MNXA 2FOHA 4DW2U 1ZYOA 1ELCA 1EPTC 2ULLA 9ESTA 3O8RA 1O3OA 1GVLA 2VGCC 1ELAA 2I6QA 1GGDB 2P93A 5EQSA 5FPYA 5FCKA 4K1EA 1PPGE 1TGCA 2FS8A 3SI3H 1EOJA 1HFDA 4YTAA 1PPEE 4A7IB 1NT1A 2SGFE 3UQVA 1L0ZA 1TPAE 1TNIA 1MMJN 1OYTH 1QCPA 2PR3A 3D62A 1EJMA 1D9IA 3PYHA 5EU8A 1FMGA 5CE1A 5DJ7A 1QBOA 3TITA 4X8TH 1FIWA 4IMZA 3GCTF 1GJ6A 1YPJH 2F9VA 2ZHQH 4GPGA 4NG9H 4YO9A 2WV4A 3ZYDA 1BA8B 4BTTB 3RXTA 1ZSJA 4ZKSU 3Q77A 1F7ZA 1SGPE 3VB5A 5DO4H 3QUMP 1C5PA 3E0NB 1GBEA 1GBBA 2XXLA 1AB9B 1PYTD 4WXVA 1GJBB 4UFFH 1DT2A 1ZGVA 3UREA 1TGTA 4X2YA 3SBKA 3SGAE 3UWJH 1NRSH 2ZDLA 5C1XA 3PB1E 3RXPA 3LGYA 5DP8A 3RXQA 4A5TS 1C5WB 1EAUA 4K2YA 3LGUA 1HJ8A 4X1RU 2A45B 3MYWA 1FJSA 3ZZAA 3SNBA 2A0QB 1GG6C 1QBNA 4OS5A 1DUEA 3PTNA 1K22H 1AD8H 6GCHG 1IAUA 4UONA 1JBUH 3N7OA 1NS3A 1XXFA 5A8ZA 5FX6A 1V6DA 1ZOMA 3EA8A 1F5LA 1O2NA 1V2VT 5HXFA 1B0FA 1ZPBA 1ORFA 1MTNC 1TNHA 2V3HH 2FP7B 3GYLB 1C2MA 3LU9B 2GP9B 1DOJA 1C1SA 2PKSC 4CRFA 2A4GA 4MVNA 1V2KT 4NFFA 3TNSA 4H4FA 1WQSA 3M5OA 1CHOF 1S0RA 1XMNB 2Z9GA 3BTDE 1H9IE 3IWMA 4KTUA 1DWBH 2WYGA 1T8OA 1BTZA 2HPPH 4NCYA 1GHBF 1ZZZA 2ZGBH 1ID5H 1IQGA 5A09A 1CVWH 3P8NA 1ANBA 2H9TH 2ZF0H 1NRRH 2WV5A 2F9BH 2AFQB 2GMTC 4NIVA 1C2JA 1UVPA 4U30A 1UK4A 3RXEA 1EB2A 4YOJA 4MTBA 4FUFA 2WPMS 1K1NA 3EE0B 4DOQA 1C1TA 1S0QA 3OU0A 1O2IA 4AN7A 2Y5FA 1GI0A 2AH4X 4X8UH 1KTSB 1DUAA 1JIMA 5C1UA 1O3LA 4K1SA 4WMDA 2W5EA 1WU1A 2UUJB 3ODDA 3VGCC 2BY6X 5I25A 1XKAC 1WSSH 1HCGA 3UIRA 2V3OH 2C93B 1LHDH 1O3GA 3M61U 2RA3A 1H8DH 2VIDA 1FI8A 1TB6H 2EI7A 1GBHA 2BY7X 4KGAA 1SBWA 4A1TA 5F03A 1GHVH 3ZVCA 2FESH 3M3TA 1D6RA 4ISNA 3RDZA 2J92A 2IJOB 5L2ZH 3OX7U 4JYVH 4XFQA 3SNEA 2GTBA 3BTKE 3FP7E 1K1MA 1DY9A 1THSH 2XCNA 4AFZA 4DJZB 1V3XA 1CSOE 2O8UA 1CHGA 2CF8H 3NXPA 5PTPA 3SV8A 6CHAC 4U32A 5BRRE 1P0SH 1IOEA 3A7WA 1O5GH 1YPHE 4GAWA 1EAIA 3UPEA 1QQUA 1AIXH 3O8CA 3MH5A 3OY6U 2AGEX 3LIWA 1ELVA 1VCPA 4WWYA 1KLTA 2C8WB 1AUJA 4AB9A 1BTHH 1IHSH 1LPGB 3RM2H 4BTUB 3CS7A 1OKXA 3LH3A 2WUBA 2Y7ZA 4Q7XA 2XBXA 2GD4B 2ZECA 1Z6EA 2ZQ2A 1LHEH 1V2LT 1TX6A 3S7HB 1BZXE 1C5RA 3PMJA 2XBYA 4Y76A 3ZVFA 4THNH 3E8LA 1AHTH 1SGDE 3P70B 3MO9A 2ZU5A 3MFJA 2Z7FE 4R8TB 2BVRH 1SGIB 3I78A 1TBRH 2OINA 3UR9A 3E6PH 4X1SU 4X0WU 1W12U 1MAXA 3STJA 3K2UA 5EGMA 2GVFA 1WBGB 1Z8RA 2AYWA 1MCTA 1P2JA 2M5TA 2VWMA 1DPOA 1GHWH 4FUIA 2ZCKP 5C3NA 1DICA 1ELGA 1ANCA 5ESTE 1DXPA 1FY8E 1FV9A 3GY6A 5F8ZA 1L1GA 4RKOB 3SU1A 2STAE 1NC6A 1CT0E 2F9OA 4TWWA 4B76A 2Y81A 2FI3E 5FCRA 4MNYA 4NZQA 1A61H 1LCYA 4B2AA 5C67A 3BIVH 3TK9A 5E0GA 1IQIA 2BY9X 1YCPH 1GHZA 3A7YA 1OS8A 1C2FA 1TNGA 3V3MA 2KAIA 1C1OA 3QK1A 2BVXH