1AZ8A

Bovine trypsin complexed to bis-phenylamidine inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
molecule tags Serine protease
publication title Unexpected Binding Mode of a Bis-Phenylamidine Factor Xa Inhibitor Complexed to Bovine Trypsin
rcsb
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A02
1OWIA 4H42U 1NY22 3ATLA 4KTCA 2QXGA 1F0TA 1PFXC 1NO9H 1NM6A 4AG1A 1IHSH 4UD9H 2ZCHP 4Y8ZA 3SJ9A 3NKKA 1TMTH 1DY8A 2FO9A 3TK5A 4AFQA 1ID5H 1P3EA 4U2WA 2HNTE 1C1PA 3A8BA 2ZU4A 1HAIH 1J15A 1IAUA 1GDNA 2WPJS 1CHOF 2ZQ1A 1PPEE 2FOCA 3P8GA 4JZFH 1O2QA 2ZDKA 4D9RA 5L2ZH 1W8BH 2QXHA 4K1EA 1HAPH 1UTOA 3SU1A 2VVVA 4ISNA 1V2WT 3PLPA 2FXRA 5C1UA 3KF2A 2M5TA 1ZMLA 4GHTA 2O8UA 5EXLA 2WYGA 1EAUA 5GCHF 5C2ZA 1VITG 1EZQA 4Z6AH 1O30A 1YPJH 1TB6H 3ZZCA 1SGPE 1B0FA 3BG8A 4NWLA 1K1LA 1KY9A 1GHVH 3F1SB 1D6RA 1GI6A 1GBCA 4R8TB 1SVPA 1TBZH 1IQKA 1GMDG 2A4OA 1SGIB 1ZPZA 4MNXA 5CE1A 3E0PB 2A5KA 5DP8A 1YPHE 1AFQC 1KLTA 4HFPB 2ZHQH 3SNAA 1GHWH 2BXUH 2QC2A 1BMNH 3F9FA 1OYQA 1CHGA 1T8NA 2EI6A 2ZNKH 1D3PB 2SGQE 3SW2B 3T28A 2VU8E 1G3BA 5A8ZA 1CE5A 1PPBH 1KTSB 5A8YA 3SV8A 2FM2A 1Z8JB 2ZI2H 1PQ5A 2P8OC 2SGEE 4NSVA 1MQ5A 2O8WA 3DT0H 4YLUA 2F9PA 4WJG2 3RXQA 1QRWA 1A3BH 1XUJA 3NZIA 2CJIA 4UFEH 1THSH 1BOQA 1NN6A 2BHGA 1MAYA 3E8LA 4O97A 4ZKRU 3KQBA 1TPOA 1EATA 1VGCC 2Z6BD 3UOUA 4BAQB 4BXSA 3LJJA 2B0FA 1J16A 1FNIA 3EA8A 4NCYA 3QN7A 1P03A 3KQEA 4OGYA 2XBWA 1EASA 1MCTA 2DUCA 1VCPA 1C2IA 5AHGH 1WBGB 1MUEB 2ZTYA 3A7ZA 3EDXB 6CHAB 3DA9B 3URDA 1CA8B 2BY6X 3B8JA 2ANYA 2BXTH 5CHAB 4B73A 2P16A 2Z3CA 1AU8A 1QL8A 4MPXA 2FI5E 1JMOH 1Y3XA 1YBWA 1KDQB 4YOGA 5BPEA 2J9NA 4DURA 5GDSH 2ZECA 4FUIA 1AE8H 1L2EA 1LHCH 4FUCA 1GI7B 5E0GA 3T29A 4FUGA 4JZDH 2CGAA 4AX9H 2P59A 2UUYA 5SGAE 4NWKA 3E6PH 3SI4H 1TPAE 2GDDA 3RXTA 2AIQA 1O3AA 3ODFA 3PB1E 3MH4A 4Q80A 3GOVB 1LQDB 1YPGH 3BTEE 3F68H 4GCHG 2ANMH 4TWYA 1SPJA 3IWMA 5DKMA 1OWJA 4DJZB 2QY0B 4MNWA 1MTNB 2OXSA 2A4QA 5FX5A 1BTWA 2C93B 2ZPSA 3L3TA 1F2SE 4DIIH 5K7RA 2FOFA 3RM2H 2OINA 1OP8A 4X1RU 3SNBA 4B74A 2AEIH 1W7XH 3MWIU 3TGIE 1GL0E 1DFPA 2RA0A 8KME2 1TPPA 2G5NA 2H1UA 2HOBA 2W26A 4HTCH 1M9UA 3LGIA 1TA2A 1C5WB 3Q00A 2ZDAH 2G51A 4AN7A 3UNSA 2BDYA 1F5KU 1ESBA 1BRBE 2J95A 2FTLE 4X8VH 1CGJE 2H6MA 1QL9A 3VPKA 3LGYA 2R3YA 1Y59T 1SI5H 3RXCA 1NFWA 3BTDE 4CH8B 3SGQE 1TRYA 4INLA 2FYRA 1L1JA 1E38B 1C1WH 3A7YA 1QJ1B 1YYY1 4DGJA 1HAOH 2VJ1A 3LC3A 2ZPRA 1NRNH 1LHFH 4JZ1A 4GUXA 1NTPA 1H9LB 1QB9A 1V2NT 1QJ7B 4KTUA 3BSQA 1XUKA 1MKWK 3SJKA 4ABEA 2ZGJA 3FFGA 4NSYA 4BNRA 1K1OA 1O2SA 1NZQH 1ZRKA 1PYTC 2XWAA 4ABJA 1JWTA 1C5RA 5EPNA 3RXAA 3KGPA 2OTVA 3FZZA 4UFFH 3O8BA 3T27A 4DG4A 5ETXA 1O2YA 1O3MA 2GCTC 2CV3A 3GCTG 2CF9H 2JKHA 3SU2A 2XCNA 2VWLA 1BRAA 2FOHA 5E0HA 1EX3A 1TRNA 3GCHB 4XE4A 3I29A 5F8XA 3BIVH 2XRCA 4MVNA 3P17H 1V2PT 5GWZA 1O5FH 4JYUH 3PLBA 5C3NA 1TFXA 1KLJH 1EB2A 1FMGA 1LHGH 2ZEBA 4I31A 1C1TA 2PTNA 5EQRA 1F0SA 1ESTA 4WVPE 1DUEA 3QGJA 1THPB 1RXPA 3EGKH 2ZHWH 2ZF0H 4YZUA 1A0HB 2Q6FA 1OX1A 2B9LA 1GVZA 1HRTH 4X2YA 1RTFB 2VIQA 1C2MA 8LPRA 4DCDA 1Z7KA 2JH6D 1DM4B 4I8JA 3RLYH 2R0LA 1SFIA 3TK6A 1C1VH 1GJ6A 4Y71A 2FZZA 2Q6DA 3SORA 1AWHB 1V2QT 1WOFA 1H1BA 2H9EH 2C8WB 4JZEH 1C2JA 4BAMB 1SGTA 1TGNA 3VGCC 2VIOA 1P2NA 3RXBA 4A5TS 2ZDNA 4RSPA 4U32A 1EAXA 1FY1A 2XC5A 4NIYA 1LQEA 2VIVA 3R0FA 1TMUH 1Z8RA 3RU4D 5PTPA 1SGYE 3SV6A 2BZAA 2ZFPH 1MZDA 3UWJH 3AW0A 1YC0A 1SHHB 1P2IA 2QV1A 3STJA 1Y5AT 3S69A 3A87A 4H6SB 3RXFA 5HXFA 1AUTC 1GI8B 4ABDA 2O8MA 4D8NA 1H8IH 1D9IA 1RRKA 1BBRE 1ACBE 2BVXH 1O2PA 1QQ4A 1TRMA 1O5DH 3AAUA 1OWKA 4MPVA 5HMAA 2F83A 4WXVA 1CU1A 2UWLA 2ZC9H 3SU3A 3VB7A 1P9SA 3UPEA 4ASHA 1XKAC 2WUBA 1LVMA 1TNLA 2ZDVH 3MNCA 1ELBA 2V6NA 2BD7A 2CN0H 2G4UA 2XC0A 4TPYA 5DPAA 4BAKB 3M5OA 1HAVB 1NU7B 3RXKA 2ZGBH 4Y8XA 3RP2A 3UREA 1S83A 2AGGX 1DOJA 3RU4T 4WXIA 4Y10E 3LONA 2LPRA 2GKVE 1YGCH 2PFEA 2UUJB 3OY6U 1O2TA 1W3CA 3BEIB 4LXBH 2UUFB 2GCTB 2Z94A 3H5CB 1C4Y2 2QYIA 1DT2A 4Y76A 2ZHDA 1XUFA 1O3GA 4BTUB 5FBEA 3SO3A 1O3JA 2GV6A 1D6WA 2UUKB 1TNIA 3M7TA 3BTHE 3P8FA 3PV4A 5L30H 1L1GA 1SGDE 4MNYA 1F5LA 2CF8H 1Z8IB 2UWOA 5K0HA 5AF9H 4HGCA 4D76A 1TX7A 2Y7XA 3LDXH 3IG6B 3BTGE 3QGNB 3A7VA 5C5OA 1QTFA 3LC5A 4Y7AA 2NU1E 3UNRA 1C5ZB 3A80A 3SUDA 3ZZ9A 1TNKA 4A6LA 1C2LA 4FUEA 1LVOA 2R2MB 7LPRA 1HAVA 2YNBA 3SU6A 3PTBA 1UTMA 2F91A 3B23B 3LU9B 5A0CA 2OCVB 1LPZB 4JK6A 3ZZ3A 2VWMA 3DFLA 1CA0B 3AVZA 1C4V2 4X1SU 1WQVH 1GI3A 4MPWA 5C67A 3A7XA 2HVXA 1GG6B 1F92A 2BMGB 1K21H 2FLBH 3ZV8A 5A0BA 1UK3A 1GJDB 4K5ZA 3ZZ5A 5CHAC 2ZPQA 1TYNA 2BD9A 3M61U 2Y81A 4K60A 3ZVFA 1Y5BT 4UFGH 4FUHA 1T7CA 3RUOA 2WPHS 1HBTH 1HJAC 3K9XB 4Y0ZE 2ZFTA 4X1PU 1L0ZA 3TLOA 8ESTE 2J94A 1CT0E 2ZU2A 3ZZ6A 4YOJA 5EOKA 1J14A 2GVFA 3LGVA 2AS9A 1OWEA 3PWCA 2P3TB 4BTIB 3M36A 4U30A 1ORFA 3ZVDA 4CRCA 1GJ8B 5HGGA 4CRDA 3T62A 1O3HA 3GY6A 3TH3H 2WPKS 3GY4A 3LGWA 3U8TH 3K65B 2P93A 1O2GH 3A88A 3HKIB 3PLKA 1IOEA 5ESTE 1SGNE 1WUNH 4ISOA 3EE0B 1N1LA 3ZZDA 5EW2H 1O2MA 3P8OA 4WH8A 1TBQH 5AVDA 4OGXA 1D4PB 2A7CA 2Y80A 5BRRE 1GHZA 2ANWA 4O3UA 3SHAH 2A0QB 5FCKA 1AKSB 2TGPZ 3MU4A 4I8HA 3T26A 3PTNA 3P6ZB 1O34A 1DLKB 3ATMA 1GCTC 4X6MA 3UTUH 3MHWU 1UVUH 4KELA 1TABE 1A5GH 2Z9LA 3D62A 2BOKA 3LGTA 5DG6A 4NG9H 1PQ7A 1EZUC 3BTTE 2D1JA 5FPYA 2R0KA 1AQ7A 1V2OT 2NU2E 1UVPA 4XBCA 1HGTH 2ZHFH 6CHAC 3MU1A 1V2MT 3GISB 1QL7A 2BD8A 3TVJB 1EB1H 1SGCA 1TALA 1TNJA 4MDSA 3RXLA 3W95A 3SHCH 4K1TA 1ELGA 2XCFA 1TOCB 2GZ9A 4TY7A 3VFEA 4AYVB 1UMAH 2ZGHA 3KL6A 1C5UA 4IMQA 1ZPBA 1CT4E 1NFYA 1JRTA 4IC6A 3RXVA 2AGEX 1A5HA 1TOMH 1IQIA 2EI7A 1MKXK 3RMMH 5C5NA 4OS6A 1P06A 1C5LH 3V12A 1C1MA 2AYWA 4CRAA 4E06H 1EXFA 1DDJA 1ELTA 2TIOA 3DHKH 1L4DA 1S82A 2BLQA 1QJ6B 2ZG0H 3RU4E 2ZDMA 1TGBA 1JRSA 1GMCF 4KP0A 3TITA 4CHAC 1UVSH 3TGKE 2F9VA 1PPFE 1RGQA 2EEKA 1DANH 3VB6A 4DW2U 2QXIA 4B75A 5ESBA 1YPMH 1Y5UT 1G9IE 2FODA 4AFZA 4ISHH 2PKAB 4RKJB 1C2EA 2GMTB 2CMYA 4MQAA 4AGJA 1BTYA 1KDQA 2PGBB 4DOQA 1FY4A 4AFUA 2RCEA 3RC6A 1BMMH 1NESE 3QDZB 2GD4B 1O2ZA 3RXEA 1MTNC 3MH7A 4CREA 3RXHA 3MO3A 4K2YA 4Y79A 3M3VA 1VCWA 2VH6A 1RD3B 5DJ7A 1HAXB 3Q76A 3GDSA 2YOLA 3A7WA 2XWBI 3MH5A 3P92A 4D7FA 4DVAU 4WY3A 1V2LT 1GG6C 2FESH 1INCA 3SUFA 2GMTC 3BEUA 4XBDA 2GCHF 1V2TT 4I7YH 2VINA 1S6FA 1GBTA 3TNSA 5I25A 1Y3VA 1CBWC 3G01A 1BITA 1QGFA 4WH6A 5JBBS 4BANB 2Z3EA 1EZXC 2A4GA 2FWWA 1GHAG 1GBLA 3Q3KA 2H9HA 3RXUA 5JDUB 2OBOA 2FIRH 2P3FH 4FU7A 3ZYDA 1GGDC 3LH3A 4BAOB 4ZROA 3S7KB 2HWLB 4ZKNU 1AZ8A 3O8CA 3ATWA 1XM1A 1ABIH 2BQWB 4AB9A 1V2RT 1DUAA 1GI9B 1NFUA 3MNXA 5FPSA 1FQ3A 1KXCA 1Q31A 3QX5H 2B5TB 1NU9A 4AOQA 1GJBB 4GPGA 2BD3A 1EQ9A 1O3BA 1FDPA 1BMLA 2THFB 2IPHA 1OWDA 1YF4A 4CBOA 1AUJA 4LOYH 1GBFA 2ZZUH 2F9BH 3SGAE 1HCGA 3ODDA 1K28D 4XDEA 1A5IA 1XX9A 3SJ8A 1QNJA 1LTOA 4K8BA 3VB3A 3MYWA 1O3LA 3GDVA 1Q2WA 3FANA 1OP2A 4NZQA 2G4TA 1FXYA 4VGCC 2W3KA 1J17T 1MTVA 4AZ2B 2PW8H 1EOJA 2PGQB 1P12E 4Q7XA 2ALVA 1AD8H 1MTUA 5EODA 3SN8A 1TPSA 1SLVB 4FUFA 3TJVA 3UUZA 4IBLH 2VIDA 1LMWB 1NS3A 3S7HB 3ZZAA 3M7QA 1N6XA 1U6QA 4CRBA 4A1TA 1ESAA 4KKDA 2W7SA 2A45B 1S5SA 3MU5A 5A09A 3ZVCA 3KQCA 3LGUA 3ATIA 1AVXA 1J8AA 4QT8C 3TK9A 4U01A 2V3OH 1CHOG 3LIWA 1BCUH 1UCYK 1Z6JH 1FN8A 1OOKB 1G32B 9LPRA 3AAVA 1XVMA 1MH0A 4FXGH 3ATKA 3AW1A 2GZ7A 5B6OA 3LJOA 1MMJN 1DVAH 1GHBG 3ZVEA 2A7HA 3LPRA 1HAZB 4E05H 5F6MA 1O5CB 2PR3A 4NA8A 1ABJH 1K2I1 1GJ5H 3SUEA 1JOUB 5C1YA 1V2ST 1TGTA 2P8OB 5EXNA 3O8RA 4INKA 2J34A 2WPIS 4I8GA 5GIBA 3SU0A 3PWBA 1KYNA 1D3QB 3TIUA 1WU1A 1GHAF 1P05A 2TGAA 4O3TA 1RTLA 1YPKH 3S9BA 4M7GA 2FEQH 3E1XB 3HKJB 1GVKB 2ZFQH 1FAXA 3NK8A 1O3IA 3U9AH 1PQ8A 1PPGE 1WTHD 4FUJA 3BG4B 2W7UA 1QB6A 2ALPA 3R3GB 4ABGA 2BVRH 3IITA 1VCQA 5LH8A 1SC8U 1NRPH 2SNVA 4AGKA 1UTKA 2G52A 4ZHAA 1SQOA 3SZNA 2G8TA 3BTFE 5DO4H 2P95A 4YOIA 1NRQH 3LT3A 4BTTB 4NIWA 4WMEA 4B1TA 4XOJA 2AIPA 3C1KA 3QUMP 1C5MD 3TJOA 2QXJA 3GICB 3HK6B 3RDZA 4ZMAH 4TWWA 1AN1E 4IN2A 4JYVH 1QB1A 1IQMA 4FUBA 1QFKH 1A0LA 1AI8H 4OS7A 4PROA 1QRZA 1ELEE 1Y3YA 3PO1B 5LPEA 1ANBA 1ETSH 3SJOA 3RLWH 2GCHG 1MD8A 3HPTB 1BTHH 1JIRA 1QA7A 3MI4A 1OYTH 5HM2A 3RXIA 3Q3YA 1S0QA 3CENA 3HK3B 1BHXB 1AFEH 2OC1A 2FX6A 1YLCA 1UTPA 3N7OA 1XKBC 1SGQE 4ZHLU 1HLTH 2ILNA 2Y5HA 2BVSH 1PQAA 4FVDA 3ZVBA 2R3UA 3UOPA 2ULLA 3M5LA 2PKSB 1DS2E 1O2IA 1MTWA 1ZZZA 5EQQA 1C2KA 4NFFA 4AFSA 5DGJA 3QLPH 2FDAA 3GY7A 4TYDA 3GCHC 1TGSZ 5FCRA 2GT7A 1W10U 2EA3A 1O2UA 4MNVA 3ZVAA 3GY5A 1DY9A 1T4VH 1PYTD 1TBRH 1MTSA 2FP7B 1V2JT 2J38A 1C9PA 5F8TA 3DUXH 3BTQE 1RS0A 2GP9B 1P04A 1SGEE 4Y11E 1GMCG 1GBAA 3D23A 2A2XH 3QZQA 4JYTA 2OUAA 1H9IE 1NRSH 1UHBA 5ABWA 2BY9X 1DPOA 1C5TA 3FP8E 1XUHA 1AIXH 3HGNA 3UQVA 1N6YA 1DXWA 3E90B 1O3PB 2Z9KA 1AFQB 1GJ7B 1O39A 2A2QH 4WF8A 1GBIA 1O2VA 4OS1A 4Z0KA 3RXGA 4IC5A 1O3CA 2Q6GA 2VWOA 1TX8A 2V3HH 1A7SA 1ZR0A 4BOHA 4ZXXH 3M3TA 2TRMA 2I6QA 1HIAB 1BUIA 5DP7A 1UTLM 2D26C 1P9UA 4X1QU 4A7IB 2O8LA 2IOTA 3NPSA 1O3OA 2FOAA 1P57B 1A3EH 1GCDA 2CHAB 1UTNA 2JH5D 4FUDA 3BF6H 2UWPA 3BG4C 4AYYB 1LKAA 1GMDF 1WTGH 1XMNB 1O33A 2ODPA 4X0WU 1YPLH 2HNTF 4XBBA 3I78A 3SV2H 4Y8YA 1OSSA 1ETRH 1FY3A 5TCCA 4I32A 1TMBH 4F49A 4K69A 3BTKE 2WPMS 1MKWH 1C2FA 7KMEH 5JBAS 1ZJDA 2H2ZA 1ANCA 3UWIA 3GDUA 1HAGE 1TWXB 3CP7A 2FOEA 4TY6A 3E16B 2Z9JA 3KEEA 4NFEA 1T32A 1SOTA 1BBRH 3GCTF 1TLDA 2A5IA 2I6SA 3PMJA 2AGIX 5T6DA 2Z9GA 2Q1JA 1CGHA 1S81A 6LPRA 1O2WA 2QCYA 2JETC 1JXPA 2W3IA 4E7NA 3PO1C 2TPIZ 4MTBA 1SGFG 4FU8A 3S9AA 1SG8B 1AHTH 3TGJE 1EJNA 5AFZH 3ZV9A 3A81A 1G37A 3BTME 4YO9A 4KTSA 3FP7E 1G3DA 4ZKSU 1TNHA 3NWUA 3T25A 1XXFA 4IN1A 1GBMA 1BB0B 5T6FA 2PKSC 1KIGH 2BDCA 3TJNA 4X2VA 2VH0A 4YESB 1F0UA 3ZZ7A 1MU8B 3MU8A 1ANDA 1BDAA 5TCAA 1GCTB 1RFNA 1ZSKA 2WPLS 3QTOH 4OS2A 1T4UH 3SU4A 1SHYA 2FX4A 2AFQB 1GBBA 1GL1A 1DXPA 3VXFH 1Z6EA 1KXDA 1WSSH 4ISLA 3KN2A 4NGAH 1E35B 1GPZA 1O2JA 4BAHB 3SBKA 2EI8A 1P2QA 1S6HA 1QBNA 1LHDH 3GY8A 1UVTH 3EQ0H 1K1JA 1KTTB 1A61H 2XXLA 1E34B 1GHYH 2PKAA 3A8AA 1H8DH 2H5CA 3SNEA 4LK4A 1FY5A 3PMBB 4XSKU 1ANEA 2CXVA 2QA9E 1AE5A 1IQGA 2B8OH 2BD2A 3E91A 1UHBB 4NIXA 1YP9A 1BRUP 1V2KT 2HRVA 1MBMA 3TH4H 3GCNA 4X6NA 3M3SA 1K1PA 3A82A 5HYOA 1FJSA 2JETB 1OP0A 1O37A 3TNTA 2A4RA 1SFQB 1SGRE 1JBUH 1LCYA 6ESTA 1HUTH 1RJXB 1BTZA 1ZTKA 2PV9B 5E2PA 1AO5A 2DE9A 1BIOA 3GCOA 3SV7A 3PROA 5FAHA 2HPPH 1GBDA 1FI8A 1QQUA 2O9QA 1O2NA 2SGFE 1F0RA 1MAXA 1BQYA 1TQ0B 4X2WA 2HNTC 2A7JA 1DWDH 1Y8TA 1WQSA 3U1JB 1LPGB 1K1IA 2B7DH 5EGMA 1ETTH 2SGDE 1AB9B 1UK2A 2GGVB 3VEQB 4SGBE 4CRGA 1GDUA 2V0BA 5GXPA 1P0SH 1F5RA 2OLGA 5E8EH 2ZKSA 5F03A 4IS5A 1C5VA 4UONA 1NRRH 2C90B 4FU9A 3VXEH 4D7GA 1EPTC 1O2XA 2H9TH 1K1NA 3HATH 4OS5A 3MH6A 1ZJKA 2ZHEH 1YKTA 3M7UA 4ZKOU 1BRCE 5DP9A 1GI5A 1CSOE 5CMXH 1OPHB 1G30B 3MNBA 3UNQA 3A84A 3D65E 1WYKA 3NCLA 3BV9B 1AVGH 3L33A 2XBXA 5E2OA 1EUFA 1N8OB 4CR5A 1MBQA 1W13U 2BTCE 1HJ9A 2IN2A 3MU0A 1VR1H 5LPRA 5GJ4B 3SQEE 1BZXE 3RXMA 3RC4A 3F9GA 4X6OA 1QRXA 2GTBA 2QIQA 4AG2A 5C1XA 1MQ6A 1HIAA 5LGOA 2G00A 4Q7YA 1DWEH 2NU4E 2V35A 3UIRA 1YLDA 1LVYA 1SLXB 2XBYA 5EW1H 1O2RA 4CBNA 3DFJA 5EXMA 1Z71A 3MFJA 2SFAA 1DX5M 1ARBA 4GHQA 3UQOA 4X1NU 1SBWA 1C5QA 1ZLRA 4D9QA 1C9TA 1AKSA 1A46H 4DIHH 2FYQA 3UR9A 3A83A 1AMHA 3SJIA 1GBHA 1O32A 3BIUH 4K1SA 1A2CH 1FIWA 1NT1A 4JCNA 1C5SA 1O5BB 1DITH 1VITH 2JH0D 2AMQA 1FLEE 1QHRB 3KNXA 2LNCA 5LPFA 4F4OC 4K3JA 1C1UH 1YPEH 3VB5A 1ZHPA 4UFDH 1P09A 4H6TA 1K9OE 3A86A 1EP6A 2NWNA 1G2LA 1GI1A 1BHXF 3NUMA 1EZSC 2ODQA 1EJAA 1C5PA 1PPHE 1HJ8A 4KGAA 1GBKA 4ISIH 3OU0A 4IGDA 4MG3A 4ABBA 5HM9A 3RMOH 3RXOA 2G55A 2ZU3A 1B0EA 3CS0A 2PTCE 2PUXB 3K6YA 3QZRA 4MPUA 3F9EA 1YCPK 1SQTA 2F3CE 1O2OA 3AASA 1SL3A 2FTMA 2PWXA 1GI2A 1F7ZA 3U8OH 5IDKA 1C2GA 1O2LA 3PMAB 5JB9S 2ZO3H 4CH2B 1PJPA 4Y6DA 1DWBH 1GHXH 3MMGA 4YM9A 2SGPE 1C1QA 1EOLA 3BN9A 2A1DB 3I77A 1DICA 2SGAA 1SR5C 1O2KA 1GI0A 4H4FA 3U69H 3UR6A 1DWCH 1O35A 1G3CA 3RMNH 2PLXA 2VWNA 3V0XA 1GWAA 6GCHG 1TQ7B 3SI3H 1T8OA 3DD2H 3ZZ8A 2HALA 9ESTA 2BY5X 3RXJA 4UE7H 3SQHE 3PYHA 1DE7H 3PMHB 2ZTXA 1FPHH 3C27B 2C8XB 2KAIB 1BJVA 1J9CH 3RMLH 1O5AB 4YT6H 4NIVA 2DE8A 5FBIA 2ASUB 3WY8A 3UFAA 4J1YA 4X2XA 5C20A 3A7TA 1WAYB 4AB8A 2G5VA 4GCHF 3TJUA 4DT7B 1MD7A 1MZAA 2F9NA 2FI4E 1V6DA 1XUIA 4MLFB 1AWFH 3O8DA 2ZQ2A 2OC7A 1P2KA 1GBJA 2Y7ZA 1PPCE 2G81E 3V13A 1AY6H 3ENSB 4WWYA 3ZZ4A 1P2JA 3PM3A 1GMHG 3V3MA 3S0NA 1ZYOA 4WMDA 2AMPA 2ZIQH 3FP6E 1NPMA 4ZAEA 1TONA 3U1IB 1C2DA 2STBE 3EYDA 1CVWH 1V3XA 1NROH 2BX4A 1TX6A 5G4BA 2PUQH 2A32A 1G36A 5FXLA 1LKBA 2Y5FA 3ITIA 5DK1A 3RM0H 3URCA 1FPCH 2VVCA 5JBCS 2XNIA 2KAIA 2OP9A 1O36A 1P8VC 4GLYA 1C5YB 2C3SA 3OX7U 1ZSJA 1W2KH 1T8LA 1FIZA 4TPIZ 2EC9H 1SQAA 2VIPA 1GDQA 1FV9A 1LPKB 1EAWA 1TIOA 1UTQA 5FPTA 4RKOB 3QK1A 4HZHA 1PPZA 4O9VA 3S9CA 1FONA 1T31A 5A0AE 2J2UA 5DP5A 1RTKA 4R0IA 3EAJA 1TA6A 1TE0A 3M35A 5JB8S 1FUJA 5L6NH 3H7TA 2P94A 3JZ2B 1C4U2 2A31A 2BD5A 2BYAX 3GYMA 1JIMA 2GX4A 1AVWA 2NU3E 4UDWH 5EQSA 4CR9A 7ESTE 3STIA 1NC6A 2ZA5A 4Q7ZA 4X8UH 2R9PA 1A1RA 2QAAA 1P02A 2BDHA 1C5OH 1EP5A 2ZFSA 1CQQA 1RIWB 2Y5GA 2WV4A 2FOGA 2GZ8A 3VGCB 3SU5A 4Y0YE 1O3NA 3E3TA 1ZMJA 1V2UT 4YT7H 3FVFB 2ZCKP 3SUGA 5DP6A 1YCPH 1E37B 1EAIA 4ESTE 1VZQH 3V7TA 1FZZA 3U8RH 3H7OA 1BTXA 2ZP0H 1C1SA 1DSTA 2ANKH 1P2MA 2WINI 4JZIA 4ZHMU 1AB9C 4X8TH 3LH1A 2H5DA 1HAYB 1QURH 1SGFA 1TNGA 1VGCB 2BLWA 1B5GH 3T5FH 4IMZA 3QWCH 1GGDB 2C8YB 2Y82A 2WYJA 3M5MA 2OBQA 2PHBA 5J4SA 3KCGH 3LOXA 1Z1IA 2J4IA 1O3DA 1Y3UA 1KXEA 2P3UB 2Z3DA 4YTAA 5H4IB 1FN6A 3K6ZA 1IQNA 2A5AA 3T2NA 1ZGVA 5EU8A 1CBWB 1BA8B 1GBEA 1TGCA 4ABHA 1CT2E 2F9UA 2ESTE 5JYIA 3K2UA 4GAWA 1SLWB 1MU6B 4YLQH 5DP4A 1G3EA 3TPIZ 2VVUA 1EJMA 1QBVH 2VGCC 1UO6A 3KQDA 3BTWE 1LHEH 2GV7A 1ELAA 1D3TB 2FOBA 1C1RA 3D49H 1A4WH 3MO9A 5TJXA 2R2WU 3OSYA 1HPGA 1KXFA 4I8LA 1BBRK 2NU0E 5JBTA 1BJUA 2BX3A 1ELCA 3JZ1B 4E7RG 1ZTJA 2ZDLA 1IQJA 2FOMB 1HB0B 4THNH 1O31A 2QN5T 2BLVA 3MNSA 1O5EH 4WMFA 4A1XA 1Z1JA 2TGTA 1Q3XA 3SNCA 5EG4A 5GCHG 4UEHH 2BDIA 1S85A 1SMFE 2SNWA 7GCHF 2XYAA 3OTJE 1ZMNA 1DSUA 1D3DB 4Y7BA 1W12U 4CRFA 3A89A 2ZGCA 3FAOA 1H4WA 1ZRBA 1V2VT 3CS7A 2RA3A 4XFQA 4CHAB 1W14U 1OWHA 1O38A 2BQ7B 3L6PA 4B2AA 5T3HA 2BDGA 3MTYA 1SLUB 3W94A 1C2HA 1GMHF 1P2OA 2QF0A 1RIWC 1W0ZU 3UY9A 4ABFA 2VB0A 3A8DA 2RG3A 2FPZA 3MOCA 2GT8A 1G2MA 1XUGA 3OYPA 3U98H 2HPQH 2Z9IA 4HI3A 1UVOA 3TU7H 3OY5U 3Q3XA 5F8ZA 1ZSLA 3NXPA 1E0FD 4ZUHA 1QCPA 8GCHG 1QA0A 5FHTA 2ZU5A 1QBOA 3TH2H 2TGDA 5A8XA 1EKBB 1HV7A 5JPMH 1WCZA 1ZPCA 1GJCB 2J92A 2VIWA 2K1QA 1EPTB 2BQ6B 3MO6A 2BLOA 4NZLA 4O03A 2AERH 3GYLB 4NA9H 1GVLA 2BB4A 1K1MA 1VJ9U 2XW9A 1HXEH 1CA0C 2XTTB 5J4QA 1L1NA 2F9OA 2IJOB 2RDLA 3ELAH 5GPIB 2Z7FE 3LKWA 1GI4A 3E0NB 6GCHF 1XVOA 1P10A 1S0RA 1ZGIA 1IQHA 2BDAA 1X7AC 2QGRA 2STAE 2Y6TA 1GJAB 5I46H 5DP3A 1EPTA 4SGAE 3VB4A 1WV7H 3SOSA 1QIXB 2OQ5A 2AMDA 1DLEA 1FY8E 1UCYH 1HJAB 1BT7A 3M37A 1HYLA 1SB1H 1B7XB 2FMJA 1KSNA 1THRH 2HLCA 2BM2A 1IQLA 1NFXA 4GVUA 1MKXH 1HXFH 1HDTH 3EA7A 2FLRH 1C1OA 1L4ZA 1KXBA 4I33A 1AGJA 4ZH8A 1OXGA 1BTPA 4B2BA 2BDBA 1ELDE 1XXDA 5IYTA 5E0JA 3P70B 3Q77A 2VNTA 2YNAA 1C5XB 2FS9A 2ZWLH 1S84A 2ZFFH 2QF3A 1W0YH 1ARCA 1A0JA 1SOZA 3ZVGA 3ZZBA 3SV9A 2ZU1A 1ELFA 4X8SH 1LDTT 2OC8A 1TAWA 1O2HA 1YM0A 4AORA 1KXAA 4ABAA 2AH4X 5FX6A 1LVBA 2W5EA 1IHTH 2C8ZB 3FZDA 1BTUA 1H9HE 1Z8GA 3A85A 4B2CA 4ABIA 1ZTLA 1GJ9B 1P11E 1UTJA 4RN6A 3QTVH 2D8WA 3KHVA 3HGPA 2D2DA 5EPYA 1T8MA 3RXPA 1O5GH 1ELVA 1O0DH 2ODYB 1VJAU 2XC4A 1C5NH 4B76A 1HNEE 2WUCA 4I8KA 1GJ4H 3M5NA 1LO6A 1IQFA 2GDEH 3BEFB 4GSOA 1VITF 3ZYEA 4DY7B 1QY6A 3SGBE 1CGIE 1UCYE 2BZ6H 1C1NA 1UK4A 2TBSA 1O3KA 2C4FH 3RXDA 3GY3A 3RXRA 1OS8A 1E36B 1GHBF 1ZHRA 2ZFRH 2PSYA 1W11U 4ZXYH 1IQEA 1O3EA 2FS8A 1O3FA 7GCHG 1SSXA 3KIDU 1ZOMA 4VGCB 1P3CA 2HGTH 1OKXA 1UJ1A 2BY8X 1W7GH 2BD4A 3P95A 4J2YB 3P8NA 4INHA 3EA9A 1HAHH 2BY7X 4A92A 4OS4A 4JK5A 4A1VA 2OD3B 2WV5A 1MCVA 4JMYA 1YPHC 3ESTA 5AFYH 1CO7E 3RC5A 1FAKH 3F6UH 1YCPM 1K22H 1N8OC 3GY2A 1QR3E 3QO6A 2XBVA 2ZGXH 4FVBA 3RXSA 1KLIH 1HFDA 3SNDA 3A8CA 4Q2KA 2VGCB 8GCHF 1AZZA 2FI3E 4LZ4B 4IW4E 2OQUA 4B71A 2CHAC 4BXWA 4K8YA 3B9FH 2ZCLP 2ZTZA 5T6GA 1BMAA 4LZ1H 5L2YH 4X6PA 5A2MH 2OC0A 2O8TA 1ZHMA 2BOHB 3F9HA 1Y3WA 1P01A 4NA7A 2PSXA
chains in the Genus database with same CATH superfamily
1OWIA 4H42U 1NY22 3ATLA 4KTCA 2QXGA 1F0TA 1PFXC 1NO9H 1NM6A 4AG1A 1IHSH 4UD9H 2ZCHP 4Y8ZA 3SJ9A 3NKKA 1TMTH 1DY8A 2FO9A 3TK5A 4AFQA 1ID5H 1P3EA 5DSFA 4U2WA 2HNTE 1C1PA 3A8BA 2ZU4A 5HIZA 1HAIH 1J15A 1IAUA 1GDNA 2WPJS 1CHOF 2ZQ1A 1PPEE 2FOCA 3P8GA 4JZFH 1O2QA 2ZDKA 4D9RA 5L2ZH 1W8BH 2QXHA 4K1EA 1HAPH 1UTOA 3SU1A 2VVVA 4ISNA 1V2WT 3PLPA 2FXRA 5C1UA 2L6OA 3KF2A 2M5TA 5CHBA 1ZMLA 4GHTA 2O8UA 5EXLA 2EY4C 2WYGA 1EAUA 5GCHF 5C2ZA 1VITG 1EZQA 4Z6AH 1O30A 1YPJH 1TB6H 3ZZCA 1SGPE 1B0FA 2GJGA 3BG8A 4NWLA 1K1LA 1KY9A 3OTPA 1GHVH 3F1SB 1D6RA 1GI6A 1GBCA 4R8TB 1SVPA 1TBZH 1IQKA 1GMDG 2A4OA 1SGIB 1ZPZA 4MNXA 5CE1A 3E0PB 2A5KA 5DP8A 1YPHE 1AFQC 1KLTA 4HFPB 2ZHQH 3SNAA 1GHWH 2BXUH 2QC2A 1BMNH 3F9FA 1OYQA 1CHGA 1T8NA 2EI6A 2ZNKH 1D3PB 2SGQE 3SW2B 3T28A 2VU8E 1G3BA 5A8ZA 5KEDA 1CE5A 1PPBH 1KTSB 5A8YA 3SV8A 2FM2A 1Z8JB 2ZI2H 1PQ5A 2P8OC 2SGEE 4NSVA 1MQ5A 2O8WA 3DT0H 4YLUA 3MQKC 2F9PA 4WJG2 3RXQA 1QRWA 1A3BH 1XUJA 3NZIA 2CJIA 4UFEH 1THSH 1BOQA 1NN6A 2BHGA 1MAYA 3E8LA 4O97A 4ZKRU 3KQBA 1TPOA 1EATA 1VGCC 2Z6BD 3UOUA 4BAQB 4BXSA 3LJJA 2B0FA 1J16A 1FNIA 3EA8A 4NCYA 3QN7A 1P03A 4FETA 3KQEA 4OGYA 2XBWA 1EASA 1MCTA 2DUCA 1VCPA 1C2IA 5AHGH 1WBGB 1MUEB 2ZTYA 3A7ZA 3EDXB 6CHAB 3DA9B 3URDA 1CA8B 2BY6X 3B8JA 2ANYA 2BXTH 5CHAB 4B73A 2P16A 2Z3CA 1AU8A 1QL8A 4MPXA 2FI5E 1JMOH 1Y3XA 1YBWA 1KDQB 4YOGA 5BPEA 2J9NA 3DCLA 4DURA 5GDSH 2ZECA 4FUIA 1AE8H 1L2EA 1LHCH 4FUCA 1GI7B 5E0GA 3T29A 4FUGA 4JZDH 2CGAA 4AX9H 2P59A 2UUYA 5SGAE 2IPQX 4NWKA 3E6PH 3SI4H 1TPAE 1OHHD 2GDDA 3RXTA 2AIQA 1O3AA 3ODFA 3PB1E 3MH4A 4Q80A 3GOVB 1LQDB 1YPGH 3BTEE 3F68H 4GCHG 2ANMH 4TWYA 4Z1MD 1SPJA 1NBME 3IWMA 5DKMA 1OWJA 4DJZB 2QY0B 4MNWA 1QZ8A 1MTNB 2OXSA 2A4QA 5FX5A 1BTWA 2C93B 2ZPSA 3L3TA 1F2SE 4DIIH 5K7RA 2FOFA 3RM2H 2OINA 1OP8A 4X1RU 3SNBA 4B74A 2AEIH 1W7XH 3MWIU 3TGIE 1GL0E 1DFPA 2RA0A 8KME2 1TPPA 2G5NA 2H1UA 2HOBA 2W26A 1EFRD 4HTCH 1M9UA 3LGIA 1TA2A 1C5WB 3Q00A 2ZDAH 2G51A 3N99A 4AN7A 3UNSA 2BDYA 1F5KU 1ESBA 1BRBE 2J95A 2FTLE 4X8VH 1CGJE 2H6MA 1QL9A 5C17A 3VPKA 2F4LA 3LGYA 2R3YA 1Y59T 1SI5H 3RXCA 1NFWA 3BTDE 4CH8B 3SGQE 1VKYA 1TRYA 4INLA 2FYRA 1L1JA 1E38B 1C1WH 3A7YA 1QJ1B 1YYY1 4DGJA 1HAOH 2WSSD 2VJ1A 3LC3A 2ZPRA 1NRNH 1LHFH 4JZ1A 4GUXA 1NTPA 1H8HD 1H9LB 1QB9A 1V2NT 1QJ7B 4KTUA 3BSQA 1XUKA 1MKWK 3SJKA 4ABEA 2ZGJA 3FFGA 4NSYA 4BNRA 1K1OA 1O2SA 1NZQH 1FX0B 3F2GA 4RI0A 1ZRKA 1PYTC 2XWAA 4ABJA 1JWTA 1C5RA 5EPNA 3RXAA 3KGPA 1H8ED 2OTVA 3FZZA 4UFFH 3O8BA 3T27A 4DG4A 5ETXA 1O2YA 1O3MA 2GCTC 2CV3A 3GCTG 2CF9H 2JKHA 3SU2A 2XCNA 2VWLA 1BRAA 2FOHA 5E0HA 1EX3A 1TRNA 3GCHB 1YLNA 4XE4A 3I29A 5F8XA 3BIVH 2XRCA 4MVNA 3P17H 1V2PT 5GWZA 1O5FH 4JYUH 3PLBA 4M9FA 5C3NA 1TFXA 1KLJH 1EB2A 1FMGA 1LHGH 2ZEBA 4I31A 1C1TA 2PTNA 5EQRA 1F0SA 1ESTA 4WVPE 1DUEA 3QGJA 1THPB 1RXPA 3EGKH 2ZHWH 2ZF0H 4YZUA 1A0HB 2Q6FA 1OX1A 2B9LA 1GVZA 1HRTH 4X2YA 1RTFB 2VIQA 1C2MA 8LPRA 4DCDA 1Z7KA 2JH6D 1DM4B 4I8JA 3RLYH 1KMHB 2R0LA 1SFIA 3TK6A 2LELA 1C1VH 1GJ6A 4Y71A 4B6EA 2FZZA 2Q6DA 3SORA 1COWD 1AWHB 1V2QT 4TT3D 1WOFA 1H1BA 2H9EH 2C8WB 4JZEH 1C2JA 4BAMB 1SGTA 1TGNA 3VGCC 2KR7A 2VIOA 1P2NA 3F0PA 3RXBA 2ZDNA 4RSPA 4A5TS 4U32A 1EAXA 1FY1A 2XC5A 4NIYA 1LQEA 2VIVA 3R0FA 1TMUH 1Z8RA 4RT1A 3RU4D 3FOAA 5PTPA 1SGYE 3SV6A 2BZAA 2ZFPH 1MZDA 3UWJH 3AW0A 1YC0A 1SHHB 1P2IA 2QV1A 3STJA 1Y5AT 3S69A 3A87A 4H6SB 3RXFA 5HXFA 1AUTC 4DT4A 1GI8B 4ABDA 2O8MA 4D8NA 1H8IH 3PRDA 1D9IA 1RRKA 1BBRE 2YMSC 1ACBE 2BVXH 1O2PA 1QQ4A 1TRMA 1O5DH 3AAUA 1OWKA 4MPVA 5HMAA 2F83A 4WXVA 1CU1A 2UWLA 2ZC9H 3SU3A 3VB7A 1P9SA 3UPEA 4ASHA 1XKAC 2WUBA 1LVMA 1TNLA 2ZDVH 3MNCA 1ELBA 1NBMD 2V6NA 2BD7A 2CN0H 2G4UA 2XC0A 4TPYA 5DPAA 1W0JD 4BAKB 3M5OA 1HAVB 1NU7B 2KCPA 2ZGBH 4Y8XA 3RXKA 3RP2A 3UREA 1S83A 2AGGX 1DOJA 3RU4T 4WXIA 4Y10E 3LONA 2LPRA 2GKVE 1YGCH 2PFEA 2UUJB 4AC9A 3OY6U 1O2TA 1W3CA 3OEED 3BEIB 4LXBH 2UUFB 2GCTB 2Z94A 3H5CB 1C4Y2 2QYIA 1DT2A 4Y76A 2ZHDA 1XUFA 1O3GA 4BTUB 5FBEA 3SO3A 1YY3A 1O3JA 2GV6A 1D6WA 2UUKB 1TNIA 3M7TA 3BTHE 3P8FA 3PV4A 5L30H 1L1GA 1SGDE 4MNYA 1F5LA 2CF8H 1Z8IB 2UWOA 5K0HA 5AF9H 4HGCA 4D76A 1TX7A 2Y7XA 3LDXH 3IG6B 3BTGE 3QGNB 3A7VA 5C5OA 4TSFD 1QTFA 3LC5A 4Y7AA 2NU1E 3UNRA 2PP6A 1C5ZB 3A80A 3SUDA 3ZZ9A 1TNKA 4A6LA 1C2LA 2KM0A 4FUEA 3F2FA 1LVOA 2R2MB 7LPRA 1HAVA 2YNBA 3SU6A 3PTBA 1UTMA 2F91A 3B23B 3LU9B 5A0CA 2OCVB 1LPZB 4JK6A 3ZZ3A 2VWMA 3DFLA 1CA0B 3AVZA 1C4V2 4X1SU 1WQVH 1GI3A 4MPWA 5C67A 3A7XA 2HVXA 1GG6B 1F92A 2BMGB 1K21H 5IK2D 2FLBH 3ZV8A 5A0BA 1UK3A 1GJDB 4K5ZA 3ZZ5A 5CHAC 2ZPQA 1TYNA 2BD9A 3M61U 2Y81A 4K60A 3ZVFA 1Y5BT 4UFGH 4FUHA 1T7CA 3RUOA 2WPHS 1HBTH 3DSGA 1HJAC 3K9XB 4Y0ZE 2ZFTA 1SKYE 4X1PU 1L0ZA 3TLOA 8ESTE 2J94A 1CT0E 2ZU2A 1E1RD 3ZZ6A 4YOJA 5EOKA 1J14A 2GVFA 3LGVA 2AS9A 1OWEA 3PWCA 1YWUA 2P3TB 3M36A 4U30A 4BTIB 5C0UA 1ORFA 3ZVDA 4CRCA 1GJ8B 5HGGA 4CRDA 3T62A 1O3HA 3GY6A 3TH3H 3AK5A 2V7QD 2WPKS 3GY4A 3LGWA 5EJLA 3U8TH 3K65B 2P93A 1O2GH 3A88A 3HKIB 3PLKA 1IOEA 5ESTE 1SGNE 1WUNH 2QF4A 4ISOA 3EE0B 1N1LA 3ZZDA 5EW2H 1O2MA 3P8OA 4WH8A 1TBQH 5AVDA 4OGXA 1D4PB 2A7CA 2Y80A 5BRRE 1GHZA 2ANWA 4O3UA 3SHAH 2A0QB 5FCKA 1AKSB 2TGPZ 3MU4A 4I8HA 3T26A 2J5UA 3P6ZB 3PTNA 1O34A 1DLKB 3ATMA 1GCTC 4X6MA 3UTUH 3MHWU 1UVUH 4KELA 1TABE 1A5GH 2Z9LA 3PRBA 3D62A 2BOKA 3LGTA 5DG6A 2F43B 4NG9H 1PQ7A 1EZUC 3BTTE 2D1JA 5FPYA 2R0KA 1AQ7A 1V2OT 2NU2E 1UVPA 4XBCA 1HGTH 2ZHFH 6CHAC 3MU1A 1V2MT 3GISB 1QL7A 2BD8A 3TVJB 1EB1H 1SGCA 1TALA 1TNJA 3OFND 4MDSA 3RXLA 5B6LA 3W95A 3SHCH 4K1TA 1ELGA 2XCFA 1TOCB 2GZ9A 2OK5A 4TY7A 3VFEA 4AYVB 1UMAH 2WPDD 2ZGHA 3KL6A 1C5UA 4IMQA 1ZPBA 4P02A 1CT4E 1NFYA 1JRTA 4IC6A 3RXVA 4ZCNA 2AGEX 5CDFE 3N7EA 1A5HA 1TOMH 1IQIA 2EI7A 1MKXK 3RMMH 5C5NA 4OS6A 1P06A 1C5LH 3V12A 1C1MA 2AYWA 4CRAA 4E06H 1EXFA 1DDJA 1ELTA 2TIOA 3DHKH 1L4DA 1S82A 3F2HA 2BLQA 1QJ6B 2ZG0H 3RU4E 2ZDMA 1TGBA 1JRSA 1GMCF 4KP0A 3TITA 4CHAC 1UVSH 3TGKE 3SYJA 2F9VA 1PPFE 1RGQA 2EEKA 1DANH 3VB6A 4DW2U 2QXIA 4B75A 5ESBA 1S6LA 1Y5UT 1G9IE 1YPMH 2FODA 3H09A 4AFZA 4ISHH 1WXRA 2PKAB 4RKJB 1C2EA 2GMTB 2CMYA 3UAIC 4MQAA 4AGJA 1BTYA 1KDQA 2PGBB 4DOQA 1FY4A 4AFUA 2RCEA 3RC6A 1BMMH 1NESE 3QDZB 2GD4B 1O2ZA 3RXEA 1MTNC 3MH7A 4CREA 3RXHA 3MO3A 4K2YA 4Y79A 3M3VA 1VCWA 2VH6A 1RD3B 5DJ7A 1HAXB 3Q76A 3GDSA 2YOLA 3A7WA 2XWBI 3MH5A 3P92A 4D7FA 4DVAU 4WY3A 1V2LT 1GG6C 2FESH 1INCA 3SUFA 2GMTC 3PV5A 3BEUA 4XBDA 2GCHF 3DSPA 1V2TT 4I7YH 2VINA 1S6FA 1GBTA 3TNSA 5I25A 1Y3VA 1CBWC 3G01A 1BITA 1QGFA 4WH6A 5JBBS 2JJ2D 4BANB 2Z3EA 1EZXC 2A4GA 2FWWA 1GHAG 1GBLA 3Q3KA 2H9HA 3RXUA 2J98A 5JDUB 2OBOA 2FIRH 2P3FH 4FU7A 3ZYDA 1GGDC 3LH3A 4BAOB 4ZROA 3S7KB 2HWLB 4ZKNU 1AZ8A 3O8CA 3KQ5A 3ATWA 1XM1A 1ABIH 2BQWB 4AB9A 1V2RT 1DUAA 3KYGA 1GI9B 1NFUA 3MNXA 5FPSA 1FQ3A 1KXCA 1Q31A 3QX5H 2B5TB 1NU9A 4AOQA 1GJBB 4GPGA 2BD3A 1EQ9A 3FKSD 1O3BA 1FDPA 1BMLA 2THFB 2IPHA 1OWDA 1YF4A 4CBOA 1AUJA 4LOYH 1GBFA 2ZZUH 2F9BH 3SGAE 1HCGA 3ODDA 1K28D 4XDEA 1A5IA 1XX9A 3SJ8A 1QNJA 1LTOA 4K8BA 3VB3A 3MYWA 1O3LA 3GDVA 1Q2WA 3FANA 1OP2A 4NZQA 2G4TA 1FXYA 4VGCC 2W3KA 1J17T 1MTVA 4AZ2B 2PW8H 1EOJA 2PGQB 1P12E 4Q7XA 2ALVA 1AD8H 1MTUA 5EODA 3SN8A 1TPSA 1SLVB 4FUFA 3TJVA 3UUZA 4IBLH 2VIDA 1LMWB 1NS3A 3S7HB 3ZZAA 3M7QA 1N6XA 1U6QA 4CRBA 4A1TA 1ESAA 4KKDA 2W7SA 2A45B 1S5SA 3MU5A 5A09A 3ZVCA 3KQCA 3LGUA 2QF5A 3ATIA 5HKKD 1AVXA 1J8AA 4QT8C 3TK9A 4U01A 2V3OH 1CHOG 3LIWA 1BCUH 1UCYK 2XOKD 1Z6JH 1FN8A 1OOKB 1G32B 9LPRA 3AAVA 1XVMA 1MH0A 4FXGH 3ATKA 3AW1A 2GZ7A 5B6OA 3LJOA 1MMJN 1DVAH 1GHBG 3ZVEA 2A7HA 3LPRA 1HAZB 4E05H 5F6MA 1O5CB 2PR3A 4NA8A 1ABJH 1K2I1 1GJ5H 3SUEA 1JOUB 5C1YA 1V2ST 1TGTA 2P8OB 5EXNA 3O8RA 4INKA 2J34A 2WPIS 4I8GA 5GIBA 3SU0A 3PWBA 1KYNA 1D3QB 3TIUA 1WU1A 1GHAF 1P05A 2TGAA 4O3TA 1RTLA 1YPKH 3S9BA 4M7GA 2FEQH 3E1XB 3HKJB 1GVKB 2ZFQH 1FAXA 3NK8A 1O3IA 3U9AH 1PQ8A 1PPGE 1WTHD 4FUJA 3BG4B 2W7UA 1QB6A 2ALPA 3R3GB 4ABGA 3WW7A 2BVRH 3IITA 1VCQA 5LH8A 1SC8U 1NRPH 2SNVA 4AGKA 1UTKA 2KCOA 5HIYA 2G52A 4ZHAA 1SQOA 3SZNA 2G8TA 3BTFE 5DO4H 2P95A 4YOIA 5KGOA 1NRQH 1WDIA 3LT3A 4BTTB 4NIWA 4WMEA 4B1TA 4XOJA 2AIPA 3C1KA 3QUMP 1C5MD 3TJOA 2QXJA 3GICB 3HK6B 3RDZA 4ZMAH 4TWWA 1AN1E 4IN2A 4JYVH 1QB1A 1IQMA 4FUBA 1QFKH 1A0LA 1AI8H 4OS7A 4PROA 1QRZA 1ELEE 1Y3YA 3PO1B 5LPEA 1ANBA 1ETSH 3SJOA 3RLWH 2GCHG 1MD8A 3HPTB 1BTHH 1JIRA 1QA7A 3MI4A 1OYTH 5HM2A 2QE7D 3RXIA 3Q3YA 1S0QA 3CENA 3HK3B 1BHXB 1AFEH 2IJD1 2OC1A 2FX6A 1YLCA 1UTPA 3N7OA 1XKBC 1SGQE 4ZHLU 1HLTH 2ILNA 2Y5HA 2BVSH 1PQAA 4FVDA 3ZVBA 2R3UA 3WWBA 3UOPA 2ULLA 3M5LA 2PKSB 1DS2E 1O2IA 1MTWA 1ZZZA 5EQQA 1C2KA 4NFFA 4AFSA 5DGJA 3QLPH 2FDAA 3GY7A 4TYDA 3GCHC 1TGSZ 5FCRA 2GT7A 1W10U 2EA3A 1O2UA 4MNVA 3ZVAA 3GY5A 1DY9A 1T4VH 1PYTD 1TBRH 1MTSA 2FP7B 1V2JT 2J38A 1C9PA 5F8TA 3DUXH 3BTQE 1RS0A 2GP9B 1P04A 1SGEE 4Y11E 1GMCG 1GBAA 3D23A 2A2XH 3QZQA 4JYTA 2OUAA 1H9IE 1NRSH 1UHBA 5ABWA 2BY9X 1DPOA 4I86A 1C5TA 3FP8E 1XUHA 1AIXH 3HGNA 4F48B 3UQVA 1N6YA 1DXWA 3E90B 1O3PB 2Z9KA 2EQNA 1AFQB 1GJ7B 1O39A 2A2QH 4WF8A 1GBIA 1O2VA 4OS1A 4Z0KA 3RXGA 4IC5A 1O3CA 2Q6GA 2VWOA 1TX8A 2V3HH 1A7SA 1ZR0A 4BOHA 4ZXXH 3M3TA 2TRMA 2I6QA 3UB0A 1HIAB 1BUIA 5DP7A 1UTLM 2D26C 1P9UA 4X1QU 4A7IB 2O8LA 2IOTA 3NPSA 1O3OA 2FOAA 3EE7A 1P57B 1A3EH 1GCDA 2CHAB 1UTNA 2JH5D 4FUDA 3BF6H 2UWPA 3BG4C 4AYYB 4YXWD 1LKAA 1GMDF 1WTGH 1XMNB 1O33A 2ODPA 4X0WU 1YPLH 2HNTF 4XBBA 3I78A 3SV2H 4Y8YA 1OSSA 1ETRH 1FY3A 5TCCA 4I32A 1TMBH 4F49A 4K69A 3BTKE 2WPMS 1MKWH 1C2FA 7KMEH 5JBAS 1ZJDA 2H2ZA 1ANCA 3UWIA 3GDUA 1HAGE 1TWXB 3CP7A 2FOEA 4TY6A 3E16B 2Z9JA 3KEEA 4NFEA 1T32A 1SOTA 1BBRH 3GCTF 1E1QD 1TLDA 2A5IA 2I6SA 3PMJA 2AGIX 5T6DA 2Z9GA 2Q1JA 1CGHA 1S81A 6LPRA 1O2WA 2QCYA 2JETC 1JXPA 2W3IA 4E7NA 3PO1C 2TPIZ 4MTBA 2KCAA 1SGFG 4FU8A 3S9AA 1SG8B 1AHTH 3TGJE 5EJ1A 1EJNA 5AFZH 3ZV9A 3A81A 1G37A 3BTME 4YO9A 4KTSA 3FP7E 1G3DA 4ZKSU 4B6FA 1TNHA 3NWUA 3T25A 1XXFA 4IN1A 1GBMA 1BB0B 5T6FA 5KECA 2PKSC 1KIGH 2BDCA 3TJNA 4X2VA 2VH0A 4YESB 1F0UA 2J98B 3ZZ7A 2WV9A 1MU8B 3MU8A 1ANDA 1BDAA 5TCAA 1GCTB 1RFNA 1ZSKA 2WPLS 3QTOH 4OS2A 1T4UH 3SU4A 1SHYA 2FX4A 2AFQB 1GBBA 1GL1A 1DXPA 3VXFH 1Z6EA 1KXDA 1WSSH 4ISLA 3KN2A 4NGAH 1E35B 1GPZA 1O2JA 4BAHB 3SBKA 2EI8A 1P2QA 1S6HA 1QBNA 1LHDH 3GY8A 1UVTH 3EQ0H 1K1JA 1KTTB 1A61H 2XXLA 3OAAD 1E34B 1GHYH 2PKAA 3A8AA 1H8DH 2H5CA 3SNEA 4LK4A 1FY5A 3PMBB 4XSKU 1ANEA 2CXVA 2QA9E 1AE5A 1IQGA 2B8OH 4FOUC 2BD2A 3E91A 1UHBB 1K0HA 4NIXA 1YP9A 1BRUP 1V2KT 2HRVA 1MBMA 5EJZA 3TH4H 3GCNA 4X6NA 3M3SA 1K1PA 3A82A 2LP6A 5HYOA 1FJSA 2JETB 1OP0A 1O37A 3PV2A 3TNTA 2A4RA 3CNRA 2J97A 1SFQB 3N7DA 1SGRE 1JBUH 1LCYA 6ESTA 1HUTH 1RJXB 1BTZA 1ZTKA 2PV9B 5E2PA 1AO5A 2DE9A 1BIOA 3GCOA 3SV7A 3PROA 5FAHA 2HPPH 1GBDA 1FI8A 1QQUA 2O9QA 1O2NA 2SGFE 1F0RA 1MAXA 1BQYA 1TQ0B 4X2WA 2HNTC 2A7JA 1DWDH 1Y8TA 1WQSA 3U1JB 1LPGB 1K1IA 2B7DH 5EGMA 1ETTH 2SGDE 1AB9B 3W1EA 1UK2A 2GGVB 3VEQB 2RDEA 4SGBE 4CRGA 1GDUA 2V0BA 5GXPA 1P0SH 1F5RA 2OLGA 5E8EH 2ZKSA 5F03A 4IS5A 1C5VA 4UONA 1NRRH 2C90B 4FU9A 3VXEH 1BMFD 4D7GA 1EPTC 1O2XA 2H9TH 1K1NA 3HATH 4OS5A 3MH6A 1ZJKA 2ZHEH 1YKTA 3M7UA 4ZKOU 1BRCE 5DP9A 1GI5A 1CSOE 5CMXH 1OPHB 1G30B 3MNBA 3UNQA 3A84A 2CK3D 3D65E 1WYKA 3NCLA 3BV9B 2HVYB 1AVGH 3L33A 2XBXA 5E2OA 1EUFA 4OM9A 1N8OB 4CR5A 1MBQA 1W13U 2BTCE 1HJ9A 2IN2A 3MU0A 1VR1H 3VG8A 5LPRA 5GJ4B 3DSOA 3SQEE 1BZXE 3RXMA 3RC4A 3F9GA 4X6OA 1QRXA 2GTBA 2QIQA 4AG2A 5C1XA 1MQ6A 1HIAA 5LGOA 2G00A 4Q7YA 1DWEH 2NU4E 2V35A 3UIRA 1YLDA 1LVYA 1SLXB 2XBYA 5EW1H 1O2RA 4CBNA 3DFJA 5EXMA 1Z71A 3MFJA 2SFAA 1DX5M 1ARBA 4GHQA 3UQOA 4X1NU 1SBWA 1C5QA 1ZLRA 4P00A 4D9QA 1C9TA 1AKSA 1A46H 4DIHH 2FYQA 3UR9A 3A83A 1AMHA 3SJIA 1GBHA 1O32A 3BIUH 4K1SA 1A2CH 1FIWA 1NT1A 4JCNA 2WHXA 5T1VA 1C5SA 1O5BB 1DITH 1VITH 2JH0D 2AMQA 1FLEE 1QHRB 3KNXA 2LNCA 3GS9A 2XNDD 5LPFA 4F4OC 4K3JA 1C1UH 1YPEH 3VB5A 1ZHPA 4UFDH 1P09A 4H6TA 1K9OE 3A86A 1EP6A 2NWNA 1G2LA 1GI1A 1BHXF 3NUMA 1EZSC 2ODQA 1EJAA 1C5PA 1PPHE 1HJ8A 2JIZD 1GBKA 4KGAA 4ISIH 3OU0A 4IGDA 4MG3A 4ABBA 5HM9A 3RMOH 3RXOA 2G55A 2ZU3A 1B0EA 3CS0A 2PTCE 2PUXB 3K6YA 3QZRA 4MPUA 3F9EA 1YCPK 1SQTA 2V3MA 2F3CE 1O2OA 3AASA 1SL3A 2FTMA 2PWXA 1GI2A 1F7ZA 2AHME 3U8OH 5IDKA 1C2GA 1O2LA 2WZQA 3PMAB 5JB9S 2ZO3H 4CH2B 1PJPA 4Y6DA 1DWBH 1GHXH 3MMGA 4YM9A 4F55A 2M2AA 2SGPE 1C1QA 1EOLA 3U28C 3BN9A 2A1DB 3KYFA 3I77A 1DICA 2SGAA 1SR5C 1O2KA 1GI0A 4H4FA 3U69H 3UR6A 1DWCH 1O35A 1G3CA 3RMNH 2PLXA 2VWNA 3V0XA 1GWAA 6GCHG 1TQ7B 3SI3H 3ZIAD 1T8OA 3DD2H 3ZZ8A 2HALA 9ESTA 2BY5X 3RXJA 4UE7H 3SQHE 2VBCA 3PYHA 1DE7H 3PMHB 2W6JD 2ZTXA 1FPHH 3C27B 2C8XB 2KAIB 1BJVA 1J9CH 3RMLH 1O5AB 4YT6H 4NIVA 2DE8A 5FBIA 1UW7A 2ASUB 3WY8A 3UFAA 4J1YA 4X2XA 5C20A 3A7TA 1WAYB 4AB8A 2G5VA 4GCHF 3TJUA 4DT7B 1MD7A 1MZAA 2F9NA 2FI4E 1V6DA 1XUIA 4MLFB 1AWFH 3O8DA 3SZEA 2JJ1D 2ZQ2A 2OC7A 1P2KA 1GBJA 2Y7ZA 1PPCE 2G81E 3V13A 1AY6H 3ENSB 4WWYA 3ZZ4A 1P2JA 3PM3A 1GMHG 3V3MA 3S0NA 1ZYOA 4WMDA 2AMPA 1SQRA 2ZIQH 3FP6E 1NPMA 4ZAEA 1TONA 2K0QA 3U1IB 1C2DA 2STBE 3EYDA 1CVWH 1V3XA 1NROH 2BX4A 1TX6A 5G4BA 2PUQH 2A32A 1G36A 5FXLA 1LKBA 2Y5FA 3ITIA 5DK1A 3RM0H 3URCA 1FPCH 2VVCA 5JBCS 2XNIA 2KAIA 2OP9A 1O36A 1P8VC 4GLYA 3F0OA 1C5YB 2C3SA 3OX7U 1ZSJA 2W6ID 4XD7D 1W2KH 1T8LA 1FIZA 4TPIZ 2EC9H 4Q4LA 1SQAA 2VIPA 1GDQA 1FV9A 1LPKB 1EAWA 1TIOA 1UTQA 5FPTA 4RKOB 3QK1A 4HZHA 1W0KD 1PPZA 4O9VA 2L74A 3S9CA 1FONA 2K8IA 1T31A 5A0AE 2J2UA 5DP5A 1RTKA 3OEHD 4R0IA 3EAJA 5C0TA 1TA6A 4ACBA 1TE0A 3M35A 5JB8S 1FUJA 5L6NH 3H7TA 2P94A 1E79D 3JZ2B 1C4U2 2A31A 2BD5A 2BYAX 3GYMA 1JIMA 2GX4A 1AVWA 2NU3E 4UDWH 5EQSA 4CR9A 7ESTE 3STIA 1NC6A 2ZA5A 4Q7ZA 4X8UH 2R9PA 1A1RA 2QAAA 1P02A 2BDHA 1C5OH 1EP5A 2ZFSA 1CQQA 1RIWB 2WV4A 2Y5GA 2FOGA 2GZ8A 3VGCB 3SU5A 4Y0YE 1O3NA 3E3TA 1ZMJA 1V2UT 4XRNA 3FVFB 2KCYA 2ZCKP 4YT7H 3SUGA 5DP6A 1YCPH 1E37B 1EAIA 4ESTE 3OE7D 1VZQH 3V7TA 1FZZA 3U8RH 3H7OA 1BTXA 2ZP0H 1C1SA 1DSTA 2ANKH 1P2MA 2WINI 4JZIA 4RT0A 4ZHMU 1AB9C 4X8TH 3LH1A 2H5DA 2KZ4A 1HAYB 1QURH 1SGFA 1TNGA 1VGCB 2BLWA 1B5GH 3T5FH 4IMZA 3QWCH 1GGDB 2C8YB 2Y82A 2WYJA 3M5MA 2OBQA 2PHBA 5J4SA 3KCGH 3LOXA 1Z1IA 2J4IA 1O3DA 1Y3UA 1KXEA 2P3UB 2Z3DA 4YTAA 3NRLA 5H4IB 1FN6A 3K6ZA 1IQNA 2A5AA 3T2NA 1ZGVA 5EU8A 1CBWB 1BA8B 1GBEA 2YMSD 1TGCA 4ABHA 1CT2E 2F9UA 2ESTE 5JYIA 3K2UA 4GAWA 1SLWB 1MU6B 4YLQH 5DP4A 1G3EA 3TPIZ 2VVUA 1EJMA 1QBVH 2VGCC 1UO6A 3KQDA 3BTWE 1LHEH 2GV7A 1ELAA 1D3TB 2FOBA 1C1RA 3D49H 1A4WH 3MO9A 5TJXA 2R2WU 3OSYA 1HPGA 1KXFA 4I8LA 1BBRK 2NU0E 5JBTA 1BJUA 2BX3A 1ELCA 3JZ1B 4E7RG 1ZTJA 2ZDLA 1IQJA 2FOMB 1HB0B 4THNH 1O31A 2QN5T 2BLVA 3MNSA 1O5EH 4WMFA 4A1XA 1Z1JA 2TGTA 1Q3XA 3SNCA 5EG4A 5GCHG 4UEHH 2BDIA 1S85A 1SMFE 2SNWA 7GCHF 2XYAA 3OTJE 1ZMNA 1DSUA 1D3DB 4Y7BA 1W12U 4CRFA 3A89A 2ZGCA 3FAOA 1H4WA 1ZRBA 1V2VT 3CS7A 2RA3A 4XFQA 4CHAB 1W14U 1OWHA 1O38A 2BQ7B 3L6PA 4B2AA 5T3HA 2BDGA 3MTYA 1SLUB 3W94A 1C2HA 1GMHF 1P2OA 2QF0A 1RIWC 1W0ZU 3UY9A 4ABFA 2VB0A 3A8DA 2RG3A 2FPZA 3MOCA 2GT8A 1G2MA 1XUGA 3OYPA 3U98H 2HPQH 2Z9IA 4HI3A 1UVOA 3TU7H 3OY5U 3Q3XA 5F8ZA 1ZSLA 3NXPA 1E0FD 4ZUHA 1QCPA 8GCHG 1QA0A 5FHTA 2ZU5A 1QBOA 3TH2H 2TGDA 5A8XA 1EKBB 1HV7A 5JPMH 1WCZA 1ZPCA 1GJCB 2J92A 2VIWA 2K1QA 1EPTB 2BQ6B 3MO6A 2BLOA 4NZLA 4O03A 2AERH 3GYLB 4NA9H 1GVLA 2BB4A 1K1MA 1VJ9U 2XW9A 1HXEH 1CA0C 2XTTB 5J4QA 1L1NA 2F9OA 2IJOB 2RDLA 3ELAH 5GPIB 2Z7FE 3LKWA 1GI4A 3E0NB 4HG6A 3WWFA 6GCHF 1XVOA 1P10A 1S0RA 1ZGIA 1IQHA 2BDAA 1X7AC 2QGRA 2STAE 2Y6TA 1GJAB 5I46H 5DP3A 1EPTA 4SGAE 3VB4A 1WV7H 3SOSA 1QIXB 2OQ5A 2AMDA 1DLEA 1FY8E 4ACAA 1UCYH 1HJAB 1BT7A 3M37A 1HYLA 1SB1H 1B7XB 2FMJA 1KSNA 1THRH 2HLCA 4Q63A 2BM2A 1IQLA 1NFXA 4GVUA 1MKXH 1HXFH 1HDTH 3EA7A 2FLRH 1C1OA 5DN6D 1L4ZA 5C94A 1KXBA 4I33A 1AGJA 4ZH8A 1OXGA 1BTPA 4B2BA 2BDBA 1ELDE 1XXDA 5IYTA 5E0JA 3P70B 3Q77A 2VNTA 2YNAA 1C5XB 2FS9A 2ZWLH 1S84A 2ZFFH 2QF3A 1W0YH 1ARCA 1A0JA 1SOZA 3ZVGA 3ZZBA 3SV9A 2ZU1A 1ELFA 4X8SH 1LDTT 2OC8A 1TAWA 1O2HA 1YM0A 4AORA 1KXAA 4ABAA 2AH4X 5FX6A 1LVBA 1IHTH 2W5EA 2C8ZB 3FZDA 1BTUA 1H9HE 1Z8GA 3A85A 4B2CA 4ABIA 1ZTLA 2RFKC 1GJ9B 1P11E 1UTJA 4RN6A 3QTVH 2D8WA 3KHVA 3HGPA 2D2DA 5EPYA 1T8MA 5GNDA 3RXPA 1O5GH 3FN8A 1ELVA 3FO8D 1O0DH 2ODYB 1VJAU 1C5NH 2XC4A 4B76A 1HNEE 2WUCA 4I8KA 1GJ4H 3M5NA 1LO6A 1IQFA 2GDEH 3BEFB 4GSOA 1VITF 3ZYEA 4DY7B 1QY6A 2JDID 3SGBE 1CGIE 1UCYE 2BZ6H 1C1NA 1UK4A 2TBSA 1MABB 1O3KA 2C4FH 3RXDA 2KFWA 3GY3A 3RXRA 1OS8A 1E36B 2KX4A 1GHBF 1ZHRA 2ZFRH 2PSYA 1W11U 4ZXYH 1IQEA 1O3EA 2FS8A 1O3FA 7GCHG 1SSXA 3KIDU 5F53A 1ZOMA 4VGCB 1P3CA 2HGTH 1OKXA 1UJ1A 2BY8X 1W7GH 2BD4A 3P95A 4J2YB 3P8NA 4INHA 3EA9A 1HAHH 2BY7X 4A92A 4OS4A 4JK5A 4A1VA 2OD3B 2WV5A 1MCVA 4JMYA 1YPHC 3ESTA 5AFYH 1CO7E 3RC5A 1FAKH 3F6UH 1YCPM 1K22H 1N8OC 3GY2A 1QR3E 3QO6A 2XBVA 2ZGXH 4FVBA 3RXSA 1KLIH 1HFDA 3SNDA 3A8CA 4Q2KA 5EIYA 2VGCB 3F3BA 8GCHF 1AZZA 2FI3E 2HLDD 4LZ4B 4IW4E 2YMSB 2OQUA 4B71A 2CHAC 4BXWA 4K8YA 3B9FH 2ZCLP 2ZTZA 5T6GA 1BMAA 4LZ1H 5L2YH 4X6PA 5A2MH 2OC0A 2O8TA 1ZHMA 2BOHB 3F9HA 1Y3WA 4ASUD 1P01A 4NA7A 2PSXA 5FL7D
chains in the Genus database with same CATH topology
1OWIA 4H42U 1NY22 3ATLA 4KTCA 2QXGA 1F0TA 1PFXC 1NO9H 1NM6A 4AG1A 1IHSH 4UD9H 2ZCHP 4Y8ZA 3SJ9A 3NKKA 1TMTH 1DY8A 2FO9A 3TK5A 4AFQA 1ID5H 1P3EA 4U2WA 2HNTE 1C1PA 3A8BA 2ZU4A 1HAIH 1J15A 1IAUA 1GDNA 2WPJS 1CHOF 2ZQ1A 1PPEE 2FOCA 3P8GA 4JZFH 1O2QA 2ZDKA 4D9RA 5L2ZH 1W8BH 2QXHA 4K1EA 1HAPH 1UTOA 3SU1A 2VVVA 4ISNA 1V2WT 3PLPA 2FXRA 5C1UA 3KF2A 2M5TA 1ZMLA 4GHTA 2O8UA 5EXLA 2WYGA 1EAUA 5GCHF 5C2ZA 1VITG 1EZQA 4Z6AH 1O30A 1YPJH 1TB6H 3ZZCA 1SGPE 1B0FA 3BG8A 4NWLA 1K1LA 1KY9A 1GHVH 3F1SB 1D6RA 1GI6A 1GBCA 4R8TB 1SVPA 1TBZH 1IQKA 1GMDG 2A4OA 1SGIB 1ZPZA 4MNXA 5CE1A 3E0PB 2A5KA 5DP8A 1YPHE 1AFQC 1KLTA 4HFPB 2ZHQH 3SNAA 1GHWH 2BXUH 2QC2A 1BMNH 3F9FA 1OYQA 1CHGA 1T8NA 2EI6A 2ZNKH 1D3PB 2SGQE 3SW2B 3T28A 2VU8E 1G3BA 5A8ZA 1CE5A 1PPBH 1KTSB 5A8YA 3SV8A 2FM2A 1Z8JB 2ZI2H 1PQ5A 2P8OC 2SGEE 4NSVA 1MQ5A 2O8WA 3DT0H 4YLUA 2F9PA 4WJG2 3RXQA 1QRWA 1A3BH 1XUJA 3NZIA 2CJIA 4UFEH 1THSH 1BOQA 1NN6A 2BHGA 1MAYA 3E8LA 4O97A 4ZKRU 3KQBA 1TPOA 1EATA 1VGCC 2Z6BD 3UOUA 4BAQB 4BXSA 3LJJA 2B0FA 1J16A 1FNIA 3EA8A 4NCYA 3QN7A 1P03A 3KQEA 4OGYA 2XBWA 1EASA 1MCTA 2DUCA 1VCPA 1C2IA 5AHGH 1WBGB 1MUEB 2ZTYA 3A7ZA 3EDXB 6CHAB 3DA9B 3URDA 1CA8B 2BY6X 3B8JA 2ANYA 2BXTH 5CHAB 4B73A 2P16A 2Z3CA 1AU8A 1QL8A 4MPXA 2FI5E 1JMOH 1Y3XA 1YBWA 1KDQB 4YOGA 5BPEA 2J9NA 4DURA 5GDSH 2ZECA 4FUIA 1AE8H 1L2EA 1LHCH 4FUCA 1GI7B 5E0GA 3T29A 4FUGA 4JZDH 2CGAA 4AX9H 2P59A 2UUYA 5SGAE 4NWKA 3E6PH 3SI4H 1TPAE 2GDDA 3RXTA 2AIQA 1O3AA 3ODFA 3PB1E 3MH4A 4Q80A 3GOVB 1LQDB 1YPGH 3BTEE 3F68H 4GCHG 2ANMH 4TWYA 1SPJA 3IWMA 5DKMA 1OWJA 4DJZB 2QY0B 4MNWA 1MTNB 2OXSA 2A4QA 5FX5A 1BTWA 2C93B 2ZPSA 3L3TA 1F2SE 4DIIH 5K7RA 2FOFA 3RM2H 2OINA 1OP8A 4X1RU 3SNBA 4B74A 2AEIH 1W7XH 3MWIU 3TGIE 1GL0E 1DFPA 2RA0A 8KME2 1TPPA 2G5NA 2H1UA 2HOBA 2W26A 4HTCH 1M9UA 3LGIA 1TA2A 1C5WB 3Q00A 2ZDAH 2G51A 4AN7A 3UNSA 2BDYA 1F5KU 1ESBA 1BRBE 2J95A 2FTLE 4X8VH 1CGJE 2H6MA 1QL9A 3VPKA 3LGYA 2R3YA 1Y59T 1SI5H 3RXCA 1NFWA 3BTDE 4CH8B 3SGQE 1TRYA 4INLA 2FYRA 1L1JA 1E38B 1C1WH 3A7YA 1QJ1B 1YYY1 4DGJA 1HAOH 2VJ1A 3LC3A 2ZPRA 1NRNH 1LHFH 4JZ1A 4GUXA 1NTPA 1H9LB 1QB9A 1V2NT 1QJ7B 4KTUA 3BSQA 1XUKA 1MKWK 3SJKA 4ABEA 2ZGJA 3FFGA 4NSYA 4BNRA 1K1OA 1O2SA 1NZQH 1ZRKA 1PYTC 2XWAA 4ABJA 1JWTA 1C5RA 5EPNA 3RXAA 3KGPA 2OTVA 3FZZA 4UFFH 3O8BA 3T27A 4DG4A 5ETXA 1O2YA 1O3MA 2GCTC 2CV3A 3GCTG 2CF9H 2JKHA 3SU2A 2XCNA 2VWLA 1BRAA 2FOHA 5E0HA 1EX3A 1TRNA 3GCHB 4XE4A 3I29A 5F8XA 3BIVH 2XRCA 4MVNA 3P17H 1V2PT 5GWZA 1O5FH 4JYUH 3PLBA 5C3NA 1TFXA 1KLJH 1EB2A 1FMGA 1LHGH 2ZEBA 4I31A 1C1TA 2PTNA 5EQRA 1F0SA 1ESTA 4WVPE 1DUEA 3QGJA 1THPB 1RXPA 3EGKH 2ZHWH 2ZF0H 4YZUA 1A0HB 2Q6FA 1OX1A 2B9LA 1GVZA 1HRTH 4X2YA 1RTFB 2VIQA 1C2MA 8LPRA 4DCDA 1Z7KA 2JH6D 1DM4B 4I8JA 3RLYH 2R0LA 1SFIA 3TK6A 1C1VH 1GJ6A 4Y71A 2FZZA 2Q6DA 3SORA 1AWHB 1V2QT 1WOFA 1H1BA 2H9EH 2C8WB 4JZEH 1C2JA 4BAMB 1SGTA 1TGNA 3VGCC 2VIOA 1P2NA 3RXBA 4A5TS 2ZDNA 4RSPA 4U32A 1EAXA 1FY1A 2XC5A 4NIYA 1LQEA 2VIVA 3R0FA 1TMUH 1Z8RA 3RU4D 5PTPA 1SGYE 3SV6A 2BZAA 2ZFPH 1MZDA 3UWJH 3AW0A 1YC0A 1SHHB 1P2IA 2QV1A 3STJA 1Y5AT 3S69A 3A87A 4H6SB 3RXFA 5HXFA 1AUTC 1GI8B 4ABDA 2O8MA 4D8NA 1H8IH 1D9IA 1RRKA 1BBRE 1ACBE 2BVXH 1O2PA 1QQ4A 1TRMA 1O5DH 3AAUA 1OWKA 4MPVA 5HMAA 2F83A 4WXVA 1CU1A 2UWLA 2ZC9H 3SU3A 3VB7A 1P9SA 3UPEA 4ASHA 1XKAC 2WUBA 1LVMA 1TNLA 2ZDVH 3MNCA 1ELBA 2V6NA 2BD7A 2CN0H 2G4UA 2XC0A 4TPYA 5DPAA 4BAKB 3M5OA 1HAVB 1NU7B 3RXKA 2ZGBH 4Y8XA 3RP2A 3UREA 1S83A 2AGGX 1DOJA 3RU4T 4WXIA 4Y10E 3LONA 2LPRA 2GKVE 1YGCH 2PFEA 2UUJB 3OY6U 1O2TA 1W3CA 3BEIB 4LXBH 2UUFB 2GCTB 2Z94A 3H5CB 1C4Y2 2QYIA 1DT2A 4Y76A 2ZHDA 1XUFA 1O3GA 4BTUB 5FBEA 3SO3A 1O3JA 2GV6A 1D6WA 2UUKB 1TNIA 3M7TA 3BTHE 3P8FA 3PV4A 5L30H 1L1GA 1SGDE 4MNYA 1F5LA 2CF8H 1Z8IB 2UWOA 5K0HA 5AF9H 4HGCA 4D76A 1TX7A 2Y7XA 3LDXH 3IG6B 3BTGE 3QGNB 3A7VA 5C5OA 1QTFA 3LC5A 4Y7AA 2NU1E 3UNRA 1C5ZB 3A80A 3SUDA 3ZZ9A 1TNKA 4A6LA 1C2LA 4FUEA 1LVOA 2R2MB 7LPRA 1HAVA 2YNBA 3SU6A 3PTBA 1UTMA 2F91A 3B23B 3LU9B 5A0CA 2OCVB 1LPZB 4JK6A 3ZZ3A 2VWMA 3DFLA 1CA0B 3AVZA 1C4V2 4X1SU 1WQVH 1GI3A 4MPWA 5C67A 3A7XA 2HVXA 1GG6B 1F92A 2BMGB 1K21H 2FLBH 3ZV8A 5A0BA 1UK3A 1GJDB 4K5ZA 3ZZ5A 5CHAC 2ZPQA 1TYNA 2BD9A 3M61U 2Y81A 4K60A 3ZVFA 1Y5BT 4UFGH 4FUHA 1T7CA 3RUOA 2WPHS 1HBTH 1HJAC 3K9XB 4Y0ZE 2ZFTA 4X1PU 1L0ZA 3TLOA 8ESTE 2J94A 1CT0E 2ZU2A 3ZZ6A 4YOJA 5EOKA 1J14A 2GVFA 3LGVA 2AS9A 1OWEA 3PWCA 2P3TB 4BTIB 3M36A 4U30A 1ORFA 3ZVDA 4CRCA 1GJ8B 5HGGA 4CRDA 3T62A 1O3HA 3GY6A 3TH3H 2WPKS 3GY4A 3LGWA 3U8TH 3K65B 2P93A 1O2GH 3A88A 3HKIB 3PLKA 1IOEA 5ESTE 1SGNE 1WUNH 4ISOA 3EE0B 1N1LA 3ZZDA 5EW2H 1O2MA 3P8OA 4WH8A 1TBQH 5AVDA 4OGXA 1D4PB 2A7CA 2Y80A 5BRRE 1GHZA 2ANWA 4O3UA 3SHAH 2A0QB 5FCKA 1AKSB 2TGPZ 3MU4A 4I8HA 3T26A 3PTNA 3P6ZB 1O34A 1DLKB 3ATMA 1GCTC 4X6MA 3UTUH 3MHWU 1UVUH 4KELA 1TABE 1A5GH 2Z9LA 3D62A 2BOKA 3LGTA 5DG6A 4NG9H 1PQ7A 1EZUC 3BTTE 2D1JA 5FPYA 2R0KA 1AQ7A 1V2OT 2NU2E 1UVPA 4XBCA 1HGTH 2ZHFH 6CHAC 3MU1A 1V2MT 3GISB 1QL7A 2BD8A 3TVJB 1EB1H 1SGCA 1TALA 1TNJA 4MDSA 3RXLA 3W95A 3SHCH 4K1TA 1ELGA 2XCFA 1TOCB 2GZ9A 4TY7A 3VFEA 4AYVB 1UMAH 2ZGHA 3KL6A 1C5UA 4IMQA 1ZPBA 1CT4E 1NFYA 1JRTA 4IC6A 3RXVA 2AGEX 1A5HA 1TOMH 1IQIA 2EI7A 1MKXK 3RMMH 5C5NA 4OS6A 1P06A 1C5LH 3V12A 1C1MA 2AYWA 4CRAA 4E06H 1EXFA 1DDJA 1ELTA 2TIOA 3DHKH 1L4DA 1S82A 2BLQA 1QJ6B 2ZG0H 3RU4E 2ZDMA 1TGBA 1JRSA 1GMCF 4KP0A 3TITA 4CHAC 1UVSH 3TGKE 2F9VA 1PPFE 1RGQA 2EEKA 1DANH 3VB6A 4DW2U 2QXIA 4B75A 5ESBA 1YPMH 1Y5UT 1G9IE 2FODA 4AFZA 4ISHH 2PKAB 4RKJB 1C2EA 2GMTB 2CMYA 4MQAA 4AGJA 1BTYA 1KDQA 2PGBB 4DOQA 1FY4A 4AFUA 2RCEA 3RC6A 1BMMH 1NESE 3QDZB 2GD4B 1O2ZA 3RXEA 1MTNC 3MH7A 4CREA 3RXHA 3MO3A 4K2YA 4Y79A 3M3VA 1VCWA 2VH6A 1RD3B 5DJ7A 1HAXB 3Q76A 3GDSA 2YOLA 3A7WA 2XWBI 3MH5A 3P92A 4D7FA 4DVAU 4WY3A 1V2LT 1GG6C 2FESH 1INCA 3SUFA 2GMTC 3BEUA 4XBDA 2GCHF 1V2TT 4I7YH 2VINA 1S6FA 1GBTA 3TNSA 5I25A 1Y3VA 1CBWC 3G01A 1BITA 1QGFA 4WH6A 5JBBS 4BANB 2Z3EA 1EZXC 2A4GA 2FWWA 1GHAG 1GBLA 3Q3KA 2H9HA 3RXUA 5JDUB 2OBOA 2FIRH 2P3FH 4FU7A 3ZYDA 1GGDC 3LH3A 4BAOB 4ZROA 3S7KB 2HWLB 4ZKNU 1AZ8A 3O8CA 3ATWA 1XM1A 1ABIH 2BQWB 4AB9A 1V2RT 1DUAA 1GI9B 1NFUA 3MNXA 5FPSA 1FQ3A 1KXCA 1Q31A 3QX5H 2B5TB 1NU9A 4AOQA 1GJBB 4GPGA 2BD3A 1EQ9A 1O3BA 1FDPA 1BMLA 2THFB 2IPHA 1OWDA 1YF4A 4CBOA 1AUJA 4LOYH 1GBFA 2ZZUH 2F9BH 3SGAE 1HCGA 3ODDA 1K28D 4XDEA 1A5IA 1XX9A 3SJ8A 1QNJA 1LTOA 4K8BA 3VB3A 3MYWA 1O3LA 3GDVA 1Q2WA 3FANA 1OP2A 4NZQA 2G4TA 1FXYA 4VGCC 2W3KA 1J17T 1MTVA 4AZ2B 2PW8H 1EOJA 2PGQB 1P12E 4Q7XA 2ALVA 1AD8H 1MTUA 5EODA 3SN8A 1TPSA 1SLVB 4FUFA 3TJVA 3UUZA 4IBLH 2VIDA 1LMWB 1NS3A 3S7HB 3ZZAA 3M7QA 1N6XA 1U6QA 4CRBA 4A1TA 1ESAA 4KKDA 2W7SA 2A45B 1S5SA 3MU5A 5A09A 3ZVCA 3KQCA 3LGUA 3ATIA 1AVXA 1J8AA 4QT8C 3TK9A 4U01A 2V3OH 1CHOG 3LIWA 1BCUH 1UCYK 1Z6JH 1FN8A 1OOKB 1G32B 9LPRA 3AAVA 1XVMA 1MH0A 4FXGH 3ATKA 3AW1A 2GZ7A 5B6OA 3LJOA 1MMJN 1DVAH 1GHBG 3ZVEA 2A7HA 3LPRA 1HAZB 4E05H 5F6MA 1O5CB 2PR3A 4NA8A 1ABJH 1K2I1 1GJ5H 3SUEA 1JOUB 5C1YA 1V2ST 1TGTA 2P8OB 5EXNA 3O8RA 4INKA 2J34A 2WPIS 4I8GA 5GIBA 3SU0A 3PWBA 1KYNA 1D3QB 3TIUA 1WU1A 1GHAF 1P05A 2TGAA 4O3TA 1RTLA 1YPKH 3S9BA 4M7GA 2FEQH 3E1XB 3HKJB 1GVKB 2ZFQH 1FAXA 3NK8A 1O3IA 3U9AH 1PQ8A 1PPGE 1WTHD 4FUJA 3BG4B 2W7UA 1QB6A 2ALPA 3R3GB 4ABGA 2BVRH 3IITA 1VCQA 5LH8A 1SC8U 1NRPH 2SNVA 4AGKA 1UTKA 2G52A 4ZHAA 1SQOA 3SZNA 2G8TA 3BTFE 5DO4H 2P95A 4YOIA 1NRQH 3LT3A 4BTTB 4NIWA 4WMEA 4B1TA 4XOJA 2AIPA 3C1KA 3QUMP 1C5MD 3TJOA 2QXJA 3GICB 3HK6B 3RDZA 4ZMAH 4TWWA 1AN1E 4IN2A 4JYVH 1QB1A 1IQMA 4FUBA 1QFKH 1A0LA 1AI8H 4OS7A 4PROA 1QRZA 1ELEE 1Y3YA 3PO1B 5LPEA 1ANBA 1ETSH 3SJOA 3RLWH 2GCHG 1MD8A 3HPTB 1BTHH 1JIRA 1QA7A 3MI4A 1OYTH 5HM2A 3RXIA 3Q3YA 1S0QA 3CENA 3HK3B 1BHXB 1AFEH 2OC1A 2FX6A 1YLCA 1UTPA 3N7OA 1XKBC 1SGQE 4ZHLU 1HLTH 2ILNA 2Y5HA 2BVSH 1PQAA 4FVDA 3ZVBA 2R3UA 3UOPA 2ULLA 3M5LA 2PKSB 1DS2E 1O2IA 1MTWA 1ZZZA 5EQQA 1C2KA 4NFFA 4AFSA 5DGJA 3QLPH 2FDAA 3GY7A 4TYDA 3GCHC 1TGSZ 5FCRA 2GT7A 1W10U 2EA3A 1O2UA 4MNVA 3ZVAA 3GY5A 1DY9A 1T4VH 1PYTD 1TBRH 1MTSA <