1AZ8A

Bovine trypsin complexed to bis-phenylamidine inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Binding Mode of a Bis-Phenylamidine Factor Xa Inhibitor Complexed to Bovine Trypsin
rcsb
molecule tags Serine protease
molecule keywords TRYPSIN
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A02
4Q7XA 1GMCG 2QXGA 3MNCA 2F9UA 1K1LA 2TRMA 2PUXB 2H6MA 3SNEA 4BANB 2ZNKH 4K2YA 2FWWA 1O3GA 4MLFB 1XUIA 2VVUA 1UVTH 4AX9H 1MH0A 2PKAA 2ZFFH 5EODA 1CQQA 1O34A 1DM4B 1BRBE 4MG3A 1GJ8B 1T8OA 3PO1B 3P8GA 5T6DA 4KELA 1HAHH 4BTTB 5GXPA 1UHBB 1QB9A 3RP2A 1ZTJA 1YCPM 4FUDA 1SGFA 5FX6A 3UNSA 1MKWK 1O3CA 3RMMH 3KL6A 2OC0A 1SLWB 3DA9B 3RXHA 2ZA5A 1P0SH 2VGCC 4H6TA 3LH3A 3RXMA 3SU2A 1SGQE 1ARBA 2JKHA 1J15A 1C4Y2 1O2VA 2AGIX 1T7CA 1UJ1A 1GDQA 3Q3XA 1NU7B 2Z6BD 1TNLA 3OYPA 1SGYE 3SJIA 2CXVA 5GDSH 4ZHMU 1SHYA 2A2XH 1O2LA 1HLTH 3LGYA 4ZKOU 2FODA 1X7AC 1L4ZA 3M36A 4GHQA 1DX5M 2JH5D 3UREA 1MAXA 5SGAE 1T4VH 2BDAA 3PM3A 4X2YA 2XWBI 3W94A 1AY6H 4Y0YE 2ZTYA 1PPBH 1LVYA 1KSNA 3QWCH 3UWIA 1TBRH 1GBAA 3A89A 1NROH 2O9QA 1HFDA 5LPRA 1GBEA 4ABIA 3MTYA 1QCPA 5JBAS 3BTWE 4XBDA 4NA8A 4JYVH 2BHGA 4RSPA 3ODFA 3ZZ9A 5LH8A 1C2GA 3PMAB 1EP6A 1OP8A 1V2WT 2TGAA 1AZ8A 1UTQA 4X6PA 3UQOA 4D76A 1C2JA 1PYTC 2GV6A 3QGJA 3OX7U 1EXFA 1TPOA 2G8TA 2Z9JA 2OLGA 1IQKA 1EB1H 1QA0A 1HBTH 1TOCB 1YPLH 4JZEH 1CHOG 2IJOB 3URDA 1C2HA 1O3DA 1VCWA 1OSSA 4I8GA 5F03A 2ZHDA 3BEIB 1Y3WA 1G9IE 2EI8A 1OWHA 5LPFA 4YO9A 2PV9B 2AEIH 2ZTXA 4ABBA 3SUDA 5BRRE 1O3JA 3I77A 3A8CA 4MPUA 1Y3XA 2GCTB 1Y3UA 2GT8A 1EUFA 1FNIA 1JBUH 3E3TA 1QBVH 1S84A 1A5IA 1P2NA 2HNTF 4MDSA 1O3LA 5DP7A 3T25A 5L6NH 4OS4A 3RXKA 2JH6D 3PMHB 2KAIA 4CBOA 1GI9B 4UE7H 2BY5X 1GCDA 1XVMA 1EP5A 1KYNA 1GI3A 2WYJA 4HI3A 4RKJB 3BTDE 1ETSH 3QX5H 1O3MA 2HLCA 5JDUB 3P8FA 1OWKA 3RXRA 5E0JA 5DO4H 5DP4A 1PJPA 1TFXA 1P10A 2ZDLA 2ANWA 1W3CA 3AW0A 2ZHFH 2ZDMA 4X2XA 1GI0A 1ACBE 1RRKA 2W3IA 2ZGJA 2BDCA 2C93B 3DFLA 4WVPE 2PKAB 4Z0KA 1ELGA 4MNXA 1LQEA 1AB9B 4YM9A 2B5TB 3M3TA 1TNJA 4K1SA 1FIWA 1YCPK 1GBTA 2AGGX 2UUJB 4I31A 2ZZUH 3SV7A 3MO9A 2Z3CA 1TONA 2Q6FA 2FOAA 1C5WB 2J9NA 5AVDA 1TMBH 5HYOA 1EASA 1C5ZB 7GCHF 3RM0H 3GCOA 3IITA 4WMDA 4YOIA 1SB1H 3MI4A 1F2SE 3MH6A 2OINA 1VITH 1ELTA 1UHBA 3LC3A 1E35B 1LVBA 2A1DB 2TIOA 3LKWA 1GHVH 3GISB 5DP3A 1P3CA 4NIWA 5ABWA 3EA7A 4CRAA 4LXBH 1VZQH 3HKJB 3HPTB 4FUFA 1GHXH 1EZXC 1SI5H 3SU5A 1ESBA 4IN1A 4INKA 1J9CH 4DCDA 3GCHB 1ANBA 5HGGA 1D3PB 2P93A 2STBE 1NM6A 3P17H 2QN5T 2SGPE 5ETXA 1QHRB 1LCYA 5EGMA 3RXVA 3A80A 3STIA 2HPPH 2ZU2A 3NKKA 1RTKA 1GBKA 3SNBA 2XWAA 1OXGA 1A7SA 3A8BA 4TPYA 1EOJA 1V2RT 3LJOA 4BAHB 4ABDA 4NGAH 1GHZA 1OP0A 3OU0A 5CMXH 3QTOH 1HAYB 1JRSA 1RTFB 2BLOA 3RXLA 2ZQ2A 1AFEH 1YYY1 3SZNA 1HJAC 3TPIZ 4B2BA 4ZHLU 1C2DA 3ZZCA 4ABHA 1D6WA 2O8UA 1MBMA 4WJG2 1KDQA 4GPGA 4NFEA 1GG6C 1YPMH 1QGFA 1RJXB 1QIXB 1XMNB 2W5EA 2WPMS 3ZV9A 1IHSH 1Y5UT 1SLVB 3VGCB 1BIOA 4ZMAH 1QL9A 1SHHB 3P6ZB 5BPEA 3BG4B 1AFQC 1C5UA 1P2IA 1EJNA 1GI7B 2ZG0H 4MPVA 2UUYA 2VWMA 5HM2A 1C4V2 1O2IA 5F6MA 1LHEH 1DXPA 2VWLA 5CHAB 3HATH 3ZVDA 1BJUA 1EPTC 5TJXA 8GCHF 2ZECA 3D65E 1CHOF 2ZDNA 3KIDU 1WQVH 4K1TA 1W0YH 1EZSC 4YZUA 2BXUH 3K6ZA 1XVOA 2KAIB 4KTUA 1SGFG 1ABJH 1OKXA 2A4GA 2ZPRA 1P02A 2BLVA 3E6PH 3TVJB 1SGRE 1TALA 1EPTB 2A7HA 4LZ1H 4OS7A 3O8RA 2P8OB 1MMJN 2QXJA 2AYWA 5DJ7A 5JYIA 4XE4A 1NN6A 1LHDH 3TIUA 1NO9H 1FI8A 3EA8A 1SQAA 1YM0A 3P8OA 2BD2A 5A8ZA 3SU6A 3S0NA 1TE0A 6GCHG 1Z8IB 1P2MA 1TNGA 2WPLS 2BQWB 1ABIH 1TA6A 3Q76A 1G3EA 2FOFA 1O3PB 3M61U 2J92A 3BTHE 4UDWH 4M7GA 1V2QT 2R3YA 2GVFA 1DY8A 1LDTT 4CRCA 2J38A 1PYTD 3ZZ3A 3QZQA 4BXWA 1C1PA 2OXSA 4CRDA 1BTZA 1FQ3A 1EB2A 3FFGA 2Y82A 3RXOA 5FCRA 2G5VA 1CBWB 3UNQA 3A86A 1RFNA 1SOTA 5AHGH 3SGBE 4B73A 1W14U 4LOYH 5TCCA 5EG4A 4FU8A 4AGKA 1LKAA 1NC6A 4B76A 3UPEA 3U1JB 4DY7B 2XC4A 2CGAA 1CBWC 4JYUH 3GY2A 1T32A 2ASUB 1P2OA 2GZ8A 1W8BH 2A45B 3D62A 3SN8A 2J2UA 1H8DH 3PTNA 3M37A 2QYIA 2HNTC 1FXYA 1A2CH 4ISHH 4Q7ZA 4ZROA 1KLTA 2ZFQH 4MTBA 4JK5A 1SGTA 2BDYA 1K1OA 1S85A 3RLYH 2HGTH 3A88A 2VVCA 1W12U 2TGPZ 2WV5A 4NA9H 4DOQA 1MQ6A 2BOHB 1HV7A 2OQUA 1DE7H 3D23A 3QO6A 5DP5A 2A5AA 4FUIA 1PQ5A 1ZSLA 2B0FA 3T2NA 2PHBA 3FZZA 4AYYB 3PTBA 1O38A 1QR3E 1VITG 1YLCA 5J4SA 3RU4D 1V2PT 1P8VC 3GY5A 3LGVA 3LGTA 1CA0B 1O2KA 1UTMA 1C1UH 3BG8A 3VGCC 2XTTB 3LGIA 1VJAU 2BD7A 2C8ZB 1HB0B 4JZIA 1TB6H 1C5LH 1IHTH 3QLPH 2BMGB 1G32B 5J4QA 1O2TA 3Q00A 1GHYH 1K28D 1GVLA 2C90B 1NZQH 1H8IH 2G51A 1ZMNA 1TX7A 4ABFA 1A5GH 1O5DH 1QQUA 2BTCE 7KMEH 1PPCE 2FTLE 5E2OA 3VPKA 1O2PA 2H2ZA 4DURA 3A7TA 1RD3B 3RC6A 1O2OA 2XBXA 1DS2E 1MKWH 1ZRKA 1BZXE 1HAPH 2V35A 1JWTA 1HIAA 1ZYOA 1RXPA 3NXPA 3RXBA 4Q80A 1SL3A 1J14A 4A1VA 1TOMH 1JMOH 1C1VH 2VIVA 1HAVB 1S0QA 2GGVB 2M5TA 3OY5U 3PROA 4I7YH 1B7XB 1A46H 4INLA 4ZAEA 1LHGH 4AG2A 2P3TB 3K6YA 4ABGA 2V0BA 2VVVA 2Y6TA 1UVSH 3KCGH 2FM2A 1OWEA 1O0DH 3LGUA 1BJVA 5FHTA 5JBCS 1AE5A 1EAWA 1TNIA 2ZFTA 1LMWB 1C2FA 4ZHAA 3TJNA 3TH3H 4DT7B 3I78A 3L6PA 5A8YA 5FXLA 2FOCA 1O35A 2VIOA 2G5NA 2BD3A 4UEHH 2GT7A 1XXFA 5C5OA 2ZHEH 1CGHA 1DOJA 2JETB 3LDXH 1PQAA 2J4IA 3H7TA 2CHAB 3SNDA 1AKSB 2VIDA 3E91A 3GYLB 3RU4T 3V12A 3ZZBA 1Z8GA 1ANDA 5LGOA 5GPIB 1XUHA 1NRPH 3ZVBA 4XBCA 4AFUA 1TQ0B 2ZFSA 1PPHE 4TYDA 1GGDB 1G2LA 3V3MA 1O2MA 1SC8U 2LNCA 4IC5A 1IQGA 2BD8A 3MO3A 1AZZA 4LK4A 3C27B 4I8JA 1PQ8A 5T6GA 1BHXF 1C4U2 2CF9H 4O97A 2Z94A 3SV8A 2EI6A 5E8EH 3LH1A 2VH0A 1P2QA 3U8RH 1SGNE 3DFJA 1ZPBA 3K9XB 1ORFA 1V6DA 2D26C 1C2LA 3SUGA 1MKXK 3E1XB 3R3GB 3VXEH 5A8XA 4GUXA 3RXUA 3IWMA 3ZVCA 1O3BA 4FVDA 1DUEA 2GCHF 1MZAA 2Z3DA 1ELEE 3EGKH 2GZ9A 1F0UA 1A5HA 1OS8A 2Z9LA 3FVFB 1UCYE 1W0ZU 3SGAE 1KTTB 1VJ9U 3E0NB 1L1NA 3WY8A 2QF3A 4AN7A 1PPEE 4AG1A 1UK2A 3Q77A 2V3HH 2UUKB 2QCYA 2XBVA 1GJAB 2GCHG 3F9EA 1TX6A 2XNIA 1Y5AT 1HAOH 1AGJA 1C5SA 3A8DA 4YOJA 1GBIA 3SGQE 2GP9B 1TBZH 2ZTZA 2OD3B 3ZYEA 1C2EA 1AB9C 2OTVA 3U69H 1LPKB 1DWCH 2OUAA 1O5GH 1GBMA 3LIWA 2P3UB 5TCAA 2BM2A 5DGJA 1F0SA 3G01A 1NPMA 3M3SA 4JCNA 1ANEA 1SGEE 1GI6A 4U01A 1TAWA 2FDAA 2FMJA 2TPIZ 2CMYA 1INCA 4X1PU 1O37A 1YP9A 4X1SU 1BA8B 4A7IB 1MQ5A 3L33A 3AW1A 1UCYK 3JZ2B 3BF6H 1SGPE 1G3BA 1QNJA 4X6MA 4NIYA 1AUJA 2OP9A 2BY6X 3PLPA 3GY8A 2A0QB 1Z6EA 2H9EH 4HGCA 3RXGA 5A2MH 1UVPA 3TJVA 4ASHA 2O8LA 2FLRH 1O2UA 3DHKH 3S7HB 1FIZA 4A6LA 2H9TH 1EATA 1FV9A 4A92A 1SFIA 3SORA 2OBQA 2PSYA 4YTAA 1TRYA 3M5LA 1T8LA 3SQHE 1IAUA 4X8VH 2OCVB 2WV4A 3HK6B 2WPJS 5A0AE 5EW2H 3UFAA 2ZGBH 3RMLH 1BUIA 2RA0A 1TGSZ 4AZ2B 1C1QA 4K60A 3EQ0H 3F9GA 4RN6A 2VJ1A 1GBHA 5DKMA 1KXDA 2JETC 1TABE 2GV7A 1E37B 1V2OT 3F68H 5HMAA 1G3CA 1HIAB 1GVKB 2P3FH 4SGBE 3GDSA 3RXJA 3SV2H 1YGCH 1SQTA 3KHVA 4AOQA 3RMOH 1P57B 4XFQA 1GJDB 4TWWA 3GY4A 1AVGH 1XUJA 4XSKU 4CREA 4BTUB 1K1NA 3MU0A 1B0EA 2Z9IA 3MOCA 2FX6A 3LGWA 2FOHA 4MVNA 1SPJA 5ESBA 3VXFH 3ATLA 3AVZA 1OPHB 2BDBA 1AVXA 4CRBA 2Q1JA 1K2I1 1GHBG 2CV3A 4BAQB 3CS7A 2NU4E 1P04A 1C2IA 2PW8H 2ZU5A 3PWBA 4ZKNU 2A4RA 3RXPA 3URCA 1E36B 2R2WU 2ZEBA 1NT1A 1XKAC 1SBWA 1V2LT 4AYVB 1C5VA 3OY6U 1O5FH 3TGJE 1Y3YA 3MMGA 4ESTE 4ZXXH 1QRWA 1UVOA 4H6SB 1Y59T 2IPHA 4OS2A 4NZQA 4PROA 2RCEA 3KQBA 3RXIA 1YCPH 4E7NA 5CHAC 4D7FA 1JIMA 3QZRA 5C1UA 5EQSA 3A7XA 4B71A 1BITA 1TMTH 2ZDAH 3U8TH 1EAUA 1TPAE 2EA3A 2ULLA 1DLEA 3PB1E 4UD9H 5L30H 2OC1A 3ZVFA 2HALA 3M35A 1UMAH 2FS8A 3P70B 3SJOA 3ZVAA 1O3FA 4Y79A 5FPTA 1AWHB 1HRTH 1BMLA 1BMMH 4Y8XA 3KQEA 1L0ZA 1VGCC 2BOKA 3U8OH 1RIWC 4YLQH 2F83A 1J16A 3FP8E 4UFGH 1SLUB 3S9AA 1ZGVA 1A0LA 2P8OC 3CS0A 5LPEA 2VNTA 3MNSA 1PPZA 2PGBB 1BRCE 3SHAH 4R0IA 1BCUH 3GOVB 2XCFA 3K65B 3FAOA 3RLWH 1SFQB 1NRSH 2IN2A 3ZYDA 1YPKH 5L2YH 3BTKE 1W10U 2DE8A 1IQMA 1GHAG 2CJIA 2VB0A 4Z6AH 1DWEH 2ZFRH 4O3TA 1UTLM 3BIVH 3SO3A 3ZVGA 3O8CA 1MD8A 3RDZA 3HGPA 1QRZA 1O2JA 4VGCB 2Y5FA 2Y81A 5L2ZH 1WYKA 2BVRH 1FY5A 5A0CA 4JZDH 2WUBA 3GYMA 4NWLA 3VEQB 1CT4E 5A09A 1GBJA 2STAE 3A83A 5F8ZA 1IQJA 5B6OA 1O5AB 4Q2KA 2ODPA 1A3BH 4U30A 1UTOA 2AGEX 3SU1A 3M5MA 4CRFA 3MU4A 1WTHD 1T31A 3M5NA 1JRTA 4D9QA 4X2WA 1A1RA 1O2SA 3DUXH 1MCTA 1KLIH 3BTTE 1SGIB 4NSVA 2FPZA 4GSOA 2LPRA 2H9HA 4ISIH 4ISOA 3P95A 1SMFE 1XUGA 2FOGA 5DP6A 1IOEA 1O3KA 1UTPA 1XM1A 1D4PB 3CP7A 3GY7A 1QL8A 2A5KA 3TGKE 1DUAA 4Y6DA 2ZF0H 4FVBA 1C5YB 1G37A 1H9IE 1Z6JH 4NIXA 2EC9H 1DSUA 3P92A 1QB6A 2PGQB 1VCQA 3BG4C 1H9HE 1LVOA 2R0LA 8KME2 4B2CA 3CENA 3GY6A 2VH6A 5K0HA 1W7GH 3DT0H 3T62A 1ZTKA 2PTCE 4B1TA 2FI4E 1Q2WA 4K5ZA 4NZLA 2QGRA 3B8JA 1P09A 1C9PA 2D1JA 4IBLH 2ALVA 1N6YA 1N8OB 2YNAA 1FDPA 3BTQE 1GL0E 2VIPA 2D2DA 2BX3A 2GKVE 3KN2A 1O2GH 1ZHRA 3EA9A 3RXFA 2GTBA 1V2ST 2TBSA 1BTHH 2ZP0H 2BY7X 1D3DB 4RKOB 2BD9A 2C8XB 1O5BB 3H7OA 1P06A 4ZKRU 1V2MT 2EI7A 4WY3A 2I6QA 3M7TA 1XX9A 3PMJA 1NRNH 1SOZA 1P9UA 3HGNA 1L1JA 2BLWA 1OX1A 5E0GA 5DP9A 1NTPA 4Y76A 2FYRA 2YNBA 1WCZA 1QA7A 1BHXB 4INHA 5H4IB 3S7KB 1M9UA 1KLJH 1GJ5H 5C5NA 2BVXH 1BOQA 3QUMP 1GI4A 1S0RA 4CR5A 1EAIA 5HXFA 2CF8H 2Z7FE 4NG9H 5C67A 1WBGB 1O3EA 4X8SH 4U2WA 3FANA 3T27A 3SJ8A 3SNCA 1E0FD 1HDTH 5EQQA 2NU1E 4NFFA 4X1QU 1D6RA 5I46H 1K21H 1LO6A 4GCHF 5JB8S 5JBBS 4XOJA 1J8AA 1GBBA 3RXTA 2ZHWH 2NU0E 1VITF 1UK3A 1LTOA 4D8NA 3V7TA 2QXIA 3RM2H 3BSQA 2FOMB 1F5RA 1KDQB 3TK5A 3RC5A 1KXCA 2H5DA 3ITIA 2BX4A 3TNTA 3KF2A 4DIHH 4WH6A 4YT6H 1CVWH 1GDUA 1MD7A 3NCLA 3STJA 2SGFE 2BD4A 3S69A 1QQ4A 3ZZDA 1GMCF 3LU9B 4ZKSU 1Y5BT 1C1RA 4FUJA 2GMTC 3MU8A 2G81E 3D49H 1EPTA 1F0TA 4ABJA 2OC7A 1RTLA 2SNWA 2QV1A 3MNBA 1GJBB 1QJ6B 3BTEE 1FY3A 4BTIB 1CHGA 1RGQA 2O8TA 3FZDA 3E8LA 4J1YA 4NCYA 2GX4A 3T29A 1ELVA 4KTSA 4Y0ZE 3MU1A 3TK6A 4XDEA 5EXLA 1FY1A 1HAVA 1ZTLA 2J34A 1IQHA 1HPGA 3SI4H 1AIXH 2FOEA 2Z9KA 4GLYA 5FX5A 1T8MA 4Y71A 3PWCA 1V2UT 4JMYA 4MQAA 1F5KU 1AI8H 5GJ4B 2XBWA 4YLUA 3MHWU 1F5LA 1P11E 2BY8X 2RDLA 1FZZA 1GBDA 5C1YA 2WPKS 5FBIA 1HUTH 2BY9X 1BTYA 4NA7A 2FS9A 4Y8YA 2DUCA 1ETRH 1ELCA 4MPXA 1OWIA 3NZIA 1CO7E 5PTPA 3QDZB 1MTNC 1QL7A 3DD2H 1CU1A 1UTJA 3NWUA 4TPIZ 1NRRH 3SOSA 2I6SA 2W3KA 1RIWB 2SFAA 2C8YB 1MBQA 4ZXYH 3TJUA 1LHFH 4KP0A 1T4UH 1O3OA 2BB4A 1V2VT 2XC5A 5E0HA 4WH8A 1W11U 1C1SA 2VIQA 1KXAA 2HPQH 3T5FH 1TA2A 1BBRE 1HNEE 2Y7ZA 2VIWA 3KNXA 1GMHG 1HAIH 1AE8H 4H42U 1ZZZA 4UFFH 1DWDH 1NFYA 3BTFE 2Y7XA 3SJ9A 2PUQH 4BAKB 2Y80A 4SGAE 1MTWA 2C4FH 2THFB 1FY8E 2BXTH 3VB6A 2G00A 6CHAB 1K22H 2EEKA 1O39A 3I29A 1PPGE 1UK4A 4Y8ZA 3E0PB 5G4BA 3A81A 3S9CA 3VB3A 1QBNA 3BEUA 1BTPA 3PLBA 2WPHS 1FN8A 1KY9A 3UWJH 1G3DA 1EOLA 3JZ1B 2ZI2H 1DT2A 2AMPA 1AD8H 1K1MA 3BEFB 2FESH 3SU0A 5C1XA 2ALPA 3A7YA 1WAYB 2FEQH 1O3NA 1ZMLA 2W7UA 2SNVA 1AQ7A 2SGAA 7LPRA 1GMDF 2VINA 3K2UA 2ZGCA 2R0KA 4B2AA 5JBTA 1SR5C 1V2JT 1TQ7B 1ZGIA 1FPHH 3RXCA 1KTSB 1UO6A 1ZSKA 1C5QA 2W26A 2XYAA 3MWIU 4MNVA 4AORA 4ISNA 4BAOB 4ABEA 3NK8A 9LPRA 1C5XB 1ZJKA 2GDEH 3BTGE 1GPZA 1TYNA 2ZU3A 1Q31A 1O2YA 1AFQB 1O33A 1TGBA 2AS9A 1D3TB 2A7CA 1PFXC 1QTFA 3FP6E 1L1GA 2ZHQH 4FUGA 1OWDA 4OGYA 2B8OH 3LJJA 1SGCA 4X1NU 1W13U 4CR9A 1P03A 3SUEA 1DVAH 4D9RA 2ZPSA 2VWNA 3ZZ5A 1TGTA 3P8NA 1KXEA 2JH0D 4ISLA 4Y7BA 2F9PA 1MZDA 1LKBA 4FXGH 5K7RA 1THPB 3SU4A 3W95A 1Q3XA 1CSOE 2BZAA 4AB8A 1GJ6A 1GCTB 2FX4A 3SQEE 2FOBA 2P95A 1NS3A 1JOUB 3NUMA 3TK9A 3QN7A 4BXSA 2PLXA 5DPAA 2BQ6B 1FJSA 4B75A 2XCNA 1K1JA 1G30B 4J2YB 3SU3A 3LOXA 1EZQA 4R8TB 4XBBA 1Z1JA 2V3OH 7ESTE 1PQ7A 5IYTA 3PMBB 2F9VA 1O2HA 3VB5A 1ZOMA 3V0XA 1TRMA 1H9LB 1XKBC 2V6NA 2ZCHP 2QC2A 2QF0A 5FAHA 2ANYA 4CHAC 2FYQA 1MAYA 2SGEE 6LPRA 1B5GH 3RUOA 1FY4A 1MTSA 2Y5GA 1XXDA 4CRGA 1GBFA 2BDGA 1VGCB 4FUBA 4I33A 4IN2A 1MTUA 1TBQH 1XUFA 2A31A 1YBWA 1TX8A 3QK1A 4CHAB 1FONA 2QA9E 1NFWA 2ZU1A 3RXAA 1ARCA 1UCYH 1YLDA 1TWXB 4K8BA 2A5IA 2B9LA 4Q7YA 1HXFH 3C1KA 1A0JA 1BDAA 1HYLA 1TMUH 2ZGHA 2NU3E 4UFEH 1C2MA 5EXMA 2P59A 2G55A 1O2RA 4OGXA 5T3HA 4THNH 1ZSJA 4BNRA 1ZPCA 3ZZ4A 4CH8B 1RS0A 1OOKB 5DK1A 4WXVA 2SGQE 1CGIE 4JYTA 2RG3A 1HAZB 3SV9A 1FAKH 4FUCA 1S83A 1NFXA 4NIVA 4DGJA 3MNXA 1A3EH 4MPWA 2ZPQA 1NRQH 1THRH 1IQLA 2H1UA 4X8UH 1OYTH 3PLKA 1O3AA 1WTGH 2QAAA 4GCHG 5DP8A 2QXHA 3F1SB 2F91A 3L3TA 1GHWH 1F0RA 5FPYA 1MTVA 1TRNA 3ATMA 1AU8A 2QIQA 2R2MB 1P12E 2GCTC 7GCHG 1N1LA 1CA0C 1P05A 1O2XA 3SW2B 3TU7H 2OBOA 1ID5H 2WPIS 4IMZA 1HAXB 2F9NA 1JIRA 1ZJDA 5HM9A 1GJ9B 1UTNA 4B74A 1GG6B 1C1NA 1QRXA 1YPHE 4I32A 3QGNB 2AERH 3SUFA 1DITH 1S6FA 2PFEA 3UY9A 1YC0A 2NU2E 4OS1A 1O5EH 2Z9GA 2A7JA 2ZDKA 2FIRH 3F9HA 1LPZB 3EE0B 1O3HA 2UWLA 1CT2E 3RXQA 1MU8B 2J94A 3U1IB 1CT0E 1CA8B 5EU8A 1W7XH 1B0FA 1C5TA 2ZDVH 1O5CB 2ZU4A 4I8KA 2ZC9H 2ZCLP 3KGPA 4K69A 1D3QB 1TGCA 1TIOA 3A7VA 2C3SA 2XRCA 1SLXB 1GCTC 3GCNA 4GAWA 3A7WA 1EX3A 2ILNA 1QURH 1P2KA 2AFQB 3UOPA 1GI5A 2ODQA 3UOUA 5JPMH 4E7RG 3GDUA 2BDHA 3ODDA 4FUHA 2PWXA 3SJKA 4AFSA 5C2ZA 3UIRA 3NPSA 1F7ZA 1Z71A 1O3IA 1AKSA 3VB7A 3RU4E 1LPGB 2XW9A 3BTME 3GCTF 2F9OA 2FP7B 3IG6B 4DW2U 1OYQA 2W7SA 4CBNA 2GZ7A 8LPRA 1P3EA 2WYGA 1MKXH 4FU9A 3Q3KA 4JZFH 1C1TA 3TITA 1EJAA 3U9AH 1AMHA 2CHAC 1N6XA 3OTJE 2XXLA 2YOLA 5F8XA 1GJ7B 2VWOA 3M7QA 1IQIA 1GBCA 1V2NT 1D9IA 3ENSB 1LQDB 1K9OE 4GHTA 3BIUH 4WF8A 3RXDA 5T6FA 1IQEA 2BLQA 1HJ9A 2PKSC 9ESTA 1ZR0A 2FXRA 2PR3A 4IW4E 2FLBH 3GCHC 1TNHA 1QJ1B 1AWFH 3ELAH 3ATIA 4K3JA 2DE9A 3Q3YA 3MH4A 5A0BA 3U98H 2BD5A 1GVZA 1VCPA 1OP2A 5CE1A 1KXBA 2NWNA 3LONA 4X2VA 1YPGH 4E05H 1P9SA 1S5SA 3S9BA 3TJOA 3E90B 5EXNA 1ZRBA 2HRVA 2QY0B 2D8WA 1HGTH 4F4OC 1BMAA 3RXEA 4X6NA 1TNKA 2B7DH 3MU5A 1C5MD 3PYHA 3F9FA 1C5RA 1FLEE 1O2ZA 5FBEA 3QTVH 3A7ZA 1V2KT 4NWKA 1GHAF 4YESB 3SV6A 3M5OA 1SQOA 1PPFE 2O8MA 3ESTA 1DFPA 1GMHF 1FMGA 2ZO3H 3PV4A 4ZUHA 1U6QA 3MO6A 3BN9A 2ANKH 1TPSA 3EDXB 4KGAA 1KIGH 4U32A 1Y3VA 1EJMA 4DG4A 1BBRH 3H5CB 3SBKA 1O2WA 3M7UA 4AFQA 2ZGXH 4CH2B 1FN6A 3O8BA 1GMDG 1A61H 1H1BA 3KEEA 1AUTC 5GCHG 1GL1A 5AFYH 1YPJH 1BBRK 4O3UA 3ATWA 5ESTE 1DWBH 1ELDE 3B23B 1ZHPA 2AMDA 4YOGA 3T26A 1G36A 3F6UH 2ESTE 5C20A 4WMFA 1L2EA 1JXPA 1C1OA 1QY6A 2A2QH 4DIIH 1BT7A 1W2KH 3MH7A 3KQCA 3PO1C 2J95A 1DPOA 4KTCA 2RA3A 4A1TA 4IS5A 4TY7A 1WU1A 1AN1E 2AIPA 4A5TS 2PSXA 4NSYA 3B9FH 4E06H 2ZQ1A 4MNWA 1MCVA 1QFKH 3A85A 4A1XA 3GDVA 4BAMB 1Z1IA 3V13A 2VGCB 4OS6A 1BB0B 2ZFPH 2G4TA 1WV7H 1BRUP 1EAXA 3SNAA 1P01A 2ZCKP 4GVUA 4WXIA 1WOFA 2CN0H 2G52A 2O8WA 4K8YA 6CHAC 5EQRA 3MYWA 1SG8B 3BV9B 1J17T 1EZUC 1ELBA 1O36A 2XC0A 4QT8C 4OS5A 4X1RU 2Y5HA 2OQ5A 3SHCH 2A4OA 2UWOA 1GDNA 8GCHG 2UWPA 1WSSH 2A32A 4TWYA 4ZH8A 3UNRA 1ZMJA 3GY3A 2UUFB 3LPRA 1FUJA 2AMQA 2FO9A 1HCGA 3RC4A 4DVAU 1AHTH 1LHCH 2GD4B 3HKIB 3T28A 1EKBB 4DJZB 1DSTA 1Z8RA 2F3CE 2AH4X 1TPPA 3GCTG 2FI3E 1CE5A 1ZHMA 4I8LA 1FAXA 1HJ8A 1DLKB 1FPCH 3N7OA 4WWYA 5GCHF 1WQSA 2HNTE 1QJ7B 1UVUH 4D7GA 2Z3EA 2C8WB 3MFJA 3UUZA 3TLOA 1ESTA 3ZZ7A 5AFZH 1IQFA 1UTKA 1BTUA 4O03A 1ELFA 5EW1H 3AAVA 1ETTH 2P16A 2HVXA 4AFZA 2SGDE 2VU8E 1E34B 2K1QA 1IQNA 2AIQA 5JB9S 1SVPA 1C9TA 1DY9A 2ANMH 1GI1A 4HTCH 5I25A 1NY22 1GI8B 2BYAX 1C5OH 3A8AA 1V3XA 6ESTA 2G4UA 3HK3B 3ZV8A 4HFPB 1DXWA 1MUEB 4FU7A 1HJAB 2F9BH 2GDDA 4HZHA 2P94A 4ABAA 2R9PA 3UR6A 4AB9A 5EPYA 4AGJA 3LT3A 3O8DA 1Z8JB 5F8TA 4F49A 4BOHA 2IOTA 1G2MA 3ZVEA 1L4DA 1KXFA 2Q6DA 3TGIE 1AO5A 2Q6GA 1BQYA 1OWJA 2BZ6H 1C5NH 1N8OC 1F92A 1GJ4H 4IGDA 1K1PA 4X8TH 3A84A 1BTWA 1NESE 3UR9A 1QBOA 1BTXA 1GJCB 1QB1A 5AF9H 2OC8A 5IDKA 1T8NA 1O32A 5C3NA 5FCKA 1ELAA 4IMQA 1S81A 2ZIQH 4H4FA 1BMNH 1MTNB 4KKDA 3SI3H 1XUKA 3KQDA 1GWAA 4FUEA 3M3VA 1C1MA 2H5CA 4JK6A 5DG6A 3A82A 4X0WU 2ZKSA 1VR1H 1ZPZA 4X6OA 3RXSA 1O2NA 1C1WH 1YKTA 3ZZ6A 2R3UA 4IC6A 5FPSA 3R0FA 1GBLA 3TH2H 5GWZA 2WINI 4I8HA 2FTMA 3EAJA 1BRAA 2PTNA 4YT7H 4UONA 1H4WA 1YPEH 2TGTA 1O30A 3AASA 4K1EA 2TGDA 3E16B 1S6HA 5E2PA 2PKSB 2WUCA 2BDIA 3EYDA 3GICB 2FI5E 1YF4A 1ESAA 1DANH 1MU6B 1NU9A 1P2JA 3TNSA 2BQ7B 1E38B 3VB4A 1GGDC 4MNYA 3ATKA 1Z7KA 3OSYA 1HXEH 4WMEA 1GHBF 3LC5A 1DICA 1ZLRA 4JZ1A 1A0HB 1YPHC 1O31A 3AAUA 1DDJA 4UFDH 1C5PA 4Y11E 2BVSH 1C2KA 2ZWLH 1O2QA 1TGNA 1EQ9A 1A4WH 1HAGE 1Y8TA 2GMTB 3UTUH 4VGCC 1CGJE 1TLDA 3MH5A 1ANCA 8ESTE 3RMNH 5GIBA 1AVWA 1NFUA 3VFEA 1LVMA 2FZZA 5EOKA 1WUNH 3TH4H 6GCHF 1K1IA 3ZZ8A 1S82A 2A4QA 1GI2A 4O9VA 3A87A 1THSH 3UQVA 3ZZAA 1SGDE 4Y10E 2ODYB 1SSXA 4TY6A 5EPNA 4Y7AA 2XBYA 4LZ4B 2HWLB 1V2TT 3FP7E 2HOBA
chains in the Genus database with same CATH superfamily
4Q7XA 1GMCG 2QXGA 3MNCA 2F9UA 1K1LA 2TRMA 2PUXB 2H6MA 3SNEA 4BANB 2ZNKH 4K2YA 2FWWA 1O3GA 1W0KD 1XUIA 4MLFB 2VVUA 1UVTH 4AX9H 1MH0A 2PKAA 2ZFFH 5EODA 1CQQA 1O34A 1DM4B 1BRBE 1W0JD 4MG3A 1GJ8B 1T8OA 3PO1B 3P8GA 5T6DA 4KELA 1HAHH 4BTTB 5GXPA 1UHBB 1QB9A 3RP2A 1ZTJA 1YCPM 4FUDA 1SGFA 5FX6A 3UNSA 1MKWK 1O3CA 3RMMH 3DSOA 3KL6A 2OC0A 2K8IA 1SLWB 3DA9B 3RXHA 2ZA5A 1P0SH 2VGCC 4H6TA 3LH3A 3RXMA 3SU2A 1SGQE 1ARBA 2JKHA 1J15A 1C4Y2 1O2VA 2AGIX 1T7CA 1UJ1A 3KYGA 1GDQA 3Q3XA 4P02A 2QE7D 1NU7B 2Z6BD 1TNLA 3OYPA 1SGYE 3SJIA 2CXVA 5GDSH 4ZHMU 1SHYA 2A2XH 1O2LA 1HLTH 3LGYA 4ZKOU 1EFRD 2FODA 1X7AC 1L4ZA 3M36A 4GHQA 1DX5M 2JH5D 3UREA 1MAXA 5SGAE 1T4VH 2BDAA 3PM3A 4X2YA 2XWBI 3W94A 1AY6H 4Y0YE 2ZTYA 1PPBH 1LVYA 1KSNA 3QWCH 3UWIA 1TBRH 1GBAA 3A89A 1NROH 2O9QA 1HFDA 5LPRA 1GBEA 4ABIA 3MTYA 1QCPA 5JBAS 2EY4C 3BTWE 4XBDA 4NA8A 4JYVH 2BHGA 4RSPA 3ODFA 4Q4LA 3ZZ9A 5LH8A 1C2GA 3PMAB 1EP6A 1OP8A 1V2WT 2TGAA 1AZ8A 1UTQA 4X6PA 3UQOA 4D76A 1C2JA 1PYTC 2GV6A 3QGJA 3OX7U 1EXFA 1TPOA 2G8TA 2Z9JA 2OLGA 1IQKA 1EB1H 1QA0A 1HBTH 1TOCB 1YPLH 4JZEH 1CHOG 2IJOB 3URDA 1C2HA 1O3DA 1VCWA 1OSSA 4I8GA 5F03A 3WWFA 2ZHDA 3BEIB 1Y3WA 1G9IE 2EI8A 1OWHA 5LPFA 4YO9A 2PV9B 2AEIH 2ZTXA 4ABBA 3SUDA 5BRRE 1O3JA 3I77A 3A8CA 4DT4A 4MPUA 1Y3XA 2GCTB 1Y3UA 2GT8A 1EUFA 1FNIA 1JBUH 3E3TA 1QBVH 1S84A 1A5IA 1P2NA 2HNTF 4MDSA 1O3LA 5DP7A 3T25A 5L6NH 4OS4A 3RXKA 2JH6D 3PMHB 2KAIA 4CBOA 1GI9B 4ACAA 4UE7H 2BY5X 1GCDA 1XVMA 1EP5A 1KYNA 1GI3A 2WYJA 4HI3A 4RKJB 3BTDE 1ETSH 3QX5H 1O3MA 2HLCA 5JDUB 1E1RD 1OWKA 3P8FA 5E0JA 3RXRA 3MQKC 5DO4H 5DP4A 1PJPA 1TFXA 1P10A 2ZDLA 2ANWA 1W3CA 3AW0A 2ZHFH 2ZDMA 4X2XA 1GI0A 1ACBE 1RRKA 2W3IA 2ZGJA 2BDCA 2C93B 3DFLA 4WVPE 2PKAB 4Z0KA 1ELGA 4MNXA 1LQEA 1AB9B 4YM9A 2B5TB 3M3TA 1TNJA 4K1SA 1FIWA 1YCPK 1GBTA 2AGGX 2UUJB 4I31A 4F55A 2ZZUH 3SV7A 3MO9A 3FKSD 2Z3CA 1TONA 2Q6FA 2FOAA 1C5WB 2J9NA 5AVDA 1TMBH 3KYFA 5HYOA 1EASA 1C5ZB 7GCHF 3RM0H 3GCOA 3IITA 4WMDA 4YOIA 1SB1H 3MI4A 1F2SE 3MH6A 3DSPA 2OINA 1VITH 1ELTA 1UHBA 3LC3A 1E35B 1LVBA 2A1DB 2TIOA 3LKWA 1GHVH 3GISB 5DP3A 1P3CA 4NIWA 5ABWA 3EA7A 4CRAA 4B6FA 4LXBH 1VZQH 3HKJB 3HPTB 4FUFA 1GHXH 1EZXC 1SI5H 5HIZA 3SU5A 1ESBA 4IN1A 4INKA 1J9CH 4DCDA 3GCHB 1ANBA 5HGGA 1D3PB 1SKYE 5CDFE 2P93A 2STBE 1NM6A 3P17H 2QN5T 2SGPE 5ETXA 1QHRB 2KCAA 1LCYA 5EGMA 3RXVA 3A80A 3STIA 2HPPH 2ZU2A 3NKKA 1RTKA 1GBKA 3SNBA 2V7QD 2XWAA 1OXGA 1A7SA 3A8BA 4TPYA 1EOJA 1V2RT 3LJOA 4BAHB 4ABDA 4NGAH 1GHZA 1OP0A 3OU0A 5CMXH 3QTOH 1HAYB 1JRSA 1RTFB 2BLOA 3RXLA 2ZQ2A 1AFEH 1YYY1 3SZNA 3DSGA 1HJAC 3TPIZ 4B2BA 4ZHLU 1C2DA 3ZZCA 4ABHA 1D6WA 2O8UA 1MBMA 4WJG2 1KDQA 4GPGA 4NFEA 1GG6C 1YPMH 1QGFA 1RJXB 1QIXB 1XMNB 2W5EA 2WPMS 3ZV9A 1IHSH 1Y5UT 1SLVB 3VGCB 1BIOA 4ZMAH 1QL9A 1SHHB 3P6ZB 5BPEA 3BG4B 1AFQC 1C5UA 1P2IA 1EJNA 1GI7B 2ZG0H 4MPVA 2UUYA 2VWMA 5HM2A 1C4V2 1O2IA 5F6MA 1LHEH 1DXPA 2VWLA 5CHAB 3HATH 4I86A 3ZVDA 1BJUA 1EPTC 5TJXA 8GCHF 2ZECA 3D65E 1CHOF 2ZDNA 3KIDU 1WQVH 4K1TA 1W0YH 1EZSC 4OM9A 2BXUH 4YZUA 3K6ZA 1XVOA 2KAIB 4KTUA 1SGFG 1ABJH 1OKXA 2A4GA 2ZPRA 1P02A 2BLVA 3E6PH 3TVJB 1SGRE 1TALA 1EPTB 2XOKD 2A7HA 4LZ1H 4OS7A 3O8RA 2P8OB 1MMJN 2QXJA 1H8HD 2AYWA 5DJ7A 5JYIA 4XE4A 1NN6A 1LHDH 3TIUA 1NO9H 1FI8A 3EA8A 5EJLA 1SQAA 1YM0A 3P8OA 2BD2A 5A8ZA 3SU6A 3S0NA 1TE0A 6GCHG 1Z8IB 1P2MA 1TNGA 2WPLS 2BQWB 1ABIH 1TA6A 3Q76A 1G3EA 2FOFA 1O3PB 2WZQA 3M61U 2J92A 3GS9A 3BTHE 4UDWH 4Z1MD 4M7GA 1V2QT 2R3YA 2GVFA 1DY8A 1SQRA 1LDTT 4CRCA 2J38A 1PYTD 4B6EA 3ZZ3A 3QZQA 4BXWA 1C1PA 2OXSA 4CRDA 1BTZA 1FQ3A 1EB2A 3FFGA 2Y82A 3RXOA 5FCRA 2G5VA 1CBWB 3UNQA 3A86A 1RFNA 1SOTA 1YWUA 5AHGH 1S6LA 3SGBE 4B73A 1W14U 4LOYH 5TCCA 5EG4A 4FU8A 4AGKA 1LKAA 1NC6A 4B76A 3UPEA 3U1JB 4DY7B 2XC4A 2CGAA 1CBWC 4JYUH 3GY2A 1T32A 2ASUB 1P2OA 2GZ8A 3N7EA 1W8BH 2A45B 3D62A 4FETA 3SN8A 2J2UA 1H8DH 3PTNA 3M37A 2QYIA 2HNTC 1FXYA 1A2CH 4ISHH 4Q7ZA 4ZROA 4ZCNA 1KLTA 2ZFQH 3DCLA 4MTBA 2WHXA 4JK5A 3VG8A 1SGTA 2BDYA 1K1OA 1S85A 2JJ1D 3RLYH 2HGTH 3A88A 2VVCA 1W12U 2TGPZ 2WV5A 4NA9H 4DOQA 1MQ6A 2BOHB 1HV7A 2OQUA 1DE7H 1H8ED 3D23A 3QO6A 5DP5A 2A5AA 4FUIA 1PQ5A 1ZSLA 2B0FA 3T2NA 2PHBA 3FZZA 3OAAD 4AYYB 3PTBA 1O38A 1QR3E 1VITG 1YLCA 2EQNA 5J4SA 3RU4D 1V2PT 1P8VC 3GY5A 3LGVA 3LGTA 1CA0B 1O2KA 1UTMA 1C1UH 2K0QA 3BG8A 3VGCC 2XTTB 3LGIA 1VJAU 2BD7A 2C8ZB 1HB0B 4JZIA 1TB6H 1C5LH 1IHTH 3QLPH 2BMGB 1G32B 5J4QA 1O2TA 3Q00A 1GHYH 1K28D 1GVLA 2C90B 1NZQH 1H8IH 2G51A 1ZMNA 1TX7A 4ABFA 1A5GH 1O5DH 1QQUA 2BTCE 7KMEH 1PPCE 2FTLE 5E2OA 3VPKA 1O2PA 2H2ZA 4DURA 3A7TA 1RD3B 3RC6A 1O2OA 2XBXA 1DS2E 1MKWH 1ZRKA 1BZXE 1HAPH 2V35A 4M9FA 1JWTA 1HIAA 2F43B 1ZYOA 1RXPA 3NXPA 3RXBA 4Q80A 1SL3A 1J14A 4A1VA 1TOMH 1JMOH 1C1VH 2VIVA 1HAVB 1S0QA 2GGVB 2M5TA 3OY5U 3PROA 4I7YH 1B7XB 1A46H 2W6ID 4INLA 4ZAEA 1LHGH 4AG2A 2P3TB 3K6YA 4ABGA 2V0BA 2VVVA 2L74A 5C94A 2Y6TA 1UVSH 3KCGH 2FM2A 1OWEA 1O0DH 3LGUA 1BJVA 5FHTA 5JBCS 1AE5A 1EAWA 1TNIA 2ZFTA 1LMWB 1C2FA 4ZHAA 3TJNA 3TH3H 4DT7B 3I78A 3L6PA 5A8YA 5FXLA 2FOCA 1O35A 2VIOA 2G5NA 2BD3A 3W1EA 4UEHH 2GT7A 1XXFA 5C5OA 2ZHEH 1CGHA 1DOJA 2JETB 3LDXH 1PQAA 2J4IA 3H7TA 2CHAB 3SNDA 1AKSB 2VIDA 3E91A 3GYLB 3RU4T 3V12A 3ZZBA 1Z8GA 1ANDA 5LGOA 5GPIB 1XUHA 1NRPH 3ZVBA 3OTPA 4XBCA 4AFUA 1TQ0B 2ZFSA 1PPHE 4TYDA 5KECA 1GGDB 1G2LA 3V3MA 1O2MA 1SC8U 2WV9A 2LNCA 4IC5A 1IQGA 2BD8A 3MO3A 1AZZA 4LK4A 3C27B 4I8JA 1PQ8A 5T6GA 1BHXF 1C4U2 2CF9H 4O97A 2Z94A 3SV8A 2EI6A 5E8EH 3LH1A 2VH0A 1P2QA 3U8RH 1SGNE 3DFJA 1ZPBA 3K9XB 1K0HA 1ORFA 1V6DA 2D26C 1C2LA 3SUGA 1MKXK 3E1XB 3R3GB 3VXEH 5A8XA 4GUXA 3RXUA 3IWMA 3ZVCA 1O3BA 4FVDA 1DUEA 2GCHF 1MZAA 2Z3DA 1ELEE 3EGKH 2GZ9A 1F0UA 1A5HA 1OS8A 2Z9LA 3FVFB 1UCYE 1W0ZU 3SGAE 1KTTB 1VJ9U 3E0NB 1L1NA 3WY8A 2QF3A 5DN6D 4AN7A 1PPEE 4AG1A 1UK2A 3Q77A 2V3HH 2UUKB 2QCYA 2XBVA 3OEHD 1GJAB 2GCHG 2WSSD 3F9EA 1TX6A 2XNIA 1Y5AT 1HAOH 1AGJA 1C5SA 3A8DA 4YOJA 1GBIA 3SGQE 2GP9B 1TBZH 2ZTZA 2RFKC 2OD3B 3ZYEA 1C2EA 1AB9C 2OTVA 3U69H 1LPKB 1KMHB 1DWCH 2OUAA 1O5GH 1GBMA 4XRNA 3LIWA 2P3UB 5TCAA 2BM2A 5DGJA 1F0SA 3G01A 1NPMA 3M3SA 4JCNA 1ANEA 2KCOA 1SGEE 1GI6A 4U01A 1TAWA 2FDAA 2FMJA 2TPIZ 2CMYA 1INCA 4X1PU 1O37A 2M2AA 1YP9A 4X1SU 1BA8B 4A7IB 1MQ5A 3L33A 3AW1A 1UCYK 3JZ2B 3BF6H 1SGPE 1G3BA 1QNJA 4X6MA 4NIYA 1AUJA 2OP9A 2BY6X 3PLPA 3GY8A 2A0QB 1Z6EA 2H9EH 4HGCA 3RXGA 3UAIC 5A2MH 3AK5A 1UVPA 3TJVA 4ASHA 2O8LA 4AC9A 2FLRH 1O2UA 3DHKH 3S7HB 1FIZA 4A6LA 2H9TH 1EATA 1FV9A 4A92A 1SFIA 3SORA 2OBQA 2PSYA 4YTAA 1TRYA 3M5LA 1T8LA 3SQHE 1IAUA 4X8VH 2OCVB 2WV4A 3HK6B 2WPJS 5A0AE 5EW2H 3UFAA 2ZGBH 3RMLH 1BUIA 2RA0A 1TGSZ 4AZ2B 1C1QA 2WPDD 4K60A 3EQ0H 3F9GA 4RN6A 2VJ1A 3FN8A 1GBHA 5DKMA 1KXDA 2JETC 1TABE 2GV7A 1E37B 1V2OT 3F68H 5HMAA 1G3CA 1HIAB 1GVKB 2P3FH 4SGBE 3GDSA 3RXJA 3SV2H 1YGCH 1SQTA 3KHVA 4TT3D 4AOQA 3RMOH 1P57B 4XFQA 1GJDB 4TWWA 3GY4A 1AVGH 1XUJA 4XSKU 4CREA 4BTUB 1K1NA 3MU0A 1B0EA 2Z9IA 3MOCA 2FX6A 3LGWA 2J5UA 2FOHA 4MVNA 1SPJA 5ESBA 3VXFH 3ATLA 3AVZA 1OPHB 2BDBA 1AVXA 4CRBA 2Q1JA 1K2I1 1GHBG 2CV3A 4BAQB 3CS7A 2NU4E 1P04A 4ACBA 5IK2D 1C2IA 1WDIA 2PW8H 2ZU5A 3PWBA 4ZKNU 2A4RA 3RXPA 3URCA 1E36B 2R2WU 2YMSC 2ZEBA 1NT1A 1XKAC 1SBWA 1V2LT 4AYVB 1C5VA 3OY6U 1O5FH 3UB0A 1Y3YA 3TGJE 3MMGA 4ESTE 4ZXXH 1QRWA 1UVOA 4H6SB 1Y59T 2IPHA 4OS2A 4NZQA 4PROA 2RCEA 3KQBA 3RXIA 1YCPH 4E7NA 5CHAC 4D7FA 3F3BA 1JIMA 3QZRA 5C1UA 5EQSA 3A7XA 4B71A 1BITA 1TMTH 2ZDAH 3U8TH 1EAUA 1TPAE 2PP6A 2EA3A 2ULLA 1DLEA 3PB1E 4UD9H 5L30H 2OC1A 3ZVFA 2HALA 3M35A 1UMAH 2FS8A 3P70B 3SJOA 3ZVAA 1O3FA 4Y79A 4F48B 5FPTA 1AWHB 1HRTH 1BMLA 1BMMH 4Y8XA 3KQEA 1L0ZA 1VGCC 2BOKA 3U8OH 1RIWC 4YLQH 2F83A 1J16A 3FP8E 4UFGH 3N99A 1SLUB 3S9AA 1ZGVA 1A0LA 2P8OC 3CS0A 5LPEA 2IPQX 2VNTA 3OFND 3MNSA 1PPZA 2PGBB 1BRCE 3SHAH 4R0IA 1BCUH 3GOVB 2XCFA 3K65B 3FAOA 3RLWH 1SFQB 1NRSH 2IN2A 3ZYDA 1YPKH 5L2YH 3BTKE 1W10U 2DE8A 1IQMA 1GHAG 2VBCA 2CJIA 2VB0A 4Z6AH 1DWEH 2ZFRH 4O3TA 1UTLM 3BIVH 3SO3A 3ZVGA 3O8CA 5C17A 1MD8A 3RDZA 3HGPA 1QRZA 1O2JA 4VGCB 2Y5FA 2Y81A 4RT1A 5L2ZH 1WYKA 2BVRH 1FY5A 5A0CA 4JZDH 2WUBA 3GYMA 4NWLA 3VEQB 1CT4E 5A09A 1GBJA 2STAE 3A83A 5F8ZA 1IQJA 5B6OA 1O5AB 4Q2KA 2ODPA 1A3BH 4U30A 1UTOA 2AGEX 3SU1A 3M5MA 4CRFA 3MU4A 1WTHD 1T31A 3M5NA 1JRTA 4D9QA 4X2WA 1A1RA 1O2SA 3DUXH 1MCTA 1KLIH 3PV5A 3BTTE 1SGIB 4NSVA 2FPZA 4GSOA 2LPRA 2H9HA 4ISIH 2IJD1 4ISOA 3P95A 1SMFE 1XUGA 2FOGA 5DP6A 1IOEA 1O3KA 1UTPA 1XM1A 1D4PB 3CP7A 3GY7A 1QL8A 2A5KA 4XD7D 3TGKE 1DUAA 4Y6DA 2ZF0H 4FVBA 5GNDA 1C5YB 1G37A 1H9IE 1Z6JH 4NIXA 2EC9H 1DSUA 3P92A 2YMSB 1QB6A 2PGQB 1VCQA 3BG4C 1H9HE 1LVOA 2R0LA 8KME2 4B2CA 3CENA 3GY6A 2VH6A 5K0HA 1W7GH 3DT0H 3T62A 1ZTKA 2PTCE 4B1TA 2FI4E 1Q2WA 4K5ZA 4NZLA 2QGRA 3B8JA 1P09A 1C9PA 2D1JA 5C0UA 4IBLH 2ALVA 1N6YA 1N8OB 2YNAA 1FDPA 3BTQE 1GL0E 2VIPA 2D2DA 3FO8D 2BX3A 2GKVE 3KN2A 1O2GH 1ZHRA 3EA9A 3OE7D 3RXFA 2GTBA 1V2ST 3U28C 2TBSA 1NBMD 1BTHH 2ZP0H 2BY7X 1D3DB 4RKOB 2BD9A 2C8XB 1O5BB 3H7OA 1P06A 4ZKRU 1V2MT 2EI7A 4WY3A 2I6QA 3M7TA 1XX9A 3PMJA 1NRNH 1SOZA 1P9UA 5T1VA 3HGNA 1L1JA 2BLWA 1OX1A 5E0GA 5DP9A 1NTPA 4Y76A 2FYRA 2YNBA 1WCZA 1QA7A 1BHXB 4INHA 5H4IB 3S7KB 1M9UA 2LELA 1KLJH 1GJ5H 3F2GA 5C5NA 2BVXH 1BOQA 3QUMP 1GI4A 1S0RA 4CR5A 1EAIA 5HXFA 2CF8H 2Z7FE 4NG9H 5C67A 1WBGB 1O3EA 4X8SH 4U2WA 3FANA 2XNDD 3SJ8A 3T27A 3SNCA 1E0FD 1HDTH 5EQQA 2NU1E 4NFFA 4X1QU 1D6RA 5I46H 1K21H 1LO6A 4GCHF 5JB8S 5JBBS 4XOJA 5CHBA 1J8AA 1GBBA 3RXTA 2ZHWH 2NU0E 1VITF 1UK3A 1LTOA 4D8NA 3V7TA 2QXIA 3RM2H 3BSQA 2FOMB 1F5RA 1KDQB 3TK5A 3RC5A 1KXCA 2H5DA 3ITIA 2BX4A 3TNTA 3KF2A 2AHME 4DIHH 4WH6A 4ASUD 4YT6H 1CVWH 1GDUA 1MD7A 3NCLA 3STJA 2SGFE 2BD4A 3S69A 1QQ4A 3ZZDA 1GMCF 3LU9B 5EIYA 4ZKSU 1Y5BT 1C1RA 4FUJA 2GMTC 3MU8A 2G81E 3D49H 1EPTA 1F0TA 4ABJA 2OC7A 1RTLA 2J97A 2SNWA 2QV1A 3MNBA 1GJBB 1QJ6B 3BTEE 1FY3A 4BTIB 1CHGA 1RGQA 2O8TA 3FZDA 3E8LA 4J1YA 4NCYA 2GX4A 3T29A 1ELVA 4KTSA 4Y0ZE 3MU1A 3TK6A 4XDEA 1WXRA 5EXLA 1FY1A 1HAVA 1ZTLA 2J34A 1IQHA 1HPGA 3SI4H 1AIXH 2FOEA 2Z9KA 4GLYA 5FX5A 1T8MA 4Y71A 3PWCA 1V2UT 4JMYA 4MQAA 1F5KU 1AI8H 5GJ4B 2XBWA 4YLUA 3WWBA 3MHWU 1F5LA 1P11E 2BY8X 2RDLA 1FZZA 1GBDA 2LP6A 5C1YA 2WPKS 5FBIA 4RT0A 1HUTH 2BY9X 1BTYA 4NA7A 2FS9A 4Y8YA 2DUCA 1ETRH 1ELCA 4MPXA 1OWIA 3NZIA 1CO7E 5PTPA 2QF4A 3QDZB 1MTNC 1QL7A 3DD2H 1CU1A 1UTJA 3NWUA 4TPIZ 5KEDA 1NRRH 3SOSA 2I6SA 2W3KA 1RIWB 2SFAA 2C8YB 1MBQA 4ZXYH 3TJUA 1LHFH 4KP0A 1T4UH 1O3OA 2BB4A 1V2VT 2XC5A 5E0HA 4WH8A 1QZ8A 1W11U 1C1SA 2VIQA 1KXAA 2HPQH 3T5FH 1TA2A 1BBRE 1HNEE 2Y7ZA 2VIWA 3KNXA 1GMHG 1HAIH 1AE8H 4H42U 1ZZZA 4UFFH 1DWDH 1NFYA 5FL7D 3BTFE 2Y7XA 3SJ9A 2PUQH 4BAKB 2Y80A 4SGAE 1MTWA 1YY3A 2C4FH 2THFB 1FY8E 2BXTH 3VB6A 2G00A 6CHAB 1K22H 2EEKA 1O39A 3I29A 1PPGE 1UK4A 3PRDA 4Y8ZA 3E0PB 5G4BA 3ZIAD 3A81A 3S9CA 3VB3A 1QBNA 3BEUA 1BTPA 3PLBA 2WPHS 1FN8A 1KY9A 3UWJH 1G3DA 1EOLA 1VKYA 3JZ1B 2ZI2H 1DT2A 2AMPA 1AD8H 1K1MA 3BEFB 2FESH 3SU0A 3KQ5A 5C1XA 2ALPA 3A7YA 1WAYB 2FEQH 1O3NA 1ZMLA 2W7UA 2SNVA 1AQ7A 2SGAA 7LPRA 1GMDF 2VINA 3K2UA 2ZGCA 2R0KA 1BMFD 4B2AA 5JBTA 1SR5C 1V2JT 1TQ7B 1ZGIA 1FPHH 3RXCA 1KTSB 1UO6A 1ZSKA 1C5QA 2W26A 2XYAA 3MWIU 4MNVA 4AORA 4ISNA 4BAOB 4ABEA 3NK8A 9LPRA 1C5XB 1ZJKA 2GDEH 3BTGE 1GPZA 1TYNA 2ZU3A 1Q31A 1O2YA 1AFQB 1O33A 1TGBA 2AS9A 1D3TB 2A7CA 1PFXC 1QTFA 3FP6E 1L1GA 2ZHQH 4FUGA 1OWDA 4OGYA 2B8OH 3LJJA 1SGCA 4X1NU 1W13U 4CR9A 1P03A 3SUEA 1DVAH 1FX0B 4D9RA 2ZPSA 2VWNA 3ZZ5A 1TGTA 3P8NA 1KXEA 2JH0D 4ISLA 4Y7BA 2F9PA 1MZDA 1LKBA 4FXGH 5K7RA 1THPB 3SU4A 3W95A 1Q3XA 1CSOE 2BZAA 4AB8A 1GJ6A 3SZEA 1GCTB 2FX4A 3SQEE 2FOBA 2P95A 1NS3A 2L6OA 1JOUB 3NUMA 3TK9A 3QN7A 4BXSA 2PLXA 5DPAA 2BQ6B 1FJSA 4B75A 2XCNA 1K1JA 1G30B 4J2YB 3SU3A 3LOXA 1EZQA 4R8TB 4XBBA 1Z1JA 2V3OH 4TSFD 7ESTE 1PQ7A 5IYTA 3PMBB 2F9VA 1O2HA 3VB5A 1UW7A 1ZOMA 3V0XA 1TRMA 1H9LB 1XKBC 2V6NA 2ZCHP 2QC2A 2QF0A 5FAHA 2ANYA 4CHAC 2FYQA 1MAYA 2SGEE 3N7DA 6LPRA 1B5GH 3RUOA 1FY4A 1MTSA 2Y5GA 1XXDA 4CRGA 1GBFA 2BDGA 1VGCB 4FUBA 4I33A 4IN2A 1MTUA 1TBQH 1XUFA 2A31A 3F0OA 1YBWA 1TX8A 2J98B 3QK1A 4CHAB 1FONA 2QA9E 1NFWA 2ZU1A 3RXAA 1ARCA 1UCYH 1YLDA 1TWXB 4K8BA 2A5IA 2B9LA 4Q7YA 1HXFH 3C1KA 1A0JA 1BDAA 1HYLA 1TMUH 2ZGHA 2NU3E 4UFEH 1C2MA 5EXMA 2P59A 2HLDD 2G55A 1O2RA 4OGXA 5T3HA 4THNH 1ZSJA 4BNRA 1ZPCA 3ZZ4A 4CH8B 1RS0A 1OOKB 5DK1A 4WXVA 2SGQE 1CGIE 4JYTA 2RG3A 1HAZB 3SV9A 1FAKH 4FUCA 1S83A 1NFXA 4NIVA 2J98A 4DGJA 3F2FA 3MNXA 1A3EH 4MPWA 2ZPQA 1NRQH 1THRH 1IQLA 2H1UA 4X8UH 1OYTH 3PLKA 1O3AA 1WTGH 2QAAA 4GCHG 5DP8A 2QXHA 3F1SB 2F91A 3L3TA 1GHWH 1F0RA 3OEED 5FPYA 1MTVA 1TRNA 3ATMA 1AU8A 3PRBA 2QIQA 2R2MB 1P12E 2GCTC 7GCHG 1N1LA 4HG6A 1CA0C 1P05A 1O2XA 3SW2B 3TU7H 2OBOA 1ID5H 2WPIS 2YMSD 4IMZA 1HAXB 2F9NA 1JIRA 1ZJDA 5HM9A 1GJ9B 1UTNA 4B74A 1GG6B 1C1NA 1QRXA 1YPHE 4I32A 4RI0A 3QGNB 2AERH 3SUFA 1DITH 1S6FA 2PFEA 2KR7A 3UY9A 1YC0A 2NU2E 4OS1A 1O5EH 2V3MA 2Z9GA 2A7JA 2ZDKA 2FIRH 3F9HA 1LPZB 3EE0B 1O3HA 1OHHD 2UWLA 1CT2E 3RXQA 1MU8B 5C0TA 2J94A 3U1IB 1CT0E 1CA8B 5EU8A 1W7XH 2KZ4A 1B0FA 1C5TA 2ZDVH 1O5CB 2ZU4A 3F2HA 4I8KA 2ZC9H 2ZCLP 3KGPA 4K69A 1D3QB 1TGCA 1TIOA 3A7VA 2C3SA 2XRCA 1SLXB 1GCTC 3GCNA 4GAWA 3A7WA 1EX3A 2ILNA 1QURH 1P2KA 2AFQB 3UOPA 1GI5A 2ODQA 3UOUA 5JPMH 4E7RG 3GDUA 2BDHA 3ODDA 4FUHA 2PWXA 3SJKA 4AFSA 5C2ZA 3UIRA 3NPSA 1F7ZA 1Z71A 1O3IA 1AKSA 3VB7A 3RU4E 1LPGB 2XW9A 3BTME 3GCTF 2F9OA 2FP7B 3IG6B 4DW2U 1OYQA 2W7SA 4CBNA 2GZ7A 8LPRA 1P3EA 2WYGA 1MKXH 4FU9A 3Q3KA 4JZFH 1C1TA 3TITA 1EJAA 3U9AH 1AMHA 2CHAC 1N6XA 3OTJE 2XXLA 2YOLA 5F8XA 1GJ7B 2VWOA 2OK5A 3M7QA 1IQIA 1GBCA 2QF5A 1V2NT 1D9IA 3ENSB 1LQDB 2KM0A 1K9OE 4GHTA 3BIUH 4WF8A 3RXDA 5T6FA 1IQEA 2BLQA 1HJ9A 2PKSC 9ESTA 1ZR0A 2FXRA 2PR3A 4IW4E 2FLBH 3GCHC 1TNHA 1QJ1B 1AWFH 3ELAH 3ATIA 4K3JA 2DE9A 3Q3YA 3MH4A 5A0BA 3U98H 2BD5A 1GVZA 1VCPA 1OP2A 5CE1A 1KXBA 2NWNA 3LONA 4X2VA 1YPGH 4E05H 1P9SA 1S5SA 3S9BA 3TJOA 3E90B 5EXNA 1ZRBA 2HRVA 2QY0B 2D8WA 1HGTH 4F4OC 1BMAA 3RXEA 4X6NA 1TNKA 2B7DH 3MU5A 1C5MD 3PYHA 3F9FA 1C5RA 1FLEE 1O2ZA 5FBEA 3QTVH 2KFWA 3A7ZA 1V2KT 2W6JD 4NWKA 1GHAF 2HVYB 4YESB 3SV6A 3M5OA 1SQOA 1PPFE 2O8MA 3ESTA 1DFPA 1GMHF 1FMGA 2ZO3H 3PV4A 4ZUHA 4FOUC 1U6QA 4Q63A 3MO6A 3BN9A 2ANKH 1TPSA 3EDXB 4KGAA 1KIGH 4U32A 1Y3VA 2F4LA 1EJMA 4DG4A 5F53A 4YXWD 1BBRH 3H5CB 3SBKA 1O2WA 3M7UA 4AFQA 2ZGXH 4CH2B 1FN6A 3O8BA 1GMDG 1A61H 1H1BA 3KEEA 1AUTC 5GCHG 1GL1A 5AFYH 1YPJH 1BBRK 4O3UA 3ATWA 5ESTE 1DWBH 1ELDE 3B23B 1ZHPA 2AMDA 4YOGA 3T26A 1G36A 3F6UH 2ESTE 5C20A 4WMFA 1L2EA 1E1QD 1JXPA 1C1OA 1QY6A 2A2QH 4DIIH 1BT7A 1W2KH 3MH7A 3KQCA 3PO1C 2J95A 1DPOA 3H09A 4KTCA 2RA3A 4A1TA 4IS5A 4TY7A 1WU1A 1AN1E 2AIPA 4A5TS 2PSXA 4NSYA 3B9FH 3CNRA 4E06H 2ZQ1A 4MNWA 1MCVA 1QFKH 3A85A 2JIZD 3GDVA 4A1XA 4BAMB 1Z1IA 1E79D 3V13A 2VGCB 4OS6A 1BB0B 2JJ2D 2ZFPH 2G4TA 3F0PA 1WV7H 1BRUP 1EAXA 3SNAA 1P01A 2ZCKP 4GVUA 4WXIA 1WOFA 2CN0H 2G52A 2O8WA 4K8YA 6CHAC 5EQRA 3WW7A 3MYWA 1SG8B 3BV9B 1J17T 1EZUC 1ELBA 1O36A 2XC0A 4QT8C 4OS5A 4X1RU 2Y5HA 2OQ5A 3SHCH 2A4OA 2UWOA 1GDNA 8GCHG 2UWPA 2JDID 1WSSH 2A32A 4TWYA 4ZH8A 3UNRA 1ZMJA 3GY3A 2UUFB 3LPRA 1FUJA 3EE7A 2AMQA 2FO9A 1HCGA 3RC4A 4DVAU 2KCYA 1AHTH 1LHCH 2KCPA 2GD4B 3HKIB 1EKBB 3T28A 4DJZB 1DSTA 1Z8RA 2F3CE 2AH4X 1TPPA 2GJGA 3GCTG 3SYJA 2FI3E 1CE5A 1ZHMA 4I8LA 1FAXA 1HJ8A 1DLKB 1FPCH 3N7OA 4WWYA 5GCHF 1WQSA 2HNTE 1QJ7B 1UVUH 4D7GA 3FOAA 2Z3EA 2C8WB 3MFJA 3UUZA 3TLOA 1ESTA 1YLNA 5AFZH 1IQFA 1UTKA 3ZZ7A 1BTUA 4O03A 5DSFA 1ELFA 2KX4A 5EW1H 3AAVA 1ETTH 2P16A 5B6LA 2HVXA 4AFZA 2SGDE 2VU8E 1E34B 2CK3D 2K1QA 1IQNA 2AIQA 5JB9S 1SVPA 1C9TA 1DY9A 2ANMH 1GI1A 4HTCH 5I25A 1NY22 1GI8B 2BYAX 1C5OH 3A8AA 1V3XA 6ESTA 2G4UA 3HK3B 3ZV8A 3NRLA 4HFPB 1DXWA 1MUEB 4FU7A 1HJAB 2F9BH 5HKKD 1MABB 2GDDA 3PV2A 4HZHA 2P94A 4ABAA 2R9PA 3UR6A 4AB9A 5EPYA 4AGJA 3LT3A 5KGOA 3O8DA 1Z8JB 5F8TA 4F49A 5HIYA 4BOHA 2IOTA 1G2MA 3ZVEA 1L4DA 1KXFA 2Q6DA 3TGIE 1AO5A 2Q6GA 1BQYA 1OWJA 2BZ6H 1C5NH 1N8OC 1F92A 1GJ4H 4IGDA 1K1PA 4X8TH 3A84A 1BTWA 1NESE 3UR9A 1QBOA 1BTXA 1GJCB 1QB1A 5AF9H 2OC8A 5IDKA 1T8NA 1O32A 5C3NA 5FCKA 1ELAA 5EJZA 4IMQA 1COWD 1S81A 2ZIQH 4H4FA 1BMNH 1MTNB 4KKDA 3SI3H 1XUKA 3KQDA 1GWAA 4FUEA 3M3VA 1C1MA 5EJ1A 2H5CA 4JK6A 5DG6A 3A82A 4X0WU 2ZKSA 1VR1H 1ZPZA 4X6OA 3RXSA 1O2NA 1C1WH 1YKTA 3ZZ6A 2R3UA 4IC6A 5FPSA 3R0FA 1GBLA 3TH2H 5GWZA 2WINI 4I8HA 2FTMA 3EAJA 1BRAA 2PTNA 4YT7H 4UONA 1H4WA 1YPEH 2TGTA 1O30A 3AASA 4K1EA 2TGDA 3E16B 1S6HA 5E2PA 2PKSB 2WUCA 2BDIA 3EYDA 3GICB 2FI5E 1YF4A 2RDEA 1ESAA 1DANH 1MU6B 1NU9A 1P2JA 3TNSA 2BQ7B 1E38B 3VB4A 1GGDC 4MNYA 3ATKA 1Z7KA 3OSYA 1HXEH 4WMEA 1GHBF 3LC5A 1DICA 1ZLRA 4JZ1A 1A0HB 1YPHC 1O31A 3AAUA 1DDJA 4UFDH 1C5PA 4Y11E 2BVSH 1C2KA 2ZWLH 1O2QA 1TGNA 1EQ9A 1A4WH 1HAGE 1Y8TA 2GMTB 3UTUH 4VGCC 1CGJE 1TLDA 3MH5A 1ANCA 8ESTE 3RMNH 5GIBA 1AVWA 4P00A 1NFUA 3VFEA 1LVMA 2FZZA 5EOKA 1WUNH 3TH4H 6GCHF 1K1IA 3ZZ8A 1S82A 2A4QA 1GI2A 1NBME 3A87A 1THSH 4O9VA 3UQVA 3ZZAA 1SGDE 4Y10E 2ODYB 1SSXA 4TY6A 5EPNA 4Y7AA 2XBYA 4LZ4B 2HWLB 1V2TT 3FP7E 2HOBA
chains in the Genus database with same CATH topology
4Q7XA 1GMCG 2QXGA 3MNCA 2F9UA 1K1LA 2TRMA 2PUXB 2H6MA 3SNEA 4BANB 2ZNKH 4K2YA 2FWWA 1O3GA 4MLFB 1XUIA 2VVUA 1UVTH 4AX9H 1MH0A 2PKAA 2ZFFH 5EODA 1CQQA 1O34A 1DM4B 1BRBE 4MG3A 1GJ8B 1T8OA 3PO1B 3P8GA 5T6DA 4KELA 1HAHH 4BTTB 5GXPA 1UHBB 1QB9A 3RP2A 1ZTJA 1YCPM 4FUDA 1SGFA 5FX6A 3UNSA 1MKWK 1O3CA 3RMMH 3KL6A 2OC0A 1SLWB 3DA9B 3RXHA 2ZA5A 1P0SH 2VGCC 4H6TA 3LH3A 3RXMA 3SU2A 1SGQE 1ARBA 2JKHA 1J15A 1C4Y2 1O2VA 2AGIX 1T7CA 1UJ1A 1GDQA 3Q3XA 1NU7B 2Z6BD 1TNLA 3OYPA 1SGYE 3SJIA 2CXVA 5GDSH 4ZHMU 1SHYA 2A2XH 1O2LA 1HLTH 3LGYA 4ZKOU 2FODA 1X7AC 1L4ZA 3M36A 4GHQA 1DX5M 2JH5D 3UREA 1MAXA 5SGAE 1T4VH 2BDAA 3PM3A 4X2YA 2XWBI 3W94A 1AY6H 4Y0YE 2ZTYA 1PPBH 1LVYA 1KSNA 3QWCH 3UWIA 1TBRH 1GBAA 3A89A 1NROH 2O9QA 1HFDA 5LPRA 1GBEA 4ABIA 3MTYA 1QCPA 5JBAS 3BTWE 4XBDA 4NA8A 4JYVH 2BHGA 4RSPA 3ODFA 3ZZ9A 5LH8A 1C2GA 3PMAB 1EP6A 1OP8A 1V2WT 2TGAA 1AZ8A 1UTQA 4X6PA 3UQOA 4D76A 1C2JA 1PYTC 2GV6A 3QGJA 3OX7U 1EXFA 1TPOA 2G8TA 2Z9JA 2OLGA 1IQKA 1EB1H 1QA0A 1HBTH 1TOCB 1YPLH 4JZEH 1CHOG 2IJOB 3URDA 1C2HA 1O3DA 1VCWA 1OSSA 4I8GA 5F03A 2ZHDA 3BEIB 1Y3WA 1G9IE 2EI8A 1OWHA 5LPFA 4YO9A 2PV9B 2AEIH 2ZTXA 4ABBA 3SUDA 5BRRE 1O3JA 3I77A 3A8CA 4MPUA 1Y3XA 2GCTB 1Y3UA 2GT8A 1EUFA 1FNIA 1JBUH 3E3TA 1QBVH 1S84A 1A5IA 1P2NA 2HNTF 4MDSA 1O3LA 5DP7A 3T25A 5L6NH 4OS4A 3RXKA 2JH6D 3PMHB 2KAIA 4CBOA 1GI9B 4UE7H 2BY5X 1GCDA 1XVMA 1EP5A 1KYNA 1GI3A 2WYJA 4HI3A 4RKJB 3BTDE 1ETSH 3QX5H 1O3MA 2HLCA 5JDUB 3P8FA 1OWKA 3RXRA 5E0JA 5DO4H 5DP4A 1PJPA 1TFXA 1P10A 2ZDLA 2ANWA 1W3CA 3AW0A 2ZHFH 2ZDMA 4X2XA 1GI0A 1ACBE 1RRKA 2W3IA 2ZGJA 2BDCA 2C93B 3DFLA 4WVPE 2PKAB 4Z0KA 1ELGA 4MNXA 1LQEA 1AB9B 4YM9A 2B5TB 3M3TA 1TNJA 4K1SA 1FIWA 1YCPK 1GBTA 2AGGX 2UUJB 4I31A 2ZZUH 3SV7A 3MO9A 2Z3CA 1TONA 2Q6FA 2FOAA 1C5WB 2J9NA 5AVDA 1TMBH 5HYOA 1EASA 1C5ZB 7GCHF 3RM0H 3GCOA 3IITA 4WMDA 4YOIA 1SB1H 3MI4A 1F2SE 3MH6A 2OINA 1VITH 1ELTA 1UHBA 3LC3A 1E35B 1LVBA 2A1DB 2TIOA 3LKWA 1GHVH 3GISB 5DP3A 1P3CA 4NIWA 5ABWA 3EA7A 4CRAA 4LXBH 1VZQH 3HKJB 3HPTB 4FUFA 1GHXH 1EZXC 1SI5H 3SU5A 1ESBA 4IN1A 4INKA 1J9CH 4DCDA 3GCHB 1ANBA 5HGGA 1D3PB 2P93A 2STBE 1NM6A 3P17H 2QN5T 2SGPE 5ETXA 1QHRB 1LCYA 5EGMA 3RXVA 3A80A 3STIA 2HPPH 2ZU2A 3NKKA 1RTKA 1GBKA 3SNBA 2XWAA 1OXGA 1A7SA 3A8BA 4TPYA 1EOJA 1V2RT 3LJOA 4BAHB 4ABDA 4NGAH 1GHZA 1OP0A 3OU0A 5CMXH 3QTOH 1HAYB 1JRSA 1RTFB 2BLOA 3RXLA 2ZQ2A 1AFEH 1YYY1 3SZNA 1HJAC 3TPIZ 4B2BA 4ZHLU 1C2DA 3ZZCA 4ABHA 1D6WA 2O8UA 1MBMA 4WJG2 1KDQA 4GPGA 4NFEA 1GG6C 1YPMH 1QGFA 1RJXB 1QIXB 1XMNB 2W5EA 2WPMS 3ZV9A 1IHSH 1Y5UT 1SLVB 3VGCB 1BIOA 4ZMAH 1QL9A 1SHHB 3P6ZB 5BPEA 3BG4B 1AFQC 1C5UA 1P2IA 1EJNA 1GI7B 2ZG0H 4MPVA 2UUYA 2VWMA 5HM2A 1C4V2 1O2IA 5F6MA 1LHEH 1DXPA 2VWLA 5CHAB 3HATH 3ZVDA 1BJUA 1EPTC 5TJXA 8GCHF 2ZECA 3D65E 1CHOF 2ZDNA 3KIDU 1WQVH 4K1TA 1W0YH 1EZSC 4YZUA 2BXUH 3K6ZA 1XVOA 2KAIB 4KTUA 1SGFG 1ABJH 1OKXA 2A4GA 2ZPRA 1P02A 2BLVA 3E6PH 3TVJB 1SGRE 1TALA 1EPTB 2A7HA 4LZ1H 4OS7A 3O8RA 2P8OB 1MMJN 2QXJA 2AYWA 5DJ7A 5JYIA 4XE4A 1NN6A 1LHDH 3TIUA 1NO9H 1FI8A 3EA8A 1SQAA 1YM0A 3P8OA 2BD2A 5A8ZA 3SU6A 3S0NA 1TE0A 6GCHG 1Z8IB 1P2MA 1TNGA 2WPLS 2BQWB 1ABIH 1TA6A 3Q76A 1G3EA 2FOFA 1O3PB 3M61U 2J92A 3BTHE 4UDWH 4M7GA 1V2QT 2R3YA 2GVFA 1DY8A 1LDTT 4CRCA 2J38A 1PYTD 3ZZ3A 3QZQA 4BXWA 1C1PA 2OXSA 4CRDA 1BTZA 1FQ3A 1EB2A 3FFGA 2Y82A 3RXOA 5FCRA 2G5VA 1CBWB 3UNQA 3A86A 1RFNA 1SOTA 5AHGH 3SGBE 4B73A 1W14U 4LOYH 5TCCA 5EG4A 4FU8A 4AGKA 1LKAA 1NC6A 4B76A 3UPEA 3U1JB 4DY7B 2XC4A 2CGAA 1CBWC 4JYUH 3GY2A 1T32A 2ASUB 1P2OA 2GZ8A 1W8BH 2A45B 3D62A 3SN8A 2J2UA 1H8DH 3PTNA 3M37A 2QYIA 2HNTC 1FXYA 1A2CH 4ISHH 4Q7ZA 4ZROA 1KLTA 2ZFQH 4MTBA 4JK5A 1SGTA 2BDYA 1K1OA 1S85A 3RLYH 2HGTH 3A88A 2VVCA 1W12U 2TGPZ 2WV5A 4NA9H 4DOQA 1MQ6A 2BOHB 1HV7A 2OQUA 1DE7H 3D23A 3QO6A 5DP5A 2A5AA 4FUIA 1PQ5A 1ZSLA 2B0FA 3T2NA 2PHBA 3FZZA 4AYYB 3PTBA 1O38A 1QR3E 1VITG 1YLCA 5J4SA 3RU4D 1V2PT 1P8VC 3GY5A 3LGVA 3LGTA 1CA0B 1O2KA 1UTMA 1C1UH 3BG8A 3VGCC 2XTTB 3LGIA 1VJAU 2BD7A 2C8ZB 1HB0B 4JZIA 1TB6H 1C5LH 1IHTH 3QLPH 2BMGB 1G32B 5J4QA 1O2TA 3Q00A 1GHYH 1K28D 1GVLA 2C90B 1NZQH 1H8IH 2G51A 1ZMNA 1TX7A 4ABFA 1A5GH 1O5DH 1QQUA 2BTCE 7KMEH 1PPCE 2FTLE 5E2OA 3VPKA 1O2PA 2H2ZA 4DURA 3A7TA 1RD3B 3RC6A 1O2OA 2XBXA 1DS2E 1MKWH 1ZRKA 1BZXE 1HAPH 2V35A 1JWTA 1HIAA 1ZYOA 1RXPA 3NXPA 3RXBA 4Q80A 1SL3A 1J14A 4A1VA 1TOMH 1JMOH 1C1VH 2VIVA 1HAVB 1S0QA 2GGVB 2M5TA 3OY5U 3PROA 4I7YH 1B7XB 1A46H 4INLA 4ZAEA 1LHGH 4AG2A 2P3TB 3K6YA 4ABGA 2V0BA 2VVVA 2Y6TA 1UVSH 3KCGH 2FM2A 1OWEA 1O0DH 3LGUA 1BJVA 5FHTA 5JBCS 1AE5A 1EAWA 1TNIA 2ZFTA 1LMWB 1C2FA 4ZHAA 3TJNA 3TH3H 4DT7B 3I78A 3L6PA 5A8YA 5FXLA 2FOCA 1O35A 2VIOA 2G5NA 2BD3A 4UEHH 2GT7A 1XXFA 5C5OA 2ZHEH 1CGHA 1DOJA 2JETB 3LDXH 1PQAA 2J4IA 3H7TA 2CHAB 3SNDA 1AKSB 2VIDA 3E91A 3GYLB 3RU4T 3V12A 3ZZBA 1Z8GA 1ANDA 5LGOA 5GPIB 1XUHA 1NRPH 3ZVBA 4XBCA 4AFUA 1TQ0B 2ZFSA 1PPHE 4TYDA 1GGDB 1G2LA 3V3MA 1O2MA 1SC8U 2LNCA 4IC5A 1IQGA 2BD8A 3MO3A 1AZZA 4LK4A 3C27B 4I8JA 1PQ8A 5T6GA 1BHXF 1C4U2 2CF9H 4O97A 2Z94A 3SV8A 2EI6A 5E8EH 3LH1A 2VH0A 1P2QA 3U8RH 1SGNE 3DFJA 1ZPBA 3K9XB 1ORFA 1V6DA 2D26C 1C2LA 3SUGA 1MKXK 3E1XB 3R3GB 3VXEH 5A8XA 4GUXA 3RXUA 3IWMA 3ZVCA 1O3BA 4FVDA 1DUEA 2GCHF 1MZAA 2Z3DA 1ELEE 3EGKH 2GZ9A 1F0UA 1A5HA 1OS8A 2Z9LA 3FVFB 1UCYE 1W0ZU 3SGAE 1KTTB 1VJ9U 3E0NB 1L1NA 3WY8A 2QF3A 4AN7A 1PPEE 4AG1A 1UK2A 3Q77A 2V3HH 2UUKB 2QCYA 2XBVA 1GJAB 2GCHG 3F9EA 1TX6A 2XNIA 1Y5AT 1HAOH 1AGJA 1C5SA 3A8DA 4YOJA 1GBIA 3SGQE 2GP9B 1TBZH 2ZTZA 2OD3B 3ZYEA 1C2EA 1AB9C 2OTVA 3U69H 1LPKB 1DWCH 2OUAA 1O5GH 1GBMA 3LIWA 2P3UB 5TCAA 2BM2A 5DGJA 1F0SA 3G01A 1NPMA 3M3SA 4JCNA 1ANEA 1SGEE 1GI6A 4U01A 1TAWA 2FDAA 2FMJA 2TPIZ 2CMYA 1INCA 4X1PU 1O37A 1YP9A 4X1SU 1BA8B 4A7IB 1MQ5A 3L33A 3AW1A 1UCYK 3JZ2B 3BF6H 1SGPE 1G3BA 1QNJA 4X6MA 4NIYA 1AUJA 2OP9A 2BY6X 3PLPA 3GY8A 2A0QB 1Z6EA 2H9EH 4HGCA 3RXGA 5A2MH 1UVPA 3TJVA 4ASHA 2O8LA 2FLRH 1O2UA 3DHKH 3S7HB 1FIZA 4A6LA 2H9TH 1EATA 1FV9A 4A92A 1SFIA 3SORA 2OBQA 2PSYA 4YTAA 1TRYA 3M5LA 1T8LA 3SQHE 1IAUA 4X8VH 2OCVB 2WV4A 3HK6B 2WPJS 5A0AE 5EW2H 3UFAA 2ZGBH 3RMLH 1BUIA 2RA0A 1TGSZ 4AZ2B 1C1QA 4K60A 3EQ0H 3F9GA 4RN6A 2VJ1A 1GBHA 5DKMA 1KXDA 2JETC 1TABE 2GV7A 1E37B 1V2OT 3F68H 5HMAA 1G3CA 1HIAB 1GVKB 2P3FH 4SGBE 3GDSA 3RXJA 3SV2H 1YGCH 1SQTA 3KHVA 4AOQA 3RMOH 1P57B 4XFQA 1GJDB 4TWWA 3GY4A 1AVGH 1XUJA 4XSKU 4CREA 4BTUB 1K1NA 3MU0A 1B0EA 2Z9IA 3MOCA 2FX6A 3LGWA 2FOHA 4MVNA 1SPJA 5ESBA 3VXFH 3ATLA 3AVZA 1OPHB 2BDBA 1AVXA 4CRBA 2Q1JA 1K2I1 1GHBG 2CV3A 4BAQB 3CS7A 2NU4E 1P04A 1C2IA 2PW8H 2ZU5A 3PWBA 4ZKNU 2A4RA 3RXPA 3URCA 1E36B 2R2WU 2ZEBA 1NT1A 1XKAC 1SBWA 1V2LT 4AYVB 1C5VA 3OY6U 1O5FH 3TGJE 1Y3YA 3MMGA 4ESTE 4ZXXH 1QRWA 1UVOA 4H6SB 1Y59T 2IPHA 4OS2A 4NZQA 4PROA 2RCEA 3KQBA 3RXIA 1YCPH 4E7NA 5CHAC 4D7FA 1JIMA 3QZRA 5C1UA 5EQSA 3A7XA 4B71A 1BITA 1TMTH 2ZDAH 3U8TH 1EAUA 1TPAE 2EA3A 2ULLA 1DLEA 3PB1E 4UD9H 5L30H 2OC1A 3ZVFA 2HALA 3M35A 1UMAH 2FS8A 3P70B 3SJOA 3ZVAA 1O3FA 4Y79A 5FPTA 1AWHB 1HRTH 1BMLA 1BMMH 4Y8XA 3KQEA 1L0ZA 1VGCC 2BOKA 3U8OH 1RIWC 4YLQH 2F83A 1J16A 3FP8E 4UFGH 1SLUB 3S9AA 1ZGVA 1A0LA 2P8OC 3CS0A 5LPEA 2VNTA 3MNSA 1PPZA 2PGBB 1BRCE 3SHAH 4R0IA 1BCUH 3GOVB 2XCFA 3K65B 3FAOA 3RLWH 1SFQB 1NRSH 2IN2A 3ZYDA 1YPKH 5L2YH 3BTKE 1W10U 2DE8A 1IQMA 1GHAG 2CJIA 2VB0A 4Z6AH 1DWEH 2ZFRH 4O3TA 1UTLM 3BIVH 3SO3A 3ZVGA 3O8CA 1MD8A 3RDZA 3HGPA 1QRZA 1O2JA 4VGCB 2Y5FA 2Y81A 5L2ZH 1WYKA 2BVRH 1FY5A 5A0CA 4JZDH 2WUBA 3GYMA 4NWLA 3VEQB 1CT4E 5A09A 1GBJA 2STAE 3A83A 5F8ZA 1IQJA 5B6OA 1O5AB 4Q2KA 2ODPA 1A3BH 4U30A 1UTOA 2AGEX 3SU1A 3M5MA 4CRFA 3MU4A 1WTHD 1T31A 3M5NA 1JRTA 4D9QA 4X2WA 1A1RA 1O2SA 3DUXH 1MCTA 1KLIH 3BTTE 1SGIB 4NSVA 2FPZA 4GSOA 2LPRA 2H9HA 4ISIH 4ISOA 3P95A 1SMFE 1XUGA 2FOGA 5DP6A 1IOEA 1O3KA 1UTPA 1XM1A 1D4PB 3CP7A 3GY7A 1QL8A 2A5KA 3TGKE 1DUAA 4Y6DA 2ZF0H 4FVBA 1C5YB 1G37A 1H9IE 1Z6JH 4NIXA 2EC9H 1DSUA 3P92A 1QB6A 2PGQB 1VCQA 3BG4C 1H9HE 1LVOA 2R0LA 8KME2 4B2CA 3CENA 3GY6A 2VH6A 5K0HA 1W7GH 3DT0H 3T62A 1ZTKA 2PTCE 4B1TA 2FI4E 1Q2WA 4K5ZA 4NZLA 2QGRA