1AZ8A

Bovine trypsin complexed to bis-phenylamidine inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Unexpected Binding Mode of a Bis-Phenylamidine Factor Xa Inhibitor Complexed to Bovine Trypsin
rcsb
molecule tags Serine protease
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1az8A02
1DY8A 1UVSH 1EJMA 2ANKH 1GI3A 3NKKA 1O2RA 4NIXA 4DG4A 2ULLA 2GCHG 1O3DA 3A8BA 1A7SA 1O2LA 4KTSA 4ESTE 1EAIA 1AGJA 1KLTA 4OS4A 3EQ0H 3RXIA 2OC7A 3AW1A 4YESB 2VIPA 5DPAA 1G32B 1GJ8B 2NWNA 1EAXA 1HXFH 4ABDA 3F9FA 4IN1A 5EXLA 1XM1A 2R2WU 3GCTF 3TK6A 3ZZCA 1A5HA 5BPEA 3VPKA 3TIUA 3PB1E 2VWNA 2Z94A 1SSXA 3T25A 3LGYA 1C4V2 4NFFA 1V2UT 2GT7A 3SU1A 2NU0E 1SGYE 1KXAA 1TBZH 3B8JA 1K1MA 3VB6A 1E37B 1V2QT 2WINI 5TCAA 3T29A 2OD3B 1O3IA 2F9BH 2VH6A 1GJCB 1UVOA 4FU8A 2D1JA 4UD9H 1CQQA 1UHBB 4JK6A 4VGCB 1PJPA 2JH5D 4ABBA 5CE1A 2ALPA 1GVLA 1C5LH 1DITH 1UHBA 3TJUA 4E06H 4RKOB 1PFXC 3E0NB 2CMYA 3BEIB 1FN6A 5JBTA 2Y7ZA 3QX5H 3RDZA 1CO7E 3SU5A 2GTBA 1ETRH 3MH6A 3S9AA 2A1DB 3SGBE 1BTPA 3E8LA 4FUBA 3BTWE 2QA9E 1Y59T 3FVFB 2BDCA 4ISIH 4I33A 1K1NA 2GCHF 2OC0A 3EA7A 1EZSC 1IQNA 1RS0A 2EI6A 4FUEA 3H7TA 2QXJA 1BZXE 1D9IA 2FXRA 2OBOA 3P8GA 1V6DA 3UUZA 1CHGA 3SV7A 2QXIA 1C1OA 1CVWH 5E0HA 3SJKA 3NUMA 3UQOA 1Y3WA 3TJOA 1TE0A 5ETXA 2G5NA 3P8OA 2ZO3H 5CHAB 3ZVFA 2BXUH 1KSNA 1TPAE 5GXPA 4Q7XA 5AFZH 4LK4A 4X2VA 2J38A 4WXVA 1D6WA 2BM2A 5G4BA 4O97A 3MH5A 4JMYA 1CSOE 3UNRA 2B7DH 1ELTA 4DIHH 1P8VC 1FI8A 1XKAC 4VGCC 1PPGE 1P2MA 3ZVDA 1OWIA 4CRDA 1B0FA 3SNBA 1QIXB 1AVXA 5DK1A 4JYUH 4NZLA 1HLTH 4K1EA 1ZPZA 1OP8A 1AN1E 2AMQA 2KAIB 3EE0B 1D4PB 1CE5A 3RXVA 1FZZA 2A4QA 1OPHB 3TH4H 1FV9A 3TJNA 2KAIA 1HRTH 2ZDLA 1PPEE 2W3KA 4CR5A 2BX3A 5J4QA 4J1YA 2FOFA 5DP6A 4H4FA 1PYTC 1BDAA 3U1IB 1AWHB 1YGCH 3KIDU 5CHAC 5JDUB 3P6ZB 3LOXA 3RC6A 1P06A 1ARBA 4JYVH 1UTJA 1SGEE 1P2OA 1IQFA 3MU4A 1ELGA 3ZVCA 3STIA 3GISB 3MH7A 3QTOH 3IWMA 2TRMA 1Z71A 1QCPA 4JYTA 2QY0B 1QY6A 1F7ZA 1SR5C 1J9CH 4DW2U 1N6XA 5PTPA 3QGJA 1OWHA 4RSPA 1SC8U 4Q2KA 2ZDVH 2A5KA 1HIAA 2FP7B 3PMAB 4OGXA 1ID5H 5E0GA 2FPZA 3V3MA 2TGAA 2VIVA 3STJA 4ZXYH 1JBUH 4BAKB 4GSOA 3TGJE 1A0LA 2UWOA 1U6QA 2AIQA 2PGBB 3NK8A 4QT8C 1LHEH 5EGMA 1C5ZB 2PWXA 1XX9A 1QFKH 1RRKA 1A0HB 1GCTB 1S84A 2A4GA 4B75A 1GJ9B 1V2MT 4WY3A 1ZRKA 1NM6A 3S0NA 1BOQA 4O9VA 7GCHG 4MPWA 1K1IA 2HALA 3A83A 5DP4A 1HFDA 3AAUA 3GYMA 1ZR0A 3TU7H 1SVPA 2HNTE 3OY5U 5BRRE 2BLOA 2O8TA 3EAJA 1LHCH 1KDQB 4IBLH 1IQJA 1O2OA 3K6ZA 6GCHG 1V2NT 3UPEA 5JB9S 2GD4B 3RXAA 3OX7U 4I32A 4BAOB 5A8ZA 1KDQA 4JZ1A 3UIRA 2OINA 2A4OA 3EGKH 3F68H 1O3MA 1OXGA 1O3FA 1EKBB 2FEQH 2ZU1A 2ZU3A 1C5QA 3NXPA 2UUJB 4XOJA 3LU9B 1TA2A 4YO9A 4E05H 1AD8H 1QB1A 3UTUH 2ZQ2A 4YOGA 4I8KA 4FUDA 3MYWA 1HGTH 2P94A 1GCTC 1YLCA 1G3BA 1H9IE 1WQVH 3A7VA 1TABE 5DP5A 2A4RA 4D76A 2AIPA 5L6NH 2QF0A 4X6PA 2Z3CA 1GVKB 2ZPQA 1MH0A 3MFJA 3QZRA 1HPGA 4CHAB 3V12A 3HKJB 2A32A 7ESTE 1S0QA 1SGIB 3O8CA 4X6OA 5C3NA 4HFPB 4X2XA 5DP9A 1AB9B 1CT0E 7GCHF 3U69H 2JH0D 1F2SE 1FNIA 4AFQA 3DUXH 4OGYA 2ZU5A 1O2IA 3LIWA 1CGJE 1YPGH 1HAPH 2H9EH 3A7XA 1UCYK 2BOHB 1S83A 1CHOG 1WAYB 4DCDA 3D23A 1DPOA 5F8TA 2C8XB 1MMJN 1UVUH 1XMNB 1B5GH 4FUIA 1SBWA 4FUHA 2ALVA 3H5CB 4K69A 5HM2A 2WPLS 4OS2A 1P04A 4K5ZA 1TAWA 4XBDA 3TNSA 1O32A 1WTGH 3LJJA 4X1PU 1SGCA 3URCA 2FX4A 3A88A 1C5UA 2A2XH 4PROA 1F5RA 1GI1A 1C1UH 1YCPM 1T31A 2XBYA 1T8LA 1EXFA 1Z8JB 1J17T 1AZ8A 1Y3VA 1G37A 1QA7A 2PUXB 4WMEA 4CHAC 2PLXA 2HWLB 1BMLA 1TMTH 3KQCA 2ILNA 1AO5A 3UWIA 1F5LA 2F9NA 1GHZA 5HGGA 2ZDKA 2G81E 3M7TA 2XCFA 1O38A 1AB9C 3FZZA 1G30B 1SFQB 2ZKSA 2A7CA 1C2IA 3R0FA 2VU8E 4MNWA 1ZMLA 1TPSA 1C2JA 1O3CA 1OP2A 1GJ5H 1EATA 1MBMA 2Y5HA 3SGAE 1E38B 1C1NA 1DFPA 3SN8A 1NO9H 4I7YH 3HATH 2UWLA 1GBLA 2GP9B 4K1TA 4Z6AH 3A7YA 2QN5T 3LGUA 4HI3A 1O2HA 1C1WH 2PKAA 1HB0B 2ZGJA 1TBRH 4CRAA 1GL0E 1BTHH 1LQEA 1CHOF 4F4OC 1F0SA 2GZ8A 2SNWA 3S69A 2XNIA 2ZTZA 4YLUA 4AGKA 2B5TB 1LPGB 1W11U 3SQHE 1A5GH 1YLDA 3O8BA 1QB9A 1JRSA 1V2JT 1UTPA 4NCYA 2XRCA 4MPUA 1GMCG 1NRNH 1Z8GA 1EASA 4AFZA 1P01A 1GHXH 2P3TB 3SBKA 3U1JB 2GCTB 1MKXK 3KQEA 1EOJA 3RXTA 3ODDA 2IN2A 2ZGBH 1OWKA 4GLYA 4MVNA 5C1YA 1DWBH 5FBIA 1W7GH 4YT7H 1UTLM 4Y6DA 5F8XA 2J95A 4GCHG 1LVOA 4XBCA 4GUXA 2YNBA 1AIXH 3KQDA 4O03A 1YC0A 1OYTH 1C1PA 3M7QA 3ATWA 1LCYA 2OXSA 1T8NA 4DGJA 3RXKA 2J2UA 1QTFA 1Q3XA 1NFUA 1TGBA 2PR3A 4LOYH 5L2ZH 1LMWB 1GBMA 3A7WA 3PROA 2O9QA 4D9RA 1O0DH 1VZQH 2ZI2H 2ZG0H 1TNIA 3T27A 1D6RA 5JYIA 2FI3E 1ELAA 1GHBG 2EEKA 4MNVA 1ZZZA 2ZHFH 3ZZ4A 3PMBB 2BTCE 1XUJA 2W26A 1O2NA 3P8NA 2AS9A 1GWAA 1E0FD 1LVBA 2D2DA 1O39A 1HV7A 2GCTC 1TGSZ 3LPRA 2PKSB 4YT6H 2STAE 2BDIA 2AYWA 1AFQB 3VGCB 3M37A 1NS3A 2ZHEH 1FDPA 2ZA5A 4JZIA 1C2LA 3T62A 1W3CA 1AZZA 1ZHPA 1SGFA 3W95A 3GCTG 4DT7B 2HGTH 3TK9A 4BXWA 1T4UH 2A7HA 4BANB 1ABJH 2F9PA 2P3UB 4BAQB 1LVYA 4NA7A 2ZGHA 3U98H 4X6MA 4GCHF 2GT8A 1SHHB 1SQTA 2ZC9H 1ACBE 1P3CA 2BZAA 2ZFTA 1BA8B 1QA0A 1ZGIA 3ATIA 1Z1JA 1RTLA 2HNTC 4CBOA 3CP7A 1AFEH 3P95A 3PMJA 1S6HA 4ZXXH 4AB8A 1TFXA 1C5NH 3LGVA 2XBXA 4NIVA 3PWBA 2UUKB 2ZPSA 2Q6DA 2XYAA 1DUAA 2PKSC 1SG8B 4LXBH 1C5PA 1MKWK 3ZZ3A 1AFQC 1HAGE 1BRAA 3VGCC 3UY9A 1HAXB 1C9PA 3KGPA 1DE7H 2FOCA 2DUCA 2DE8A 3ZV8A 3MU8A 5JBBS 3K6YA 1O2VA 3SJOA 3B9FH 2J92A 2CF8H 1K1JA 4KTCA 3A86A 3RMNH 1KIGH 1YPMH 1RJXB 3NPSA 1HYLA 3P8FA 1P09A 1C2KA 3M5OA 3OTJE 2QYIA 2BXTH 3F9GA 3ZZ6A 1LPKB 2P59A 1G36A 2BD4A 1MTSA 3KHVA 2IJOB 1DY9A 9ESTA 1DXPA 1ABIH 3GY7A 1A5IA 1WBGB 1TOMH 1XUIA 2ZCHP 1DDJA 4I8HA 1ZGVA 1BJUA 3UNQA 2ZIQH 1NFWA 1O2WA 2VIQA 1W7XH 1QRXA 3E3TA 3BTKE 3TH3H 1E34B 4ZHMU 1O2JA 4AG1A 3WY8A 5LPEA 3TGIE 1AE5A 2Y82A 3KQBA 3T26A 1FJSA 1OX1A 1G2MA 2G52A 1AQ7A 2BVXH 1ZMNA 1RTKA 4FUGA 3A85A 1EP5A 4A6LA 1MQ6A 1NTPA 3RXLA 1W2KH 1NY22 1K28D 4JZDH 1TBQH 3HGPA 2BY6X 4XFQA 1XUHA 2H9TH 3BTQE 4ZKRU 3RXFA 1LVMA 4CRFA 3UR6A 2C3SA 3IG6B 1TNHA 1K22H 3TVJB 1O3LA 4A1TA 1HAIH 1KY9A 5HYOA 1OP0A 2BOKA 2ZGXH 1ANDA 2ASUB 2H2ZA 1O3KA 2O8MA 3PMHB 2EC9H 1O31A 1A1RA 1K1LA 3ZZBA 4MLFB 3FAOA 3M3TA 2FODA 1BTYA 1ANEA 2UWPA 4Y7AA 1F0TA 1ZPBA 3GCOA 2HLCA 4B2CA 4HZHA 1TPPA 5AFYH 2H1UA 2J34A 4YOIA 1DWDH 1GI8B 2TGTA 1EJAA 1FY5A 2Z7FE 2ODYB 1M9UA 2CHAB 1QURH 3CENA 3RXEA 4TPYA 4ABAA 1O35A 4ISLA 4DOQA 4XBBA 4K1SA 1C1MA 3VXEH 3BF6H 3MNBA 1V2PT 2C93B 5JBAS 1MQ5A 2SGAA 2RDLA 4WF8A 4HGCA 2CXVA 3UR9A 2BY9X 1L2EA 2VIWA 2GZ9A 3SV9A 4E7NA 2XBWA 5ESBA 3RM2H 1BBRH 1ELEE 1HDTH 2Z9JA 4H6TA 4U01A 1MD7A 2ZTYA 2ZF0H 4Y8YA 3MNCA 1P9SA 4A7IB 1ORFA 1FY4A 5EQSA 3VFEA 1TMBH 5DG6A 3RXUA 3MU5A 3QLPH 2G55A 1XUFA 2A5AA 2RG3A 2GMTB 1H8IH 2VVUA 1C5RA 2GDEH 2FX6A 1SLUB 3GDSA 1GPZA 2WPMS 1AKSB 3U8RH 2FI5E 4X2YA 4YTAA 2BLVA 1HJ9A 4A1XA 1O5EH 5I46H 3HK6B 1AKSA 3DA9B 3NCLA 2ZDAH 3LC5A 1GHWH 1F0UA 1C5VA 1TYNA 2VGCB 3S9CA 4ISNA 4NSYA 2Z9LA 2CHAC 1FQ3A 3RXHA 5LPFA 4TWWA 3ZZ5A 3FANA 1ELFA 4NGAH 1HNEE 4XE4A 2BQ7B 2GZ7A 2ZFPH 1DX5M 3HPTB 1HIAB 3FP7E 2WYGA 2GVFA 2ZECA 1DWEH 3HKIB 2OLGA 5GJ4B 1E35B 1YPHE 3ODFA 1PQ8A 2BMGB 3EYDA 1GHAF 3BTEE 3HGNA 4CR9A 3TH2H 1TA6A 1LDTT 2ZPRA 1TRNA 3MI4A 2HPQH 2BDBA 1QQ4A 3JZ1B 1UK4A 1O5DH 3RXRA 3MH4A 3TITA 1C5WB 4KGAA 4FVBA 4R0IA 1EUFA 7LPRA 2GMTC 1J15A 1QBVH 4IMZA 3MNSA 2ODPA 1SHYA 4NA9H 1HAHH 1N8OB 1IQIA 1UTOA 3LJOA 4Q80A 1GMHG 3FFGA 1ELVA 1S6FA 2WUCA 3MU0A 4ZHAA 3E91A 1N6YA 1PPZA 3VEQB 1L4DA 2VGCC 4B2BA 1C5SA 2CV3A 1XUKA 2QGRA 4MNYA 1GI0A 1HBTH 1TNJA 3T2NA 5E0JA 3MU1A 4JZEH 1TGNA 2BVRH 3GY5A 1L1JA 2HVXA 1YBWA 3RC5A 1IQLA 2J4IA 5CMXH 2XXLA 2F83A 1ZYOA 3ZV9A 1GDQA 1HAVB 1HCGA 1KXCA 3SV6A 2GDDA 1YKTA 3BTGE 1GBFA 1HAVA 3R3GB 1EB1H 1G9IE 1EOLA 3NWUA 4Y10E 2V3HH 4I8GA 2QXHA 4K8BA 1WSSH 3MWIU 1SLWB 4INKA 4AYYB 1P2IA 2ZQ1A 2BZ6H 1EZQA 1L4ZA 3UQVA 2SNVA 3U9AH 1S0RA 1PQAA 3S7KB 3GY4A 1OOKB 1O36A 4AFSA 9LPRA 3ATKA 2O8UA 1BMMH 1BB0B 1P3EA 5DP8A 1A3EH 5H4IB 1PPHE 1N8OC 3SU4A 5A8XA 1Y3UA 4X1RU 3TLOA 2AGEX 2GKVE 2FTLE 1GJAB 2ZNKH 4H6SB 4YOJA 2BY5X 1GJBB 1ZTKA 3I77A 2NU1E 2R0KA 2BY7X 4I8JA 2CGAA 5C2ZA 4BTUB 4INHA 2VWLA 1GI5A 1BITA 2BVSH 1GMHF 1O3AA 3M3SA 4ZHLU 1VGCB 1GBTA 4YZUA 4ZKSU 5EODA 3KEEA 5LH8A 2A31A 2BDGA 3VB7A 5ESTE 1NRRH 1QL9A 1DUEA 2LPRA 1S81A 1FXYA 1DT2A 4RN6A 4Y7BA 1GHVH 4UEHH 1TQ0B 4NWLA 1EB2A 4WH6A 2G00A 1NROH 1W8BH 4ABGA 2WV5A 3SI4H 4ABEA 3PV4A 2W7UA 2TPIZ 4X1QU 1FY3A 1BTWA 1ZOMA 1C2EA 2H5CA 3SW2B 3RC4A 3RXPA 1K21H 2BQWB 3E90B 3OU0A 2ANYA 2V6NA 2FOAA 4GAWA 4GPGA 3SU0A 4D9QA 2XC0A 3F1SB 2VH0A 1MU8B 2H5DA 2W7SA 2QV1A 3L6PA 4CRGA 2XWAA 1T7CA 3LC3A 2V3OH 3SNAA 2BD8A 3ZZ8A 3ZZ7A 3NZIA 3ATMA 1BRUP 1C4Y2 4LZ1H 3BG4B 1PPBH 5FPSA 1VCPA 1UK2A 1VGCC 2ZFQH 1WCZA 3L33A 4B76A 4MNXA 4X8VH 1SOTA 3PLPA 2Q1JA 4ZKOU 3ELAH 5C20A 1SGQE 1A3BH 1TMUH 5F03A 5J4SA 2SGPE 4B1TA 3EA9A 1DLKB 3SV8A 1P02A 2QCYA 3ITIA 3ZZDA 3SU2A 4DVAU 3DD2H 2PKAB 3MTYA 3S9BA 3RUOA 2FOMB 1MBQA 1KLIH 5TCCA 1VJ9U 2C8ZB 2OQ5A 5EOKA 2G51A 3SQEE 2C8YB 1LKAA 1DSTA 4NFEA 4ABIA 1C5YB 4Z0KA 4U30A 1O3JA 2QC2A 1IQEA 2J9NA 1Y5UT 4XDEA 1SGFG 1LTOA 2VVVA 4WH8A 1UTKA 1GJ6A 4D7FA 1CGIE 2G4UA 2JETB 1TPOA 4YLQH 2ANWA 1O37A 4I8LA 2R3UA 2BDHA 3C1KA 2Z6BD 3RMOH 2QAAA 4OS5A 2G5VA 2FO9A 1VCWA 5EPYA 4O3UA 1C9TA 1RD3B 2XCNA 1JRTA 3O8DA 3GCNA 2AGIX 3BTME 5FBEA 2ZHWH 1HUTH 1GGDB 1FLEE 1L0ZA 1SLVB 4NG9H 1TIOA 2GGVB 3F6UH 1W13U 1YPJH 3KL6A 3BSQA 5AHGH 1XVOA 2W3IA 1GDNA 3A89A 4AGJA 2F9UA 1NC6A 2PV9B 4CREA 2Z3DA 4HTCH 3UWJH 1K1PA 1S82A 1SGPE 3MO6A 2VINA 2FOEA 3M35A 4FU9A 4IC6A 5EW2H 1O34A 3BTTE 4ISHH 5E2OA 1UVPA 4OS6A 2SFAA 1GI2A 2ZFSA 2V35A 4DJZB 1BMAA 4X1SU 1CT4E 1GI7B 2HNTF 2I6SA 2VNTA 3U8OH 1G3CA 2EA3A 1P2QA 4MG3A 3AW0A 3A81A 2FYRA 1GJ7B 3SU3A 2JETC 1ZRBA 1XXDA 5SGAE 1AWFH 4FUFA 5GWZA 6CHAB 3K9XB 1W12U 3M5MA 1WUNH 4GHQA 2THFB 3JZ2B 1Y3XA 3AAVA 1BRCE 4KP0A 2W5EA 3PTNA 2D8WA 2F91A 5T6FA 3M7UA 5A09A 3A7TA 4IC5A 4MTBA 2Y81A 2BX4A 4Y8ZA 1WQSA 1TONA 3SHCH 5K0HA 1AMHA 2BDAA 1GBJA 1P0SH 1PPCE 1GGDC 1KTTB 3UOUA 2VWOA 1MTWA 2TGPZ 1BHXF 3E0PB 5GCHF 2Z3EA 2BD3A 1DVAH 3VB4A 4ZMAH 1ESBA 2VWMA 3DHKH 1FY8E 1YPHC 2BD5A 3SO3A 1RIWB 1S5SA 2ZDNA 4KTUA 4WMDA 4K3JA 1O5FH 2BB4A 3BTFE 2V0BA 1SQOA 1BHXB 3MO3A 5HMAA 5DGJA 4A92A 3F9HA 2EI8A 5A0AE 2FS9A 1YPKH 3ZYDA 1D3QB 1GBHA 1RXPA 3V13A 3GY8A 1BBRE 1YP9A 1FAXA 1AUTC 3GICB 2RCEA 3A80A 4BTIB 3F9EA 3VXFH 3BTDE 4A5TS 1O5BB 4B2AA 2ZCLP 5FX5A 2Z9GA 1NRSH 1XXFA 5AVDA 4ISOA 1OS8A 3AVZA 5E2PA 1DM4B 5EG4A 3M3VA 1D3TB 2Q6GA 1IHSH 4Y0YE 1C2MA 2XW9A 6CHAC 8LPRA 3TNTA 1QL8A 1Q2WA 1P05A 5DO4H 5EU8A 1EJNA 1ANCA 3QDZB 4AN7A 1PYTD 2VVCA 1QNJA 3A87A 3U8TH 2RA3A 1FIWA 2ESTE 2WV4A 3Q3YA 2FESH 2QIQA 4FUJA 3QN7A 3M5NA 4DIIH 2Q6FA 1KTSB 1VITF 1RIWC 4CRCA 5EXNA 3LGTA 3H7OA 2WYJA 2UUFB 2ZGCA 1RFNA 3RU4D 2P8OB 1THSH 1C5TA 4K2YA 1NFXA 2ZFRH 2TGDA 1GL1A 1ZHRA 1NU7B 3PTBA 2LNCA 2HPPH 1THPB 2C90B 1WYKA 1DOJA 1UJ1A 2PSYA 3MHWU 7KMEH 3SHAH 3SNDA 3CS7A 2IPHA 1T8MA 2OBQA 1GBBA 2NU3E 1QBNA 2B0FA 2B9LA 4MQAA 1QJ6B 1A46H 4K60A 1FIZA 1V2RT 3VB5A 1B0EA 1NT1A 1TGCA 1F5KU 3Q77A 3SUFA 2I6QA 1ZHMA 4ABHA 4UE7H 2F9VA 1MU6B 1FN8A 1SFIA 1YF4A 3PLKA 5DP3A 5FX6A 2FM2A 3PO1B 2FLRH 1N1LA 1O3BA 3SORA 1NU9A 1C1SA 1ZMJA 2CN0H 1FY1A 3RM0H 2P95A 3SGQE 3LH1A 1CBWB 2FIRH 5C1XA 1Z8RA 3PM3A 1LHGH 2C8WB 1JOUB 1O2ZA 1UK3A 3MNXA 8KME2 1RTFB 1MTUA 5FHTA 3ZVAA 2O8WA 2P8OC 2FDAA 1O2GH 3A7ZA 4X1NU 2VJ1A 1P2JA 1IQGA 3SUDA 3LH3A 5FPTA 3L3TA 1C2HA 1JMOH 1NZQH 1KLJH 3KN2A 3V0XA 1K1OA 1OSSA 1C1QA 1KXEA 1C2GA 1A2CH 3RXBA 1B7XB 1BJVA 2YOLA 1O5AB 1TLDA 1WOFA 2VB0A 1V2KT 2OC1A 2R2MB 1ELDE 4O3TA 1GI6A 3OYPA 2QF3A 4Y79A 3MOCA 1A61H 1P11E 1Z7KA 1UCYH 2XTTB 4ZH8A 2SGDE 1EZUC 2TIOA 1AU8A 2FWWA 3PO1C 3VB3A 3RLWH 1IAUA 3TJVA 3Q00A 4LZ4B 1GJDB 2TBSA 1QJ7B 1CBWC 1ZTLA 3QGNB 1BTXA 4UFGH 2F9OA 4Y0ZE 1GHAG 6LPRA 4CH8B 5IDKA 5AF9H 1IOEA 1TNKA 1ETSH 2BHGA 1QRWA 1TX8A 1G3DA 3SJ8A 4AORA 1TX7A 4ZKNU 4TYDA 3ZVBA 4SGAE 3Q76A 2P93A 4U2WA 4NIYA 4YM9A 1TRMA 1X7AC 1Z8IB 1V2OT 1ZPCA 2SGQE 4Q7YA 5C1UA 1ZSLA 1Z6EA 1OWJA 2WPIS 1P2NA 1W14U 1HAZB 5L2YH 1O2SA 2GX4A 4AFUA 2HRVA 3UREA 1GG6B 2AH4X 2AFQB 1GDUA 2ZCKP 1MTNB 3E6PH 1QB6A 1L1GA 1BIOA 1GCDA 2AERH 8GCHG 1UTMA 4AYVB 4MPVA 4X8TH 5A8YA 4ZROA 3Q3XA 4IW4E 1EP6A 3BG8A 3E16B 1P12E 4ZUHA 1GBKA 2WPJS 2Y6TA 1TALA 4Y71A 3PWCA 4NIWA 1OWEA 1QQUA 5FCKA 2F3CE 3A82A 2ZWLH 1V2VT 1PQ5A 1HAYB 1UTQA 1K2I1 2A5IA 5F6MA 3BEUA 1QBOA 2FZZA 5FCRA 3T5FH 5T6DA 2AMPA 1H9HE 1GBEA 3PLBA 3GDUA 3O8RA 4IGDA 4GVUA 1IQMA 1FMGA 1C5XB 3BN9A 1YCPK 4U32A 1C1RA 1SMFE 1INCA 1XUGA 1Z1IA 4MDSA 1O3PB 1A0JA 2HOBA 1H9LB 4UFDH 5E8EH 5K7RA 1EPTB 2XC4A 2ZHDA 2FMJA 1GBDA 4FXGH 1MKXH 1ZSKA 1SOZA 2DE9A 1EPTA 1ESAA 1GG6C 1IQKA 1RGQA 1ZSJA 1MUEB 4TWYA 1P03A 5JB8S 2H6MA 2BY8X 4ZAEA 2OC8A 1HJ8A 1MTNC 1O5CB 1FUJA 1QL7A 4JCNA 1V2ST 1ZLRA 3P70B 4SGBE 1F0RA 1NN6A 2OP9A 1ELCA 2Y5FA 4J2YB 2NU2E 1KXFA 4IN2A 3MO9A 1BTUA 4KELA 1W10U 5TJXA 4X2WA 3D49H 1EAWA 3GY6A 2PW8H 1XVMA 1C2DA 3QZQA 1ESTA 2GV7A 1MAXA 3BIUH 2FLBH 3SNCA 4A1VA 4BAHB 8GCHF 3S7HB 4TY7A 2QXGA 1GBCA 4R8TB 4THNH 2PHBA 2WUBA 3ZZAA 1H4WA 2BLQA 3ZZ9A 3GCHB 3GY2A 4K8YA 2PTCE 3FZDA 1O3NA 2IOTA 1LHDH 1YYY1 1OWDA 2G4TA 1G3EA 1LO6A 1LQDB 3RLYH 3SUEA 1DLEA 1HJAB 1P57B 1SGRE 4UFEH 4NWKA 1EPTC 3RU4T 2JKHA 3LDXH 1VR1H 4B71A 5A0BA 4Y8XA 1TNLA 4UONA 4UDWH 2XWBI 2Y7XA 4OS1A 1DS2E 2ANMH 2P3FH 2PSXA 5DKMA 2EI7A 4ASHA 3LGWA 4WMFA 1UMAH 4FVDA 1KXDA 4TPIZ 1FPHH 3G01A 1C4U2 4GHTA 2A45B 1K9OE 3A8CA 3ZYEA 1TGTA 1BRBE 1TQ7B 3M61U 4UFFH 1TNGA 3P17H 2D26C 2ZHQH 1DWCH 3RXMA 3KF2A 2ZTXA 5DJ7A 1AHTH 1O3OA 4AOQA 1BTZA 4Q7ZA 1TOCB 4F49A 5LPRA 2ZEBA 1WTHD 5FPYA 1W0ZU 5ABWA 1SLXB 2JH6D 2OTVA 1MCTA 5C5NA 1SB1H 5EW1H 1O30A 2VIOA 1J8AA 3GCHC 1O2KA 2R0LA 3ZVEA 2Y5GA 3TK5A 3IITA 1BT7A 4D7GA 3CS0A 2YNAA 1JWTA 1KYNA 2ZP0H 1EZXC 1C1VH 1A4WH 1MZAA 1S85A 2ODQA 1HJAC 1AUJA 4AZ2B 1O33A 1SQAA 4AB9A 3RP2A 3UOPA 1MKWH 1WU1A 5GPIB 4WXIA 1DANH 2OUAA 5EPNA 5A2MH 2B8OH 1Y5AT 1MZDA 3QO6A 3K65B 1FPCH 2BDYA 1O5GH 2FOBA 3LT3A 4IS5A 3E1XB 2O8LA 2PFEA 1GI9B 2VIDA 3ZVGA 6GCHF 1V2WT 3BV9B 1QGFA 4INLA 5I25A 5JPMH 3OY6U 3A8AA 4OS7A 1CGHA 2G8TA 1UVTH 3SJIA 1J16A 4BOHA 2BD7A 3T28A 4CBNA 3MMGA 3GYLB 1Q31A 3RXCA 3LONA 3DFLA 1Y3YA 4X0WU 1Z6JH 1QR3E 2XBVA 1TX6A 2Y80A 1MD8A 1GI4A 2OCVB 3PYHA 3URDA 1V2TT 2FYQA 1THRH 4H42U 4Y76A 2CJIA 2ZDMA 1UO6A 1ZJDA 1T4VH 2C4FH 1QJ1B 2ZU2A 5B6OA 1SPJA 1BBRK 2A7JA 3SJ9A 3QTVH 5EQQA 1C2FA 2PTNA 5FAHA 1E36B 1EX3A 3BTHE 3LGIA 4JK5A 2H9HA 2BYAX 5T6GA 1ARCA 5T3HA 1BQYA 1P9UA 4NSVA 4FUCA 2Z9IA 4AG2A 1NFYA 3M5LA 4XSKU 3D65E 2WPHS 1C5OH 1FAKH 3Q3KA 3LKWA 1O3EA 2UUYA 1OYQA 4DURA 4DY7B 1O3HA 2J94A 3KCGH 1GHYH 5L30H 5GCHG 1O2YA 3GDVA 2FI4E 3C27B 4BAMB 1EAUA 2SGFE 3QUMP 2ZZUH 4I31A 1DICA 1BMNH 5FXLA 3BG4C 1DXWA 2OQUA 1L1NA 4TY6A 4CRBA 1GMDG 4WJG2 3DFJA 1DSUA 1BCUH 1XKBC 3SI3H 3RXJA 4X8SH 1O2MA 1P2KA 1WV7H 4NZQA 1CA0B 1T32A 1C5MD 3QWCH 2BD9A 5EXMA 1BUIA 1H1BA 5GDSH 1GBIA 1W0YH 4E7RG 4WWYA 1J14A 3EA8A 3I78A 3GOVB 3FP6E 2RA0A 3TPIZ 3DT0H 3OSYA 3D62A 3QK1A 4JZFH 4IMQA 3P92A 4X6NA 1MTVA 1JIMA 1SGDE 1UTNA 3M36A 3EDXB 4BNRA 2FOGA 3A84A 3RXDA 1QHRB 5DP7A 3RU4E 1CA8B 4FU7A 4WVPE 1UCYE 3B23B 1O2QA 2K1QA 5LGOA 1FONA 4BTTB 2SGEE 1NPMA 3V7TA 1VITG 1TRYA 3KNXA 3HK3B 1V2LT 1AY6H 4RKJB 2BQ6B 5IYTA 5HM9A 3K2UA 1V3XA 1MAYA 2WPKS 4MPXA 4Y11E 2R9PA 1ELBA 1SL3A 1O2TA 2AEIH 2FTMA 3SV2H 3ESTA 1PPFE 3RXSA 1ZTJA 1G2LA 3BEFB 3SU6A 3UFAA 3ENSB 1CA0C 2A2QH 4BXSA 1YPEH 3GY3A 5GIBA 4NA8A 5JBCS 5F8ZA 1CT2E 5EQRA 1ANBA 1GVZA 1GMDF 3I29A 4ABFA 1AVWA 3ATLA 5HXFA 2P16A 4X8UH 1D3DB 1GMCF 3A8DA 4B74A 3FP8E 2FOHA 1NRPH 1LPZB 6ESTA 1JIRA 2Z9KA 1VCQA 3UNSA 3N7OA 5A0CA 1CU1A 2ZU4A 1IQHA 1D3PB 2XC5A 3RXQA 2FS8A 1KXBA 1IHTH 1OKXA 1YCPH 1VITH 2BD2A 3RMMH 1EQ9A 4M7GA 1YPLH 3SOSA 4D8NA 2BLWA 3SNEA 1GJ4H 1NRQH 1SI5H 3W94A 1PQ7A 3AASA 1HAOH 3RXOA 1AVGH 4CH2B 4KKDA 2PUQH 1Y8TA 2ZFFH 1YM0A 1O3GA 1P10A 1SGTA 3SUGA 1C1TA 2PGQB 1TB6H 1LKBA 4B73A 1TWXB 1LHFH 1JXPA 4ABJA 5C5OA 1QRZA 1H8DH 1VJAU 1T8OA 2STBE 8ESTE 1AI8H 1AE8H 3RXGA 2M5TA 5C67A 1HXEH 3SZNA 2GV6A 1O2UA 1NESE 3BIVH 1GHBF 2AGGX 3TGKE 2AMDA 1Y5BT 2NU4E 1O2XA 1MCVA 2CF9H 1SGNE 3RMLH 1ETTH 2R3YA 4AX9H 1F92A 2A0QB 1GBAA 1O2PA 1ZJKA
chains in the Genus database with same CATH superfamily
1DY8A 1UVSH 1EJMA 2ANKH 1GI3A 3NKKA 1O2RA 4NIXA 4DG4A 2ULLA 2GCHG 1O3DA 3A8BA 1A7SA 1O2LA 4KTSA 4ESTE 1EAIA 1AGJA 1KLTA 4OS4A 3EQ0H 3RXIA 2OC7A 3AW1A 3KQ5A 4YESB 2VIPA 5DPAA 1G32B 5CDFE 1GJ8B 2NWNA 1EAXA 1HXFH 1K0HA 4ABDA 3F9FA 4IN1A 5EXLA 1XM1A 2R2WU 3GCTF 3TK6A 3ZZCA 1A5HA 5BPEA 3VPKA 3TIUA 3PB1E 2VWNA 2Z94A 1SSXA 3T25A 3LGYA 1C4V2 4NFFA 1V2UT 2GT7A 3SU1A 2NU0E 1SGYE 1KXAA 1TBZH 2EQNA 3B8JA 1K1MA 3VB6A 1E37B 1V2QT 2WINI 5TCAA 3T29A 2OD3B 1O3IA 2F9BH 2VH6A 1GJCB 2PP6A 1UVOA 4FU8A 2D1JA 1W0KD 4UD9H 1CQQA 1UHBB 4JK6A 4VGCB 1PJPA 2JH5D 4ABBA 4RT0A 5CE1A 2ALPA 1GVLA 1C5LH 1DITH 1UHBA 3TJUA 4E06H 4RKOB 1PFXC 3E0NB 2CMYA 3BEIB 1FN6A 5JBTA 2Y7ZA 3OTPA 3QX5H 3RDZA 1CO7E 3SU5A 2GTBA 1ETRH 3MH6A 3S9AA 2A1DB 3SGBE 1BTPA 3E8LA 4FUBA 3BTWE 2QA9E 1Y59T 3FVFB 2BDCA 4ISIH 4I33A 1K1NA 3WW7A 2GCHF 2OC0A 3EA7A 1EZSC 1IQNA 1RS0A 2EI6A 4FUEA 3H7TA 3EE7A 2QXJA 1BZXE 1D9IA 2FXRA 2OBOA 3P8GA 1V6DA 3UUZA 3FO8D 1CHGA 3SV7A 2QXIA 1C1OA 1CVWH 5E0HA 3SJKA 3NUMA 3UQOA 1Y3WA 3TJOA 1TE0A 5ETXA 1KMHB 2G5NA 3P8OA 2ZO3H 5CHAB 3ZVFA 2BXUH 1KSNA 1TPAE 5GXPA 4Q7XA 5AFZH 4LK4A 4X2VA 2J38A 4WXVA 1D6WA 2BM2A 5G4BA 4O97A 3MH5A 4JMYA 1CSOE 3UNRA 2B7DH 1ELTA 4DIHH 1P8VC 1FI8A 1XKAC 4VGCC 1PPGE 1P2MA 3ZVDA 1OWIA 4CRDA 1B0FA 3SNBA 1QIXB 1AVXA 4ASUD 5DK1A 4JYUH 4NZLA 1HLTH 4K1EA 1ZPZA 1OP8A 1AN1E 2AMQA 5T1VA 2KAIB 3EE0B 1D4PB 3W1EA 1CE5A 3RXVA 1FZZA 2A4QA 1OPHB 3TH4H 1FV9A 3TJNA 2KAIA 1HRTH 2ZDLA 1PPEE 2W3KA 4CR5A 2BX3A 5J4QA 4J1YA 2FOFA 5DP6A 4H4FA 1PYTC 1BDAA 2V3MA 5HKKD 3U1IB 1AWHB 1YGCH 3KIDU 2J5UA 5CHAC 5JDUB 3P6ZB 3LOXA 3RC6A 1P06A 1ARBA 4JYVH 3OAAD 1UTJA 1SGEE 1P2OA 1IQFA 3MU4A 1ELGA 3ZVCA 3STIA 3GISB 3MH7A 3QTOH 3IWMA 2TRMA 1Z71A 4HG6A 1QCPA 4JYTA 2QY0B 1QY6A 1F7ZA 1SR5C 1J9CH 4DW2U 1N6XA 5PTPA 3QGJA 1OWHA 4RSPA 1SC8U 4Q2KA 2ZDVH 2A5KA 1HIAA 2FP7B 3PMAB 4OGXA 1ID5H 5E0GA 2FPZA 1YY3A 3V3MA 2TGAA 2VIVA 3STJA 4ZXYH 1JBUH 4BAKB 4GSOA 3TGJE 1A0LA 2UWOA 1U6QA 2AIQA 2PGBB 3NK8A 4QT8C 1LHEH 5EGMA 4B6EA 1C5ZB 2PWXA 1XX9A 1QFKH 1RRKA 1A0HB 1GCTB 1S84A 2A4GA 4B75A 1GJ9B 1V2MT 4WY3A 1ZRKA 1NM6A 3S0NA 1BOQA 4O9VA 7GCHG 4MPWA 1K1IA 2HALA 3A83A 5DP4A 1HFDA 3AAUA 3GYMA 1ZR0A 3TU7H 1SVPA 2HNTE 3OY5U 2WHXA 1OHHD 5BRRE 2BLOA 2O8TA 3EAJA 1LHCH 1KDQB 4IBLH 1IQJA 1O2OA 3F2HA 3K6ZA 6GCHG 1V2NT 3UPEA 5JB9S 2GD4B 3RXAA 3OX7U 4I32A 4BAOB 5A8ZA 1KDQA 4YXWD 4JZ1A 3UIRA 2OINA 2A4OA 3EGKH 3FN8A 2JJ1D 2RFKC 1BMFD 3F68H 1O3MA 3UB0A 1OXGA 1O3FA 1EKBB 2FEQH 2ZU1A 2ZU3A 1C5QA 3NXPA 2UUJB 4XOJA 3LU9B 1TA2A 4YO9A 4M9FA 4E05H 1AD8H 1QB1A 3UTUH 2ZQ2A 4YOGA 3PRDA 4I8KA 4FUDA 3MYWA 1HGTH 2P94A 1GCTC 1YLCA 1G3BA 1H9IE 1WQVH 3A7VA 1TABE 5DP5A 2A4RA 4D76A 2AIPA 5L6NH 2QF0A 4X6PA 2Z3CA 1GVKB 2ZPQA 1MH0A 3MFJA 3QZRA 1HPGA 4CHAB 3V12A 3HKJB 2A32A 7ESTE 1S0QA 1SGIB 3O8CA 4X6OA 5C3NA 4HFPB 4X2XA 5DP9A 1AB9B 1CT0E 7GCHF 3U69H 2JH0D 1F2SE 1FNIA 4AFQA 3DUXH 4OGYA 2ZU5A 1O2IA 3LIWA 2J98A 1CGJE 1YPGH 1HAPH 2H9EH 3A7XA 1UCYK 2BOHB 1S83A 1CHOG 1WAYB 4DCDA 3D23A 1DPOA 5F8TA 2C8XB 1MMJN 1UVUH 1XMNB 1B5GH 3KYGA 4FUIA 1SBWA 4FUHA 2ALVA 3H5CB 4K69A 5HM2A 2WPLS 4OS2A 1P04A 4K5ZA 1TAWA 4XBDA 3TNSA 1O32A 1WTGH 3LJJA 4X1PU 1SGCA 3URCA 2FX4A 1EFRD 3A88A 1C5UA 2A2XH 4PROA 1F5RA 1GI1A 1C1UH 1YCPM 1T31A 2XBYA 1T8LA 1EXFA 1Z8JB 1J17T 2KR7A 1AZ8A 1Y3VA 1G37A 1QA7A 2PUXB 4WMEA 4CHAC 2PLXA 2HWLB 1BMLA 1TMTH 3KQCA 2ILNA 1AO5A 5C94A 3UWIA 1F5LA 3OEHD 2F9NA 5HIZA 1GHZA 5HGGA 2ZDKA 2G81E 3M7TA 2XCFA 1O38A 1AB9C 3FZZA 1G30B 1COWD 1SFQB 2ZKSA 3KYFA 2A7CA 1C2IA 3R0FA 2VU8E 4MNWA 1ZMLA 1TPSA 1C2JA 1O3CA 1E1QD 1OP2A 3OFND 1GJ5H 1EATA 1MBMA 2Y5HA 3SGAE 1E38B 1C1NA 1DFPA 3SN8A 1NO9H 4I7YH 3HATH 2UWLA 1GBLA 2GP9B 4K1TA 4Z6AH 3A7YA 2QN5T 3LGUA 4HI3A 1O2HA 1C1WH 2PKAA 1H8HD 1HB0B 2HLDD 2ZGJA 1TBRH 4CRAA 1GL0E 1BTHH 1LQEA 4XD7D 1CHOF 4F4OC 1F0SA 2GZ8A 2SNWA 3S69A 2XNIA 2ZTZA 4YLUA 4AGKA 2B5TB 1LPGB 1W11U 3SQHE 1A5GH 1YLDA 3O8BA 1QB9A 1JRSA 1V2JT 1UTPA 4NCYA 2XRCA 4MPUA 1GMCG 1NRNH 1Z8GA 1EASA 5CHBA 4AFZA 1P01A 1GHXH 2P3TB 3SBKA 3U1JB 2GCTB 1MKXK 3KQEA 1EOJA 3RXTA 3ODDA 2IN2A 2ZGBH 1OWKA 4GLYA 4MVNA 5C1YA 1DWBH 5FBIA 1W7GH 4YT7H 1UTLM 4Y6DA 5F8XA 2J95A 4GCHG 1LVOA 4XBCA 4GUXA 2YNBA 1AIXH 3KQDA 4O03A 1YC0A 1OYTH 1C1PA 3M7QA 3ATWA 1LCYA 2OXSA 1T8NA 4DGJA 3RXKA 2J2UA 1QTFA 1Q3XA 1NFUA 1TGBA 2PR3A 4LOYH 5L2ZH 4RI0A 1LMWB 1GBMA 3A7WA 4OM9A 3PROA 2O9QA 4D9RA 1O0DH 1VZQH 2ZI2H 2ZG0H 1TNIA 3T27A 1D6RA 5JYIA 2FI3E 1ELAA 1GHBG 2EEKA 4MNVA 1ZZZA 2ZHFH 3ZZ4A 3PMBB 2BTCE 1XUJA 2W26A 1O2NA 3P8NA 2AS9A 1GWAA 1E0FD 1SQRA 1LVBA 2D2DA 1O39A 1HV7A 2GCTC 1TGSZ 3LPRA 2PKSB 4YT6H 2STAE 2BDIA 2AYWA 1AFQB 3VGCB 3M37A 1NS3A 2ZHEH 1FDPA 2ZA5A 4JZIA 1C2LA 3T62A 1W3CA 1AZZA 1ZHPA 1SGFA 3W95A 3GCTG 4DT7B 2HGTH 3TK9A 1YLNA 4BXWA 5HIYA 1T4UH 2A7HA 2JIZD 4BANB 1ABJH 2F9PA 2P3UB 4BAQB 1LVYA 4NA7A 2ZGHA 3U98H 4X6MA 2W6ID 4GCHF 2GT8A 1SHHB 1SQTA 2ZC9H 1ACBE 1P3CA 2BZAA 2ZFTA 1BA8B 1QA0A 1ZGIA 3ATIA 1Z1JA 1RTLA 2HNTC 4CBOA 3CP7A 1AFEH 3P95A 3PMJA 1S6HA 4ZXXH 4AB8A 1TFXA 1C5NH 3LGVA 2XBXA 4NIVA 3PWBA 2UUKB 2ZPSA 2Q6DA 2XYAA 1DUAA 2PKSC 1SG8B 4LXBH 1C5PA 1MKWK 3ZZ3A 1AFQC 1HAGE 1BRAA 3VGCC 3UY9A 1HAXB 1C9PA 3KGPA 1DE7H 2FOCA 2DUCA 2DE8A 3ZV8A 3MU8A 5JBBS 3K6YA 1O2VA 3SJOA 3B9FH 2J92A 2CF8H 1K1JA 2OK5A 4KTCA 3A86A 3RMNH 1KIGH 1YPMH 1RJXB 3NPSA 1HYLA 3P8FA 1P09A 4B6FA 1C2KA 1WXRA 3M5OA 3OTJE 2QYIA 2BXTH 3F9GA 3ZZ6A 1LPKB 2P59A 1G36A 2BD4A 1MTSA 3KHVA 2IJOB 1DY9A 9ESTA 1DXPA 1ABIH 3GY7A 1A5IA 1WBGB 1TOMH 1XUIA 2ZCHP 1DDJA 4I8HA 1ZGVA 1BJUA 3UNQA 2ZIQH 1NFWA 1O2WA 2VIQA 4AC9A 1W7XH 1QRXA 3E3TA 3BTKE 3TH3H 1E34B 4ZHMU 1O2JA 5FL7D 4AG1A 2VBCA 3WY8A 5LPEA 3TGIE 1AE5A 2Y82A 3KQBA 3T26A 1FJSA 1OX1A 1G2MA 2G52A 2WSSD 1AQ7A 2BVXH 1ZMNA 1RTKA 4FUGA 3A85A 1EP5A 4A6LA 1MQ6A 1NTPA 3RXLA 1W2KH 1NY22 2CK3D 1K28D 4JZDH 1TBQH 3HGPA 2BY6X 4XFQA 1XUHA 2H9TH 3BTQE 4ZKRU 3RXFA 1LVMA 3F0PA 4CRFA 3UR6A 2C3SA 3IG6B 1TNHA 1K22H 3TVJB 1O3LA 4A1TA 1HAIH 1KY9A 5HYOA 1OP0A 2BOKA 2ZGXH 1ANDA 2ASUB 2H2ZA 1O3KA 2O8MA 3PMHB 2EC9H 1O31A 1A1RA 1K1LA 3ZZBA 4MLFB 3FAOA 5C0TA 3M3TA 2FODA 1BTYA 1ANEA 2UWPA 4Y7AA 1E1RD 1F0TA 1ZPBA 3GCOA 3PV5A 2HLCA 4B2CA 4RT1A 4HZHA 1TPPA 5AFYH 2H1UA 2J34A 4YOIA 1DWDH 1GI8B 2TGTA 1EJAA 1FY5A 2Z7FE 2ODYB 1M9UA 2CHAB 1QURH 3CENA 3RXEA 4TPYA 4ABAA 1O35A 4ISLA 4DOQA 4XBBA 4K1SA 1C1MA 3VXEH 3BF6H 3MNBA 1V2PT 2C93B 5JBAS 1MQ5A 2SGAA 2RDLA 4WF8A 4HGCA 2CXVA 3UR9A 2BY9X 1L2EA 2VIWA 2GZ9A 3SV9A 4E7NA 2XBWA 5ESBA 3RM2H 1BBRH 1ELEE 1HDTH 2Z9JA 4H6TA 4U01A 1MD7A 2ZTYA 2ZF0H 4Y8YA 3MNCA 1P9SA 4A7IB 1ORFA 1FY4A 5EQSA 3VFEA 1TMBH 5DG6A 2RDEA 3RXUA 3MU5A 3QLPH 2G55A 1XUFA 2A5AA 2YMSD 2RG3A 2GMTB 1H8IH 2VVUA 1C5RA 2GDEH 2FX6A 1SLUB 3GDSA 1GPZA 2WPMS 1AKSB 3U8RH 2FI5E 4X2YA 4YTAA 2BLVA 1HJ9A 4A1XA 1O5EH 5I46H 3HK6B 1AKSA 2J97A 3DA9B 5EJ1A 3NCLA 2ZDAH 3LC5A 1GHWH 1F0UA 1C5VA 1TYNA 2VGCB 3S9CA 4ISNA 4NSYA 2Z9LA 2CHAC 1FQ3A 3RXHA 5EIYA 5LPFA 4TWWA 3ZZ5A 3FANA 1ELFA 4NGAH 1HNEE 4XE4A 2BQ7B 2GZ7A 2ZFPH 1DX5M 4TSFD 3HPTB 1HIAB 3FP7E 2WYGA 2GVFA 2ZECA 1DWEH 3HKIB 2OLGA 5GJ4B 1E35B 1YPHE 3ODFA 1PQ8A 2BMGB 3EYDA 1GHAF 3BTEE 1VKYA 3HGNA 3TH2H 4CR9A 1TA6A 1LDTT 4P00A 2ZPRA 1TRNA 3MI4A 2HPQH 2BDBA 1QQ4A 3JZ1B 1UK4A 2XOKD 1O5DH 3RXRA 3MH4A 3TITA 1C5WB 4KGAA 4FVBA 4R0IA 1EUFA 7LPRA 2GMTC 1J15A 1QBVH 4IMZA 3MNSA 1SHYA 2ODPA 4NA9H 1HAHH 1N8OB 1IQIA 4F55A 1UTOA 3LJOA 4Q80A 1GMHG 3FFGA 1ELVA 1S6FA 2WUCA 3MU0A 4ZHAA 3E91A 1N6YA 1PPZA 3VEQB 1L4DA 2VGCC 4B2BA 1C5SA 2CV3A 1XUKA 2QGRA 4MNYA 1GI0A 1HBTH 1TNJA 3T2NA 5E0JA 3MU1A 4JZEH 1TGNA 2BVRH 3GY5A 1L1JA 2HVXA 1YBWA 3RC5A 1IQLA 2J4IA 5CMXH 2XXLA 2F83A 1ZYOA 3ZV9A 1GDQA 1HAVB 1HCGA 1KXCA 3SV6A 2GDDA 4ACBA 1YKTA 3BTGE 1GBFA 1HAVA 3R3GB 1EB1H 1G9IE 1EOLA 3NWUA 4Y10E 2V3HH 4I8GA 2IJD1 2QXHA 4K8BA 1WSSH 3MWIU 1SLWB 1SKYE 4INKA 4AYYB 1P2IA 2ZQ1A 2BZ6H 1EZQA 1L4ZA 3UQVA 2SNVA 3U9AH 1S0RA 1PQAA 3S7KB 3OE7D 3GY4A 1OOKB 1O36A 4AFSA 9LPRA 3ATKA 2O8UA 1BMMH 1BB0B 1P3EA 5DP8A 1A3EH 5H4IB 3WWFA 1PPHE 3ZIAD 1N8OC 3SU4A 5A8XA 1Y3UA 4X1RU 3TLOA 2AGEX 2GKVE 2FTLE 5F53A 1GJAB 2ZNKH 4H6SB 4YOJA 2BY5X 1GJBB 1ZTKA 3I77A 2NU1E 2R0KA 2BY7X 1YWUA 4I8JA 3FKSD 2CGAA 5C2ZA 4BTUB 4INHA 2VWLA 1GI5A 1BITA 2BVSH 1GMHF 1O3AA 3M3SA 4ZHLU 1VGCB 1GBTA 2J98B 4YZUA 4ZKSU 3H09A 5EODA 3KEEA 5LH8A 2A31A 2BDGA 3VB7A 5ESTE 1NRRH 1QL9A 1DUEA 2LPRA 1S81A 1FXYA 2KM0A 1DT2A 4RN6A 4Y7BA 1GHVH 4UEHH 1TQ0B 5DN6D 4NWLA 1EB2A 4WH6A 2G00A 1NROH 1S6LA 1W8BH 4ABGA 2WV5A 3SI4H 4ABEA 3PV4A 2W7UA 2TPIZ 4X1QU 1FY3A 1BTWA 1ZOMA 1C2EA 2H5CA 3SW2B 3RC4A 3RXPA 1K21H 5KECA 2BQWB 3E90B 3OU0A 2ANYA 2V6NA 2FOAA 4GAWA 4GPGA 3SU0A 4D9QA 2XC0A 4ACAA 3F1SB 2VH0A 1MU8B 2H5DA 2W7SA 2QV1A 3L6PA 4CRGA 2XWAA 1T7CA 3LC3A 2V3OH 3SNAA 2BD8A 3ZZ8A 3ZZ7A 3NZIA 3ATMA 1BRUP 1C4Y2 2W6JD 4LZ1H 3BG4B 3OEED 1PPBH 5FPSA 1VCPA 1UK2A 1VGCC 2ZFQH 1WCZA 3L33A 4B76A 3F2FA 4MNXA 4X8VH 1SOTA 3PLPA 2Q1JA 4ZKOU 3ELAH 5C20A 1SGQE 1A3BH 1TMUH 4I86A 5F03A 5J4SA 2SGPE 4B1TA 3EA9A 1DLKB 3SV8A 1P02A 2QCYA 3ITIA 3ZZDA 3SU2A 2QF5A 4DVAU 3DD2H 2PKAB 3MTYA 3S9BA 3RUOA 2FOMB 1MBQA 1KLIH 5TCCA 1VJ9U 2C8ZB 2OQ5A 1MABB 5EOKA 2G51A 3SQEE 2C8YB 1LKAA 1DSTA 4NFEA 4ABIA 1C5YB 4Z0KA 4U30A 1O3JA 2QC2A 1IQEA 2J9NA 1Y5UT 4XDEA 1SGFG 1LTOA 2VVVA 4WH8A 1UTKA 1GJ6A 4D7FA 1CGIE 2G4UA 2JETB 1TPOA 4YLQH 2ANWA 1O37A 2LP6A 4I8LA 2R3UA 2BDHA 3C1KA 2Z6BD 3RMOH 5IK2D 2QAAA 4OS5A 2G5VA 2FO9A 1VCWA 5EPYA 4O3UA 1C9TA 1RD3B 2XCNA 4TT3D 1JRTA 3O8DA 3GCNA 2AGIX 3BTME 5FBEA 2ZHWH 1HUTH 1GGDB 1FLEE 1L0ZA 1SLVB 4NG9H 1TIOA 2AHME 2GGVB 3F6UH 1W13U 1YPJH 3KL6A 3BSQA 5AHGH 1XVOA 2V7QD 2W3IA 1GDNA 3A89A 4AGJA 2F9UA 1NC6A 2PV9B 4CREA 2Z3DA 4HTCH 5C17A 3UWJH 1K1PA 1S82A 1SGPE 3MO6A 2VINA 2FOEA 3M35A 4FU9A 4IC6A 5EW2H 1O34A 3BTTE 4ISHH 5E2OA 1UVPA 4OS6A 1NBMD 2SFAA 1GI2A 2ZFSA 2V35A 4DJZB 1BMAA 4X1SU 1CT4E 1GI7B 2HNTF 2I6SA 2VNTA 3U8OH 1G3CA 2EA3A 1P2QA 4MG3A 3AW0A 3A81A 2FYRA 1GJ7B 3SU3A 2JETC 1ZRBA 1XXDA 5SGAE 2IPQX 1AWFH 4FUFA 5GWZA 6CHAB 3K9XB 1W12U 3M5MA 1WUNH 4GHQA 2THFB 3JZ2B 1Y3XA 3AAVA 1BRCE 4KP0A 2W5EA 3PTNA 1UW7A 2D8WA 2F91A 3CNRA 5T6FA 3M7UA 5A09A 3A7TA 4IC5A 4MTBA 2Y81A 2BX4A 4Y8ZA 1WQSA 2GJGA 1TONA 3SHCH 5K0HA 1AMHA 2BDAA 1GBJA 2EY4C 1P0SH 1PPCE 1GGDC 1KTTB 3N7DA 3UOUA 2VWOA 1MTWA 2TGPZ 1BHXF 3E0PB 5GCHF 2Z3EA 2BD3A 1DVAH 3VB4A 4ZMAH 1ESBA 2VWMA 3DHKH 1FY8E 1YPHC 2BD5A 3SO3A 1RIWB 1S5SA 2ZDNA 4KTUA 4WMDA 4K3JA 3DSOA 1O5FH 2BB4A 3BTFE 2V0BA 1SQOA 1BHXB 3MO3A 5HMAA 5DGJA 4A92A 3F9HA 2EI8A 5A0AE 2FS9A 1YPKH 3ZYDA 1D3QB 1GBHA 1RXPA 3V13A 3GY8A 1BBRE 1YP9A 1FAXA 1AUTC 3GICB 2RCEA 3A80A 4BTIB 3F9EA 3VXFH 2F43B 3BTDE 4A5TS 1O5BB 4B2AA 2ZCLP 5FX5A 2Z9GA 1NRSH 1XXFA 5AVDA 4ISOA 1OS8A 3AVZA 5E2PA 1DM4B 5EG4A 3M3VA 1D3TB 2Q6GA 1IHSH 4Y0YE 1C2MA 2XW9A 6CHAC 8LPRA 1WDIA 3TNTA 1QL8A 2KCAA 1Q2WA 1P05A 5DO4H 5EU8A 1EJNA 1ANCA 3QDZB 4AN7A 1PYTD 2VVCA 1QNJA 3A87A 3U8TH 2RA3A 1FIWA 2ESTE 2WV4A 3Q3YA 2FESH 2QIQA 4FUJA 3QN7A 3M5NA 4DIIH 2Q6FA 1KTSB 1VITF 1RIWC 4CRCA 5EXNA 3LGTA 5KEDA 3H7OA 2QF4A 2WYJA 2UUFB 2ZGCA 1RFNA 3VG8A 3RU4D 2P8OB 1THSH 1C5TA 4K2YA 1NFXA 2ZFRH 2TGDA 1GL1A 1ZHRA 1NU7B 3PTBA 2LNCA 2HPPH 1THPB 2C90B 1WYKA 1DOJA 1UJ1A 2PSYA 3MHWU 7KMEH 3SHAH 3SNDA 3CS7A 2IPHA 3SYJA 1T8MA 2OBQA 1GBBA 2NU3E 1QBNA 2B0FA 2B9LA 4MQAA 1QJ6B 1A46H 4K60A 1FIZA 1V2RT 3VB5A 1B0EA 1NT1A 1TGCA 1F5KU 3Q77A 3SUFA 2I6QA 1ZHMA 4ABHA 4UE7H 2F9VA 1MU6B 1FN8A 4XRNA 1SFIA 1YF4A 3PLKA 2KZ4A 5DP3A 5FX6A 4F48B 2FM2A 3PO1B 2FLRH 1N1LA 1O3BA 3SORA 1NU9A 1C1SA 1ZMJA 2CN0H 1FY1A 3RM0H 2P95A 3SGQE 3LH1A 1CBWB 2FIRH 2QE7D 5C1XA 1Z8RA 3PM3A 1LHGH 2C8WB 1JOUB 1O2ZA 1UK3A 3MNXA 2L6OA 8KME2 1RTFB 1MTUA 5FHTA 3ZVAA 2O8WA 2P8OC 2FDAA 4DT4A 1O2GH 3A7ZA 4X1NU 2VJ1A 1P2JA 1IQGA 3SUDA 3LH3A 5FPTA 3L3TA 1C2HA 1JMOH 1NZQH 1KLJH 3KN2A 3V0XA 1K1OA 1OSSA 1C1QA 1KXEA 1C2GA 1A2CH 3RXBA 1B7XB 1BJVA 2YOLA 1O5AB 1TLDA 1WOFA 2VB0A 1V2KT 2OC1A 2R2MB 1ELDE 4O3TA 1GI6A 3OYPA 2QF3A 4Y79A 3MOCA 1A61H 1P11E 1Z7KA 1UCYH 2XTTB 4ZH8A 2SGDE 1EZUC 2TIOA 1AU8A 2FWWA 3PO1C 3VB3A 3DCLA 2K8IA 3RLWH 3AK5A 1IAUA 3TJVA 3NRLA 3Q00A 4LZ4B 1GJDB 2TBSA 1QJ7B 1CBWC 1ZTLA 3QGNB 1BTXA 4FOUC 4UFGH 2F9OA 4Y0ZE 1GHAG 6LPRA 4CH8B 5IDKA 5AF9H 1IOEA 1TNKA 1ETSH 2BHGA 1QRWA 1TX8A 1G3DA 3SJ8A 4AORA 1TX7A 4ZKNU 4TYDA 3ZVBA 4SGAE 3Q76A 2P93A 4U2WA 4NIYA 4YM9A 1TRMA 1X7AC 1Z8IB 1V2OT 1ZPCA 2SGQE 4Q7YA 5C1UA 1ZSLA 1Z6EA 1OWJA 2WPIS 1P2NA 1W14U 1HAZB 5L2YH 1O2SA 2GX4A 4AFUA 2HRVA 3UREA 3N7EA 1GG6B 2AH4X 2AFQB 1GDUA 2ZCKP 1MTNB 3E6PH 1QB6A 1L1GA 1BIOA 1GCDA 2AERH 8GCHG 1UTMA 4AYVB 4MPVA 4X8TH 1H8ED 5A8YA 3PRBA 4ZROA 3Q3XA 4IW4E 1EP6A 3BG8A 3E16B 1P12E 4ZUHA 1GBKA 2WPJS 2Y6TA 1TALA 4Y71A 3PWCA 4NIWA 1OWEA 1QQUA 5FCKA 2F3CE 3A82A 2ZWLH 1V2VT 1PQ5A 1HAYB 1UTQA 1K2I1 2A5IA 5F6MA 3BEUA 1QBOA 2FZZA 5FCRA 3T5FH 5T6DA 2AMPA 1H9HE 1GBEA 4FETA 3PLBA 3GDUA 3O8RA 4IGDA 4GVUA 1IQMA 1FMGA 1C5XB 5GNDA 3BN9A 1YCPK 4U32A 1C1RA 1SMFE 1INCA 1XUGA 1Z1IA 4MDSA 1O3PB 1A0JA 2HOBA 1H9LB 4UFDH 5E8EH 5K7RA 1EPTB 2XC4A 2ZHDA 2FMJA 1GBDA 4FXGH 3PV2A 1MKXH 1ZSKA 1SOZA 2DE9A 1EPTA 1ESAA 1GG6C 4Q4LA 1IQKA 1RGQA 1ZSJA 1MUEB 4TWYA 1P03A 5JB8S 2H6MA 2BY8X 4ZAEA 2OC8A 1HJ8A 1MTNC 1E79D 4ZCNA 1O5CB 1FUJA 1QL7A 4JCNA 1V2ST 1ZLRA 3P70B 4SGBE 1F0RA 3F0OA 1NN6A 2OP9A 1ELCA 2Y5FA 4J2YB 2NU2E 1KXFA 4IN2A 3MO9A 1BTUA 4KELA 1W10U 5TJXA 5DSFA 4X2WA 3D49H 1EAWA 3GY6A 1W0JD 2PW8H 1XVMA 5B6LA 1C2DA 3QZQA 2JDID 4P02A 1ESTA 2GV7A 1MAXA 3BIUH 2FLBH 3SNCA 4A1VA 4BAHB 8GCHF 3S7HB 4TY7A 2QXGA 1GBCA 4R8TB 4THNH 3DSGA 2PHBA 2KCPA 2WUBA 3ZZAA 1H4WA 2BLQA 3ZZ9A 3GCHB 3GY2A 4K8YA 2PTCE 3FZDA 1O3NA 2IOTA 1LHDH 1YYY1 1OWDA 2G4TA 1G3EA 1LO6A 1LQDB 3RLYH 3SUEA 1DLEA 1HJAB 1P57B 1SGRE 4UFEH 4NWKA 1EPTC 3RU4T 2JKHA 3LDXH 1VR1H 4B71A 5A0BA 4Y8XA 1TNLA 4UONA 4UDWH 2XWBI 2Y7XA 4OS1A 1DS2E 3U28C 2ANMH 2P3FH 2PSXA 2XNDD 5DKMA 2EI7A 4ASHA 3LGWA 4WMFA 1UMAH 4FVDA 1KXDA 4TPIZ 1FPHH 3G01A 1C4U2 4GHTA 2A45B 1K9OE 3A8CA 3ZYEA 1TGTA 1BRBE 1TQ7B 3M61U 5KGOA 4UFFH 1TNGA 2F4LA 3P17H 2D26C 2ZHQH 1DWCH 3RXMA 3KF2A 2ZTXA 5DJ7A 1AHTH 1O3OA 4AOQA 1BTZA 4Q7ZA 1TOCB 4F49A 2YMSB 5LPRA 2ZEBA 1WTHD 5FPYA 1W0ZU 5ABWA 1SLXB 2L74A 2JH6D 2OTVA 1MCTA 5C5NA 1SB1H 5EW1H 1O30A 2VIOA 1J8AA 3GCHC 1O2KA 2R0LA 3ZVEA 2Y5GA 2WPDD 3TK5A 3IITA 5EJZA 1BT7A 4D7GA 3CS0A 2YNAA 1JWTA 1KYNA 2ZP0H 1EZXC 1C1VH 1A4WH 1MZAA 1S85A 2ODQA 4Z1MD 1HJAC 1AUJA 4AZ2B 1O33A 1SQAA 4AB9A 3RP2A 3UOPA 1MKWH 1WU1A 5GPIB 1FX0B 4WXIA 1DANH 2OUAA 5EPNA 5A2MH 2B8OH 1Y5AT 1MZDA 3QO6A 3K65B 1FPCH 2BDYA 1O5GH 2FOBA 3LT3A 4IS5A 3E1XB 3FOAA 2O8LA 2PFEA 1GI9B 2VIDA 3ZVGA 6GCHF 1V2WT 3BV9B 1QGFA 4INLA 5I25A 5JPMH 3OY6U 3GS9A 3A8AA 4OS7A 1CGHA 2G8TA 1UVTH 3SJIA 1J16A 4BOHA 2BD7A 3T28A 4CBNA 3MMGA 1NBME 3GYLB 1Q31A 3RXCA 3LONA 3DFLA 1Y3YA 4X0WU 1Z6JH 1QR3E 2XBVA 2YMSC 1TX6A 2Y80A 1QZ8A 1MD8A 1GI4A 2OCVB 2WV9A 3PYHA 1V2TT 3URDA 2FYQA 1THRH 4H42U 4Y76A 2CJIA 2ZDMA 2K0QA 1UO6A 1ZJDA 1T4VH 2KCYA 2C4FH 1QJ1B 2ZU2A 5B6OA 2WZQA 1SPJA 1BBRK 4Q63A 2A7JA 3SJ9A 3SZEA 3QTVH 5EQQA 1C2FA 2PTNA 5FAHA 1E36B 1EX3A 3BTHE 3LGIA 4JK5A 2H9HA 2BYAX 5T6GA 1ARCA 5T3HA 1BQYA 3F2GA 1P9UA 4NSVA 2KX4A 2Z9IA 4FUCA 4AG2A 1NFYA 3M5LA 4XSKU 3D65E 3DSPA 5EJLA 2WPHS 1C5OH 1FAKH 3Q3KA 3LKWA 1O3EA 2UUYA 1OYQA 4DURA 4DY7B 1O3HA 2J94A 3KCGH 1GHYH 5L30H 5GCHG 1O2YA 3GDVA 2FI4E 3C27B 4BAMB 1EAUA 2SGFE 3QUMP 2ZZUH 4I31A 1DICA 1BMNH 5FXLA 3BG4C 1DXWA 2OQUA 1L1NA 5C0UA 3F3BA 4TY6A 4CRBA 1GMDG 2KFWA 4WJG2 3DFJA 1DSUA 1BCUH 1XKBC 3SI3H 3RXJA 4X8SH 1O2MA 1P2KA 1WV7H 4NZQA 1CA0B 1T32A 1C5MD 3QWCH 2BD9A 5EXMA 1BUIA 1H1BA 5GDSH 1GBIA 1W0YH 4E7RG 4WWYA 1J14A 3EA8A 3I78A 3GOVB 3FP6E 2RA0A 3TPIZ 3DT0H 3OSYA 3D62A 3QK1A 4JZFH 4IMQA 3P92A 2KCOA 4X6NA 1MTVA 1JIMA 1SGDE 1UTNA 3M36A 3EDXB 4BNRA 2FOGA 3A84A 3RXDA 1QHRB 5DP7A 3RU4E 1CA8B 4FU7A 4WVPE 1UCYE 3B23B 1O2QA 2K1QA 5LGOA 1FONA 4BTTB 2SGEE 1NPMA 3V7TA 1VITG 1TRYA 3KNXA 3HK3B 1V2LT 2HVYB 1AY6H 4RKJB 2BQ6B 5IYTA 5HM9A 3K2UA 1V3XA 2LELA 1MAYA 2WPKS 4MPXA 4Y11E 2R9PA 1ELBA 1SL3A 1O2TA 2AEIH 2FTMA 3SV2H 3ESTA 1PPFE 3WWBA 3RXSA 1ZTJA 1G2LA 3BEFB 3SU6A 3UFAA 3ENSB 1CA0C 2A2QH 4BXSA 1YPEH 3GY3A 5GIBA 4NA8A 5JBCS 5F8ZA 1CT2E 5EQRA 1ANBA 1GVZA 1GMDF 3I29A 4ABFA 1AVWA 3ATLA 5HXFA 2P16A 4X8UH 1D3DB 1GMCF 3A8DA 4B74A 3FP8E 2FOHA 1NRPH 1LPZB 6ESTA 1JIRA 2Z9KA 1VCQA 3UNSA 3N7OA 5A0CA 1CU1A 2ZU4A 1IQHA 1D3PB 2XC5A 3RXQA 2FS8A 1KXBA 2JJ2D 1IHTH 1OKXA 1YCPH 1VITH 2BD2A 3RMMH 1EQ9A 4M7GA 1YPLH 3SOSA 4D8NA 2BLWA 3SNEA 1GJ4H 1NRQH 1SI5H 3W94A 1PQ7A 3AASA 1HAOH 3RXOA 1AVGH 4CH2B 4KKDA 2PUQH 1Y8TA 2ZFFH 1YM0A 1O3GA 1P10A 1SGTA 3SUGA 1C1TA 2PGQB 1TB6H 1LKBA 4B73A 3UAIC 1TWXB 1LHFH 1JXPA 4ABJA 5C5OA 1QRZA 1H8DH 1VJAU 1T8OA 2STBE 8ESTE 1AI8H 1AE8H 3RXGA 2M5TA 5C67A 1HXEH 3SZNA 3N99A 2GV6A 1O2UA 1NESE 3BIVH 2M2AA 1GHBF 2AGGX 3TGKE 2AMDA 1Y5BT 2NU4E 1O2XA 1MCVA 2CF9H 1SGNE 3MQKC 3RMLH 1ETTH 2R3YA 4AX9H 1F92A 2A0QB 1GBAA 1O2PA 1ZJKA
chains in the Genus database with same CATH topology
1DY8A 1UVSH 1EJMA 2ANKH 1GI3A 3NKKA 1O2RA 4NIXA 4DG4A 2ULLA 2GCHG 1O3DA 3A8BA 1A7SA 1O2LA 4KTSA 4ESTE 1EAIA 1AGJA 1KLTA 4OS4A 3EQ0H 3RXIA 2OC7A 3AW1A 4YESB 2VIPA 5DPAA 1G32B 1GJ8B 2NWNA 1EAXA 1HXFH 4ABDA 3F9FA 4IN1A 5EXLA 1XM1A 2R2WU 3GCTF 3TK6A 3ZZCA 1A5HA 5BPEA 3VPKA 3TIUA 3PB1E 2VWNA 2Z94A 1SSXA 3T25A 3LGYA 1C4V2 4NFFA 1V2UT 2GT7A 3SU1A 2NU0E 1SGYE 1KXAA 1TBZH 3B8JA 1K1MA 3VB6A 1E37B 1V2QT 2WINI 5TCAA 3T29A 2OD3B 1O3IA 2F9BH 2VH6A 1GJCB 1UVOA 4FU8A 2D1JA 4UD9H 1CQQA 1UHBB 4JK6A 4VGCB 1PJPA 2JH5D 4ABBA 5CE1A 2ALPA 1GVLA 1C5LH 1DITH 1UHBA 3TJUA 4E06H 4RKOB 1PFXC 3E0NB 2CMYA 3BEIB 1FN6A 5JBTA 2Y7ZA 3QX5H 3RDZA 1CO7E 3SU5A 2GTBA 1ETRH 3MH6A 3S9AA 2A1DB 3SGBE 1BTPA 3E8LA 4FUBA 3BTWE 2QA9E 1Y59T 3FVFB 2BDCA 4ISIH 4I33A 1K1NA 2GCHF 2OC0A 3EA7A 1EZSC 1IQNA 1RS0A 2EI6A 4FUEA 3H7TA 2QXJA 1BZXE 1D9IA 2FXRA 2OBOA 3P8GA 1V6DA 3UUZA 1CHGA 3SV7A 2QXIA 1C1OA 1CVWH 5E0HA 3SJKA 3NUMA 3UQOA 1Y3WA 3TJOA 1TE0A 5ETXA 2G5NA 3P8OA 2ZO3H 5CHAB 3ZVFA 2BXUH 1KSNA 1TPAE 5GXPA 4Q7XA 5AFZH 4LK4A 4X2VA 2J38A 4WXVA 1D6WA 2BM2A 5G4BA 4O97A 3MH5A 4JMYA 1CSOE 3UNRA 2B7DH 1ELTA 4DIHH 1P8VC 1FI8A 1XKAC 4VGCC 1PPGE 1P2MA 3ZVDA 1OWIA 4CRDA 1B0FA 3SNBA 1QIXB 1AVXA 5DK1A 4JYUH 4NZLA 1HLTH 4K1EA 1ZPZA 1OP8A 1AN1E 2AMQA 2KAIB 3EE0B 1D4PB 1CE5A 3RXVA 1FZZA 2A4QA 1OPHB 3TH4H 1FV9A 3TJNA 2KAIA 1HRTH 2ZDLA 1PPEE 2W3KA 4CR5A 2BX3A 5J4QA 4J1YA 2FOFA 5DP6A 4H4FA 1PYTC 1BDAA 3U1IB 1AWHB 1YGCH 3KIDU 5CHAC 5JDUB 3P6ZB 3LOXA 3RC6A 1P06A 1ARBA 4JYVH 1UTJA 1SGEE 1P2OA 1IQFA 3MU4A 1ELGA 3ZVCA 3STIA 3GISB 3MH7A 3QTOH 3IWMA 2TRMA 1Z71A 1QCPA 4JYTA 2QY0B 1QY6A 1F7ZA 1SR5C 1J9CH 4DW2U 1N6XA 5PTPA 3QGJA 1OWHA 4RSPA 1SC8U 4Q2KA 2ZDVH 2A5KA 1HIAA 2FP7B 3PMAB 4OGXA 1ID5H 5E0GA 2FPZA 3V3MA 2TGAA 2VIVA 3STJA 4ZXYH 1JBUH 4BAKB 4GSOA 3TGJE 1A0LA 2UWOA 1U6QA 2AIQA 2PGBB 3NK8A 4QT8C 1LHEH 5EGMA 1C5ZB 2PWXA 1XX9A 1QFKH 1RRKA 1A0HB 1GCTB 1S84A 2A4GA 4B75A 1GJ9B 1V2MT 4WY3A 1ZRKA 1NM6A 3S0NA 1BOQA 4O9VA 7GCHG 4MPWA 1K1IA 2HALA 3A83A 5DP4A 1HFDA 3AAUA 3GYMA 1ZR0A 3TU7H 1SVPA 2HNTE 3OY5U 5BRRE 2BLOA 2O8TA 3EAJA 1LHCH 1KDQB 4IBLH 1IQJA 1O2OA 3K6ZA 6GCHG 1V2NT 3UPEA 5JB9S 2GD4B 3RXAA 3OX7U 4I32A 4BAOB 5A8ZA 1KDQA 4JZ1A 3UIRA 2OINA 2A4OA 3EGKH 3F68H 1O3MA 1OXGA 1O3FA 1EKBB 2FEQH 2ZU1A 2ZU3A 1C5QA 3NXPA 2UUJB 4XOJA 3LU9B 1TA2A 4YO9A 4E05H 1AD8H 1QB1A 3UTUH 2ZQ2A 4YOGA 4I8KA 4FUDA 3MYWA 1HGTH 2P94A 1GCTC 1YLCA 1G3BA 1H9IE 1WQVH 3A7VA 1TABE 5DP5A 2A4RA 4D76A 2AIPA 5L6NH 2QF0A 4X6PA 2Z3CA 1GVKB 2ZPQA 1MH0A 3MFJA 3QZRA 1HPGA 4CHAB 3V12A 3HKJB 2A32A 7ESTE 1S0QA 1SGIB 3O8CA 4X6OA 5C3NA 4HFPB 4X2XA 5DP9A 1AB9B 1CT0E 7GCHF 3U69H 2JH0D 1F2SE 1FNIA 4AFQA 3DUXH 4OGYA 2ZU5A 1O2IA 3LIWA 1CGJE 1YPGH 1HAPH 2H9EH 3A7XA 1UCYK 2BOHB 1S83A 1CHOG 1WAYB 4DCDA 3D23A 1DPOA 5F8TA 2C8XB 1MMJN 1UVUH 1XMNB 1B5GH 4FUIA 1SBWA 4FUHA 2ALVA 3H5CB 4K69A 5HM2A 2WPLS 4OS2A 1P04A 4K5ZA 1TAWA 4XBDA 3TNSA 1O32A 1WTGH 3LJJA 4X1PU 1SGCA 3URCA 2FX4A 3A88A 1C5UA 2A2XH 4PROA 1F5RA 1GI1A 1C1UH 1YCPM 1T31A 2XBYA 1T8LA 1EXFA 1Z8JB 1J17T 1AZ8A 1Y3VA 1G37A 1QA7A 2PUXB 4WMEA 4CHAC 2PLXA 2HWLB 1BMLA 1TMTH 3KQCA 2ILNA 1AO5A 3UWIA 1F5LA 2F9NA 1GHZA 5HGGA 2ZDKA 2G81E 3M7TA 2XCFA 1O38A 1AB9C 3FZZA 1G30B 1SFQB 2ZKSA 2A7CA 1C2IA 3R0FA 2VU8E 4MNWA 1ZMLA 1TPSA 1C2JA 1O3CA 1OP2A 1GJ5H 1EATA 1MBMA 2Y5HA 3SGAE 1E38B 1C1NA 1DFPA 3SN8A 1NO9H 4I7YH 3HATH 2UWLA 1GBLA 2GP9B 4K1TA 4Z6AH 3A7YA 2QN5T 3LGUA 4HI3A 1O2HA 1C1WH 2PKAA 1HB0B 2ZGJA 1TBRH 4CRAA 1GL0E 1BTHH 1LQEA 1CHOF 4F4OC 1F0SA 2GZ8A 2SNWA 3S69A 2XNIA 2ZTZA 4YLUA 4AGKA 2B5TB 1LPGB 1W11U 3SQHE 1A5GH 1YLDA 3O8BA 1QB9A 1JRSA 1V2JT 1UTPA 4NCYA 2XRCA 4MPUA 1GMCG 1NRNH 1Z8GA 1EASA 4AFZA 1P01A 1GHXH 2P3TB 3SBKA 3U1JB 2GCTB 1MKXK 3KQEA 1EOJA 3RXTA 3ODDA 2IN2A 2ZGBH 1OWKA 4GLYA 4MVNA 5C1YA 1DWBH 5FBIA 1W7GH 4YT7H 1UTLM 4Y6DA 5F8XA 2J95A 4GCHG 1LVOA 4XBCA 4GUXA 2YNBA 1AIXH 3KQDA 4O03A 1YC0A 1OYTH 1C1PA 3M7QA 3ATWA 1LCYA 2OXSA 1T8NA 4DGJA 3RXKA 2J2UA 1QTFA 1Q3XA 1NFUA 1TGBA 2PR3A 4LOYH 5L2ZH 1LMWB 1GBMA 3A7WA 3PROA 2O9QA 4D9RA 1O0DH 1VZQH 2ZI2H 2ZG0H 1TNIA 3T27A 1D6RA 5JYIA 2FI3E 1ELAA 1GHBG 2EEKA 4MNVA 1ZZZA 2ZHFH 3ZZ4A 3PMBB 2BTCE 1XUJA 2W26A 1O2NA 3P8NA 2AS9A 1GWAA 1E0FD 1LVBA 2D2DA 1O39A 1HV7A 2GCTC 1TGSZ 3LPRA 2PKSB 4YT6H 2STAE 2BDIA 2AYWA 1AFQB 3VGCB 3M37A 1NS3A 2ZHEH 1FDPA 2ZA5A 4JZIA 1C2LA 3T62A 1W3CA 1AZZA 1ZHPA 1SGFA 3W95A 3GCTG 4DT7B 2HGTH 3TK9A 4BXWA 1T4UH 2A7HA 4BANB 1ABJH 2F9PA 2P3UB 4BAQB 1LVYA 4NA7A 2ZGHA 3U98H 4X6MA 4GCHF 2GT8A 1SHHB 1SQTA 2ZC9H 1ACBE 1P3CA 2BZAA 2ZFTA 1BA8B 1QA0A 1ZGIA 3ATIA 1Z1JA 1RTLA 2HNTC 4CBOA 3CP7A 1AFEH 3P95A 3PMJA 1S6HA 4ZXXH 4AB8A 1TFXA 1C5NH 3LGVA 2XBXA 4NIVA 3PWBA 2UUKB 2ZPSA 2Q6DA 2XYAA 1DUAA 2PKSC 1SG8B 4LXBH 1C5PA 1MKWK 3ZZ3A 1AFQC 1HAGE 1BRAA 3VGCC 3UY9A 1HAXB 1C9PA 3KGPA 1DE7H 2FOCA 2DUCA 2DE8A 3ZV8A 3MU8A 5JBBS 3K6YA 1O2VA 3SJOA 3B9FH 2J92A 2CF8H 1K1JA 4KTCA 3A86A 3RMNH 1KIGH 1YPMH 1RJXB 3NPSA 1HYLA 3P8FA 1P09A 1C2KA 3M5OA 3OTJE 2QYIA 2BXTH 3F9GA 3ZZ6A 1LPKB 2P59A 1G36A 2BD4A 1MTSA 3KHVA 2IJOB 1DY9A 9ESTA 1DXPA 1ABIH 3GY7A 1A5IA 1WBGB 1TOMH 1XUIA 2ZCHP 1DDJA 4I8HA 1ZGVA 1BJUA 3UNQA 2ZIQH 1NFWA 1O2WA 2VIQA 1W7XH 1QRXA 3E3TA 3BTKE 3TH3H 1E34B 4ZHMU 1O2JA 4AG1A 3WY8A 5LPEA 3TGIE 1AE5A 2Y82A 3KQBA 3T26A 1FJSA 1OX1A 1G2MA 2G52A 1AQ7A 2BVXH 1ZMNA 1RTKA 4FUGA 3A85A 1EP5A 4A6LA 1MQ6A 1NTPA 3RXLA 1W2KH 1NY22 1K28D 4JZDH 1TBQH 3HGPA 2BY6X 4XFQA 1XUHA 2H9TH 3BTQE 4ZKRU 3RXFA 1LVMA 4CRFA 3UR6A 2C3SA 3IG6B 1TNHA 1K22H 3TVJB 1O3LA 4A1TA 1HAIH 1KY9A 5HYOA 1OP0A 2BOKA 2ZGXH 1ANDA 2ASUB 2H2ZA 1O3KA 2O8MA 3PMHB 2EC9H 1O31A 1A1RA 1K1LA 3ZZBA 4MLFB 3FAOA 3M3TA 2FODA 1BTYA 1ANEA 2UWPA 4Y7AA 1F0TA 1ZPBA 3GCOA 2HLCA 4B2CA 4HZHA 1TPPA 5AFYH 2H1UA 2J34A 4YOIA 1DWDH 1GI8B 2TGTA 1EJAA 1FY5A 2Z7FE 2ODYB 1M9UA 2CHAB 1QURH 3CENA 3RXEA 4TPYA 4ABAA 1O35A 4ISLA 4DOQA 4XBBA 4K1SA 1C1MA 3VXEH 3BF6H 3MNBA 1V2PT 2C93B 5JBAS 1MQ5A 2SGAA 2RDLA 4WF8A 4HGCA 2CXVA 3UR9A 2BY9X 1L2EA 2VIWA 2GZ9A 3SV9A 4E7NA 2XBWA 5ESBA 3RM2H 1BBRH 1ELEE 1HDTH 2Z9JA 4H6TA 4U01A 1MD7A 2ZTYA 2ZF0H 4Y8YA 3MNCA 1P9SA 4A7IB 1ORFA 1FY4A 5EQSA 3VFEA 1TMBH 5DG6A 3RXUA 3MU5A 3QLPH 2G55A 1XUFA 2A5AA 2RG3A 2GMTB 1H8IH 2VVUA 1C5RA 2GDEH 2FX6A 1SLUB 3GDSA 1GPZA 2WPMS 1AKSB 3U8RH 2FI5E 4X2YA 4YTAA 2BLVA 1HJ9A 4A1XA 1O5EH 5I46H 3HK6B 1AKSA 3DA9B 3NCLA 2ZDAH 3LC5A 1GHWH 1F0UA 1C5VA 1TYNA 2VGCB 3S9CA 4ISNA 4NSYA 2Z9LA 2CHAC 1FQ3A 3RXHA 5LPFA 4TWWA 3ZZ5A 3FANA 1ELFA 4NGAH 1HNEE 4XE4A 2BQ7B 2GZ7A 2ZFPH 1DX5M 3HPTB 1HIAB 3FP7E 2WYGA 2GVFA 2ZECA 1DWEH 3HKIB 2OLGA 5GJ4B 1E35B 1YPHE 3ODFA 1PQ8A 2BMGB 3EYDA 1GHAF 3BTEE 3HGNA 4CR9A 3TH2H 1TA6A 1LDTT 2ZPRA 1TRNA 3MI4A 2HPQH 2BDBA 1QQ4A 3JZ1B 1UK4A 1O5DH 3RXRA 3MH4A 3TITA 1C5WB 4KGAA 4FVBA 4R0IA 1EUFA 7LPRA 2GMTC 1J15A 1QBVH 4IMZA 3MNSA 2ODPA 1SHYA 4NA9H 1HAHH 1N8OB 1IQIA 1UTOA 3LJOA 4Q80A 1GMHG 3FFGA 1ELVA 1S6FA 2WUCA 3MU0A 4ZHAA 3E91A 1N6YA 1PPZA 3VEQB 1L4DA 2VGCC 4B2BA 1C5SA 2CV3A 1XUKA 2QGRA 4MNYA 1GI0A 1HBTH 1TNJA 3T2NA 5E0JA 3MU1A 4JZEH 1TGNA 2BVRH 3GY5A 1L1JA 2HVXA 1YBWA 3RC5A 1IQLA 2J4IA 5CMXH 2XXLA 2F83A 1ZYOA 3ZV9A 1GDQA 1HAVB 1HCGA 1KXCA 3SV6A 2GDDA 1YKTA 3BTGE 1GBFA 1HAVA 3R3GB 1EB1H 1G9IE 1EOLA 3NWUA 4Y10E 2V3HH 4I8GA 2QXHA 4K8BA 1WSSH 3MWIU 1SLWB 4INKA 4AYYB 1P2IA 2ZQ1A 2BZ6H 1EZQA 1L4ZA 3UQVA 2SNVA 3U9AH 1S0RA 1PQAA 3S7KB 3GY4A 1OOKB 1O36A 4AFSA 9LPRA 3ATKA 2O8UA 1BMMH 1BB0B 1P3EA 5DP8A 1A3EH 5H4IB 1PPHE 1N8OC 3SU4A 5A8XA 1Y3UA 4X1RU 3TLOA 2AGEX 2GKVE 2FTLE 1GJAB 2ZNKH 4H6SB 4YOJA 2BY5X 1GJBB 1ZTKA 3I77A 2NU1E 2R0KA 2BY7X 4I8JA 2CGAA 5C2ZA 4BTUB 4INHA 2VWLA 1GI5A 1BITA 2BVSH 1GMHF 1O3AA 3M3SA 4ZHLU 1VGCB 1GBTA 4YZUA 4ZKSU 5EODA 3KEEA 5LH8A 2A31A 2BDGA 3VB7A 5ESTE 1NRRH 1QL9A 1DUEA 2LPRA 1S81A 1FXYA 1DT2A 4RN6A 4Y7BA 1GHVH 4UEHH 1TQ0B 4NWLA 1EB2A 4WH6A 2G00A 1NROH 1W8BH 4ABGA 2WV5A 3SI4H 4ABEA 3PV4A 2W7UA 2TPIZ 4X1QU 1FY3A 1BTWA 1ZOMA 1C2EA 2H5CA 3SW2B 3RC4A 3RXPA 1K21H 2BQWB 3E90B 3OU0A 2ANYA 2V6NA 2FOAA 4GAWA 4GPGA 3SU0A 4D9QA 2XC0A 3F1SB 2VH0A