1AZEA

Nmr structure of the complex between the c32s-y7v mutant of the nsh3 domain of grb2 with a peptide from sos, 10 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
MEAIAKVDFKATADDELSFKRGDILKVLNEESDQNWYKAELNGKDGFIPKNYIEMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Molecular and cellular analysis of Grb2 SH3 domain mutants: interaction with Sos and dynamin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (adaptor protein/peptide)
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1azeA00
2MOXA 5IXBA 2J6KA 1SHFA 5I11A 2MCNA 1J3TA 1G2BA 2EVRA 3UF4A 4OMLA 3VRYA 3PVLA 1NYFA 2O9SA 1ARKA 2DBKA 4QT7A 2DM1A 3JV3A 1MUZA 1YCSB 2C0IA 5IHKA 2RN8A 4GBQA 1NM7A 2SRCA 2LX7A 1Z9ZA 2KRMA 2I0NA 2GBQA 4J9FA 1TUDA 3ZL7C 2L0AA 1GCQA 4D8DA 1QCFA 1UUEA 4HXJA 3VS2A 2A28A 3PE0A 4RTXA 2DE0X 1QLYA 2LQWA 1OEBA 2F2VA 2K9GA 2C0TA 3RNJA 4CC4B 2SEMA 4Z89A 4J9CA 4DEYA 2ABLA 1RLQC 1GCPA 1T3SA 1B3QA 1KIKA 5ECAA 2FPFA 3UATA 3C0CA 2KYMA 1BBZA 2DYBA 2LNHB 1W70A 2RQWA 3VS7A 2ESWA 2ROLA 1HSQA 2VKNA 2C0OA 1OPKA 4OMMA 1RLPC 4J9EA 2CSQA 2JTEA 3PVQA 2FO0A 1JXOA 4LUDA 2EGEA 1QWEA 5IXFA 2DJQA 3H0HA 2M0YA 3LH5A 3EG2A 3H0IA 2EYWA 3VRZA 2ECZA 4OMNA 2EYZA 1NLPC 1NEGA 2DL5A 1V1CA 4CC7A 1AZGB 2JM9A 1WXTA 3H41A 2J7IA 1KJWA 1YNZA 2K3BA 1YP5A 1AWXA 1IO6A 4JZ4A 1M27C 1X2KA 1U3OA 2LMJA 2RMOA 5FWBA 2KNBB 4IIOA 1I0CA 4J9DA 1N5ZA 2G6FX 1TUCA 2EYYA 3A98A 2HDAA 1SRMA 2YDLA 1K1ZA 1K0XA 2DRMA 2D1XA 1ZUKA 2HSPA 2AZSA 4RTTA 1WDXA 3KFVA 2BZXA 1JXMA 2K2MA 1B07A 3M0QA 1CKBA 2JMAA 2AZVA 1TG0A 2LJ1A 1W6XA 3TSZA 3SHWA 2O9VA 2CT4A 4IIMA 1X6GA 1ZUYA 1GRIA 4RUGA 1AWWA 3UA7A 2F2WA 1PHTA 1RUWA 1AZEA 5EC7A 3QWXX 1HD3A 2YUPA 1GCQC 2ENMA 4J9BA 1UTIA 5FWCA 3REBB 2B86A 2J05A 3THKA 5IHIA 2EBPA 2PTKA 3I5RA 3EHRA 4AG1C 4OMOA 1Y57A 1UG1A 1CKAA 3VS1A 2JM8A 1AVZC 1T0HA 1MV3A 2EPDA 2KEAA 2HEQA 1VYVA 2CH4A 2JMCA 2K79A 1M8MA 4X1VA 2F2XA 2DL4A 1UHCA 3IQLA 1X6BA 1WYXA 2H8HA 2W10A 3GBQA 2YSQA 1EFNA 3M0UA 1I07A 2D8JA 1AWOA 4GLMA 4HCKA 4RTYA 2DA9A 2PNIA 5L23A 2EQIA 4HVVA 1K0SA 1QKXA 1ZSGA 3ULRB 1SSHA 2L2PA 4AG2C 1Z9QA 2HCKA 2KGTA 4LNPA 2J6FA 2FRYA 2DMOA 1SPKA 2KROA 1ABOA 2O88A 1AEYA 1UJ0A 1K76A 1NEBA 3VS5A 1BU1A 2V1QA 1G83A 1NLOC 4RTZA 4WCIA 4DEXA 3H0FA 1JO8A 3RBBB 4JPBW 2OJ2A 1H92A 2AKKA 4ESRA 4J9GA 5IH2A 4OMQA 1JQQA 2EGCA 4Z88A 1SHGA 3VS3A 1HJDA 4AFSC 4Y92A 2RQUA 2KBTA 2EGAA 4CC3A 3REAB 2CUDA 1H3HA 1UDLA 2GTOA 1ZLMA 1VYTA 4FSSA 2CDTA 3EHQA 2KRNA 2VWFA 2DLPA 1GBQA 1M3CA 2O2OA 3O5ZA 3EGUA 2JW4A 1AOJA 3VS6A 1K9AA 2RQRA 2V1RA 1H8KA 1QWFA 2P4RA 1PRMC 1VA7A 2QDLA 1XOVA 2FG0A 1NG2A 4JJDA 2YT6A 2YUQA 1OOTA 1OV3A 4HVUA 3TVTA 1ZUUA 3EG0A 1WXUA 2FPDA 2DRKA 4RTWA 1E6GA 1WLPB 1UECA 1WX6A 2O31A 1M3AA 2HBWA 5GJWB 1UFFA 1MV0B 1X43A 3M0PA 1AD5A 1Y0MA 2EYXA 3U23A 2CUBA 2JS0A 2DX1A 3I5SA 2EW3A 1CSKA 2JT4A 2DNUA 2JXBA 5FW9A 1M3BA 1U06A 1WA7A 3NMZC 1YN8A 2LQNA 2GNCA 2LJ0A 2DBMA 2KT8A 2M51A 1VYUA 2DL8A 3M0TA 4AFZC 4J9IA 2CT3A 3UA6A 1ZBJA 4ORZA 2BTTA 3M0SA 2XMFA 1SEMA 3EG1A 1T3LA 2KR3A 4EIKA 1X69A 2X3XD 2JS2A 1M30A 3NGPA 1S1NA 4F17A 2CH4W 1JU5C 2AK5A 4D8KA 4LUEA 3CQTA 2X3WD 1GFCA 2FPEA 2DL3A 3SEMA 3QWYA 1PKSA 2NUZA 1SRLA 3I35A 1AWJA 3NPFA 2RQVA 4AFQC 2K7AA 5I22A 4A63B 2GQIA 1GL5A 2CSIA 5HCKA 1PKTA 4Z8AA 5GJVB 1UE9A 2VVKA 1FYNA 1KSWA 2L3PA 4LE9A 1ABQA 2DVJA 2OAWA 3I9QA 2YUNA 4JJCA 2OI3A 1WXBA 1A0NB 3VS0A 1UJYA 4M4ZA 1FMKA 1UGVA 3R6NA 2D8HA 2RPNA 4AFUC 2ROTA 2D0NA 3EG3A 2W0ZA 2NWMA 2RF0A 1QKWA 1OPLA 2GGRA 4RTUA 2RNAA 2IIMA 2L3SA 2A37A 1BK2A 2L3QA 1I1JA 2LP5A 4JZ3A 2A36A 4OMPA 1JEGA 4JJBA 2BZ8A 1U5SA 2DL7A 2ED0A 1E7OA 3NHNA 1WIEA 2PZ1A 1X2QA 2ED1A 2KRSA 1X27A 4F16A 2FEIA 4J9HA 1KFZA 4KRTA 4RTVA 2MIOA 1NYGA 1WI7A 1YWPA 2A08A 2DILA 2EKHA 3FJ5A 3VS4A 1GFDA 1GBRA 4ZNXA 1W1FA 2J6OA 4E6RA 1K4US 2CREA 2LJ3A 4LN2A 1YWOA 2RQTA 3TSWA 1WFWA 2KYBA 2LZ6B 4HVWA 1T0JA 1LCKA 2J06A 2YUOA 1ZX6A 5IHNA 3M0RA 2KT1A 1RI9A 2GTJA 2DF6A 2E5KA 4K11A 4R0KA 1PWTA 4CC2A 1PNJA 1BB9A 1PRLC 2LCSA 2KE9A 2AKLA 1UHFA 2KXDA 1E6HA 2KXCA 2BZYA 2K6DA 4F14A 2FRWA
chains in the Genus database with same CATH superfamily
1WJRA 2RJFA 2MOXA 3L2QA 2EQUA 5LJ5d 5IXBA 4ZTJA 1WJSA 2M16A 4E7LA 2E6NA 1EX4A 3GIBA 2OTLQ 1VQOT 3VRYA 1NYFA 2COWA 4QT7A 3JV3A 1MUZA 3QPHA 4FSXA 5IHKA 1LJOA 3LGFA 2LX7A 1Z9ZA 3CCSQ 2FZCB 1TUDA 2L0AA 2VGMA 1GCQA 3CCLT 3CBPA 3VS2A 2A28A 1D3BB 2DE0X 2NUPA 2YLBA 1QLYA 2MI6A 3CMEA 1VQPQ 1FXXA 3RNJA 1H641 3M4GA 1KK7A 2V8JA 4DEYA 4KUIA 4M78B 1X75C 1B3QA 5ECAA 3C0CA 1YJ9Q 5LJ5j 4C5HA 5D6YA 1YFNA 2DYBA 1HYOA 1QVPA 2YRDA 4QKUA 3EFSA 1HSQA 4M7DE 2C0OA 2DZ9A 2D6FA 3G6ET 4M7AB 1QMCA 2CP3A 2JVVA 4A54A 2CSQA 2HMAA 2JTEA 2FO0A 4LUDA 1H3ZA 1QWEA 1PSEA 5IXFA 2DJQA 3H0HA 2M0YA 2FVUA 3VRZA 3RIRA 3SB2A 3CCQT 4NOYA 2R57A 4OMNA 3F70A 4WTOB 1NEGA 1YBYA 2QASA 1V1CA 1AZGB 2JM9A 1X6OA 2XI9A 5KYXB 3H41A 3EFOB 1KJWA 4M77E 5GMKl 3L2WA 2R5MA 4ANJA 2OTJQ 1ACMB 1FMVA 4E7JA 3BFMA 2RK1A 2LQ8A 2PVGB 2VV5A 4XU3A 1MHNA 1TUCA 3PT9A 1M1FA 3JRZA 5GANd 1K1ZA 2QQ9A 5GAMd 3OW2A 1S72T 4B9XA 3VU3C 1XJWB 1Q95G 4L6V5 1CKBA 3X28B 1KG1A 3OBYA 1WGSA 4L5GA 3JCMe 1VQKT 3HRSA 1GRIA 2HD0A 2IPOB 4M78E 1Q7YC 1RUWA 1VQ5T 2NUPB 1AZEA 4CRIA 3VYGA 1HD3A 1OYXA 5FWCA 5A0GA 3HPWA 2M9UA 3I56Q 1VQLA 3A8OB 4BDYA 3HHTB 3CPWS 1I5OB 2EBPA 4M7AE 4E2FB 2KMTA 3A8GB 1KD1U 2E70A 3RKYA 1Y57A 5GANj 4MDXA 3G71Q 2NYSA 4E47A 1G3YA 2MK5A 4JLGA 3OSSC 2K4YA 2Y4YA 1VYVA 1VQ6A 1M5Q1 1SF9A 2QYZA 2RI5A 1M1KC 1FWZA 3VYHB 3GBQA 2HL5C 4M75G 2DTIA 3KBGA 3M0UA 2RJEA 1PSFA 2K5LA 4JJNK 4RTYA 5AT1B 3S6WA 4XTUA 4RG8A 2EQIA 1ZSGA 3QSUA 1Q82U 4AG2C 1MMGA 1Z9QA 3GPLA 5GAN6 1C6VX 4LD6A 2O88A 2H3EB 1AEYA 1UJ0A 3VS5A 1M2OA 1JO8A 2CP6A 4FU6A 3RBBB 1MMNA 4N4IA 1I5LA 3CCRQ 3URGA 1VQ8A 2E12A 5IH2A 3V8KA 4VUBA 5M9OA 3G4ST 1SHGA 1YCYA 3PIOA 4XAXB 2RHXA 2EGAA 2JZ2A 4E7IA 4M75A 4KULA 1QP2A 1ZLMA 2EJGA 4M75F 1KC8R 3JB9I 4XU0A 1GBQA 3O5ZA 3CCVT 1K9MC 3SFMA 1K9AA 1IRXA 1KQSP 3RDVA 2YT6A 4KT0E 4XU2A 3TVTA 3M5AA 4M75D 3A8MB 3EG0A 3VJPA 2FPDA 1G5VA 1WX6A 4Y91A 2O31A 2WSCE 4C5GA 1M3AA 2CKKA 4BUGA 1X43A 4CI0C 3JCMX 2AT1B 2LX9A 3ZBDA 4IURA 2JT4A 2JXBA 5FW9A 4FW2A 3HSBA 3JCMg 2M51A 3O8VA 3M0TA 4J9IA 3UA6A 3JB9F 3QJYA 4PLLA 3V7SA 1YITQ 3H8ZA 1VQMT 1SEMA 1VQPA 1I4K1 5A0LA 3CMEQ 1VOMA 1X69A 2DO3A 2DTHA 3NGPA 2CYZB 1N9SA 1X01A 3X25B 1YJ9A 1M9SA 2CGHA 4HT8A 3SEMA 1B34B 4P5NA 3GF5A 2LRQA 4HCZA 2DYIA 3PMTA 2KAFA 5I22A 4BE2A 4A63B 2P0PA 3CD6A 5HCKA 4Z8AA 5DY9A 1UE9A 2HSEB 1FYNA 2L3PA 4N4GA 4LE9A 4JJCA 4DBQA 1ZSZC 4M75B 1G3WA 2P0QA 1UGVA 2QAZA 4AFUC 2RPNA 4DOVA 5J39A 3OS2A 2RF0A 1OPLA 2OTLT 3JCMP 4JRKA 4NL2A 1BK2A 2EJ9A 2K2VA 2LP5A 3OMCA 5GMKm 1U5SA 4PL6A 1E7OA 2D0QB 3CCST 2E3IA 2X4XA 5CVIA 1KFZA 4KRTA 2MIOA 1NYGA 1YWPA 2DILA 3VS4A 1VQ7A 1GFDA 2E65A 4E6RA 1RAHB 3HL8A 2A7YA 3NFCA 3CCMT 1K73U 2G3RA 2ZPFB 3OQ5A 5KYUA 2KVQG 3MEUA 1ZX6A 1WPYA 1OU8A 2ZCFB 5IHNA 3M0RA 4BB7A 4M7DA 2GTJA 3EH1A 3ER0A 3OYKA 3PTAA 1BB9A 1WHHA 4B9WA 4EMGA 6AT1B 2JN0A 2BE7D 2BIVA 3GP8A 3QDRB 2EQKA 1VQ4Q 4LD9K 3I5RA 2R58A 3X26B 2P84A 2VUBA 3E9GA 2J6KA 4DBHA 1QVFA 5I11A 2MCNA 1O75A 2K3XA 1RAGB 1ZA1B 2RHIA 1KD1R 1VQLQ 2O9SA 4BI3A 1YCSB 2C0IA 4M77A 1MNEA 4E7ZA 2RN8A 4GBQA 1QW1A 1XQHA 2KRMA 2I0NA 2GBQA 4HCBA 4RKUE 3JCMW 2P0KA 2KSSA 4D8DA 4HXJA 4M75E 4R55A 1LPLA 1IGQA 2LQWA 1OEBA 2OTJT 1W2BA 2QTXA 5FRMA 2SEMA 1R0BG 1YI2T 2CP2A 2ABLA 3GOXA 1RLQC 4PJOC 2LCLA 2X4WA 1KIKA 2QK0A 3MEAA 4BD3A 3CBOA 2EIFA 3WVDB 5GAN5 1D3BA 1Q82R 2KYMA 1KD1C 2JUFA 3OYJA 3CBMA 3GNFB 1M4ZA 2V8IA 1W70A 5CKEA 2JNGA 2ROLA 3DLMA 5LJ3d 4FT2A 5KH6A 5GMKj 1RLPC 4MMLA 4IUUA 4J9EA 4RCBA 2CZ6B 3PVQA 4FCYA 5LJ5h 2YRVA 3E19A 3CCRA 3EFRA 3RERA 1VQ8Q 2KK4A 4AT1B 3RMSA 3H0IA 2QDYB 2ECZA 2RHZA 4KH0B 5J26A 5KYUB 4J7IA 1VQOA 1UGQB 1UEBA 2FHDA 1YIJQ 4IUTA 1OX9A 4QQDA 2HKNA 2K3BA 1IXDA 1IO6A 2A0FB 3LWIA 2LMJA 3G71T 2RMOA 3CCLA 5FWBA 4N4HA 2KNBB 4N0AA 5KE3A 1I0CA 2WACA 3QHSA 3AT1B 4B6MA 3R6OA 2ZPGB 4J9DA 1YHQQ 1WHMA 3FC3A 1BI3A 1VQ9Q 4C0GA 2EYYA 2XD0A 4XTVA 3UT1A 1YJNQ 3L42A 1Q81C 2CP7A 3KFVA 4C8QC 1JXMA 2K2MA 3DLLA 3DB3A 3M0QA 2RJDA 4M77B 1TG0A 2LJ1A 1VIEA 4OB3B 3HFNA 2MWOA 2CP5A 2CT4A 3MHXA 1OX8A 1X6GA 1ZUYA 5LJ5f 4C92C 3DKMA 3UA7A 1OZ2A 3LYIA 5GAOr 4DA4A 3OYLA 3KXTA 2AHJB 1EZZB 2YUPA 2BE9B 3FJPA 4XK8E 4J9BA 1UTIA 2QQAA 3REBB 3A8LB 2K57A 2B86A 5I2SA 5IHIA 4LXCA 2HL3A 4FL6A 2ZZDA 1YITA 1RL2A 4OP0A 4OMOA 4A4GA 2E4HA 1UG1A 7AT1B 3VS1A 4BDZA 2RJCA 1TTHB 3BE3A 3JCMJ 5KCHA 1QVGA 2GCXA 3CXCA 2CH4A 2HBPA 3LW5E 1M8MA 3L2VA 4J7FA 1WHGA 2DL4A 3QO3A 3TREA 3IQLA 1WYXA 2H8HA 2W10A 2CP0A 1EFNA 2D8JA 5GANh 2BUDA 1U1SA 5FU7B 5GAMh 4GLMA 2X4JA 5L23A 2COYA 3SWNC 4HVVA 1K0SA 1S72A 2X4YA 2VASA 3CD6Q 4IUQA 4BY6C 1RAEB 4HA8A 3CC7T 4JS4A 3QYGB 2KGTA 2KI7A 1QCOA 3QIIA 2KROA 5DM7R 1SPKA 3JCMd 1NEBA 1JJ2S 1NLOC 2XDDA 4MZMA 4JS5A 1QCNA 1ZHIA 4IKFA 1BCOA 1NPRA 3FB9A 2DJZA 3TEEA 4EMKC 3S3MA 1JQQA 2EGCA 1HJDA 4AFSC 4Y92A 3HKSA 1VQ7Q 4LDUA 1K73R 2IVWA 1Y07A 2WSEE 1UDLA 3TQ7P 3E1SA 3CMET 1QP3A 3OYEA 3CC4T 4FSSA 3S3NA 2YXYA 1NPPA 2KRNA 3CMAT 2O2OA 5GAMf 2I2LA 3HP9A 4F7UG 2RQRA 2V1RA 4QQ6A 1Y96A 1VA7A 2QDLA 2FG0A 4ZN1A 4JJDA 5GAN8 4PFZA 1RAFB 2HNIA 3JCMc 1VQ4A 2LNVA 1K73C 4X9CA 1D09B 1E6GA 1UECA 2RO0A 4XTXA 2HBWA 4Y28E 3BY7A 1MV0B 3M0PA 2QA4Q 3QG1A 2OAUA 3RMQA 5KE2A 4PJOG 2EYXA 3U23A 2RHYA 1WNLA 2EW3A 2DNUA 4C5IA 4ZGEB 1NJIU 1M3BA 2EKOA 2EJFA 1YN8A 2GNCA 3NTIA 2LJ0A 3PFSA 4NS5A 4DBFA 3EG9A 2COZA 4AFZC 4KH1B 5C6SA 3M0SA 2XMFA 4JRPA 2MMPA 1T3LA 1RI0A 8AT1B 2X3XD 2JS2A 1M30A 4F7UF 1O9SA 1S1NA 3E9FA 3PMIA 1K8AU 3I55A 1MGQA 2LDMA 4XU1A 1PD1A 4D8KA 3HRTA 2X3WD 2DL3A 1SSFA 2NUZA 1SRLA 1AWJA 3OYBA 3UDCA 2RQVA 5KYWB 4PKCC 3EAEA 5CKBA 2GQIA 4C0FA 4PJOF 2CSIA 5C0MA 1N8RR 4LDYA 3OS1A 1KSWA 3OS5A 1B34A 2OAWA 2V8KA 3I9QA 2X35A 2ROTA 3L2RA 2D0NA 3EG3A 2W0ZA 3A5ZB 2IIMA 3M57A 4BACA 1KQ1A 2L3SA 2A36A 1VQOQ 2BZ8A 2LQKA 2RHUA 1YIJA 1WIEA 4C8QG 4PJOD 2DAQA 1X27A 2FEIA 2PQWA 4OF1A 1Y96B 1GBRA 1P92A 2J6OA 3CCLQ 4QVDA 4C92G 3C95A 1YHQA 4LN2A 3HRUA 1VQ9A 1VQ6T 3P8DA 3TSWA 2HZYA 2YUOA 3J80E 2DVEA 2GFUA 1YJNA 4PFOA 4WF2A 3H6ZA 2E5KA 4CC2A 4Q5WA 1PRLC 2HKQB 3ZEHA 9ATCB 1UHFA 1HXDA 2KXDA 2MF2A 2KXCA 2DXCA 3CCJA 3EG9B 4II1A 2HAXA 4KBMB 1ZQ1A 1TOVA 4QVCA 3V7CA 1KC8C 1C1AA 5CO7A 3FEOA 4C8QA 1HK9A 3ASKA 1SHFA 4F7UB 4C8QF 1G2BA 2EVRA 2FYKA 5D6XA 1FMWA 3UF4A 1VQ8T 3PVLA 3QBYA 3VUBA 3WVEB 5FROA 2SRCA 2CZ1B 4C92F 3CCQQ 4PJJA 2QEXT 1VIFA 1LNXA 2XDBA 4XTZA 4PK4A 4E7SA 2RB6A 4FT4A 2M02A 2ZPIB 4PJOB 8ATCB 2VYTA 4C8QD 3NTKA 5HK3A 5CIUA 1TWBA 3A1PA 4CC4B 2XU8A 3FDRA 4Z89A 5FU6B 3CC2A 3D7SB 3RKWA 3PNWC 3UATA 4C92D 3MO8A 3Q1JA 4ZTFA 2LC4A 2KQWA 3VS7A 4OGEA 3VKIA 2ESWA 1DJ7B 3FIFA 1S72Q 1VQNA 1PC0A 4YTLA 4OMMA 2XICA 1OQKA 4OGCA 1V29B 4C0DC 1Q86R 1U1TA 4J83A 3LWHA 3CCUA 3H9NA 2QQRA 3SWNA 5I21A 2EGEA 2FZKB 5GAMg 1IHWA 1N6AA 1KQSA 2R5AA 3LH5A 2F69A 1NBEB 4FW1A 3MPUB 4HT9A 3EGDB 5GMKh 3SDZA 1JJ2P 3RESA 3MP8A 4A4HA 3QJ6A 1NLPC 1WQ7A 3M58A 1MMDA 2E5QA 2K5FA 3M54A 4IUPA 3JAME 5KYNA 1VQPT 2ZGWA 3HFOA 1M27C 1U3OA 4KGZB 1G3TA 1M8VA 1TSFA 4F7UE 3CCEA 1D0YA 2F5KA 2RM4A 1YJ9T 5CAIA 4E7KA 4C8QB 2HDAA 1TXQA 1SRMA 4KGVB 3INZA 1YI2A 2DRMA 2D1XA 3MP6A 3L2ZA 3MJXA 4RTTA 2E1HA 2NUTA 2LT4A 2BZXA 3PIPA 2EWNA 2BKDN 1OU9A 5LJ3h 4PJOE 3CD6T 1W6XA 3BDUA 3TSZA 3M9QA 4IIMA 1NJIR 3G1JA 1AWWA 1OULA 2QA4A 2F2WA 2AIRB 5EC7A 1RADB 2MYSA 2ENMA 4C0ZA 2DD5A 3WXMB 4QVZA 4OB0B 2NLUA 3THKA 2DTOA 3OMGA 4PFPA 3G4SQ 2JJ9A 3EHRA 2KDSA 3CEYA 4J5YA 1K8AR 2YRCA 5CR2A 1CKAA 2QGGA 1MV3A 2Y90A 2EPDA 2HEQA 3I55Q 2JMCA 1YJWA 4X1VA 4QW2A 2F2XA 3OA6A 2XG8D 3AHUA 1UHCA 1X6BA 2V26A 3SWNB 5GAN2 2YSQA 4M7AG 4A4FA 1AWOA 2E6ZA 4BY6B 3CCVQ 4HCKA 2DA9A 2IG0A 5LJ3f 1QKXA 3ULRB 1SSHA 3M59A 1D1CA 1MNDA 1PG5B 3E2UA 2L2PA 2CZ0B 5CK9A 4JRIA 3ZFJA 2J6FA 2FRYA 2DMOA 3UPUA 1N8RU 2P4TA 1K76A 1BU1A 4DEXA 4WCIA 4EMKB 4C8QE 1H92A 4A53A 3I56T 1Q82C 3GNGA 4ESRA 4J9GA 2YWWA 1ZA2B 3VUZA 1BI2A 3META 4L59A 3VS3A 4C92E 2RQUA 3OYDA 2KBTA 1RACB 4CC3A 3REAB 5FLXE 2CUDA 1OI1A 2NUTB 1H3HA 3M55A 2GTOA 1K9MU 4AMCA 1VYTA 2PVDB 2DIGA 2CDTA 3EHQA 4E7HA 2DLPA 5CQXA 3JB9H 1M3CA 2WSFE 4GY5A 4HKEA 3EGUA 1AOJA 3FRNA 1BYMA 3MEWA 3VS6A 5GAOl 3CPWA 1PRMC 5CKDA 2PU9B 4ELZC 1XNIA 2YUQA 1OOTA 2QGFB 3CCJQ 4M7AD 4XTWA 4JUVA 2ZPBB 5CKFA 3G6EA 4ME7A 4X9DA 3OSVA 2QTVA 5GJWB 3CC7A 3JCMh 3J81E 3CCRT 1PD0A 1AD5A 4A4KA 2JS0A 1CSKA 1UGPB 1U06A 1WA7A 2RH2A 2LQNA 3CCQA 1W4SA 4FIBA 2FB7A 1I8FA 2CT3A 1ZBJA 2ZPEB 2BTTA 2M1HA 4O6JA 2O4XA 3EG1A 3OW2P 4DBRA 5D7UA 4OMFB 4EIKA 1MMAA 2CH4W 1QVFS 3CC2Q 3CCMQ 2AK5A 1RAAB 4PJLA 4JRQA 2A3LA 3CC4A 4BI4A 1I81A 3CMAA 1M2VA 2E3HA 3JCMb 4MMKA 3L1AA 1PKSA 3I35A 1VQNQ 4ZGDB 1QQJA 2K7AA 2DXUA 4ATOA 2DXTA 1GL5A 5LJ5e 3CCUQ 2VVKA 1VQKA 1ABQA 2DVJA 4NL3A 1W2BS 3JCMf 1AT1B 4PNOA 1Q86U 1A0NB 4M4ZA 2DFUA 2D8HA 3FLGA 5KYWA 1BKBA 1VQ5A 1ZSZA 2NWMA 4RTUA 1WZOA 3TCJA 2GGRA 2RNAA 1SKUB 1G8XA 2A37A 2L3QA 4FM4B 5GAOn 4JZ3A 1TUGB 4OMPA 2VB6A 1PCXA 4JJBA 1WQWA 4LDVA 2JTMA 2HQXA 2DL7A 2ED0A 1TS9A 1YITT 3QDFA 4MZPA 2ED1A 1XTDA 5HK0A 2KRSA 4J9HA 2L89A 3M4YA 1WI7A 1WHLA 2A08A 3OYNA 1W1FA 1R77A 3KUFA 4PJMA 3CCEQ 1YWOA 2RQTA 5L8RE 2K3YA 2GQVA 2X9HA 5GANf 4M7DC 4HVWA 1T0JA 2VXEA 1Q7YR 3EGXB 1BIBA 1NZ9A 1YI2Q 2XHCA 2KT1A 2DF6A 4K11A 2O01E 2HQHA 1PNJA 2LCSA 2AKLA 1E6HA 4JDSA 4GLKA 4DOWA 4BE1A 1U8RA 1D0XA 2K6DA 1KHCA 2O4XB 1RAIB 2D9TA 3PGGA 1J3TA 2VGNA 4M77C 4OMLA 2DZCA 1M1KR 5LJ3g 1ARKA 2DBKA 5HKCA 2DM1A 3QZ5B 5IT9E 3P8HA 3G4SA 1RABB 1NM7A 4J8OA 5FRNA 4J9FA 3ZL7C 1R0CB 4F7UA 1M2VB 1QCFA 2FZGB 3JCMQ 1UUEA 3C12A 5GAOq 1UGSB 3PE0A 4RG2A 4RTXA 2LCCA 1IREB 2DPPB 2F2VA 2RI2A 1YJWQ 2K9GA 5GAMj 1LOJA 2C0TA 4OVAA 4J9CA 5GANe 1GCPA 1T3SA 2LTOA 5GAMe 1M90U 2FPFA 3CCVA 5CKHA 5A2QE 4PJOA 1BBZA 1ZSZB 2OX7A 2E41A 2LNHB 4M78C 2RQWA 1AHJB 4C0DB 5LL6S 1VQ4T 1JRIA 1M1GA 2VXFA 2VKNA 2F1LA 2PUOB 1OPKA 1FX7A 2EAYA 3MEVA 4KGXB 5FU7C 4KUDK 1QVGS 1JXOA 3CXCS 2XKOC 1V76A 2EFIA 3MCAB 4M7AC 3OY9A 1VQLT 4O5VA 4FYVB 3EG2A 2EYWA 5I2MA 5GAN4 5LJ5g 1K9MR 4PJNA 3V8LA 3BW1A 1R8OB 2EYZA 2DL5A 4CC7A 3CPFA 1N8RC 1WXTA 2J7IA 1YNZA 4N0AC 1YP5A 1AWXA 4JZ4A 1VQMA 3HTRA 1X2KA 2QEXA 3EGDA 3X24B 1Q81U 3VV0A 3LGLA 4IIOA 1BI1A 3I55T 1JBMA 4J6XA 1N5ZA 5GAOm 5CQYA 2M0OA 2G6FX 5CCAA 3A98A 3JB9G 3NTHA 2EQJA 2YDLA 3N5BB 3ME9A 3MP1A 1K0XA 2DETA 1ZUKA 2HSPA 5DLQE 2AZSA 2Y4XA 1GXIE 1WDXA 4V2SA 2FL7A 2HQEA 3UWNA 3OYYA 1B07A 2JMAA 2AZVA 3G6EQ 1D1BA 3SHWA 2O9VA 2L8DA 2E10A 3CC7Q 4RUGA 5GAN3 3M56A 1PHTA 4IUVA 4C92A 3QWXX 3OW2S 1GCQC 4A4EA 2OTLA 3M53A 2J05A 2RK2A 5KYYA 1YIJT 3BDLA 2PTKA 2K5IA 4ELYC 3CCSA 4AG1C 3G7ZA 5IN1A 5KCOA 3LX7A 2JM8A 1AVZC 1T0HA 3LLRA 2DEUA 5AYFA 2GFAA 3OYHA 4OB2B 4UC4A 1YHQT 2RD1A 2KEAA 1VQ9T 5A0DA 2K79A 3CCMA 2MPXC 5GAN7 1B7TA 3DB4A 1ZBXA 4HCCA 2RI3A 3C94A 3CC4Q 1YJNT 2XK0A 1I07A 3CMAQ 5HY6A 1NE8A 1QVFP 4EMHA 2PNIA 2JTFA 3JB9D 3LH0A 3CCJT 5GANg 3J7AF 5DLOA 1VQKQ 2HCKA 4LNPA 1WHJA 1ABOA 2MWPA 3L2UA 2QG9B 2V1QA 1G83A 4RTZA 1VQ5Q 1IGUA 3H0FA 4M7DG 4JPBW 2OJ2A 2AKKA 4OMQA 2XIDA 1VUBA 1W2BP 4Z88A 1C0MA 2ZAEA 2QI2A 2E64A 4EMKA 4MDWA 2Z0WA 4Z02A 3QXEB 2DKGA 1OZ3A 2YLCA 1Q86C 1KHIA 4DQ2A 2L5QA 1F1BB 2OTJA 3QUIA 1BIAA 3TU4K 2CS7A 2DXBA 2GF7A 4D6WA 2VWFA 3CC2T 4M77G 1IHVA 2JW4A 1Q7YU 4BI8B 2JOYA 4C92B 1H8KA 1QWFA 2P4RA 3QKJA 3RUXA 4TVRA 1VQNT 1XOVA 1NG2A 4QQGA 3OYMA 3QZ9B 5J3BA 1OV3A 4HVUA 4M7DF 1ZUUA 5D6WA 1WXUA 5KYYB 1G3SA 2DRKA 4RTWA 1UB4A 2C06A 1WLPB 2VC8A 3CCUT 2B8AA 2EQMA 1UFFA 2DEQA 1UGRB 1TH7A 2X51A 1Y0MA 2CUBA 3V7RA 2DX1A 3I5SA 2LVMA 5GMKi 3MKDA 1WJQA 3NMZC 2LT1A 3I56A 2DBMA 1M1KU 2KT8A 4M78G 4M7DD 1VQ7T 1VYUA 2DL8A 2ATCB 1Y7XA 2F5TX 5GAOp 3JB9J 4XTYA 4ORZA 3X20B 4X34A 3T9NA 2RA2A 4M77F 4J6WA 1NJIC 2KR3A 2QQSA 3G71A 1M90R 3RKXA 1IB8A 3OS0A 3OYCA 1JJ2A 3CCET 2DK3A 2MAMA 4F17A 2XDPA 3CPWP 1JU5C 4LUEA 3CQTA 3P8BB 1VQ6Q 1Y71A 4FYWB 4PLIA 1GFCA 1BI0A 2FPEA 4ZGJB 2DD4A 3OYAA 4LDXA 3QWYA 1IZ6A 3NPFA 2KY9A 4AFQC 1K8AC 3JCMV 4M77D 1KQ2A 1D0ZA 2PVOB 5FU6C 3JSCA 4MZTA 1PKTA 4R56A 5GJVB 1SG5A 2L3RA 4M78A 2YUNA 2QXFA 2QA4T 2OI3A 2DERA 1WXBA 1M90C 5EG2A 4J6YA 3VS0A 4LDWA 1UJYA 1FMKA 4M78F 3OYGA 3R6NA 3C4SA 3OBWA 1N9RA 2H3JA 1TU0B 2PUKB 1QKWA 5GMKe 2DIQA 3EH2A 4M75C 1N27A 1I1JA 4RMOA 1JEGA 1QVGP 3CXCP 1BCMA 4M7AA 3NHNA 3SD4A 1Q81R 2PZ1A 1X2QA 4EPCA 4M7AF 4F16A 4FYYB 4RTVA 4XQ3A 1VQMQ 2EKHA 3FJ5A 5IAYA 2QEXQ 4ZNXA 2EYQA 4C5EA 4M7DB 4OB1B 1K4US 4BE0A 4RCCA 4M78D 2CREA 2LJ3A 3A8HB 1YJWT 2QQBA 3OYFA 1WFWA 4EDUA 2KYBA 2LZ6B 1WHKA 1KQSS 1LCKA 3S3OA 3V8JA 2J06A 1PM3A 4FYXB 1D1AA 5LJ3j 2YHTA 4ZN3A 1RI9A 3GLXA 1JB0E 1KC8U 4R0KA 1PWTA 5KYXA 3EFOA 3OB9A 5LJ3e 3QYHB 3OYIA 2KE9A 1EIFA 2CZ7B 4JLIA 2BZYA 4F04B 3EGXA 2ZPHB 1LVKA 3RR6A 4F14A 2FRWA
chains in the Genus database with same CATH topology
2MOXA 5IXBA 2J6KA 1SHFA 5I11A 2MCNA 1J3TA 1G2BA 2EVRA 3UF4A 4OMLA 3VRYA 3PVLA 1NYFA 2O9SA 1ARKA 2DBKA 4QT7A 2DM1A 3JV3A 1MUZA 1YCSB 2C0IA 5IHKA 2RN8A 4GBQA 1NM7A 2SRCA 2LX7A 1Z9ZA 2KRMA 2I0NA 2GBQA 4J9FA 1TUDA 3ZL7C 2L0AA 1GCQA 4D8DA 1QCFA 1UUEA 4HXJA 3VS2A 2A28A 3PE0A 4RTXA 2DE0X 1QLYA 2LQWA 1OEBA 2F2VA 2K9GA 2C0TA 3RNJA 4CC4B 2SEMA 4Z89A 4J9CA 4DEYA 2ABLA 1RLQC 1GCPA 1T3SA 1B3QA 1KIKA 5ECAA 2FPFA 3UATA 3C0CA 2KYMA 1BBZA 2DYBA 2LNHB 1W70A 2RQWA 3VS7A 2ESWA 2ROLA 1HSQA 2VKNA 2C0OA 1OPKA 4OMMA 1RLPC 4J9EA 2CSQA 2JTEA 3PVQA 2FO0A 1JXOA 4LUDA 2EGEA 1QWEA 5IXFA 2DJQA 3H0HA 2M0YA 3LH5A 3EG2A 3H0IA 2EYWA 3VRZA 2ECZA 4OMNA 2EYZA 1NLPC 1NEGA 2DL5A 1V1CA 4CC7A 1AZGB 2JM9A 1WXTA 3H41A 2J7IA 1KJWA 1YNZA 2K3BA 1YP5A 1AWXA 1IO6A 4JZ4A 1M27C 1X2KA 1U3OA 2LMJA 2RMOA 5FWBA 2KNBB 4IIOA 1I0CA 4J9DA 1N5ZA 2G6FX 1TUCA 2EYYA 3A98A 2HDAA 1SRMA 2YDLA 1K1ZA 1K0XA 2DRMA 2D1XA 1ZUKA 2HSPA 2AZSA 4RTTA 1WDXA 3KFVA 2BZXA 1JXMA 2K2MA 1B07A 3M0QA 1CKBA 2JMAA 2AZVA 1TG0A 2LJ1A 1W6XA 3TSZA 3SHWA 2O9VA 2CT4A 4IIMA 1X6GA 1ZUYA 1GRIA 4RUGA 1AWWA 3UA7A 2F2WA 1PHTA 1RUWA 1AZEA 5EC7A 3QWXX 1HD3A 2YUPA 1GCQC 2ENMA 4J9BA 1UTIA 5FWCA 3REBB 2B86A 2J05A 3THKA 5IHIA 2EBPA 2PTKA 3I5RA 3EHRA 4AG1C 4OMOA 1Y57A 1UG1A 1CKAA 3VS1A 2JM8A 1AVZC 1T0HA 1MV3A 2EPDA 2KEAA 2HEQA 1VYVA 2CH4A 2JMCA 2K79A 1M8MA 4X1VA 2F2XA 2DL4A 1UHCA 3IQLA 1X6BA 1WYXA 2H8HA 2W10A 3GBQA 2YSQA 1EFNA 3M0UA 1I07A 2D8JA 1AWOA 4GLMA 4HCKA 4RTYA 2DA9A 2PNIA 5L23A 2EQIA 4HVVA 1K0SA 1QKXA 1ZSGA 3ULRB 1SSHA 2L2PA 4AG2C 1Z9QA 2HCKA 2KGTA 4LNPA 2J6FA 2FRYA 2DMOA 1SPKA 2KROA 1ABOA 2O88A 1AEYA 1UJ0A 1K76A 1NEBA 3VS5A 1BU1A 2V1QA 1G83A 1NLOC 4RTZA 4WCIA 4DEXA 3H0FA 1JO8A 3RBBB 4JPBW 2OJ2A 1H92A 2AKKA 4ESRA 4J9GA 5IH2A 4OMQA 1JQQA 2EGCA 4Z88A 1SHGA 3VS3A 1HJDA 4AFSC 4Y92A 2RQUA 2KBTA 2EGAA 4CC3A 3REAB 2CUDA 1H3HA 1UDLA 2GTOA 1ZLMA 1VYTA 4FSSA 2CDTA 3EHQA 2KRNA 2VWFA 2DLPA 1GBQA 1M3CA 2O2OA 3O5ZA 3EGUA 2JW4A 1AOJA 3VS6A 1K9AA 2RQRA 2V1RA 1H8KA 1QWFA 2P4RA 1PRMC 1VA7A 2QDLA 1XOVA 2FG0A 1NG2A 4JJDA 2YT6A 2YUQA 1OOTA 1OV3A 4HVUA 3TVTA 1ZUUA 3EG0A 1WXUA 2FPDA 2DRKA 4RTWA 1E6GA 1WLPB 1UECA 1WX6A 2O31A 1M3AA 2HBWA 5GJWB 1UFFA 1MV0B 1X43A 3M0PA 1AD5A 1Y0MA 2EYXA 3U23A 2CUBA 2JS0A 2DX1A 3I5SA 2EW3A 1CSKA 2JT4A 2DNUA 2JXBA 5FW9A 1M3BA 1U06A 1WA7A 3NMZC 1YN8A 2LQNA 2GNCA 2LJ0A 2DBMA 2KT8A 2M51A 1VYUA 2DL8A 3M0TA 4AFZC 4J9IA 2CT3A 3UA6A 1ZBJA 4ORZA 2BTTA 3M0SA 2XMFA 1SEMA 3EG1A 1T3LA 2KR3A 4EIKA 1X69A 2X3XD 2JS2A 1M30A 3NGPA 1S1NA 4F17A 2CH4W 1JU5C 2AK5A 4D8KA 4LUEA 3CQTA 2X3WD 1GFCA 2FPEA 2DL3A 3SEMA 3QWYA 1PKSA 2NUZA 1SRLA 3I35A 1AWJA 3NPFA 2RQVA 4AFQC 2K7AA 5I22A 4A63B 2GQIA 1GL5A 2CSIA 5HCKA 1PKTA 4Z8AA 5GJVB 1UE9A 2VVKA 1FYNA 1KSWA 2L3PA 4LE9A 1ABQA 2DVJA 2OAWA 3I9QA 2YUNA 4JJCA 2OI3A 1WXBA 1A0NB 3VS0A 1UJYA 4M4ZA 1FMKA 1UGVA 3R6NA 2D8HA 2RPNA 4AFUC 2ROTA 2D0NA 3EG3A 2W0ZA 2NWMA 2RF0A 1QKWA 1OPLA 2GGRA 4RTUA 2RNAA 2IIMA 2L3SA 2A37A 1BK2A 2L3QA 1I1JA 2LP5A 4JZ3A 2A36A 4OMPA 1JEGA 4JJBA 2BZ8A 1U5SA 2DL7A 2ED0A 1E7OA 3NHNA 1WIEA 2PZ1A 1X2QA 2ED1A 2KRSA 1X27A 4F16A 2FEIA 4J9HA 1KFZA 4KRTA 4RTVA 2MIOA 1NYGA 1WI7A 1YWPA 2A08A 2DILA 2EKHA 3FJ5A 3VS4A 1GFDA 1GBRA 4ZNXA 1W1FA 2J6OA 4E6RA 1K4US 2CREA 2LJ3A 4LN2A 1YWOA 2RQTA 3TSWA 1WFWA 2KYBA 2LZ6B 4HVWA 1T0JA 1LCKA 2J06A 2YUOA 1ZX6A 5IHNA 3M0RA 2KT1A 1RI9A 2GTJA 2DF6A 2E5KA 4K11A 4R0KA 1PWTA 4CC2A 1PNJA 1BB9A 1PRLC 2LCSA 2KE9A 2AKLA 1UHFA 2KXDA 1E6HA 2KXCA 2BZYA 2K6DA 4F14A 2FRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOX A;  5IXB A;  2J6K A;  1SHF A;  5I11 A;  2MCN A;  1J3T A;  1G2B A;  2EVR A;  3UF4 A;  4OML A;  3VRY A;  3PVL A;  1NYF A;  2O9S A;  1ARK A;  2DBK A;  4QT7 A;  2DM1 A;  3JV3 A;  1MUZ A;  1YCS B;  2C0I A;  5IHK A;  2RN8 A;  4GBQ A;  1NM7 A;  2SRC A;  2LX7 A;  1Z9Z A;  2KRM A;  2I0N A;  2GBQ A;  4J9F A;  1TUD A;  3ZL7 C;  2L0A A;  1GCQ A;  4D8D A;  1QCF A;  1UUE A;  4HXJ A;  3VS2 A;  2A28 A;  3PE0 A;  4RTX A;  2DE0 X;  1QLY A;  2LQW A;  1OEB A;  2F2V A;  2K9G A;  2C0T A;  3RNJ A;  4CC4 B;  2SEM A;  4Z89 A;  4J9C A;  4DEY A;  2ABL A;  1RLQ C;  1GCP A;  1T3S A;  1B3Q A;  1KIK A;  5ECA A;  2FPF A;  3UAT A;  3C0C A;  2KYM A;  1BBZ A;  2DYB A;  2LNH B;  1W70 A;  2RQW A;  3VS7 A;  2ESW A;  2ROL A;  1HSQ A;  2VKN A;  2C0O A;  1OPK A;  4OMM A;  1RLP C;  4J9E A;  2CSQ A;  2JTE A;  3PVQ A;  2FO0 A;  1JXO A;  4LUD A;  2EGE A;  1QWE A;  5IXF A;  2DJQ A;  3H0H A;  2M0Y A;  3LH5 A;  3EG2 A;  3H0I A;  2EYW A;  3VRZ A;  2ECZ A;  4OMN A;  2EYZ A;  1NLP C;  1NEG A;  2DL5 A;  1V1C A;  4CC7 A;  1AZG B;  2JM9 A;  1WXT A;  3H41 A;  2J7I A;  1KJW A;  1YNZ A;  2K3B A;  1YP5 A;  1AWX A;  1IO6 A;  4JZ4 A;  1M27 C;  1X2K A;  1U3O A;  2LMJ A;  2RMO A;  5FWB A;  2KNB B;  4IIO A;  1I0C A;  4J9D A;  1N5Z A;  2G6F X;  1TUC A;  2EYY A;  3A98 A;  2HDA A;  1SRM A;  2YDL A;  1K1Z A;  1K0X A;  2DRM A;  2D1X A;  1ZUK A;  2HSP A;  2AZS A;  4RTT A;  1WDX A;  3KFV A;  2BZX A;  1JXM A;  2K2M A;  1B07 A;  3M0Q A;  1CKB A;  2JMA A;  2AZV A;  1TG0 A;  2LJ1 A;  1W6X A;  3TSZ A;  3SHW A;  2O9V A;  2CT4 A;  4IIM A;  1X6G A;  1ZUY A;  1GRI A;  4RUG A;  1AWW A;  3UA7 A;  2F2W A;  1PHT A;  1RUW A;  1AZE A;  5EC7 A;  3QWX X;  1HD3 A;  2YUP A;  1GCQ C;  2ENM A;  4J9B A;  1UTI A;  5FWC A;  3REB B;  2B86 A;  2J05 A;  3THK A;  5IHI A;  2EBP A;  2PTK A;  3I5R A;  3EHR A;  4AG1 C;  4OMO A;  1Y57 A;  1UG1 A;  1CKA A;  3VS1 A;  2JM8 A;  1AVZ C;  1T0H A;  1MV3 A;  2EPD A;  2KEA A;  2HEQ A;  1VYV A;  2CH4 A;  2JMC A;  2K79 A;  1M8M A;  4X1V A;  2F2X A;  2DL4 A;  1UHC A;  3IQL A;  1X6B A;  1WYX A;  2H8H A;  2W10 A;  3GBQ A;  2YSQ A;  1EFN A;  3M0U A;  1I07 A;  2D8J A;  1AWO A;  4GLM A;  4HCK A;  4RTY A;  2DA9 A;  2PNI A;  5L23 A;  2EQI A;  4HVV A;  1K0S A;  1QKX A;  1ZSG A;  3ULR B;  1SSH A;  2L2P A;  4AG2 C;  1Z9Q A;  2HCK A;  2KGT A;  4LNP A;  2J6F A;  2FRY A;  2DMO A;  1SPK A;  2KRO A;  1ABO A;  2O88 A;  1AEY A;  1UJ0 A;  1K76 A;  1NEB A;  3VS5 A;  1BU1 A;  2V1Q A;  1G83 A;  1NLO C;  4RTZ A;  4WCI A;  4DEX A;  3H0F A;  1JO8 A;  3RBB B;  4JPB W;  2OJ2 A;  1H92 A;  2AKK A;  4ESR A;  4J9G A;  5IH2 A;  4OMQ A;  1JQQ A;  2EGC A;  4Z88 A;  1SHG A;  3VS3 A;  1HJD A;  4AFS C;  4Y92 A;  2RQU A;  2KBT A;  2EGA A;  4CC3 A;  3REA B;  2CUD A;  1H3H A;  1UDL A;  2GTO A;  1ZLM A;  1VYT A;  4FSS A;  2CDT A;  3EHQ A;  2KRN A;  2VWF A;  2DLP A;  1GBQ A;  1M3C A;  2O2O A;  3O5Z A;  3EGU A;  2JW4 A;  1AOJ A;  3VS6 A;  1K9A A;  2RQR A;  2V1R A;  1H8K A;  1QWF A;  2P4R A;  1PRM C;  1VA7 A;  2QDL A;  1XOV A;  2FG0 A;  1NG2 A;  4JJD A;  2YT6 A;  2YUQ A;  1OOT A;  1OV3 A;  4HVU A;  3TVT A;  1ZUU A;  3EG0 A;  1WXU A;  2FPD A;  2DRK A;  4RTW A;  1E6G A;  1WLP B;  1UEC A;  1WX6 A;  2O31 A;  1M3A A;  2HBW A;  5GJW B;  1UFF A;  1MV0 B;  1X43 A;  3M0P A;  1AD5 A;  1Y0M A;  2EYX A;  3U23 A;  2CUB A;  2JS0 A;  2DX1 A;  3I5S A;  2EW3 A;  1CSK A;  2JT4 A;  2DNU A;  2JXB A;  5FW9 A;  1M3B A;  1U06 A;  1WA7 A;  3NMZ C;  1YN8 A;  2LQN A;  2GNC A;  2LJ0 A;  2DBM A;  2KT8 A;  2M51 A;  1VYU A;  2DL8 A;  3M0T A;  4AFZ C;  4J9I A;  2CT3 A;  3UA6 A;  1ZBJ A;  4ORZ A;  2BTT A;  3M0S A;  2XMF A;  1SEM A;  3EG1 A;  1T3L A;  2KR3 A;  4EIK A;  1X69 A;  2X3X D;  2JS2 A;  1M30 A;  3NGP A;  1S1N A;  4F17 A;  2CH4 W;  1JU5 C;  2AK5 A;  4D8K A;  4LUE A;  3CQT A;  2X3W D;  1GFC A;  2FPE A;  2DL3 A;  3SEM A;  3QWY A;  1PKS A;  2NUZ A;  1SRL A;  3I35 A;  1AWJ A;  3NPF A;  2RQV A;  4AFQ C;  2K7A A;  5I22 A;  4A63 B;  2GQI A;  1GL5 A;  2CSI A;  5HCK A;  1PKT A;  4Z8A A;  5GJV B;  1UE9 A;  2VVK A;  1FYN A;  1KSW A;  2L3P A;  4LE9 A;  1ABQ A;  2DVJ A;  2OAW A;  3I9Q A;  2YUN A;  4JJC A;  2OI3 A;  1WXB A;  1A0N B;  3VS0 A;  1UJY A;  4M4Z A;  1FMK A;  1UGV A;  3R6N A;  2D8H A;  2RPN A;  4AFU C;  2ROT A;  2D0N A;  3EG3 A;  2W0Z A;  2NWM A;  2RF0 A;  1QKW A;  1OPL A;  2GGR A;  4RTU A;  2RNA A;  2IIM A;  2L3S A;  2A37 A;  1BK2 A;  2L3Q A;  1I1J A;  2LP5 A;  4JZ3 A;  2A36 A;  4OMP A;  1JEG A;  4JJB A;  2BZ8 A;  1U5S A;  2DL7 A;  2ED0 A;  1E7O A;  3NHN A;  1WIE A;  2PZ1 A;  1X2Q A;  2ED1 A;  2KRS A;  1X27 A;  4F16 A;  2FEI A;  4J9H A;  1KFZ A;  4KRT A;  4RTV A;  2MIO A;  1NYG A;  1WI7 A;  1YWP A;  2A08 A;  2DIL A;  2EKH A;  3FJ5 A;  3VS4 A;  1GFD A;  1GBR A;  4ZNX A;  1W1F A;  2J6O A;  4E6R A;  1K4U S;  2CRE A;  2LJ3 A;  4LN2 A;  1YWO A;  2RQT A;  3TSW A;  1WFW A;  2KYB A;  2LZ6 B;  4HVW A;  1T0J A;  1LCK A;  2J06 A;  2YUO A;  1ZX6 A;  5IHN A;  3M0R A;  2KT1 A;  1RI9 A;  2GTJ A;  2DF6 A;  2E5K A;  4K11 A;  4R0K A;  1PWT A;  4CC2 A;  1PNJ A;  1BB9 A;  1PRL C;  2LCS A;  2KE9 A;  2AKL A;  1UHF A;  2KXD A;  1E6H A;  2KXC A;  2BZY A;  2K6D A;  4F14 A;  2FRW A; 
#chains in the Genus database with same CATH topology
 1WJR A;  2RJF A;  2MOX A;  3L2Q A;  2EQU A;  5LJ5 d;  5IXB A;  4ZTJ A;  1WJS A;  2M16 A;  4E7L A;  2E6N A;  1EX4 A;  3GIB A;  2OTL Q;  1VQO T;  3VRY A;  1NYF A;  2COW A;  4QT7 A;  3JV3 A;  1MUZ A;  3QPH A;  4FSX A;  5IHK A;  1LJO A;  3LGF A;  2LX7 A;  1Z9Z A;  3CCS Q;  2FZC B;  1TUD A;  2L0A A;  2VGM A;  1GCQ A;  3CCL T;  3CBP A;  3VS2 A;  2A28 A;  1D3B B;  2DE0 X;  2NUP A;  2YLB A;  1QLY A;  2MI6 A;  3CME A;  1VQP Q;  1FXX A;  3RNJ A;  1H64 1;  3M4G A;  1KK7 A;  2V8J A;  4DEY A;  4KUI A;  4M78 B;  1X75 C;  1B3Q A;  5ECA A;  3C0C A;  1YJ9 Q;  5LJ5 j;  4C5H A;  5D6Y A;  1YFN A;  2DYB A;  1HYO A;  1QVP A;  2YRD A;  4QKU A;  3EFS A;  1HSQ A;  4M7D E;  2C0O A;  2DZ9 A;  2D6F A;  3G6E T;  4M7A B;  1QMC A;  2CP3 A;  2JVV A;  4A54 A;  2CSQ A;  2HMA A;  2JTE A;  2FO0 A;  4LUD A;  1H3Z A;  1QWE A;  1PSE A;  5IXF A;  2DJQ A;  3H0H A;  2M0Y A;  2FVU A;  3VRZ A;  3RIR A;  3SB2 A;  3CCQ T;  4NOY A;  2R57 A;  4OMN A;  3F70 A;  4WTO B;  1NEG A;  1YBY A;  2QAS A;  1V1C A;  1AZG B;  2JM9 A;  1X6O A;  2XI9 A;  5KYX B;  3H41 A;  3EFO B;  1KJW A;  4M77 E;  5GMK l;  3L2W A;  2R5M A;  4ANJ A;  2OTJ Q;  1ACM B;  1FMV A;  4E7J A;  3BFM A;  2RK1 A;  2LQ8 A;  2PVG B;  2VV5 A;  4XU3 A;  1MHN A;  1TUC A;  3PT9 A;  1M1F A;  3JRZ A;  5GAN d;  1K1Z A;  2QQ9 A;  5GAM d;  3OW2 A;  1S72 T;  4B9X A;  3VU3 C;  1XJW B;  1Q95 G;  4L6V 5;  1CKB A;  3X28 B;  1KG1 A;  3OBY A;  1WGS A;  4L5G A;  3JCM e;  1VQK T;  3HRS A;  1GRI A;  2HD0 A;  2IPO B;  4M78 E;  1Q7Y C;  1RUW A;  1VQ5 T;  2NUP B;  1AZE A;  4CRI A;  3VYG A;  1HD3 A;  1OYX A;  5FWC A;  5A0G A;  3HPW A;  2M9U A;  3I56 Q;  1VQL A;  3A8O B;  4BDY A;  3HHT B;  3CPW S;  1I5O B;  2EBP A;  4M7A E;  4E2F B;  2KMT A;  3A8G B;  1KD1 U;  2E70 A;  3RKY A;  1Y57 A;  5GAN j;  4MDX A;  3G71 Q;  2NYS A;  4E47 A;  1G3Y A;  2MK5 A;  4JLG A;  3OSS C;  2K4Y A;  2Y4Y A;  1VYV A;  1VQ6 A;  1M5Q 1;  1SF9 A;  2QYZ A;  2RI5 A;  1M1K C;  1FWZ A;  3VYH B;  3GBQ A;  2HL5 C;  4M75 G;  2DTI A;  3KBG A;  3M0U A;  2RJE A;  1PSF A;  2K5L A;  4JJN K;  4RTY A;  5AT1 B;  3S6W A;  4XTU A;  4RG8 A;  2EQI A;  1ZSG A;  3QSU A;  1Q82 U;  4AG2 C;  1MMG A;  1Z9Q A;  3GPL A;  5GAN 6;  1C6V X;  4LD6 A;  2O88 A;  2H3E B;  1AEY A;  1UJ0 A;  3VS5 A;  1M2O A;  1JO8 A;  2CP6 A;  4FU6 A;  3RBB B;  1MMN A;  4N4I A;  1I5L A;  3CCR Q;  3URG A;  1VQ8 A;  2E12 A;  5IH2 A;  3V8K A;  4VUB A;  5M9O A;  3G4S T;  1SHG A;  1YCY A;  3PIO A;  4XAX B;  2RHX A;  2EGA A;  2JZ2 A;  4E7I A;  4M75 A;  4KUL A;  1QP2 A;  1ZLM A;  2EJG A;  4M75 F;  1KC8 R;  3JB9 I;  4XU0 A;  1GBQ A;  3O5Z A;  3CCV T;  1K9M C;  3SFM A;  1K9A A;  1IRX A;  1KQS P;  3RDV A;  2YT6 A;  4KT0 E;  4XU2 A;  3TVT A;  3M5A A;  4M75 D;  3A8M B;  3EG0 A;  3VJP A;  2FPD A;  1G5V A;  1WX6 A;  4Y91 A;  2O31 A;  2WSC E;  4C5G A;  1M3A A;  2CKK A;  4BUG A;  1X43 A;  4CI0 C;  3JCM X;  2AT1 B;  2LX9 A;  3ZBD A;  4IUR A;  2JT4 A;  2JXB A;  5FW9 A;  4FW2 A;  3HSB A;  3JCM g;  2M51 A;  3O8V A;  3M0T A;  4J9I A;  3UA6 A;  3JB9 F;  3QJY A;  4PLL A;  3V7S A;  1YIT Q;  3H8Z A;  1VQM T;  1SEM A;  1VQP A;  1I4K 1;  5A0L A;  3CME Q;  1VOM A;  1X69 A;  2DO3 A;  2DTH A;  3NGP A;  2CYZ B;  1N9S A;  1X01 A;  3X25 B;  1YJ9 A;  1M9S A;  2CGH A;  4HT8 A;  3SEM A;  1B34 B;  4P5N A;  3GF5 A;  2LRQ A;  4HCZ A;  2DYI A;  3PMT A;  2KAF A;  5I22 A;  4BE2 A;  4A63 B;  2P0P A;  3CD6 A;  5HCK A;  4Z8A A;  5DY9 A;  1UE9 A;  2HSE B;  1FYN A;  2L3P A;  4N4G A;  4LE9 A;  4JJC A;  4DBQ A;  1ZSZ C;  4M75 B;  1G3W A;  2P0Q A;  1UGV A;  2QAZ A;  4AFU C;  2RPN A;  4DOV A;  5J39 A;  3OS2 A;  2RF0 A;  1OPL A;  2OTL T;  3JCM P;  4JRK A;  4NL2 A;  1BK2 A;  2EJ9 A;  2K2V A;  2LP5 A;  3OMC A;  5GMK m;  1U5S A;  4PL6 A;  1E7O A;  2D0Q B;  3CCS T;  2E3I A;  2X4X A;  5CVI A;  1KFZ A;  4KRT A;  2MIO A;  1NYG A;  1YWP A;  2DIL A;  3VS4 A;  1VQ7 A;  1GFD A;  2E65 A;  4E6R A;  1RAH B;  3HL8 A;  2A7Y A;  3NFC A;  3CCM T;  1K73 U;  2G3R A;  2ZPF B;  3OQ5 A;  5KYU A;  2KVQ G;  3MEU A;  1ZX6 A;  1WPY A;  1OU8 A;  2ZCF B;  5IHN A;  3M0R A;  4BB7 A;  4M7D A;  2GTJ A;  3EH1 A;  3ER0 A;  3OYK A;  3PTA A;  1BB9 A;  1WHH A;  4B9W A;  4EMG A;  6AT1 B;  2JN0 A;  2BE7 D;  2BIV A;  3GP8 A;  3QDR B;  2EQK A;  1VQ4 Q;  4LD9 K;  3I5R A;  2R58 A;  3X26 B;  2P84 A;  2VUB A;  3E9G A;  2J6K A;  4DBH A;  1QVF A;  5I11 A;  2MCN A;  1O75 A;  2K3X A;  1RAG B;  1ZA1 B;  2RHI A;  1KD1 R;  1VQL Q;  2O9S A;  4BI3 A;  1YCS B;  2C0I A;  4M77 A;  1MNE A;  4E7Z A;  2RN8 A;  4GBQ A;  1QW1 A;  1XQH A;  2KRM A;  2I0N A;  2GBQ A;  4HCB A;  4RKU E;  3JCM W;  2P0K A;  2KSS A;  4D8D A;  4HXJ A;  4M75 E;  4R55 A;  1LPL A;  1IGQ A;  2LQW A;  1OEB A;  2OTJ T;  1W2B A;  2QTX A;  5FRM A;  2SEM A;  1R0B G;  1YI2 T;  2CP2 A;  2ABL A;  3GOX A;  1RLQ C;  4PJO C;  2LCL A;  2X4W A;  1KIK A;  2QK0 A;  3MEA A;  4BD3 A;  3CBO A;  2EIF A;  3WVD B;  5GAN 5;  1D3B A;  1Q82 R;  2KYM A;  1KD1 C;  2JUF A;  3OYJ A;  3CBM A;  3GNF B;  1M4Z A;  2V8I A;  1W70 A;  5CKE A;  2JNG A;  2ROL A;  3DLM A;  5LJ3 d;  4FT2 A;  5KH6 A;  5GMK j;  1RLP C;  4MML A;  4IUU A;  4J9E A;  4RCB A;  2CZ6 B;  3PVQ A;  4FCY A;  5LJ5 h;  2YRV A;  3E19 A;  3CCR A;  3EFR A;  3RER A;  1VQ8 Q;  2KK4 A;  4AT1 B;  3RMS A;  3H0I A;  2QDY B;  2ECZ A;  2RHZ A;  4KH0 B;  5J26 A;  5KYU B;  4J7I A;  1VQO A;  1UGQ B;  1UEB A;  2FHD A;  1YIJ Q;  4IUT A;  1OX9 A;  4QQD A;  2HKN A;  2K3B A;  1IXD A;  1IO6 A;  2A0F B;  3LWI A;  2LMJ A;  3G71 T;  2RMO A;  3CCL A;  5FWB A;  4N4H A;  2KNB B;  4N0A A;  5KE3 A;  1I0C A;  2WAC A;  3QHS A;  3AT1 B;  4B6M A;  3R6O A;  2ZPG B;  4J9D A;  1YHQ Q;  1WHM A;  3FC3 A;  1BI3 A;  1VQ9 Q;  4C0G A;  2EYY A;  2XD0 A;  4XTV A;  3UT1 A;  1YJN Q;  3L42 A;  1Q81 C;  2CP7 A;  3KFV A;  4C8Q C;  1JXM A;  2K2M A;  3DLL A;  3DB3 A;  3M0Q A;  2RJD A;  4M77 B;  1TG0 A;  2LJ1 A;  1VIE A;  4OB3 B;  3HFN A;  2MWO A;  2CP5 A;  2CT4 A;  3MHX A;  1OX8 A;  1X6G A;  1ZUY A;  5LJ5 f;  4C92 C;  3DKM A;  3UA7 A;  1OZ2 A;  3LYI A;  5GAO r;  4DA4 A;  3OYL A;  3KXT A;  2AHJ B;  1EZZ B;  2YUP A;  2BE9 B;  3FJP A;  4XK8 E;  4J9B A;  1UTI A;  2QQA A;  3REB B;  3A8L B;  2K57 A;  2B86 A;  5I2S A;  5IHI A;  4LXC A;  2HL3 A;  4FL6 A;  2ZZD A;  1YIT A;  1RL2 A;  4OP0 A;  4OMO A;  4A4G A;  2E4H A;  1UG1 A;  7AT1 B;  3VS1 A;  4BDZ A;  2RJC A;  1TTH B;  3BE3 A;  3JCM J;  5KCH A;  1QVG A;  2GCX A;  3CXC A;  2CH4 A;  2HBP A;  3LW5 E;  1M8M A;  3L2V A;  4J7F A;  1WHG A;  2DL4 A;  3QO3 A;  3TRE A;  3IQL A;  1WYX A;  2H8H A;  2W10 A;  2CP0 A;  1EFN A;  2D8J A;  5GAN h;  2BUD A;  1U1S A;  5FU7 B;  5GAM h;  4GLM A;  2X4J A;  5L23 A;  2COY A;  3SWN C;  4HVV A;  1K0S A;  1S72 A;  2X4Y A;  2VAS A;  3CD6 Q;  4IUQ A;  4BY6 C;  1RAE B;  4HA8 A;  3CC7 T;  4JS4 A;  3QYG B;  2KGT A;  2KI7 A;  1QCO A;  3QII A;  2KRO A;  5DM7 R;  1SPK A;  3JCM d;  1NEB A;  1JJ2 S;  1NLO C;  2XDD A;  4MZM A;  4JS5 A;  1QCN A;  1ZHI A;  4IKF A;  1BCO A;  1NPR A;  3FB9 A;  2DJZ A;  3TEE A;  4EMK C;  3S3M A;  1JQQ A;  2EGC A;  1HJD A;  4AFS C;  4Y92 A;  3HKS A;  1VQ7 Q;  4LDU A;  1K73 R;  2IVW A;  1Y07 A;  2WSE E;  1UDL A;  3TQ7 P;  3E1S A;  3CME T;  1QP3 A;  3OYE A;  3CC4 T;  4FSS A;  3S3N A;  2YXY A;  1NPP A;  2KRN A;  3CMA T;  2O2O A;  5GAM f;  2I2L A;  3HP9 A;  4F7U G;  2RQR A;  2V1R A;  4QQ6 A;  1Y96 A;  1VA7 A;  2QDL A;  2FG0 A;  4ZN1 A;  4JJD A;  5GAN 8;  4PFZ A;  1RAF B;  2HNI A;  3JCM c;  1VQ4 A;  2LNV A;  1K73 C;  4X9C A;  1D09 B;  1E6G A;  1UEC A;  2RO0 A;  4XTX A;  2HBW A;  4Y28 E;  3BY7 A;  1MV0 B;  3M0P A;  2QA4 Q;  3QG1 A;  2OAU A;  3RMQ A;  5KE2 A;  4PJO G;  2EYX A;  3U23 A;  2RHY A;  1WNL A;  2EW3 A;  2DNU A;  4C5I A;  4ZGE B;  1NJI U;  1M3B A;  2EKO A;  2EJF A;  1YN8 A;  2GNC A;  3NTI A;  2LJ0 A;  3PFS A;  4NS5 A;  4DBF A;  3EG9 A;  2COZ A;  4AFZ C;  4KH1 B;  5C6S A;  3M0S A;  2XMF A;  4JRP A;  2MMP A;  1T3L A;  1RI0 A;  8AT1 B;  2X3X D;  2JS2 A;  1M30 A;  4F7U F;  1O9S A;  1S1N A;  3E9F A;  3PMI A;  1K8A U;  3I55 A;  1MGQ A;  2LDM A;  4XU1 A;  1PD1 A;  4D8K A;  3HRT A;  2X3W D;  2DL3 A;  1SSF A;  2NUZ A;  1SRL A;  1AWJ A;  3OYB A;  3UDC A;  2RQV A;  5KYW B;  4PKC C;  3EAE A;  5CKB A;  2GQI A;  4C0F A;  4PJO F;  2CSI A;  5C0M A;  1N8R R;  4LDY A;  3OS1 A;  1KSW A;  3OS5 A;  1B34 A;  2OAW A;  2V8K A;  3I9Q A;  2X35 A;  2ROT A;  3L2R A;  2D0N A;  3EG3 A;  2W0Z A;  3A5Z B;  2IIM A;  3M57 A;  4BAC A;  1KQ1 A;  2L3S A;  2A36 A;  1VQO Q;  2BZ8 A;  2LQK A;  2RHU A;  1YIJ A;  1WIE A;  4C8Q G;  4PJO D;  2DAQ A;  1X27 A;  2FEI A;  2PQW A;  4OF1 A;  1Y96 B;  1GBR A;  1P92 A;  2J6O A;  3CCL Q;  4QVD A;  4C92 G;  3C95 A;  1YHQ A;  4LN2 A;  3HRU A;  1VQ9 A;  1VQ6 T;  3P8D A;  3TSW A;  2HZY A;  2YUO A;  3J80 E;  2DVE A;  2GFU A;  1YJN A;  4PFO A;  4WF2 A;  3H6Z A;  2E5K A;  4CC2 A;  4Q5W A;  1PRL C;  2HKQ B;  3ZEH A;  9ATC B;  1UHF A;  1HXD A;  2KXD A;  2MF2 A;  2KXC A;  2DXC A;  3CCJ A;  3EG9 B;  4II1 A;  2HAX A;  4KBM B;  1ZQ1 A;  1TOV A;  4QVC A;  3V7C A;  1KC8 C;  1C1A A;  5CO7 A;  3FEO A;  4C8Q A;  1HK9 A;  3ASK A;  1SHF A;  4F7U B;  4C8Q F;  1G2B A;  2EVR A;  2FYK A;  5D6X A;  1FMW A;  3UF4 A;  1VQ8 T;  3PVL A;  3QBY A;  3VUB A;  3WVE B;  5FRO A;  2SRC A;  2CZ1 B;  4C92 F;  3CCQ Q;  4PJJ A;  2QEX T;  1VIF A;  1LNX A;  2XDB A;  4XTZ A;  4PK4 A;  4E7S A;  2RB6 A;  4FT4 A;  2M02 A;  2ZPI B;  4PJO B;  8ATC B;  2VYT A;  4C8Q D;  3NTK A;  5HK3 A;  5CIU A;  1TWB A;  3A1P A;  4CC4 B;  2XU8 A;  3FDR A;  4Z89 A;  5FU6 B;  3CC2 A;  3D7S B;  3RKW A;  3PNW C;  3UAT A;  4C92 D;  3MO8 A;  3Q1J A;  4ZTF A;  2LC4 A;  2KQW A;  3VS7 A;  4OGE A;  3VKI A;  2ESW A;  1DJ7 B;  3FIF A;  1S72 Q;  1VQN A;  1PC0 A;  4YTL A;  4OMM A;  2XIC A;  1OQK A;  4OGC A;  1V29 B;  4C0D C;  1Q86 R;  1U1T A;  4J83 A;  3LWH A;  3CCU A;  3H9N A;  2QQR A;  3SWN A;  5I21 A;  2EGE A;  2FZK B;  5GAM g;  1IHW A;  1N6A A;  1KQS A;  2R5A A;  3LH5 A;  2F69 A;  1NBE B;  4FW1 A;  3MPU B;  4HT9 A;  3EGD B;  5GMK h;  3SDZ A;  1JJ2 P;  3RES A;  3MP8 A;  4A4H A;  3QJ6 A;  1NLP C;  1WQ7 A;  3M58 A;  1MMD A;  2E5Q A;  2K5F A;  3M54 A;  4IUP A;  3JAM E;  5KYN A;  1VQP T;  2ZGW A;  3HFO A;  1M27 C;  1U3O A;  4KGZ B;  1G3T A;  1M8V A;  1TSF A;  4F7U E;  3CCE A;  1D0Y A;  2F5K A;  2RM4 A;  1YJ9 T;  5CAI A;  4E7K A;  4C8Q B;  2HDA A;  1TXQ A;  1SRM A;  4KGV B;  3INZ A;  1YI2 A;  2DRM A;  2D1X A;  3MP6 A;  3L2Z A;  3MJX A;  4RTT A;  2E1H A;  2NUT A;  2LT4 A;  2BZX A;  3PIP A;  2EWN A;  2BKD N;  1OU9 A;  5LJ3 h;  4PJO E;  3CD6 T;  1W6X A;  3BDU A;  3TSZ A;  3M9Q A;  4IIM A;  1NJI R;  3G1J A;  1AWW A;  1OUL A;  2QA4 A;  2F2W A;  2AIR B;  5EC7 A;  1RAD B;  2MYS A;  2ENM A;  4C0Z A;  2DD5 A;  3WXM B;  4QVZ A;  4OB0 B;  2NLU A;  3THK A;  2DTO A;  3OMG A;  4PFP A;  3G4S Q;  2JJ9 A;  3EHR A;  2KDS A;  3CEY A;  4J5Y A;  1K8A R;  2YRC A;  5CR2 A;  1CKA A;  2QGG A;  1MV3 A;  2Y90 A;  2EPD A;  2HEQ A;  3I55 Q;  2JMC A;  1YJW A;  4X1V A;  4QW2 A;  2F2X A;  3OA6 A;  2XG8 D;  3AHU A;  1UHC A;  1X6B A;  2V26 A;  3SWN B;  5GAN 2;  2YSQ A;  4M7A G;  4A4F A;  1AWO A;  2E6Z A;  4BY6 B;  3CCV Q;  4HCK A;  2DA9 A;  2IG0 A;  5LJ3 f;  1QKX A;  3ULR B;  1SSH A;  3M59 A;  1D1C A;  1MND A;  1PG5 B;  3E2U A;  2L2P A;  2CZ0 B;  5CK9 A;  4JRI A;  3ZFJ A;  2J6F A;  2FRY A;  2DMO A;  3UPU A;  1N8R U;  2P4T A;  1K76 A;  1BU1 A;  4DEX A;  4WCI A;  4EMK B;  4C8Q E;  1H92 A;  4A53 A;  3I56 T;  1Q82 C;  3GNG A;  4ESR A;  4J9G A;  2YWW A;  1ZA2 B;  3VUZ A;  1BI2 A;  3MET A;  4L59 A;  3VS3 A;  4C92 E;  2RQU A;  3OYD A;  2KBT A;  1RAC B;  4CC3 A;  3REA B;  5FLX E;  2CUD A;  1OI1 A;  2NUT B;  1H3H A;  3M55 A;  2GTO A;  1K9M U;  4AMC A;  1VYT A;  2PVD B;  2DIG A;  2CDT A;  3EHQ A;  4E7H A;  2DLP A;  5CQX A;  3JB9 H;  1M3C A;  2WSF E;  4GY5 A;  4HKE A;  3EGU A;  1AOJ A;  3FRN A;  1BYM A;  3MEW A;  3VS6 A;  5GAO l;  3CPW A;  1PRM C;  5CKD A;  2PU9 B;  4ELZ C;  1XNI A;  2YUQ A;  1OOT A;  2QGF B;  3CCJ Q;  4M7A D;  4XTW A;  4JUV A;  2ZPB B;  5CKF A;  3G6E A;  4ME7 A;  4X9D A;  3OSV A;  2QTV A;  5GJW B;  3CC7 A;  3JCM h;  3J81 E;  3CCR T;  1PD0 A;  1AD5 A;  4A4K A;  2JS0 A;  1CSK A;  1UGP B;  1U06 A;  1WA7 A;  2RH2 A;  2LQN A;  3CCQ A;  1W4S A;  4FIB A;  2FB7 A;  1I8F A;  2CT3 A;  1ZBJ A;  2ZPE B;  2BTT A;  2M1H A;  4O6J A;  2O4X A;  3EG1 A;  3OW2 P;  4DBR A;  5D7U A;  4OMF B;  4EIK A;  1MMA A;  2CH4 W;  1QVF S;  3CC2 Q;  3CCM Q;  2AK5 A;  1RAA B;  4PJL A;  4JRQ A;  2A3L A;  3CC4 A;  4BI4 A;  1I81 A;  3CMA A;  1M2V A;  2E3H A;  3JCM b;  4MMK A;  3L1A A;  1PKS A;  3I35 A;  1VQN Q;  4ZGD B;  1QQJ A;  2K7A A;  2DXU A;  4ATO A;  2DXT A;  1GL5 A;  5LJ5 e;  3CCU Q;  2VVK A;  1VQK A;  1ABQ A;  2DVJ A;  4NL3 A;  1W2B S;  3JCM f;  1AT1 B;  4PNO A;  1Q86 U;  1A0N B;  4M4Z A;  2DFU A;  2D8H A;  3FLG A;  5KYW A;  1BKB A;  1VQ5 A;  1ZSZ A;  2NWM A;  4RTU A;  1WZO A;  3TCJ A;  2GGR A;  2RNA A;  1SKU B;  1G8X A;  2A37 A;  2L3Q A;  4FM4 B;  5GAO n;  4JZ3 A;  1TUG B;  4OMP A;  2VB6 A;  1PCX A;  4JJB A;  1WQW A;  4LDV A;  2JTM A;  2HQX A;  2DL7 A;  2ED0 A;  1TS9 A;  1YIT T;  3QDF A;  4MZP A;  2ED1 A;  1XTD A;  5HK0 A;  2KRS A;  4J9H A;  2L89 A;  3M4Y A;  1WI7 A;  1WHL A;  2A08 A;  3OYN A;  1W1F A;  1R77 A;  3KUF A;  4PJM A;  3CCE Q;  1YWO A;  2RQT A;  5L8R E;  2K3Y A;  2GQV A;  2X9H A;  5GAN f;  4M7D C;  4HVW A;  1T0J A;  2VXE A;  1Q7Y R;  3EGX B;  1BIB A;  1NZ9 A;  1YI2 Q;  2XHC A;  2KT1 A;  2DF6 A;  4K11 A;  2O01 E;  2HQH A;  1PNJ A;  2LCS A;  2AKL A;  1E6H A;  4JDS A;  4GLK A;  4DOW A;  4BE1 A;  1U8R A;  1D0X A;  2K6D A;  1KHC A;  2O4X B;  1RAI B;  2D9T A;  3PGG A;  1J3T A;  2VGN A;  4M77 C;  4OML A;  2DZC A;  1M1K R;  5LJ3 g;  1ARK A;  2DBK A;  5HKC A;  2DM1 A;  3QZ5 B;  5IT9 E;  3P8H A;  3G4S A;  1RAB B;  1NM7 A;  4J8O A;  5FRN A;  4J9F A;  3ZL7 C;  1R0C B;  4F7U A;  1M2V B;  1QCF A;  2FZG B;  3JCM Q;  1UUE A;  3C12 A;  5GAO q;  1UGS B;  3PE0 A;  4RG2 A;  4RTX A;  2LCC A;  1IRE B;  2DPP B;  2F2V A;  2RI2 A;  1YJW Q;  2K9G A;  5GAM j;  1LOJ A;  2C0T A;  4OVA A;  4J9C A;  5GAN e;  1GCP A;  1T3S A;  2LTO A;  5GAM e;  1M90 U;  2FPF A;  3CCV A;  5CKH A;  5A2Q E;  4PJO A;  1BBZ A;  1ZSZ B;  2OX7 A;  2E41 A;  2LNH B;  4M78 C;  2RQW A;  1AHJ B;  4C0D B;  5LL6 S;  1VQ4 T;  1JRI A;  1M1G A;  2VXF A;  2VKN A;  2F1L A;  2PUO B;  1OPK A;  1FX7 A;  2EAY A;  3MEV A;  4KGX B;  5FU7 C;  4KUD K;  1QVG S;  1JXO A;  3CXC S;  2XKO C;  1V76 A;  2EFI A;  3MCA B;  4M7A C;  3OY9 A;  1VQL T;  4O5V A;  4FYV B;  3EG2 A;  2EYW A;  5I2M A;  5GAN 4;  5LJ5 g;  1K9M R;  4PJN A;  3V8L A;  3BW1 A;  1R8O B;  2EYZ A;  2DL5 A;  4CC7 A;  3CPF A;  1N8R C;  1WXT A;  2J7I A;  1YNZ A;  4N0A C;  1YP5 A;  1AWX A;  4JZ4 A;  1VQM A;  3HTR A;  1X2K A;  2QEX A;  3EGD A;  3X24 B;  1Q81 U;  3VV0 A;  3LGL A;  4IIO A;  1BI1 A;  3I55 T;  1JBM A;  4J6X A;  1N5Z A;  5GAO m;  5CQY A;  2M0O A;  2G6F X;  5CCA A;  3A98 A;  3JB9 G;  3NTH A;  2EQJ A;  2YDL A;  3N5B B;  3ME9 A;  3MP1 A;  1K0X A;  2DET A;  1ZUK A;  2HSP A;  5DLQ E;  2AZS A;  2Y4X A;  1GXI E;  1WDX A;  4V2S A;  2FL7 A;  2HQE A;  3UWN A;  3OYY A;  1B07 A;  2JMA A;  2AZV A;  3G6E Q;  1D1B A;  3SHW A;  2O9V A;  2L8D A;  2E10 A;  3CC7 Q;  4RUG A;  5GAN 3;  3M56 A;  1PHT A;  4IUV A;  4C92 A;  3QWX X;  3OW2 S;  1GCQ C;  4A4E A;  2OTL A;  3M53 A;  2J05 A;  2RK2 A;  5KYY A;  1YIJ T;  3BDL A;  2PTK A;  2K5I A;  4ELY C;  3CCS A;  4AG1 C;  3G7Z A;  5IN1 A;  5KCO A;  3LX7 A;  2JM8 A;  1AVZ C;  1T0H A;  3LLR A;  2DEU A;  5AYF A;  2GFA A;  3OYH A;  4OB2 B;  4UC4 A;  1YHQ T;  2RD1 A;  2KEA A;  1VQ9 T;  5A0D A;  2K79 A;  3CCM A;  2MPX C;  5GAN 7;  1B7T A;  3DB4 A;  1ZBX A;  4HCC A;  2RI3 A;  3C94 A;  3CC4 Q;  1YJN T;  2XK0 A;  1I07 A;  3CMA Q;  5HY6 A;  1NE8 A;  1QVF P;  4EMH A;  2PNI A;  2JTF A;  3JB9 D;  3LH0 A;  3CCJ T;  5GAN g;  3J7A F;  5DLO A;  1VQK Q;  2HCK A;  4LNP A;  1WHJ A;  1ABO A;  2MWP A;  3L2U A;  2QG9 B;  2V1Q A;  1G83 A;  4RTZ A;  1VQ5 Q;  1IGU A;  3H0F A;  4M7D G;  4JPB W;  2OJ2 A;  2AKK A;  4OMQ A;  2XID A;  1VUB A;  1W2B P;  4Z88 A;  1C0M A;  2ZAE A;  2QI2 A;  2E64 A;  4EMK A;  4MDW A;  2Z0W A;  4Z02 A;  3QXE B;  2DKG A;  1OZ3 A;  2YLC A;  1Q86 C;  1KHI A;  4DQ2 A;  2L5Q A;  1F1B B;  2OTJ A;  3QUI A;  1BIA A;  3TU4 K;  2CS7 A;  2DXB A;  2GF7 A;  4D6W A;  2VWF A;  3CC2 T;  4M77 G;  1IHV A;  2JW4 A;  1Q7Y U;  4BI8 B;  2JOY A;  4C92 B;  1H8K A;  1QWF A;  2P4R A;  3QKJ A;  3RUX A;  4TVR A;  1VQN T;  1XOV A;  1NG2 A;  4QQG A;  3OYM A;  3QZ9 B;  5J3B A;  1OV3 A;  4HVU A;  4M7D F;  1ZUU A;  5D6W A;  1WXU A;  5KYY B;  1G3S A;  2DRK A;  4RTW A;  1UB4 A;  2C06 A;  1WLP B;  2VC8 A;  3CCU T;  2B8A A;  2EQM A;  1UFF A;  2DEQ A;  1UGR B;  1TH7 A;  2X51 A;  1Y0M A;  2CUB A;  3V7R A;  2DX1 A;  3I5S A;  2LVM A;  5GMK i;  3MKD A;  1WJQ A;  3NMZ C;  2LT1 A;  3I56 A;  2DBM A;  1M1K U;  2KT8 A;  4M78 G;  4M7D D;  1VQ7 T;  1VYU A;  2DL8 A;  2ATC B;  1Y7X A;  2F5T X;  5GAO p;  3JB9 J;  4XTY A;  4ORZ A;  3X20 B;  4X34 A;  3T9N A;  2RA2 A;  4M77 F;  4J6W A;  1NJI C;  2KR3 A;  2QQS A;  3G71 A;  1M90 R;  3RKX A;  1IB8 A;  3OS0 A;  3OYC A;  1JJ2 A;  3CCE T;  2DK3 A;  2MAM A;  4F17 A;  2XDP A;  3CPW P;  1JU5 C;  4LUE A;  3CQT A;  3P8B B;  1VQ6 Q;  1Y71 A;  4FYW B;  4PLI A;  1GFC A;  1BI0 A;  2FPE A;  4ZGJ B;  2DD4 A;  3OYA A;  4LDX A;  3QWY A;  1IZ6 A;  3NPF A;  2KY9 A;  4AFQ C;  1K8A C;  3JCM V;  4M77 D;  1KQ2 A;  1D0Z A;  2PVO B;  5FU6 C;  3JSC A;  4MZT A;  1PKT A;  4R56 A;  5GJV B;  1SG5 A;  2L3R A;  4M78 A;  2YUN A;  2QXF A;  2QA4 T;  2OI3 A;  2DER A;  1WXB A;  1M90 C;  5EG2 A;  4J6Y A;  3VS0 A;  4LDW A;  1UJY A;  1FMK A;  4M78 F;  3OYG A;  3R6N A;  3C4S A;  3OBW A;  1N9R A;  2H3J A;  1TU0 B;  2PUK B;  1QKW A;  5GMK e;  2DIQ A;  3EH2 A;  4M75 C;  1N27 A;  1I1J A;  4RMO A;  1JEG A;  1QVG P;  3CXC P;  1BCM A;  4M7A A;  3NHN A;  3SD4 A;  1Q81 R;  2PZ1 A;  1X2Q A;  4EPC A;  4M7A F;  4F16 A;  4FYY B;  4RTV A;  4XQ3 A;  1VQM Q;  2EKH A;  3FJ5 A;  5IAY A;  2QEX Q;  4ZNX A;  2EYQ A;  4C5E A;  4M7D B;  4OB1 B;  1K4U S;  4BE0 A;  4RCC A;  4M78 D;  2CRE A;  2LJ3 A;  3A8H B;  1YJW T;  2QQB A;  3OYF A;  1WFW A;  4EDU A;  2KYB A;  2LZ6 B;  1WHK A;  1KQS S;  1LCK A;  3S3O A;  3V8J A;  2J06 A;  1PM3 A;  4FYX B;  1D1A A;  5LJ3 j;  2YHT A;  4ZN3 A;  1RI9 A;  3GLX A;  1JB0 E;  1KC8 U;  4R0K A;  1PWT A;  5KYX A;  3EFO A;  3OB9 A;  5LJ3 e;  3QYH B;  3OYI A;  2KE9 A;  1EIF A;  2CZ7 B;  4JLI A;  2BZY A;  4F04 B;  3EGX A;  2ZPH B;  1LVK A;  3RR6 A;  4F14 A;  2FRW A; 
#chains in the Genus database with same CATH homology
 2MOX A;  5IXB A;  2J6K A;  1SHF A;  5I11 A;  2MCN A;  1J3T A;  1G2B A;  2EVR A;  3UF4 A;  4OML A;  3VRY A;  3PVL A;  1NYF A;  2O9S A;  1ARK A;  2DBK A;  4QT7 A;  2DM1 A;  3JV3 A;  1MUZ A;  1YCS B;  2C0I A;  5IHK A;  2RN8 A;  4GBQ A;  1NM7 A;  2SRC A;  2LX7 A;  1Z9Z A;  2KRM A;  2I0N A;  2GBQ A;  4J9F A;  1TUD A;  3ZL7 C;  2L0A A;  1GCQ A;  4D8D A;  1QCF A;  1UUE A;  4HXJ A;  3VS2 A;  2A28 A;  3PE0 A;  4RTX A;  2DE0 X;  1QLY A;  2LQW A;  1OEB A;  2F2V A;  2K9G A;  2C0T A;  3RNJ A;  4CC4 B;  2SEM A;  4Z89 A;  4J9C A;  4DEY A;  2ABL A;  1RLQ C;  1GCP A;  1T3S A;  1B3Q A;  1KIK A;  5ECA A;  2FPF A;  3UAT A;  3C0C A;  2KYM A;  1BBZ A;  2DYB A;  2LNH B;  1W70 A;  2RQW A;  3VS7 A;  2ESW A;  2ROL A;  1HSQ A;  2VKN A;  2C0O A;  1OPK A;  4OMM A;  1RLP C;  4J9E A;  2CSQ A;  2JTE A;  3PVQ A;  2FO0 A;  1JXO A;  4LUD A;  2EGE A;  1QWE A;  5IXF A;  2DJQ A;  3H0H A;  2M0Y A;  3LH5 A;  3EG2 A;  3H0I A;  2EYW A;  3VRZ A;  2ECZ A;  4OMN A;  2EYZ A;  1NLP C;  1NEG A;  2DL5 A;  1V1C A;  4CC7 A;  1AZG B;  2JM9 A;  1WXT A;  3H41 A;  2J7I A;  1KJW A;  1YNZ A;  2K3B A;  1YP5 A;  1AWX A;  1IO6 A;  4JZ4 A;  1M27 C;  1X2K A;  1U3O A;  2LMJ A;  2RMO A;  5FWB A;  2KNB B;  4IIO A;  1I0C A;  4J9D A;  1N5Z A;  2G6F X;  1TUC A;  2EYY A;  3A98 A;  2HDA A;  1SRM A;  2YDL A;  1K1Z A;  1K0X A;  2DRM A;  2D1X A;  1ZUK A;  2HSP A;  2AZS A;  4RTT A;  1WDX A;  3KFV A;  2BZX A;  1JXM A;  2K2M A;  1B07 A;  3M0Q A;  1CKB A;  2JMA A;  2AZV A;  1TG0 A;  2LJ1 A;  1W6X A;  3TSZ A;  3SHW A;  2O9V A;  2CT4 A;  4IIM A;  1X6G A;  1ZUY A;  1GRI A;  4RUG A;  1AWW A;  3UA7 A;  2F2W A;  1PHT A;  1RUW A;  1AZE A;  5EC7 A;  3QWX X;  1HD3 A;  2YUP A;  1GCQ C;  2ENM A;  4J9B A;  1UTI A;  5FWC A;  3REB B;  2B86 A;  2J05 A;  3THK A;  5IHI A;  2EBP A;  2PTK A;  3I5R A;  3EHR A;  4AG1 C;  4OMO A;  1Y57 A;  1UG1 A;  1CKA A;  3VS1 A;  2JM8 A;  1AVZ C;  1T0H A;  1MV3 A;  2EPD A;  2KEA A;  2HEQ A;  1VYV A;  2CH4 A;  2JMC A;  2K79 A;  1M8M A;  4X1V A;  2F2X A;  2DL4 A;  1UHC A;  3IQL A;  1X6B A;  1WYX A;  2H8H A;  2W10 A;  3GBQ A;  2YSQ A;  1EFN A;  3M0U A;  1I07 A;  2D8J A;  1AWO A;  4GLM A;  4HCK A;  4RTY A;  2DA9 A;  2PNI A;  5L23 A;  2EQI A;  4HVV A;  1K0S A;  1QKX A;  1ZSG A;  3ULR B;  1SSH A;  2L2P A;  4AG2 C;  1Z9Q A;  2HCK A;  2KGT A;  4LNP A;  2J6F A;  2FRY A;  2DMO A;  1SPK A;  2KRO A;  1ABO A;  2O88 A;  1AEY A;  1UJ0 A;  1K76 A;  1NEB A;  3VS5 A;  1BU1 A;  2V1Q A;  1G83 A;  1NLO C;  4RTZ A;  4WCI A;  4DEX A;  3H0F A;  1JO8 A;  3RBB B;  4JPB W;  2OJ2 A;  1H92 A;  2AKK A;  4ESR A;  4J9G A;  5IH2 A;  4OMQ A;  1JQQ A;  2EGC A;  4Z88 A;  1SHG A;  3VS3 A;  1HJD A;  4AFS C;  4Y92 A;  2RQU A;  2KBT A;  2EGA A;  4CC3 A;  3REA B;  2CUD A;  1H3H A;  1UDL A;  2GTO A;  1ZLM A;  1VYT A;  4FSS A;  2CDT A;  3EHQ A;  2KRN A;  2VWF A;  2DLP A;  1GBQ A;  1M3C A;  2O2O A;  3O5Z A;  3EGU A;  2JW4 A;  1AOJ A;  3VS6 A;  1K9A A;  2RQR A;  2V1R A;  1H8K A;  1QWF A;  2P4R A;  1PRM C;  1VA7 A;  2QDL A;  1XOV A;  2FG0 A;  1NG2 A;  4JJD A;  2YT6 A;  2YUQ A;  1OOT A;  1OV3 A;  4HVU A;  3TVT A;  1ZUU A;  3EG0 A;  1WXU A;  2FPD A;  2DRK A;  4RTW A;  1E6G A;  1WLP B;  1UEC A;  1WX6 A;  2O31 A;  1M3A A;  2HBW A;  5GJW B;  1UFF A;  1MV0 B;  1X43 A;  3M0P A;  1AD5 A;  1Y0M A;  2EYX A;  3U23 A;  2CUB A;  2JS0 A;  2DX1 A;  3I5S A;  2EW3 A;  1CSK A;  2JT4 A;  2DNU A;  2JXB A;  5FW9 A;  1M3B A;  1U06 A;  1WA7 A;  3NMZ C;  1YN8 A;  2LQN A;  2GNC A;  2LJ0 A;  2DBM A;  2KT8 A;  2M51 A;  1VYU A;  2DL8 A;  3M0T A;  4AFZ C;  4J9I A;  2CT3 A;  3UA6 A;  1ZBJ A;  4ORZ A;  2BTT A;  3M0S A;  2XMF A;  1SEM A;  3EG1 A;  1T3L A;  2KR3 A;  4EIK A;  1X69 A;  2X3X D;  2JS2 A;  1M30 A;  3NGP A;  1S1N A;  4F17 A;  2CH4 W;  1JU5 C;  2AK5 A;  4D8K A;  4LUE A;  3CQT A;  2X3W D;  1GFC A;  2FPE A;  2DL3 A;  3SEM A;  3QWY A;  1PKS A;  2NUZ A;  1SRL A;  3I35 A;  1AWJ A;  3NPF A;  2RQV A;  4AFQ C;  2K7A A;  5I22 A;  4A63 B;  2GQI A;  1GL5 A;  2CSI A;  5HCK A;  1PKT A;  4Z8A A;  5GJV B;  1UE9 A;  2VVK A;  1FYN A;  1KSW A;  2L3P A;  4LE9 A;  1ABQ A;  2DVJ A;  2OAW A;  3I9Q A;  2YUN A;  4JJC A;  2OI3 A;  1WXB A;  1A0N B;  3VS0 A;  1UJY A;  4M4Z A;  1FMK A;  1UGV A;  3R6N A;  2D8H A;  2RPN A;  4AFU C;  2ROT A;  2D0N A;  3EG3 A;  2W0Z A;  2NWM A;  2RF0 A;  1QKW A;  1OPL A;  2GGR A;  4RTU A;  2RNA A;  2IIM A;  2L3S A;  2A37 A;  1BK2 A;  2L3Q A;  1I1J A;  2LP5 A;  4JZ3 A;  2A36 A;  4OMP A;  1JEG A;  4JJB A;  2BZ8 A;  1U5S A;  2DL7 A;  2ED0 A;  1E7O A;  3NHN A;  1WIE A;  2PZ1 A;  1X2Q A;  2ED1 A;  2KRS A;  1X27 A;  4F16 A;  2FEI A;  4J9H A;  1KFZ A;  4KRT A;  4RTV A;  2MIO A;  1NYG A;  1WI7 A;  1YWP A;  2A08 A;  2DIL A;  2EKH A;  3FJ5 A;  3VS4 A;  1GFD A;  1GBR A;  4ZNX A;  1W1F A;  2J6O A;  4E6R A;  1K4U S;  2CRE A;  2LJ3 A;  4LN2 A;  1YWO A;  2RQT A;  3TSW A;  1WFW A;  2KYB A;  2LZ6 B;  4HVW A;  1T0J A;  1LCK A;  2J06 A;  2YUO A;  1ZX6 A;  5IHN A;  3M0R A;  2KT1 A;  1RI9 A;  2GTJ A;  2DF6 A;  2E5K A;  4K11 A;  4R0K A;  1PWT A;  4CC2 A;  1PNJ A;  1BB9 A;  1PRL C;  2LCS A;  2KE9 A;  2AKL A;  1UHF A;  2KXD A;  1E6H A;  2KXC A;  2BZY A;  2K6D A;  4F14 A;  2FRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...