1AZLA

G61v flavodoxin mutant from desulfovibrio vulgaris
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
b'PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWVDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
molecule tags Electron transport
source organism Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
publication title Modulation of the redox potentials of FMN in Desulfovibrio vulgaris flavodoxin: thermodynamic properties and crystal structures of glycine-61 mutants.
pubmed doi rcsb
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1997-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1azlA00
4ZVMA 3N39C 1FX1A 1YCGA 3B6IA 3NHSA 2R97A 3B6MA 3OWXA 4QOGA 3UXEA 1AKTA 1AKUA 2MTBA 3F6RA 3HR4A 1XT6A 2FOXA 3NHJA 2M6RA 2F1OA 2MWMA 3N3BC 3NHWA 3U7IA 4BMPB 1FVXA 1YDGA 1GG5A 4HEQA 5JROA 2FLVA 4NULA 3L9XA 3FX2A 5LLDA 1CZUA 1TLLA 4YAFA 2D5IA 1QHEA 3NHKA 4YALA 5NLLA 2HNBA 2OHHA 3F6SA 1BU5A 1DXQA 3JSXA 3K1YA 1OFVA 5NULA 1QR2A 2QX6A 2V9CA 3ESZA 4ZVLA 3FNIA 4C14A 1DX9A 3W79A 5LJIA 3FW1A 3NLLA 1V4BA 3L9WA 4ESEA 3FJOA 3NHLA 4N9QA 4NLLA 4DILA 5EA2A 1C7EA 3W78A 3NHFA 2AMJA 4BMOB 4C0XA 1SQSA 3UXHA 4CF6A 3U7RA 3NHRA 2M6SA 3HLYA 3OX1A 3QFCA 1VMEA 4QOFA 4CETA 3EYWA 3P0RA 5LBUA 3GAMA 4N65A 6NULA 2R96A 2Z98A 4M0CA 1RLIA 1J8QA 1CZNA 3NFRA 4FGKA 4H2DA 4ZVNA 1FLVA 4D02A 4PTZA 1CZKA 4YAUA 1ZWKA 1JA1A 1T5BA 3NHYA 4N82A 3NHUA 4S24A 3ESYA 1J9ZA 3LT5A 1C7FA 2FZVA 3K20A 1CZRA 4XDHA 3F90A 4Y7CA 2FDXA 5EAIA 3OVMA 5FA6A 3S2YA 2FZ5A 3OX2A 4H6PA 3KAPA 4R81A 5LBTA 5A4KA 5EMNA 2QMYA 3W77A 4DY4A 1YRHA 1FUEA 1FLNA 4QOIA 1H69A 2BF4A 3G5MA 1CZLA 3GFSA 1RTTA 1F4PA 1RCFA 1TIKA 1I1OA 2RG1A 4QOHA 2Z9CA 1AKWA 1FLAA 2V5UA 1ZX1A 3KEGA 2FVXA 4PTYA 1JA0A 1KBQA 2Q9UA 1D03A 2Q62A 2QX8A 4QODA 2B3DA 3R6WA 2X2PA 3KAQA 5FUQA 1QBGA 1YOBA 5F12A 1B1CA 2XODA 1AMOA 2W5UA 4C76A 3EDOA 1SG0A 1ZWLA 1AKRA 4GR9A 4ICIA 3TE7A 4U7GA 2QX9A 4XDGA 3O73A 2OYSA 2XOEA 1YKGA 1H66A 3B6KA 2N1MA 4ZVKA 1XYVA 3OX3A 1AKQA 4Y9RA 2BN4A 3GFQA 4J8PA 1J9EA 5LVAA 2GSWA 4U7HA 4FGLA 3OJXA 2BMVA 2MOKA 1AZLA 2MT9A 3ES9A 3NHPA 2A5LA 2FAXA 4PU0A 4YQEA 2FCRA 1D04A 2KLBA 3OWHA 3RPEA 1OBOA 1WSWA 1CZOA 1OBVA 3O2NA 1YCHA 1YCFA 1X77A 2OHIA 3QFRA 3FVWA 3HA2A 2ARKA 4QOJA 4YAOA 4YAWA 4GI5A 5ULLA 1FTGA 3QE2A 4C0WA 5BUCA 5FX2A 1QRDA 3TEMA 4FGJA 4LTMA 1T0IA 5TGZA 4LTDA 3ZHOA 4Y9UA 5F4BA 1AKVA 2QWXA 3N3AC 1KBOA 1RLJA 3B6JA 2ZKIA 2QR2A 4LTNA 1DXOA 3ESXA 4DIKA 1NNI1 2BZSA 5LMCA 2QX4A 4QOEA 2WC1A 3OJWA 1WSBA 2Z9DA 2HNAA 3F2VA 1D4AA 1FLDA 2OHJA 2KQUA 2Z9BA 2FX2A 4LAFA 1XI2A 5F51A 4F8YA 5B3KA 3SVLA 1E5DA 1J9GA 1BVYF 2X2OA 4GQIA 3KLBA 5B3LA 4OXXA 5LJLA 4FX2A 2HPVA 2BPOA 3GFRA 1CZHA 2V5VA 3LCMA 1AG9A 4LA4A 1AHNA 4U7FA 3TZBA 1XYYA 3D7NA 2QMZA 3W7AA 4HS4A
chains in the Genus database with same CATH superfamily
1RI2A 1W0JD 3MJDA 3ZHRA 4ACAA 3KDPA 4R2HA 1PJRA 1E2JA 4WDRA 5CYPA 13PKA 4E09A 4TRMA 2J08A 4G09A 4QAJA 5EJ4A 5KX5F 2AK3A 1FSSA 2O8FA 1NLYA 3SJZA 5K09A 4Z4QA 1JZTA 1SUCA 4HWTA 5EQFA 1TVKA 2F17A 2MMCA 5ALUA 4BB5A 4NE2A 1EK0A 3OOJA 4KL8S 1ZK1A 5BV1A 2QX6A 4L5JA 4BKOA 2WUEA 1S7GA 2PX8A 3F3YA 4BTVA 1NW3A 3IUSA 4BBAA 4MQFB 5AVWA 1CJSA 3FPKA 4ZV7A 3NBXX 4L85A 2AZDA 4O3FA 2F64A 1BXRA 3MHTA 2DH6A 2DHRA 5KYUA 3QVGA 3IAXA 4CL2A 1X1RA 1GSAA 1AZSC 2GESA 3JWIA 1XVLA 4XE5A 2IHJA 1XRQA 2CGEA 1NX6A 3EARA 3O0DA 3ZDYB 1GO2A 2VL7A 3U4QB 1TO1E 4MMXB 3ETCA 1DG9A 1SXIA 3GHHA 4N4AA 1CKEA 1T5LA 2JARA 4TLAA 2OK7A 5DU2A 4DSNA 5TT1A 3NDRA 1NE2A 4RLHA 5CFZA 4WFKA 2FEMA 5FWAA 1PJ8A 1AZTA 1RCTE 4X6LA 4V0ME 4PC6A 4DE5A 2W11A 4PCAA 2OPHA 4RPCA 4BO1A 4F3YA 5KTMA 3GLGA 3P2YA 2L0XA 1ORHA 4XUDA 2XQVA 1XZ8A 3OOWA 3F1LA 4C1NA 4GW3A 3W90A 5LL6P 4IVNA 1JAXA 1MC5A 4Q3NA 4PGMA 4BCCA 1K63A 5SYNA 3THOA 1MABB 4PGAA 4KLZA 4QTZA 2IS4A 4RZ2A 4TMXA 1DEAA 5AKKA 2H51A 1O08A 2WR8A 4YUZA 3B3AA 5IKEA 4K87A 1VMAA 1DAOA 4HSEA 3CH6A 1E6UA 3M4JA 4KLCA 3BYZA 3WWZA 3LCVB 3PD0A 5T4FA 3JU3A 2O8DA 1M8KA 4YS6A 3F7TA 2YQ4A 3O73A 3F6EX 3UWDA 3M6AA 1FK8A 2W58A 3ZY6A 2WOJA 1RAGA 2WWFA 4MLCA 5DBHX 2OO5A 3ODGA 1FSGA 5AM1A 2BBSA 4XWKA 1HYHA 1MO3A 1RP7A 3KWLA 3PRJA 3VJLA 2WPNA 1NQUA 4WCDA 3SIRA 1O97C 2G82A 1DFHA 1Z74A 4NZ9A 4LWQA 4AY5A 3GGJA 3A9SA 1GEGA 1NJ6A 1SBCA 2CUTA 2E4WA 3DT8A 3GA5A 3Q98A 5DLYA 1SVIA 1WD7A 3C7KA 2XWJI 4AK9A 4GPTA 4PXAA 3F1KA 1UF9A 1Y5LA 4L2IB 1XDZA 2ZU6A 3RC1A 3K0FA 4B3GA 1FTGA 2PR7A 1O9BA 2C98A 2QD3A 3IV9A 5B4VA 1R0WA 4Y2QA 2FZKA 2QWXA 2WF7A 3OAAA 3NTUA 3OP1A 5F3DA 2O3TA 5TX7A 3ETGA 1HFWA 3KJFA 2NO0A 3WBKA 1H6CA 5B4TA 1Z5OA 3H04A 4RJIA 1B00A 5DBEX 3RH0A 1WXGA 1KQGA 1OC2A 3NW9A 4IDNA 4ND4A 5JZOA 4UAVA 3AUYA 1UZLA 1ULUA 2VH2A 5C4MA 1EFVB 4MUNA 2B1GA 1K08A 1SKAA 2WKRA 4J0EA 3UFXA 3CZQA 1C8KA 2CF6A 2VJPA 1V8BA 4Z4IA 3AF1A 3FFTA 4TVSA 4EW6A 1HR0B 1HE4A 5HDQA 4DKXA 1EE9A 4LSWA 3HN6A 1P0MA 1GGKA 5LSAA 3OLYA 4G5XA 3STHA 2WPDD 2NTNA 1O87A 4G84A 3A3KA 2CN1A 3BILA 6Q21A 1YA8A 3R3WA 1VECA 2NQTA 2P5SA 4J9VA 2IV7A 5L9AA 4F9GA 3ADOA 2NUBA 2PVSA 3RFFA 4DYHA 1U1IA 2VPQA 3FA2A 3ODPA 2WA2A 4HKTA 4KGXA 4Y2HA 4B4WA 3UCFA 5F5LA 1XU9A 3GLRA 4EAQA 4NLLA 3B1XA 3DBLB 3JD3A 2X77A 1RBMA 3NEJA 4PLGA 5CT9A 4P84A 4QFMA 1Y3AA 4C0XA 1G7SA 3ORFA 4AKHA 5ALVA 4DR1B 4Z2YA 1ZO8A 2QZSA 1MC4A 1O58A 4UNNA 4MKHA 4H7KA 3OKPA 2QTNA 5J5VA 2QRVA 3EGDA 4EJ2A 4XZ3A 5DI3B 3LC0A 2WSSD 2DFNA 4I1UA 4KYTA 1HDZA 2KBEA 4P3XA 4IW3B 1S7CA 2EFYA 3SSAA 4ED9A 2W37A 2FPPA 2X15A 4N82A 4C21A 3QQPA 3IT0A 4MO9A 2FZVA 4Q37A 4MQUA 3NGMA 5EKDA 1ZH2A 1RC1A 2HO5A 1GKUB 1Y5RA 1ZDMA 2D8AA 1VLZA 3LXUX 4Y1RB 1LNQA 5DX0A 2W9XA 3ITKA 5L7WA 3O4VA 5M5BA 3AUFA 2Q5HA 2BF4A 3Q9SA 1OILA 2ZPAA 1CHNA 3O4GA 4L76A 1RTTA 3WYDA 4OGLA 3ZGVA 1OXMA 1XZIA 1FUIA 3EAFA 5BQXA 2XECA 4G9EA 2WEKA 3Q8LA 5EZYB 2AVNA 2C83A 1N1GA 2VEDA 2ZU0C 3IUMA 3PRYA 4OJQA 1RQPA 5DM1A 1OTXA 1KK2A 3ZKWB 3TK1A 3ZLTA 4XYLA 5IT9A 1I1QB 4WAUA 1YOBA 5FWYB 2GWHA 3P4UA 2FOLA 1U3CA 2GUGA 4D6PA 1HRDA 1EP2B 3WJAA 2NVBA 2CWWA 3B2QA 1B8UA 4GLFA 2W90A 4IL5A 4ES6A 1XB2A 2DPHA 2I1WA 5ES3A 3RF6A 1NI4B 2O2HA 4F5WA 4AS1A 3GDWA 1F6DA 4O4LF 4H4DA 4J8PA 3OCCA 5TNXA 3USCS 1FJXA 2GN8A 2R7AA 3QXCA 2Q0XA 4HFRA 4B6QA 2Y1GA 4FCCA 4RLQA 1GCAA 4REQA 1J07A 4KACA 1QO0D 1D09A 5F73A 3BSYA 2QY9A 1CJVC 1CZOA 4CKWB 5BNTA 1JSCA 2G8NA 2HBYA 2JI4A 1Z22A 1QHXA 2W7TA 4JR2A 2VDWB 2VPTA 2ZTUA 5LYYA 1QFSA 3GT3A 3DAFA 3GL9A 1F8FA 1UOEA 3GBVA 2GZ2A 2XKKA 3NNSA 3U4CA 5CLHA 3TPCA 4NZPA 1VLHA 1W4ZA 5H4HA 2IWHA 4ZZIA 3VC7A 5TPWB 4R9RA 3G9ZA 1YA4A 4EO4A 3BG5A 4A82A 1MKYA 3C5VA 3Q9NA 1XWWA 4X44A 4A26A 1X1EA 1XK7A 2EF0A 1CQZA 2C57A 4CGZA 1OLSA 3FG9A 5AJHA 4IEFB 2D7CA 2AG6A 3GZJA 4M60A 2AHRA 3H05A 4LVOA 3T7AA 4YRMA 2R62A 3NALA 4DLTA 2RH5A 2RIPA 2HHCA 2O3RA 2N75A 4PNPA 4PX9A 3S4YA 2PZMA 1E2IA 5GZ3A 5JS7A 4CNBA 4OQLA 4BJ5A 4C2TA 3MAAC 1Y34E 3SC6A 3RU2A 4CVNA 1MO5A 3NHSA 2BKAA 1Q1EA 4UMDA 3GH1A 2VJNA 4J2HA 1KP3A 5THXA 5AW6A 4C6SA 1Z0JA 2PUGA 2KSQA 1NE7A 3LQYA 2VCEA 2X8JA 2Y9PB 2NU6B 3FYUB 1PSWA 1D2MA 5ALLA 1Q2UA 1H0RA 1WHSA 1F0NA 2H5IA 1SU8A 1CD5A 2HSDA 2PEZA 2FW7A 2PL9A 2ZJ1A 2ZR7A 3M2PA 2RKBA 3N59A 3N2KA 4FMPA 4HWSA 4IRUB 4CKCB 4HYQA 4F7WA 2R6GA 1D1TA 1KPIA 3ILVA 3QE3A 3AVYA 3OQPA 4W5HA 3SZUA 1SM4A 4EEZA 5KOYA 3NCHA 1Z7EA 3QBEA 3QK7A 2HSEA 3C97A 2QD2A 4QOFA 2ABWA 4CETA 2VF8A 2GTIA 2AEJA 3OCYA 2IS2A 4KQXA 3O95A 2X4GA 1OBCA 3BGVA 1DAEA 4H2DA 1YS1X 2VUHB 4Q4HB 3GRRA 1UBRS 1GFWA 1EQAA 2YV2A 3O4RA 1F17A 2C5LA 5K6RA 3D02A 3DB2A 3V8VA 4DJDC 4OHXA 4BNGA 3LGXA 2YZKA 3NHYA 3DB1A 1P0FA 2XYHA 1MEEA 2FLKA 5EP4A 1V8PA 4AF7A 2FP3A 4Y6GB 1BYIA 3DOIA 4TQGA 4U3JB 1K92A 2QLBA 4LXQA 1QV6A 2IEGA 4HNAA 4MV7A 3DHYA 4WH0A 5H3LA 4BTEA 4MZDA 4BNIA 4LGYA 2IOQA 2Q1WA 3PDWA 5FPSA 3UUGA 5LQUA 221PA 3L43A 4HAXA 3ZCPA 3BAFA 1XMQB 3AUTA 1C7QA 1KO7A 3ABRB 2C9DA 2CEKA 2HBQA 2YZ2A 3WV5A 4GBJA 1R18A 3Q85A 4ASUD 1T36B 1HL3A 5BW6B 5LU8A 4RTJA 1SGWA 3T8YA 2RBEA 1YZVA 4LVUA 3L7IA 3WS7A 4DN6A 4RFSB 3JRNA 1S9DA 4HN2A 1LC3A 3JQPA 1IY1A 1FMLA 1NQTA 2R1TB 1UM9B 5B7NA 1DJMA 4CGYA 1VTKA 1XZMA 1PZHA 1BGVA 1VBFA 3L6DA 2G83A 1WP9A 3LUGA 3QV2A 1I4OA 3R7LA 1V16A 1M34B 2X58A 3I01A 1WY5A 4W7IA 4JYAB 3Q7EA 4A8JC 1TJPB 5CFPA 5FB3A 2BMDA 1FQOA 2X7JA 2V98A 2XH8A 3WDKA 2XE4A 2ZRCA 2CMDA 2VWPA 3CM0A 2P7HA 4R0MA 4ZICA 3RDPA 1J70A 3NH6A 4OLAA 5CG2A 3QE4A 3SYTA 4BX9A 4D4JA 1IM2A 4K0RA 3V55A 5A03A 2ZTVA 5AXDA 4W9MC 3E18A 3BWVA 5LQRA 1IHUA 3ZVKA 3TX2A 2GVDC 2DM6A 4E94A 4J43A 3PEVA 3U9LA 3UPDA 4E11A 3UT5B 1XTSA 3EFOA 1JILA 3LFTA 4MW4A 5JPCA 1D4FA 1TJ4A 1W6UA 1LS6A 1QK3A 2VHVA 4KBYA 2ZTLA 4UTZA 3G88A 5FI3A 2DBYA 5I5GA 5FQOA 3QKSA 1UP4A 1KI3A 1NUPA 1Y3IA 2OC9A 3BQ9A 1NXXA 2O6HA 4FDMA 4DR7B 3GLIB 4J3JA 3I37X 3GWZA 3N53A 4DA0A 5K6AC 1KSHA 1P7VA 3WGOA 4DKJA 1GG8A 1Q7BA 4TT3A 4MRAA 2G1AA 4ND7A 4XFKA 1Y5NA 1VL2A 2CKMA 2EW8A 1VHLA 3DDOA 1ULSA 2SHKA 3EEIA 4M0LA 4NFHA 4WX2B 5JTTA 4PHCA 1R8YA 4S1NA 4CCSA 1AK9A 2HA3A 3EEOA 4G9GA 1MGOA 3JD4A 5J2TB 5KVQA 3UGJA 3CE6A 1BW9B 2QZPA 2RK6A 4MB2A 4RFLA 4AICA 4DC0A 3PVZA 1CT9A 1ESZA 1CPYA 4GOMD 4NEHB 1J8YF 2RONA 3C14C 4ABYA 1XP8A 2OM6A 4QECA 7YASA 4PLZA 4DUYB 1GFZA 1BKYA 2BMEA 3X2EA 5TEWA 1OHHA 2OO3A 1JKJA 2B25A 5JROA 4QNRA 2Q0SA 1TLLA 2ZYTX 3CLVA 3LLUA 4KR9A 4E4RA 4TTSA 5GIPE 1WZ2A 1JMKC 1QVRA 2BCGY 2ECKA 2GYUA 1U9CA 3LH5A 4DR4B 4Q9LA 1M2OA 1QR2A 1Z4KA 4LRYA 2B94A 2QIPA 3A3NA 5HA5A 3RIXA 3ZU3A 1E9AA 3GLKA 1XZCA 1OIWA 3PR2B 4FONA 2WTXA 5DNUA 5KHOC 3NT5A 4FMBB 4ID9A 5IFKA 3WA6A 1KAEA 1SC4A 1G9TA 1Y98A 2EQ5A 1NUSA 2O2XA 3L1KA 2ZGVA 3OM0A 4XUCA 3WO1A 4QGSA 4DPMA 1AO0A 1SQ5A 1DO2A 5LBUA 1GKKA 1ENZA 2V7XA 2WYVA 3AR7A 4D43A 2R87A 4F5YA 1TPZA 1US8A 1A9XA 2UZ3A 4G0ZA 3WNZA 2FW0A 1CYDA 1C30A 4RA6A 3OMWA 2BI8A 4OLFA 1BE0A 4FBGA 3CVVA 1A9TA 1OW3B 1P39A 3OEHD 3OX2A 5DHUA 1KFBB 3D7MA 4FXOA 2PUAA 1FP2A 1N2IA 1ZNQO 3BMCB 2AMFA 2ROQA 5IMBA 1DUVG 1YZFA 1P4HA 1XFAA 4N3CA 3SR4A 3WLLA 3TOXA 1TF7A 5IHPA 2WAYA 5EWJB 3MMPA 4XRRA 1GYQA 3K0EA 4TMKA 4D8WA 3VISA 1UH5A 2F4NA 2ZJBA 4KPUA 1J0AA 1VKZA 2JCSA 4DFDA 1D9ZA 2OZPA 3D64A 2DLDA 2C4HA 4MWDA 3ZY5A 4B7ZA 2OCKA 5JJBA 2QI9F 2CB0A 2ZDQA 1XPUA 1J0XO 1NMXA 3MTGA 3TE7A 5L3SA 4ICIA 1UP7A 3DCJA 4I6EA 4ZZ0A 1NJ8A 4MGHA 3TZ6A 3V34A 1VP9A 4IYJA 1JDUA 4PX5A 4LFCB 3ROQA 2FPUA 2QD5A 4J7XA 5LP6C 4IP0A 3K70C 1ISMA 3MWKA 4ZVQA 4BE9A 3VNBA 4CF7A 2QQ5A 4WKCA 5E7JA 3TAUA 4MKGA 3TSYA 4HB2A 2R6ZA 3W2IA 4F9EA 3A1CA 3D8RA 3KUDA 3LLVA 5TQJA 4BKMA 1IUNA 3I6MA 1R12A 2ECQA 3I83A 4PRZA 4QL3A 1CW2B 1U5BB 2JJ8A 4LOLA 4MVJF 3CNLA 3IV6A 5KJFA 3G5UA 4TMWA 4DV0B 3RBVA 1G9XA 2FRVA 1BQEA 1VE1A 3ZQ4A 1ZNWA 2FR0A 3ZJYA 1U63A 5IXJA 3AERA 4MWBA 2WAXA 3RHFA 2OY0A 3TEFA 4EYSA 4MDFA 1MX9A 4PHGA 3NTVA 3WLRA 4YT2A 4R1UA 1E6LA 1E7WA 2ZBUA 1MAAA 1KBOA 2FN4A 3THXA 2V6FA 2XGGA 4WCFB 5KQSA 1F06A 5A06A 2JBWA 2NXCA 2NSHA 2XHZA 3KU1A 2F3RA 1XZEA 2VLBA 2ZWAA 3CLSD 1OAAA 1SKYE 4MZXA 1AKYA 2XUJA 3O8DA 4PO8A 5IDYA 4BEJA 4E70A 3JATB 1WE2A 4BX0A 1CIVA 4CF4A 5HOEA 4MKRA 3OJCA 4OUKX 4PF1A 4Y1GA 3JSAA 3VAYA 1KDPA 3IT1A 3ZNQA 5LN1A 3IVGA 2PKRA 3CLHA 3N3BC 3IQZA 2AC2A 5LZ2A 1IY8A 1JR3E 3EXHA 4UM8B 1QO7A 2R1VB 4B3BA 4DVGA 1IDOA 3GNSA 4OP2A 3VNRA 2QSYA 3RIMA 1Y5MA 1FFAA 2E5FA 3VUFA 2HMYB 1T1RA 3UMFA 4PZ0A 3QHQA 4EPYA 1HV8A 1G6HA 1Z6AA 1NR5A 3GA0A 4QX6A 1P2SA 1SR8A 3O90A 4KN5A 4PO3X 5FPHA 5HUQA 5EUMA 3R3ZA 1ZLYA 2WMDA 3TQFA 4EW1A 1NOIA 3FOWA 1UBMS 3L6BA 3ZCRA 2A5YB 4B3MB 3I72A 5EIAA 2A59A 3AH8A 4JELA 4OQMA 3M1AA 3OEYA 4MKZA 4C05A 1ONNA 3BN3A 1TMGE 3QXSA 2WB2A 3CKKA 4L7QA 5ANRB 4BNVA 4FLFA 4UM5A 4HQKA 4OXNA 5LZ5A 1SEPA 3EVGA 3PQ2A 4I1SA 2VPIA 3LKZA 3NOXA 4XWWA 3MJCA 1GUAA 3EFHA 4YK7A 1K6IA 1M1YE 1V35A 1KO4A 5JJIA 1KYZA 3DMPA 5ICFA 3GLFB 2Z2IA 1UZAA 5DK6A 1G6OA 2GASA 3CC8A 5KCMA 2GAJA 3D59A 5CA0A 4DDVA 1F7UA 1KOJA 3ZZUA 1EFPB 1XTQA 4YLEA 1C1DA 2BDEA 3GG9A 1F5SA 4RNDB 1Z0KA 5IC5A 4ZDWA 2ORYA 4Y2PA 3K5WA 2NSJA 2ANBA 4Q9JA 2YW9A 5CEJA 3E3AA 1OAOC 2IKSA 3KP1A 2XYVA 1FFHA 1NL3A 2RC5A 5FLEX 5LA6A 4URUR 1XDBA 4K9QA 2DC1A 1I2MA 2X2PA 1TAQA 1HT3A 4KQKA 3IT3A 4BGUA 3T3NA 3X1DA 1LX7A 3WL4A 1GPBA 1NVDA 1YZQA 4IHAA 4R9VA 5K3AA 1KZ4A 3M1LA 2YWCA 3M6IA 3GCGA 2RD2A 3ONVA 3AOEA 4X91A 3ZX4A 2B82A 3LYHA 3VU1A 5C9ZA 3D6UA 3KALA 1JAIA 3QXHA 4C2AA 3Q2IA 3LQRA 1T29A 4UUOA 3O4IA 1Q20A 4UHFA 4ZO4A 2IOFK 4ARIA 4WECA 3T3DA 2QTAA 5KS2A 1T4MA 5EC8A 3ELYA 2W0SA 3OECA 3UKOA 4ADSG 2V0GA 2B7BA 2Z5LA 3M6MD 1QAMA 2EJVA 1PT8A 2GM5A 1RWOA 3OX4A 4PCVA 1HLPA 3KPUA 3CX4A 4FFSA 3OZUA 2NTEA 1NRWA 2Q2QA 3RC7A 3AOGA 1TM2A 2J8ZA 4NBNA 5I9SA 2QSUA 1RXUA 2P40A 3D4NA 4LE2A 4AWAA 3RS9A 4EG4A 3MD9A 3LECA 1LK0A 1ONOA 3OLZA 4DMKA 3L8EA 5KWSA 2BMWA 1YQDA 1WV0A 3A1FA 2AG0A 3CZPA 5CX1A 3VU3A 1LLFA 1CUJA 3MJ4A 3G8DA 3ZXYA 4CHTA 4ND1A 5TLSA 3OQMA 2DF8A 1ESEA 5LB2A 5LZ8A 3X1MA 2JFZA 1BGWA 2GEKA 2OBNA 4P3KA 1PNQA 5AUNB 4NMWA 5EPOA 3X43A 4EA9A 4PHTA 3WK6A 1BMTA 4QGGA 2BM9A 1A82A 1I4WA 1Z0UA 2WMOB 1OYOA 4DQDA 4E5MA 1RWMA 5EJ8A 4WXRA 4P5PA 3AL0C 1Z26A 1P6QA 1UKZA 3EDYA 4PZEA 2ZIEA 4ZVMA 2OBXA 4LGMA 1WBBA 4LY6A 3G2NA 5THKA 4Q7JB 3CX8A 4H08A 1OU4A 1QDEA 3OO1A 3WJ1A 1ABBA 1K4KA 1PZXA 3QVLA 5B1YA 2PSJA 3CLKA 1N25A 3IXMA 1NOKA 1NIJA 3IHWA 1NLZA 3KQVA 1FP1D 4QBGB 2V7BA 5K03A 4G25A 4JUIA 2RHTA 4DCOA 1ZJJA 4CM5A 4JT4A 3GA7A 4DBLE 3TLXA 4RQUA 2WF6A 4LCJA 2GK7A 1O95D 1OFVA 2ZTHA 3ESQA 3HYTA 2QQFA 1N2GA 1SUWA 3Q11A 3BA6A 1ECFA 2A7QA 3S29A 3PI6A 3WAGA 3R9XB 3IC5A 3HMKA 3VSCA 1VIVA 3HBAA 4LY9A 5GIOE 5LA6B 4ZEVA 5T6MA 4U2CA 1NAIA 1G2OA 1HZJA 1LQTA 1CF2O 3ZS8A 5AW0A 2J0UA 2AFIB 4KO8A 4RYLA 2B36A 1E7RA 4AJ9A 5DM60 4OQNA 4PPFA 4QBKA 2C1ZA 3RRJA 3QNUA 3WRXA 2ERXA 2ODAA 3AUKA 3TYXA 4F6CA 2X3FA 3DUWA 3I9NA 4J0GA 3SXUA 3BXXA 3NUGA 3G0DA 1M1YB 4RIFA 3TLGB 4B81A 1AS3A 4CJXA 5JXGA 4GSKA 1N33B 1UDBA 3R41A 1UPXA 3AO0B 4N76A 1DDOA 1ULAA 2YJ4A 1Y9DA 4K7JA 1PJLA 3FYTA 4LK2A 1DC5A 2Z04A 3CU5A 4IOLA 2Q4OA 3A70A 1KDYA 1I2BA 1OZFA 1P3JA 2ES4A 4TWRA 1BXKA 1IQPA 4BKUA 1P0CA 2FSFA 3KM0A 1NFRA 5I4BA 4ZREA 3TINA 4D8XA 1T6ZA 4M76B 1JXMA 2XODA 1RADA 3TZEA 3WIDA 2D2FA 1T9AA 2P1DA 4MW2A 4P36A 4JQZA 3RYHB 2A9RA 2VA9A 1JHDA 5JRDS 8LDHA 2B8TA 4UBJA 4PGHA 3QPUA 1ADJA 1ZIDA 5AT1A 1PNVA 3JD1A 2ZVQX 1E3JA 3KBOA 3L77A 3M49A 4NF2A 2XVYA 4KIGA 3AYXB 3T41A 2XXAA 2KPOA 4M89A 3ZE8A 2GCPA 4J4HA 4RFVA 2OP0A 2WT4A 1V5WA 4JGIA 4DS3A 1XAGA 2UZ4A 3UWMA 2ZROA 1IPEA 3BH7A 5HF9A 3NGLA 3C1UA 3M4YA 1F14A 3BERA 3NG1A 4LMPA 3AB7A 3I2KA 5AI6A 1S3GA 3TFWA 5ECYA 4AKTA 1H0KA 1BOOA 5AFSA 4WT7A 4PRKA 3QSGA 1UIRA 1G8MA 5CVEA 1QTNA 2O0JA 3FB1A 1E3MA 1NNLA 1DARA 1UP6A 3P2KA 5CT5A 3HYNA 5GMOA 4LW8A 4JI6B 3VHQA 2ZAGA 4MOWA 2P69A 4YJ2F 4EUHA 4KPFC 3PLNA 3T5AA 1OI3A 2WJHA 3PFHA 4WN3A 3GLTA 1B0AA 3WYGA 1R64A 4WGGA 1W6RA 1B8OA 2X6QA 2YWXA 5ERYA 1T2VA 3RTAA 4BQQA 4K6GA 4OKSA 4RF3A 2RGNC 1FS4A 2A84A 4S3MA 3G82C 5FOTA 3WY9A 2CL0X 1ZAYA 4U5XA 1LK7A 2AWOA 5T67A 3C48A 1EFVA 2FCAA 1AKTA 2ZI4A 5H70A 4Z3DA 5IH7A 3RJZA 1X86B 4F8JA 4D3XA 2RGDA 2OR3A 4B5KA 5HM6A 1QQAA 1S3IA 2I3GA 4U7TB 1LX6A 2VEOA 3U3XA 1RAHA 3WZLA 5F4ZA 5JW6A 3BXOA 3HE3A 1TADA 1T10A 3C87A 2O4UX 3H3XA 3NKVA 4FSHA 4TV8F 5FBHA 4Q47A 4WERA 3DEKA 5BR4A 1U2GC 1QDLB 2ATEA 3O1HB 1GARA 4E2XA 2CJYA 2CXRA 1L7VC 4NOMA 1AUVA 1B6GA 3NHLA 3N74A 5HBGA 3WLOA 5BNFA 2YVAA 4Q7EA 4E30A 3AYZB 4HGPA 1D2AA 3ZDFA 3A3YA 3UXHA 2O8CB 4XQGA 4JUAA 2XKAA 3NJ8A 1P9LA 2QRZA 4RSRA 3TLGA 1CR1A 4H16A 2DTXA 1DJPA 1HDYA 2Q2OA 3TI7A 2QBYA 3M9LA 2NX2A 2B8NA 1Z28A 3G0IA 2IY8A 1N8TA 5EKUA 2Y6UA 1KBZA 4IGKA 4MP6A 3LBAA 3H9QA 5HFNA 3H42B 3ICOA 2WIGA 3ZI0A 4K1XA 4F92B 2V74B 2VAMA 3ZCXA 3WQQA 4EI2A 1OJ7A 2IUSA 4FFMA 4RAQA 4UTNA 3U44B 1YA6A 2IRWA 1DC3A 3QY9A 3UYLA 4FVTA 2V3WA 3RSGA 2DP4E 2WMYA 5M34A 1GU1A 2XMZA 1PT7A 2CZGA 2JHGA 2X0JA 3AUXA 3KEGA 3KSDO 2PL3A 1E0SA 5GTDA 2H18A 3HP4A 4WIAA 4WUTA 3BGDA 3HY4A 4JODA 2HI0A 1YD7A 4AZ3B 1R0CA 4ZV4A 5H8WA 4FQ5A 4MUGA 4HWOA 3WBBA 4GVPA 5ALIA 2P62A 5BR8B 2WRZA 3CH5A 2JATA 1EK5A 1QMPA 1VL8A 3MM4A 4OMDA 3LLCA 3NOOA 3C3XA 1XCLA 3RYHA 5DKFA 1KI6A 3AU8A 1H05A 3CYFA 3KXDA 2VXBA 3NBFA 1G3QA 2VNJA 3LS2A 5FUWA 2EX1A 1J9EA 2FZGA 2Q2NA 3D2BA 2I7VA 3HFSA 3E9MA 4E1VA 2YMMA 2ZRMA 2Q3CA 4AMGA 4UU1A 4Q15A 2ZJ5A 1EWKA 1SZDA 2COEA 1LVUA 3Q3HA 2I22A 2EWMA 2DUMA 3WYAA 4FBLA 4OQZA 3DGEC 4LI3X 4S1VA 2D2EA 2I6QA 2WJAA 5JSKA 5K8CA 3ASYA 4WOCA 1GTRA 5FLYA 2FMHA 4L3WA 5AM5A 4MKFA 4Q4HA 3UF0A 4GM4A 3MB5A 3ULKA 1WB9A 3DMFA 3DA8A 1MO4A 1WDTA 4URYR 4RKQA 4A91A 1GZ7A 1YDHA 5MGNA 3JQBC 5U9CA 3TTTA 3IKLA 3PTZA 4JBLA 4PINA 4Q19A 2W2NA 2HPVA 3FUCA 5IVHA 1N2CB 1UEIA 1TEXA 3EOAI 4ZOAA 1P1IA 1VIMA 3DDWA 4KPEC 4UJ5A 4YQYA 3HI4A 2Y76A 5KWIA 2BM1A 4A6XA 2IDMA 4B35A 3A6GA 1MH9A 4FZJA 3FIJA 4HB4A 4D99A 2XGSA 2HUNA 4G1UC 1V43A 4NICA 4XAQA 1I0LA 1VB3A 2DEUA 1JFVA 1NJSA 2V6JA 1O57A 2W2QA 2WNHA 5C37A 4N48A 1LDMA 2OM2A 3ESCA 2DHEA 3OE7A 4YP0A 1G0OA 3KZMA 1J22A 2BR4A 3W8EA 4DRXA 2CXSA 1V8OA 1E2QA 5C52B 5MFZA 3HHPA 4R05A 4HZUB 3BE8A 2C5EA 2RH4A 3EE6A 4YUWA 2BDUA 4L95C 1L8OA 1QPBA 3PQ5A 4MWSA 2QS9A 3PJFA 1FRQA 3Q7SA 3TR6A 1C7RA 1VL1A 3EZFA 3STUA 4WBSA 4Q4LA 3WL3A 3B52X 1HNNA 2P9BA 3LXXA 5FWXA 4HB0A 2IBSA 5HIJA 2I76A 2HX1A 3RO7A 1MQ8B 2B5OA 2IZ6A 3PUHA 1RJEA 3K6KA 3I6YA 4N18A 4WE3A 2E6KA 2Y1LA 1U9IC 3TMYA 2YIDA 2XGMA 3GVXA 3RUCA 1CX9B 5KYKA 3V1LA 4KQ2A 3T1YB 4P35A 3OFND 3RSCA 2C2GA 4Q4CA 1M74A 3HUEA 2E7ZA 4DY4A 2J9YB 2GZHA 4ALMA 1W30A 1JG3A 2E2WA 3HO8A 1Z4QA 3PXCX 4CKEA 2F00A 3LU1A 5CW1A 1W88A 1SUSA 4ZPXA 3FHLA 1PZNA 4RXUA 1ZCJA 3RJTA 1T1SA 4R7TA 5BSVA 1JEJA 2HIMA 1X0XA 4H9GA 1BDIA 4AULA 4QU8A 3W6UA 1E7QA 3GELA 4URXR 1TKBA 3N9IA 4KMSA 3U80A 5FOUA 1CUIA 3LF1A 3KOZA 4B4VA 1Y1QA 4ZTUB 2HMUA 3VYRB 3VZQA 2GN9A 2HEGA 1L7EA 1TM3E 3D6MA 2WFZA 3IVAA 3O74A 4M9UA 1TKCA 4GKKB 4ME6A 3CG0A 1NJFA 1F3LA 4LZPA 3AUSA 3ZE6A 3LDAA 3W5DA 2XTAA 5AK3A 1SXJC 3IOMA 2NPOA 1OX6A 3VVMA 1JEYA 2HRZA 2IF2A 4OI0A 1EFUA 2G80A 3QF7A 3TJRA 3G2KA 1ISRA 1N7IA 3RSHA 2WAOA 1G2PA 4JBXA 4TV9B 4R9UC 2GX6A 2JHCA 4EHNA 4QTYA 4OQ4A 3NVDA 4B31A 4YRQA 2F8MA 3I3SR 1G4HA 2FPPB 4GL4A 2C9BA 3QU7A 4TS1A 3TQHA 4J75A 2TMYA 4FYMA 1VSVA 3SD7A 4ZK6A 5CDFE 5ALZA 3AERB 4Y0VA 2BGJA 2PS9A 4NVRA 5TR9A 4REOA 1YU9A 8ADHA 1A4IA 2XEXA 3L4SO 3MINB 1YSCA 3L5OA 3FUVA 2ZB7A 4HMPA 2RHGB 1GLNA 4ZRMA 1SHJA 2ZYRA 4WK0B 5FEMA 1GGFA 3Q3VA 3B60A 2EL9A 4J29A 4KK4A 5GJBA 2NT3A 4A2WA 3BWXA 1E63A 4G36A 3KYCB 4N6NA 4V0OA 4FSXA 1ZD2P 3VR6H 6REQB 1C5KA 4BP3A 5FV4A 2AMLA 4P81A 5MF6A 5AUOB 1A8QA 3N1UA 4X9XA 4DCJA 2EZ8A 2JIDA 1KDRA 2VDQB 3N2GA 3NHWA 1NVVR 5BP7A 4LF7B 1JIXA 2GF2A 3IPCA 1K6XA 4IRXA 4UDYX 1YH3A 4TUYF 4LYGA 5FT9A 3RKRA 5JXHA 1YBVA 4TKLA 2ZCVA 4H4EA 4ZOEA 7MDHA 1J5PA 1WD5A 4QM7A 1IN8A 4BJHB 2ZIXA 4RNCA 3HJCA 1TZBA 3ZWVA 1BG6A 3UQZA 4YCJA 2I4MA 3E05A 3HCRA 1HYQA 2ACKA 3HBFA 3OCXA 3IQWA 4OFBA 1XCBA 3EQ9A 5A9SB 2D0PB 3IUJA 3ZR4B 2H8KA 2BY4A 3F6BX 1UR5A 4UPEA 2QJOA 4A36A 2O7QA 4GOKA 4DQUA 3ZWQA 2BJWA 2YICA 3JAWA 4LWOA 4E33A 5I7VA 3OJOA 5MHTA 1DFIA 2WYUA 1XRNA 4M83A 1G7TA 1PFQA 2VBGA 2BSXA 1UJCA 3KX2A 4P33A 1N7JA 4C4TA 3U1VA 4Z1OA 1QG0A 4IPTA 2V4UA 4QYTA 4UBMA 4CODB 2KW5A 4IX9A 2A1UB 1JXQA 2REXB 3N0TA 4GXNA 4IHJA 1WMAA 2QR3A 4QXRA 1Z3CA 2Z5GA 3LVFO 1C0KA 1W0KA 3I0ZA 4OF4A 2YZGA 4CM7A 4OHFA 1VCIA 2GN6A 2PBLA 3AV0B 1ZSNA 4D97A 2JFHA 3D4OA 4DNQA 4ZJZA 5HYVA 4KCGA 2J0VA 4ZCMA 3FYDA 4W8HA 2XZLA 1RXSA 2FSIA 1KJJA 1WMEA 1YQTA 3CX6A 3I4CA 4BEWA 1BX1A 1F4PA 1TIKA 2TECE 1W9HA 3D0QA 3UMJA 2FR8C 1GZHB 4RIEA 1ZK3A 4YMVA 1THZA 1PNRA 3VO9A 2YWJA 3MJTA 3B1FA 3DO8A 1E1DA 1FVOA 3DBLA 1X80A 3BEOA 1ZM4A 3K0KA 3QENA 3DL7A 4MQ6A 3SLRA 4E2FA 2W2VA 5B1IA 4KXMA 2O8DB 4EPVA 3T5DA 4BFTA 1RPNA 4I66A 4RORA 5JXWA 1M73E 1NJGA 2BBWA 1K5HA 1DTWB 1Q0UA 3C4JA 1XO1A 3IPYA 3LCCA 3PDJA 3D4BA 4MVXA 5G02A 1HLFA 1PW7A 3F3MA 1MXHA 5ECWA 3OA2A 2W6JD 4LMBA 3O8NA 2WIBA 4EKEA 3JWJA 3KD2A 3CISA 1HFJA 2VT7A 4Q1DA 4W4TA 3C16C 2OOSA 2HEIA 4N03A 1YR6A 2YFYA 3GW8A 4TXNA 4L8FA 1OT5A 2X22A 4QJIA 1YI0A 5AJTA 4RHYA 4HX2A 2GFHA 1Y4ZA 3JALA 1GHTA 4AUNA 4BCBA 3HA2A 2PAAA 4U6QA 2A0FA 2I80A 1KAOA 1JBEA 4JYPA 4CMGA 4EI9A 5ESDA 2BFMA 4D0SA 3GLGE 2I6SA 4Y9UA 3N7TA 4DV2B 5ALKA 1UBSB 4H1UA 4L4YA 2CNWD 1XDGA 2H59A 3ECSA 1DRJA 1R0YA 2AUNA 3WK9A 1C4XA 1AKEA 4CMEA 3NV9A 4HH3C 3D5EA 3N2ZB 3QOWA 6AT1A 3Q3IA 5CB8A 3F7NA 1II8B 1NYLA 1XEWX 3U7QB 1GPNA 1C2TA 1OV6A 3V7FA 2YS6A 4D8VA 4DJAA 1V7ZA 2P2YA 4XD7D 5KVSA 3F46A 1RWNA 2Y8EA 3IOYA 3P2MA 4NYIR 4NYMR 2FTKE 3NORA 1RHMA 4G07A 5DFAA 5DM0A 4ON9A 4IQ0A 1K9SA 1Z38A 3ANMA 5HIMA 2WVAA 2FZCA 3CJQA 3S7ZA 1V4NA 2HT6A 3FB4A 4AKGA 4DG8A 1E59A 3PHBE 1OSNA 3HNPA 4FNAA 4PN7A 3SYNA 3ZE7A 1M2OB 1RM4A 3KLNA 3Q5EA 1N5IA 1ND6A 1WA5A 2CYCA 4JLDA 4Z4GA 1VI6A 2CDNA 2DBZA 2IEIA 2MYPA 2CXTA 1IG0A 2OHOA 4URWR 5K0LA 4HRVA 3E5RA 1LNSA 2IE0A 4JENA 5HILA 4CFSA 1P8JA 4KZPA 4O5OA 3WQSB 3HCBA 5I7WA 5JFGA 4HDCA 2P1ZA 1FSZA 5IAJA 2J31A 4TXJA 2OO7A 3BC1A 2OSBA 1A2BA 2CNDA 2Q27A 3DQQA 1RLMA 3FCEA 3OX1A 4HDOB 1TCUA 5D6NA 2VDOB 4FB4A 3SVTA 3DJFA 1ODFA 3GFTA 3OLVA 5JS2A 1JEQB 1Q92A 4L22A 4R8RA 2RAFA 2Z1DA 5CLJA 3UAGA 1IC6A 4C29A 2I34A 4Q93A 5CDFA 3T5CA 2XMBA 2ZT7A 3CH4B 3VR4H 1CUSA 4JSRA 2R8BA 2UZ0A 3T99A 3DZIA 4ZAWA 3OKAA 4LJ9A 2DQ4A 1GA1A 1XV5A 2BGWA 3OSZA 1JECA 1GAEO 1EIZA 4RXMA 5K3CA 4OXRA 4GGPA 1BDHA 2WBLC 5ERXA 4H17A 5H80A 2I4RA 1UDXA 2FP4A 1PLLA 4PZAA 5EMJA 1NXSA 3EVZA 2EP8A 4CKCA 5AKIA 3OZCA 1CR0A 5ETJA 1KO5A 2YOFA 5KOHA 2HIAA 4O59O 3CZ9A 2GPWA 4XWAA 1QCCA 3ZWBA 5LDDC 4IIJA 1A9QA 1I3LA 1E2EA 1UMBB 3C43A 1VL5A 3ITEA 1E9CA 3ENKA 2YVKA 1DB3A 3KJGA 4H0FA 5HG0A 4UPVA 1W4LA 3HXTA 4P7KA 4WWHA 3TRFA 2XNHA 1E2LA 3LFUA 2ODEA 2UKDA 3OKFA 3TUZC 3A3PA 4FFVA 3UJ6A 3CVJA 4ZVKA 3JQAD 5IMSA 3FMVA 1ZJ4A 1Q0QA 2YVQA 2HB6A 2HL6A 2ZBFA 4OA5A 2CHFA 5D8DA 5CH3A 3TAHA 4CTOA 1UC5B 3TW0A 3U4AA 4AI6A 1XTRA 2EKLA 3L84A 3BMNB 4G6ZA 4LXYA 4C20A 4E12A 3NIDB 4OYHA 3KPWA 1TGYA 2AFIE 4P2GA 4QUDA 4Q16A 5JO9A 3T9AA 2JLXA 4B6JA 2HV9A 5TV2A 2FK7A 3RKUA 5FNVA 1OGJA 4EHFA 4GMGA 1RPTA 3B8HA 4I5IA 4TXLA 4JEMA 1O6BA 4RGVA 5TC4A 5TPWA 3WQHA 3ZV4A 4AY6A 3HKBA 4O08A 4YWJA 5EHZA 1LXCA 1ZJWA 1Y82A 5ALTA 4MICA 4ER3A 3ZK7A 2A9QA 2HSZA 4FOOA 1P1CA 1KXZA 1NNI1 3H1BA 1OXBB 1MOSA 1ZH6A 1RQNA 2ERCA 1C41A 1R0RE 2YWGA 3PC6A 1WL8A 5EYPB 2PE5A 1YNSA 2R7KA 1SVKA 1DT3A 4YRFA 3NIWA 5AVSA 5AQEA 2O4CA 3FWKA 3P4YA 4MGKR 2ZBEA 2JLUA 1FMTA 3GG2A 2XWBF 3IOCA 1ORIA 2FSPA 1B0ZA 3W7AA 2VRWA 2ZRFA 5H02A 1DS6A 2A0UA 4UNRA 5BSGA 3OWXA 1U2RA 3NM5A 2JZCA 2UXCB 1B8PA 4O4HB 2NUAA 2QYHA 3I53A 2XBMA 1XZGA 2OCYC 3IBFA 4BRWA 4B4DA 4JC8A 1TRHA 4PLTA 4YROA 4O2BA 5IUNC 3KKKA 2C07A 2VS1A 1SVOA 1LK5A 2EJCA 1TMKA 2W6CX 1DJOA 1ICEA 3DDSA 4HNHA 4IF4A 5FI5A 4DDWA 2FFJA 3GJ7A 2DUUA 4EJFA 1NBAA 2FPXA 1NVEA 3ISVA 4PN3A 3TNYA 1ZUIA 1I3MA 4DM3A 1GRNA 3JALB 4I55F 2E21A 1GVNB 2A57A 2OAGA 3NJ4A 3GOQA 3PIDA 4KN6A 4CF6A 2Q46A 5ITVA 4JBHA 4R01A 5HF6A 2FUG6 1IXRC 1PFKA 4WZAA 3KQHA 5DLQC 3QWHA 1YE5A 1GAJA 1O96A 2RK4A 1CHDA 2B30A 2GJ8A 2XRMA 2IF0A 4X6YA 1K86A 2VG8A 1SY7A 3D5TA 3T5BA 3LE8A 4HFMA 1FX0B 2ZRGA 2OBLA 3VZSA 3AP1A 4WFJA 1KO1A 3T9BA 3EF3A 3E53A 4ENPA 2ZJ2A 2XAUA 2O9JA 4NZYA 5JZBA 1E5TA 4HDKB 4K9KA 1EA5A 1O2DA 1BS9A 3S5JA 4UU0A 4E3WA 3EHDA 1F8YA 1H6DA 4U6NA 4ERXA 2HIGA 3BL5A 3JRWA 5DGXA 3DHNA 5ARBA 3DFIA 4DCUA 5F9HA 4QJBA 1V39A 1HDXA 3GMTA 3P7MA 4WV3A 4X95A 1VIDA 1E3QA 1PL7A 3OQ6A 4HPJB 4NYMQ 4UHBA 4A2CA 1A50B 5J4HA 1Q16A 1UJNA 3M9WA 3ZQUA 2YJNA 4L5CA 1KQ3A 4N5HX 1ZN8A 1KJIA 1AHIA 3W9UA 2WT9A 2Q3EA 5DOZA 5CAEB 3VR2D 2XDAA 4F06A 4F5EA 2P6OA 1RRMA 2EKQA 3TBFA 1B8VA 1SG9A 4NPCA 3WHLA 2J9XB 3RT7A 1SC6A 1PRYA 1NBWB 2O5CA 3PHIA 4DVJA 2DU8A 3QG5A 4NY1A 4BGVA 2BFEB 2DT8A 4KFRA 5B3JC 1WSWA 3PPIA 4G63A 5DWQA 1Z68A 2HPAA 1H2XA 3GGDA 2EDCA 4KC0A 3UJBA 5DSZA 1JDNA 4Q00A 1X9HA 4UFOA 2F6RA 2IBMA 2H2FA 3B6ZA 1EXVA 1W52X 4OBBA 3UHOA 1SZJG 2H0QA 4UTRA 5EPEA 2I4NA 3C1TA 1YJAA 2QR2A 3S0JA 3JTEA 2C2KA 2ZSAA 1EAYA 3RNOA 1T15A 2ZVJA 1IN1A 1QZZA 1A0OA 4PM4A 1ZCFA 2GD2A 3C3AA 1ZMRA 4DMCA 4QUJA 1ZK2A 2X9LA 3CV3A 4HGNA 4EF4A 1EX7A 2W2LA 4N0QA 5ICSA 1X7YB 5J4YA 1B8NA 3GBSA 5CDYA 3K70D 1KFCB 2A78A 3QKRA 5LP6F 4D4LA 2V7GA 1NKSA 3TZBA 2ZR0A 1OBFO 1ZVJA 5DISB 1YWGO 3O8BA 2HADA 4EOGA 2E1PA 1LSJA 3PX3A 5DYWA 4B82A 1R4MA 2WFAA 4FYPA 3EX7C 3I4FA 5E9JA 1CUUA 2VLIA 1FX0A 1BHO1 2PH3A 5GJWC 5I7AA 1TCCA 3OFNA 2F55A 1Q7RA 1EGVB 4ZAFA 4DMUB 2FHPA 4XWYA 3T1VA 4K9DA 1L4EA 1RBYA 1H1LA 3N70A 5EHNA 4E51A 1Z82A 3TG2A 1GDTA 3S1SA 4ZMSA 1TZCA 5EHXA 3RSQA 4IJKA 3JV7A 1SXJE 2XUZA 2P4SA 3H1PA 4LYYA 3URKA 3PEFA 1XPOA 2WD8A 4EPTA 3OMXA 2ZWOA 2V1UA 3GNLA 1NVWQ 3PG5A 4QYXA 1F5NA 1TF5A 1PR1A 4MUMA 9MHTA 2OG2A 5JDCA 1CYEA 4FIZA 3CWQA 3BXPA 4KWEA 4M4SA 4PZLA 4MVJH 1T3SA 2XI4A 3D4PA 3FRJA 3KZVA 1O95A 2Y2VA 2DWCA 1QRTA 3OP4A 3COWA 4MA0A 4YDHB 3R4CA 4NSNA 3QFSA 1TQ2A 1C7FA 1UBCA 1IXYA 2C9CA 3AVQA 4H6PA 2VTBB 1PFUA 1SPBS 1L5OA 4C07A 1A96A 4MWCA 1IIBA 5TGTA 3NB0A 3SP1A 1HT2E 2QMQA 4CQLB 4OMCA 3Q7QA 4XR4A 3U56A 4UVEA 2XTNA 1VSBA 4FFPA 1VFPA 1E4YA 1QGAA 2AZTA 5ALRA 1FFGA 4GHWA 4C5BA 2D00A 2HCRA 2XDWA 1G63A 4US2R 3WFZA 3HLTA 3HKCB 3O6VA 2JLQA 4CLOA 2AFHE 3A7DA 5DGCA 3O4JA 1WQ1R 3UOWA 1MVOA 4W9NC 5TB5A 3MUEA 2H1WA 2VHZA 2O8FB 2PGDA 2ATXA 3MTEA 3DEJA 2OWDA 3MTDA 2O59A 1I4TD 4G4IA 4UPDA 1XHFA 1YZHA 4JP5A 4DCGA 4HQRA 2JGMA 4CN9A 3TLYA 1NTRA 4M0FA 5B6JA 1JQBA 4G5SA 3EBPA 3EGWA 4YYEA 4C6TB 5DLDA 2I9PA 2MOKA 2VDJA 4BEBA 1Q0ZA 4JC0A 3EIHA 1L5MA 2NTJA 5HKAA 1IY9A 4F60A 2HF7A 1OR8A 3QFRA 1I0ZA 4BQEA 2XQGA 2UXBB 3K1TA 1R6BX 3QYFA 4CW7A 5EXTA 5JUWA 2A9JA 4BBJA 5LZ9A 3EBOA 1D1SA 2J3EA 2DFLA 2YN4A 3O8QB 2Z2YA 1P1KA 4NR0A 3TVYA 1UXKA 3SFZA 1CUVA 2I6XA 2R5NA 2ZI6A 3AETB 2FW1A 2X8BA 3KCQA 4LBVA 4NCJA 3Q5GA 5FFMA 3V97A 5KNDA 2NVOA 2VSYA 4BVFA 1IHOA 4KYVA 4XIFA 1EVJA 4H7JA 1JXAA 1QH9A 2ZP1A 3RKSA 1R5JA 3RAFC 4CUKA 2B1JA 1SA0B 2AHOA 2RCYA 3ENWA 4IIHA 2HZBA 2P9QA 3ZBUA 4E6EA 4MW9A 2H17A 3O21A 1AV7A 4JB2A 3WDMA 5CA1B 2F1JA 2FHSA 4OM7A 4OUDB 3WL8A 5AVYA 4M0EA 2EJTA 1FX1A 2FWPA 3CBQA 3LHKA 4Z6KA 4F2PA 4LNHA 1IM5A 1PFWA 2ZUEA 2TMDA 3PUIA 3HB9A 3FSGA 1NATA 4NBRA 4HAVA 3CVYA 5ISMA 1OMOA 1Q57A 1WCWA 1GWNA 4XARA 3INRA 3CEJA 1Z8NA 5AVRA 1Z36A 3NRCA 2J33A 4Z5XA 1OFHA 4O4IA 1ZMOA 4H59A 4WL0A 1CY6A 1JHRA 3DS8A 5DBOA 2BEWB 4H7DA 4XVHA 5D86A 1IWOA 3A4VA 1M2VA 1YR2A 2E4YA 5HXAA 3RLFA 2BR5A 3U13A 5K05A 1D6JA 5G1OA 1M2HA 5KOJB 1IQ0A 3G0HA 2W6ID 3HDHA 3CUWA 3EF1A 1IBCA 3CT6A 2QJFA 3JPWA 4GLBA 2IHYA 1KE2A 3ROTA 3WRVA 4QLAA 3RIHA 2J59A 4AJJA 1WABA 4Y9SA 4ZFNA 1TUBB 3C6YA 4L8YA 1O7JA 3ESDA 2GXQA 1FPMA 1RYYA 2O14A 3CUYA 1ZJ6A 3X2FA 1J8MF 3JQ8B 3KVYA 1QG6A 1UPTA 2BF7A 2LDBA 2GCEA 2JPDA 2P0YA 3JYHA 3L79A 4GH5A 4HF7A 2PD4A 2YWRA 3VU0A 5IKPA 3R75A 1ZOSA 1EX1A 2HJRA 3ZHTA 1M2EA 3LQ1A 2IPXA 3T3IA 5TQ0B 4NKRA 1DDGA 2Z4TA 1RRVA 5FPTA 5FUVA 2AB0A 4JMPA 5MN6A 3QLVC 4U9UA 2O7VA 2OLJA 2Q9UA 1HTWA 3E7XA 5EJGA 1CQIB 1JMYA 2B4RO 2C2WA 3KPJA 1MIHA 2P79A 1GSIA 4YJGB 4K6KA 1CE8A 4AMBA 4Z1MD 3PUKA 2W98A 1ZY2A 3L6RA 4FMCB 3VMMA 4US0R 1I1NA 1IZZA 2GILA 1J4AA 1P1HA 1S9HA 3KZKA 1ZUHA 4GMDA 4IFTA 4MR8B 5H4GA 1RYHA 1QHGA 4X97A 1CUEA 2WZQA 2I33A 3EY9A 2FSVC 4LGVA 1KDZA 5KUTA 4IUDS 1EFLA 3UUFA 3F6PA 3RUEA 4M7WA 3OIVA 1AXRA 4MJ7A 1E3IA 3HK2A 2O2ZA 3LK6A 2Z8YA 1VHDA 2QE6A 5BUSA 1C7ZA 5AIBA 1V1JA 1I32A 1Z2CA 3VGJA 3ZG6A 1LLUA 3ZWWA 2H31A 1T3ZA 3CEMA 4DRXB 1YB1A 1YASA 2MYTA 2XQJA 3DT9A 3DULA 4JJKA 4E7OA 2VTBA 1P5JA 2WVHA 1QKJA 1ECJA 2C7BA 1H2RS 3PCXA 4IMRA 3W1VA 1EB9A 1G3MA 2H1HA 3W5JA 4BLUA 1TX4B 2CXXA 5G1NA 1JHAA 2LE0A 4GX1A 4KXQA 2HWWA 3WP1B 3OKCA 2EFCB 3MLAA 4WY8A 1FQKA 1PZGA 2HHLA 2NO4A 2YFQA 3KXPA 3E23A 4PSCA 3TFQA 5TXGA 4GQIA 1NFQA 1WCV1 4IG9A 1Z8HA 5DHRA 1XCPA 3K4PA 2ZS8A 1SAYA 3T12A 3ER6A 3OLXA 4AU1A 3T9DA 2HWXA 5KTSA 1AHNA 3E61A 3R3VA 5DXFA 2GJSA 3CG4A 1PS9A 3IAAA 4JROA 3FSRA 1E4OA 1K5DA 4H15A 4UCXA 3TOVA 1IEQA 5CT4A 4Q9NA 1RCUA 4DQXA 5ECGC 2C3YA 2IELA 4YMIA 3QZUA 5HZGA 4OFWA 4DLZA 4L9SA 2AJDA 1Z0SA 2GD1O 1QGOA 3RTBA 2WQ7A 2GPYA 4GFDA 1W581 2NSYA 1FPQA 4PAQA 3OTGA 4CDGA 3SFVA 1C9YA 4QBFA 3B2NA 2YZ7A 3I8SA 1C50A 4JOSA 4UD6A 4IIYA 5BY2A 4O2AB 1TM5E 3KJHA 3DBVO 3FNHA 1U7HA 2Q3MA 1V4BA 3P5SA 2IHTA 4DDHA 2PJZA 4IDFA 3T7EA 5JMWA 5HCUA 1R37A 4H0NA 2ZYSA 4U0JA 1UADA 5BV7A 1CY4A 4PZUA 4ZYYA 3K0AB 1PD1A 5A3JA 2AVDA 1GUDA 1OYVA 1PG0A 3RFXA 1BXZA 2NM0A 3I12A 2V9ZA 4OI2A 1NPTO 5CFLA 2LCFA 1RE1A 3FCYA 2VH5R 3R09A 3VOBA 3WGHA 4FYVA 3N8IA 3I34X 4C0JA 2C84A 3FKSA 1M0SA 2YWEA 1O6CA 2C8KA 1YKFA 4R9SA 3K20A 2OZVA 1JF8A 4F71A 3V4OA 3GRFA 2C2HA 2JFFA 2YFKA 1MR3F 1L8QA 2QMYA 3FZNA 3OTIA 3LCJA 2R86A 1LW7A 1PNTA 3F2IA 1YRYE 3SQLA 4ABTA 3G5MA 1H1TA 3KZXA 3W06A 3W5HA 3ZCQA 1PQWA 1PHRA 3HBMA 3OF5A 5CYOA 1WZEA 4GEGA 3NMUF 1C0PA 1PX2A 1JLRA 3ZU6A 3ZOZA 5FJJA 1HK7A 5FADA 1EFAA 3R6WA 2WWWA 5I3CA 2H65A 3GCXA 5KNCA 1RM0A 4EB0A 4C0QC 4CM1A 5JOQA 5KJEA 3AJDA 3J7TA 3MMSA 3THYA 1X7DA 2AOTB 2IUYA 3GB9A 3ND8A 2XITA 3U3OA 3ZY2A 3KB1A 3VYWA 5HHTA 5K45A 3ONNA 4DNPA 4MV0A 4V03A 3O47A 4DDUA 5GQSA 5A4AA 2WJ4A 5FTLA 2AD5A 1P74A 3AUJB 3DLIA 2AXEA 3KFVA 3T5MA 4GUDA 1JHVA 4KN8A 4CL0A 2M9MA 1CEQA 2EW1A 1T8SA 4IV5A 4QQKA 4BLOA 2I2WA 1N6RA 3LT1A 2BFCB 5EKXA 2Q1TA 2ID9A 4EPWA 4ZC1A 3GAZA 4DM4A 3FCCA 1IWPB 3ASZA 5LNK6 1PGPA 1I0IA 2D0OB 3DE0X 3EULA 3RAPR 2YY6A 1AQYA 2GBIA 3F8TA 3MG9A 1GPAA 1J21A 3PFIA 1J1UA 1ZOOA 3C6QA 1YBFA 3HKBB 4KQHA 4RZHA 4DLXA 2I6GA 3GUUA 5TRTA 8ABPA 4OQEA 1R8SA 3IDFA 5LQAA 2FW6A 4QDKA 3PCTA 1SCQA 3CW2A 1FFEA 2YNMC 1KVSA 3IEIA 4WADA 4MDHA 1L1FA 5I51A 2IPMA 4GPZA 2VHUA 2QU8A 1FS6A 1F2DA 1Q3HA 3H4VA 2HZ7A 3O9MA 4L50A 4LXUA 3FKJA 4WZAB 3UUWA 2IYEA 4YMSA 3I39X 4LDRA 2DPMA 4G23A 4BFWA 4WK4B 2ZYIA 1PV1A 3ZX5A 1R6VA 4OJKA 4MTLA 4XM0A 2DFPA 3MQ4A 3A11A 2FPGA 5JARA 4C08A 1LH0A 1CUBA 2C29D 1W2GA 4NCXA 3UXEA 3SOPA 2M1XA 4D3ZA 4F4DA 5C18A 1BWSA 4FX5A 4FB5A 3EFEA 1HORA 1PJ3A 1W0KD 3WGIA 2CD9A 5IULC 3RQSA 2CUNA 1V1RA 1BEZA 1E0JA 2IUEA 3OZBA 3S1LA 3WWOA 5A7HA 3WGKA 5BT9A 2J3KA 4RTQA 1U2QA 2ERYA 5AIAA 2NVUB 1JQEA 1F1BA 2ZFUA 3L1IA 1DX9A 2AH5A 2X5NA 3G02A 3ITNA 4KV7A 4D8TA 1L4KA 4IO0A 2Q3LA 1DWQA 4R0NA 4GI3A 2WM8A 1QV7A 2XCUA 3ZU5A 3C74A 3HKEB 5TJHA 1CS0A 1X7GA 3SIXA 3REOA 4V1CA 2OCIA 1ZD5A 5HJ5A 4UNPA 1V11A 1MHTA 5F76A 4MRMA 5TDHA 1PJBA 4LRQA 4ROSA 4HWGA 5J9FA 3B7GA 2XTJA 5ALDA 1OB2A 2IXTA 3LPDA 4WLUA 4DYVA 1UQTA 2QOEA 3AIMA 3H9JA 3KNZA 4L0CA 4Q3AA 5COAA 4BN4A 5LDGA 3IO5A 1VRVA 2C95A 3A0RB 3PUXA 3K94A 1E7SA 4PC7A 3LGAA 1HDRA 1G9SA 4II7A 5D2CA 2UZAA 4MKXA 1KVUA 1XNQB 2H1VA 3UMVA 5LBTA 2W71A 1JMVA 2PZFA 4ILEA 1X19A 2K7FA 1RBQA 5EGSA 2X9VA 3M5PA 2JFQA 4C7XA 3HYCA 3GRKA 3CNHA 2DB3A 2R6R1 4BC0A 4D0RA 4IXTA 5CNKA 6ADHA 2ONZA 3T6KA 2Q8QA 1CY7A 721PA 1ZJYA 1C1DB 4IZIA 3CF0A 3RARA 3A4MA 4LYHA 4D41A 3ZNOA 1NONA 1ZNXA 2C1XA 2GEUA 1A9RA 1N5MA 3MB8A 1F48A 4QC2A 5ALWA 2JIBA 1MG5A 2R8PA 3U81A 5HQTA 1DO0A 2H16A 1DINA 2BELA 3KKZA 1RE0A 3I9OA 4G41A 1RXIA 2NUPB 3EZNA 2VP3A 4WFQA 1PGOA 3QJYA 1SUDA 1CS4C 5EKSA 4FI3C 3HA7A 5JJCA 4PAGA 2J9FB 1T1IA 2IOFA 3CW8X 4Z7QB 1GPJA 1XZQA 3K2EA 3QPDA 4CTKA 1HOXA 1KJZA 1Y8RB 2QI9C 4MRRA 4YACA 3N2IA 3H2KA 2XCIA 1JFTA 1WUIS 1R9NA 4AL4A 3JCZA 3KKOA 1GL7A 2VATA 3UHPA 1P31A 2FY8A 2V6MA 4I4TB 4F6LA 3A2NA 2E89A 3B1YA 4K9RA 1XTJA 4N49A 3NS7A 5AW3A 2ZCUA 3ZTWA 5CA0F 1XZFA 2OP1A 1V8DA 3KKEA 3RW9A 3T94A 1XJ5A 4EO9A 4DLKA 1CEXA 2M1ZA 4JD5A 2WU3A 1DV1A 2B34A 3ILSA 3UTDA 4LTNA 5HCNA 4CMJA 3QU4A 4PG6A 1NN5A 4NATA 2D2XA 2R00A 1YZUA 2O5VA 1GA6A 1T24A 3T7CA 1CS0B 5B7GA 4FHDA 3WWDA 3GR6A 1OX5A 1XWIA 2A9OA 5JH7B 2Z6AA 4RHCA 1HURA 3W7BA 1RTKA 5FULA 1U4NA 1USUA 2JBAB 3E9EA 4QUAA 4LS3A 4RK4A 4Q3CA 5TPZD 4RDHA 4XUGB 3AEUB 3RVJA 3IALA 1XZAA 1GPYA 2QL9A 3B3QA 3B8EA 3QNWA 3HY3A 3OEHA 4IDHA 3WGNA 5BVHB 4ZI7A 5AVOA 2N42A 3T3EA 3L07A 3PPXA 3LT0A 4K3UA 3JZAA 1OKKA 4FFOA 1VPDA 2VWQA 4IJWA 4PXYA 5E7IA 2I7CA 3SM3A 3G6WA 4AO6A 4N7RA 1H2ZA 4JLVA 4YALA 1QANA 1ZOLA 1ARZA 2F4VB 3TGLA 4F3RA 1HOTA 2GZDA 3HABA 3CZRA 4LXHA 1QTQA 5SYAA 1SXJB 2ID8A 4CPDA 4PWYA 1YDWA 1Z2NX 3LW7A 1BFUA 5B7QA 2M32A 1JDBC 3B9PA 5EESA 2QENA 3TB4A 1DAIA 4BRZA 2Q2WA 4BP1A 2H7YA 4MUYA 3PFCA 5EUBA 3DVQX 4R3NA 5DTMA 3IKJA 2Y4OA 4B0OA 4C0SA 2QQGA 3M9XA 4Q4JB 1JR2A 2G9RA 1WPXA 5K0ZA 1RMQA 3GEMA 1WVGA 2WJPA 3H5RA 4K6HA 4AFNA 1D0VA 4UAJA 4MYUA 1S1MA 4MV3A 3EDCA 1NVAA 3M70A 2QN2A 4B6FA 5M29A 1YT5A 1W25A 5JCPA 3J81A 1N2CE 1ND5A 2VNSA 1Z08A 2F3SA 3EZLA 4PGGA 3HJBA 1PX0A 4ESHA 2PM8A 3IRVA 3A4TA 4L6IA 3W2FA 1OC4A 3HCEA 5EWJA 5HZHA 3HXPA 4OJNA 5TQ2A 4BVHA 4CMEC 5HJEA 3B53X 2VRCA 3F9RA 2GBLA 4P7JA 2P3SA 4QPJC 4WK2B 1RXVA 1T8WA 3DDHA 3TZQA 5ENVA 5FORA 4ER5A 4JASB 4W5TA 3U4MA 3U5ZB 1JFFB 2ILTA 1ZSYA 2EXXA 2YXPX 4G01B 4JVLA 2VAPA 3ZQJA 4DARA 4RCYA 3T95A 3TDNA 4A2PA 1DC8A 1RIFA 1HLDA 1PR0A 3D2LA 1DQNA 2EX0A 2H1IA 3QTTA 3QYPA 4PQEA 2OTCA 4TKUB 3I61A 1A9XB 1E2DA 3GJRA 3HUDA 3CF4A 4DQ0A 4ARZA 3GFQA 5G2OA 4MDEA 2RGAA 2IZ1A 1P1JA 2ADOA 3ELUA 3DYIA 1RXWA 5A4DA 4OGWA 1QNFA 5IDXA 3W1EA 4CKXA 3OJ0A 4BNDB 1ORWA 4OTZA 2K5UA 3ZH9B 4B2IA 3LBNA 4EKGA 3AF6A 1AH2A 1XJWA 1X77A 1YC2A 1YB2A 2FZEA 2YUTA 4L74A 1J0DA 4X1IA 1CRQA 3ZD8A 1Y8QB 3VHLB 4XJXA 1X1SA 3RYFB 2NP7A 4EDFA 2VUIB 1A88A 5TGZA 2OKCA 2Q5EA 2LCIA 4CMKA 3SR3A 1C2YA 2EGGA 2PT6A 1QGDA 4TZ6A 1MTZA 1EZZA 1XAHA 1AHPA 3KQKA 1PO7A 5CX4A 4M9XA 4WI1A 4HX5A 1S2GA 1NZJA 4JC4A 4JUBA 2BTEA 4ZD6A 1E0DA 2D13A 3N05A 1L4FA 1VSUA 2QNIA 1L7AA 1UQRA 2RHMA 1J2RA 1DIHA 3GXBA 3WISA 1JT2A 3D3WB 3BCHA 3DBHA 1FU7A 9GPBA 3SYMA 4L4XA 3OZIA 3JASA 1C3JA 2ZJ3A 3K5IA 3R5HA 2GVNA 3BFXA 4JLWA 4WA8A 3RI3A 3WK8A 2NZVG 5LOVB 3ZNPA 3B6MA 5CTAA 2VDVE 4PZYA 1NBIA 4G0YA 2ATVA 1W4CA 4H3KB 1I5OA 4LIPD 4URZR 4WEQA 2ZIXB 4QJ4A 3U4DA 4X66B 4JNCA 2GHIA 5DCLA 3VPFA 1TI7A 2BD0A 4C7MA 3ZDZB 3SR0A 4IX1A 2XWPA 2F43B 3ANNA 4M0MA 4YLYA 1ZHOA 3UV6A 1X8KA 4PICA 4L27A 4AG6A 4YJ3F 4PR0A 1U5BA 1VE5A 4FW9A 4A8JA 4JI3B 5J4VA 1JT9A 2VK8A 4QYSA 1JN0A 2B7CA 4NU5A 2X9NA 2GK4A 4MV5A 4HAOA 3FTEA 4G5HA 4OIFA 2GM4A 4J1QA 4XDZA 3GN1A 4ESVA 3RE1A 4CI9A 2QRLA 4PYQA 1JAYA 5CCDA 1U8XX 2R00C 4TL6A 2KYRA 4UXHA 1QCZA 2B37A 2KMLA 2XQFA 3HJUA 2QLMA 3ND9A 4LKRA 5FLKA 3UATA 1JSZA 1XNGA 5FTKA 3TOZA 1RSZA 1CJCA 3N2LA 4IQ4A 3RFVA 3SQMA 3SX2A 4IHJF 4DV5B 3QMWA 5B58T 5IPFA 5JQWA 4I1YA 3J7AC 4LRUA 1CZRA 2CJXA 4LGCA 1PR3A 3MRTA 5AKZA 3RAGA 3KLMX 5JISA 3EIQA 3L8CA 3VDNB 1QRSA 4MYRA 3B3JA 3AIKA 2AG1A 4UUQA 5GGYA 1PL6A 3GRZA 1A71A 1V5EA 3FWYA 3GCZA 3MT8A 5EFZA 4BIMA 3PQCA 5IKXA 4D7AA 2BEVA 4B3TB 5AW7A 4RMNA 3CLUD 3L4EA 3HN7A 2G4VA 2NAFA 4R1PA 4UMVA 5C1PA 4PWZA 1IY0A 3FBTA 1D4OA 2F3TA 3HB1A 3RU9A 4FFDA 3CVWA 2XADA 3H6HA 1JWLA 4Q1VA 1ZC4A 2AEMA 1FOEB 2ECPA 1EXMA 1VGVA 2PRJA 3A4IA 2FQYA 3F9CA 1XPJA 3RBZA 3HVIA 1FDRA 4B33A 4YJFA 2C0CA 5ITWA 1AD2A 2FR8A 3NP9A 2NMVA 2IX3A 5FBLB 3GCWA 2VJAA 4X1YA 2V0CA 2C8LA 2XJ9A 1Y4SA 1OFUX 1CUZA 2G0NA 2GYWA 2N1MA 3WHKA 4BO5A 1PTJA 3GJ6A 1GT6A 3HO6A 3U3RA 4KAFA 4FGUA 1ZR2A 4RDIA 2EZ4A 3BEDA 3OIYA 3CY6A 3R6TA 3PGLA 3ZVRA 1TK3A 4LI0A 4XIGS 4JEIA 3TMKA 3ZHSA 1G4AE 4CG2A 2GUWA 1Z4PX 1XQVA 2G09A 4PRLA 1U2ZA 4ETIA 1P9NA 1WOMA 1W88B 2VT6A 1WZNA 5FXMA 1P44A 5D3KA 3O3CA 2BE9A 3WGMA 1II9A 2PZ8A 4F72A 1XE3A 3UT6A 4WESB 4XLZA 4J0IA 2P2GA 3ILHA 2IVFA 4G37A 1JQ5A 2JVKA 1YS9A 2O5RA 4JJAA 3WK4A 4ZYVA 2FE1A 3Q7PA 2PZEA 3LNCA 4COOA 1D6NA 2QTGA 2R6DA 2XEDA 4ZA2A 2R68A 4ZI2A 1G20E 3EPKA 1NU6A 1E94E 3FTNA 3L6CA 2F3UA 3K1ZA 4IIVA 4B5LA 4F4IA 2XBUA 3DDNA 5F1KA 4BC1A 4TYWA 4WLVA 3UICA 3PS9A 2ZT8A 1QZ3A 2B6HA 3P27A 1KIMA 4MPRA 4F38A 2DBRA 4DGSA 3SQOA 2J45A 2XUGA 1BHQ1 1KI1A 3B7PA 1L9KA 2LPMA 4GX2A 3JS5A 4QUHA 2AF3C 3AEXA 5E38A 4K6FA 1S2IA 4LOAA 5HK9A 1QTIA 4QJ5A 4EHKA 5CB4B 4KQGA 3VR6D 2VPXA 4B3SB 1UKAA 2DHQA 3C15C 3AM3A 2B4QA 4DR5B 4E14A 5ALMA 1DZIA 3B9RA 4C4XA 4WBNF 3EFOB 2OUIA 1QJCA 3PJGA 3IL2A 2C00A 2WTBA 3P20A 4G0PA 1TUGA 3K5PA 4JN6B 5FO1A 1NW4A 3ZZ0A 4Z51A 3W5BA 2P4HX 1B3BA 3NCTA 1PK9A 2RGNA 2GHQA 3EBLA 3NNNA 5IK2A 4BMSA 2W8BB 3TD6A 1IN5A 4MS1B 3IMKA 1U8UA 3N75A 1R6DA 4M1QA 1YJBA 1N0VC 2GK3A 2QQEA 4YDQA 5HZMA 2EAUA 3MXTA 2OQ2A 5AVQA 3EXIB 1PWZA 3G1WA 3C1OA 3RIEA 1U2DA 3HBLA 4KO1S 4WKBA 1FFYA 3SEFA 4IWNA 1M34A 3ANYB 1BXGB 3B38A 3DF7A 2J0QA 1H1DA 2VHEA 5ALQA 3C3MA 2BHSA 4RTKA 5JJLA 1CUCA 3AEQA 1JIIA 1TYZA 1VKHA 3OPYI 3KT3A 3GPDG 4Q6BA 3JQBA 1QYWA 1UK8A 1Q14A 4HEA6 1E9DA 2W2PA 3L06A 3VV2A 1Y8ZA 1H5UA 1XRPA 3OZAA 5A4KA 1EKXA 2ZTMA 1OYWA 3ZKAA 4ALIA 2ZR9A 4RESA 4QOIA 1EVYA 4DUGA 5LOVA 2X0FA 1NBHA 5BN1A 3VDXA 3ZDRA 3E9ZA 2JC3A 1Y42X 3BIOA 3AL3A 3IQDB 2Z5VA 3KR1A 1HKUA 2JIMA 2R60A 1KS9A 3FWNA 3MLEA 1DAFA 5IM4A 5J2UA 4ZHQA 4W5QA 4D3SA 2I3AA 3P0FA 4HNUA 5JIBA 3IKMB 2BFNA 2XRFA 2ZG6A 3LF2A 1NBEA 4IIGA 2OMEA 2YC4C 2VHXA 3FLEA 3ZCVA 4C2UA 1JV2B 2YL2A 4FT4A 1C3VA 5DEOA 2LKDA 1SNYA 2YWHA 3B7WA 2V6GA 1F2VA 2PJUA 1YFKA 1NBMA 1EP1B 1G98A 2CNKA 1G1AA 3BUSA 4R1OA 4WOBA 5K3BA 4F04A 1SBIA 1S8OA 2GA8A 2R84A 3FGPA 4QPCA 4AX4A 2XKJE 4GYKA 1BAPA 1NX9A 3KQNA 1SKQA 2XPCA 4YMGA 1IOLA 4AZ3A 3K73O 3MJEA 5TMBA 4HTFA 7AT1A 3NWEA 1AQ6A 3GGOA 4ZO6A 1D04A 2CYBA 2J3LA 4TSFA 3RPEA 1Z0FA 3R76A 3VH1A 2EJBA 4PV7A 3UWOA 5LXTB 1PLKA 4V0QA 3UWSA 1QU2A 4TYPA 5JPDA 2DULA 2WQ6A 3N0WA 1DFGA 4I19A 3QEAZ 4FHCA 2XGOA 2X4LA 2FJ0A 4CLDA 1BD4A 2C7PA 1ACLA 4MUEA 5HRAA 2NOAA 1DCTA 1KRWA 4G86A 1LF0A 1PYOA 4IS2A 1ISIA 3R5TA 3QE9Y 5GVSA 2XNDD 4QGAA 3UK0A 2BEVB 2A30A 2MSWA 4P83A 2PDAA 1BVYF 1FNMA 1VPTA 2NQ8A 2Q6IA 3GJQA 4S12A 4EG5A 3THWB 1RMYA 3JQDA 4G8JA 5L4NA 4RD1A 5ESRA 3WGTA 5FTNA 4ZK2A 4NHOA 1SQGA 2C9MA 3VR5H 4MCAA 1YCDA 3PDIB 4KP7A 1XOIA 2AE2A 2XOKA 4V0LA 2J7PD 4R7ZA 1FVHA 2FOXA 1C14A 3G9TA 5EE9A 3RR2A 1ID8A 3NX4A 3UMRA 3GD5A 1VJDA 3QMPA 1R0KA 4FEYA 1QLWA 1QLHA 1YRLA 4HT3B 5BQPA 1EXWA 1ZQ1A 4HOYA 4G97A 1W1IA 3IP3A 3L0BA 4FUTA 4RH0A 4YRGA 1KZ7B 1V37A 2VF4X 3G3EA 4HUQA 3DVAA 1Q1NA 2HCFA 2ECFA 1F51E 4Z99A 3RUHA 1NN1A 3TQCA 4A0QA 4BO8A 4KNVA 2RKOA 1UMCB 2Q5QA 3EVFA 3GF4A 5ALYA 4BZPA 2GR9A 3ZI7A 1G5HA 5A7FA 1NT4A 4KLRA 4OKNA 5CA0B 2PJRA 1EHCA 2QRKA 1GCUA 4NPHA 1G8GA 1GPDG 2BGIA 1JNYA 2RJNA 2V7WA 1JKXA 3FYUC 3GWGA 3QA9A 2CMFA 4K9MA 4R4JA 2AN3A 3PD1A 3RBXA 5IABA 3ILXA 5D51S 4AJKA 3KYDB 1DAMA 4C7JA 3X1XA 3W5AA 1OVGA 1RI1A 4HEJA 4F21A 3WFJA 5FTMA 3IDOA 4X54A 1WV1A 5K3OA 1H23A 1R88A 3IAS6 4H7HA 1KARA 1VI2A 2MYNA 5DBFA 2AYXA 3GVPA 4GG1A 3TE6A 2FWIA 4Y7CA 2C92A 4ZI7B 4B46A 3VSBA 1KJNA 2LNDA 4GWLA 3Q8XB 2HRDA 2HBZA 3DWGA 5AW8A 1C3LA 1ADGA 2R6HA 5DIZA 1L7DA 2Q07A 4V0RA 1H8ED 1P9WA 1GCGA 1KEUA 2QVCA 1QKIA 3O1LA 3T1TA 1KU0A 1WUHS 5JADA 4QQNA 1FRNA 3SC3A 1EXDA 1T4BA 2YYAA 1RYNA 1FXWF 3E7DA 3QE0A 2R9VA 4PZ9A 5C1IA 4C76A 2W42A 5J40A 4ID3A 5I9TA 3RB8A 1JG4A 4W9RA 1EG7A 4PW0A 3LRPA 3Q9UA 1NBOA 4XDGA 3VYTB 4KRGA 3UC5A 1K6MA 1OXTA 4E5UA 1YIDA 2BIFA 5BQ3A 3GLVA 3WKCA 4YP1A 1HDEA 2BV3A 4GBED 1X70A 1B6SA 4B8ZA 5KNBA 2UZ1A 1J8FA 3H5NA 3ORHA 4KDFA 5COBA 5I48A 1JFRA 2W70A 5KTNA 2JGRA 4YO8A 1NYRA 5JZVA 2C03A 3QTBA 3JQGB 1J2YA 4TUYA 4PBSA 1FFBA 3KSBC 2LWIA 4O2AA 4TZKA 1Y7IA 4KUHA 4W5RA 3UN1A 3B3FA 4HZGA 2OCBA 5IJWA 4JYMA 2Q5JA 5KJ6A 3TTVA 4NARA 1GNSA 3HS3A 1N6OA 1TJ3A 2X86A 3A6LA 4CL8A 4BMNA 5HQ3A 2PWZA 3IULA 2O5EA 1FP4B 4PYIA 1JHUA 5DWVA 3IMCA 4CTJA 1NG9A 5HMLA 4AJ4A 4KQMA 2F8TA 1J90A 1WXXA 3NM4A 2I4IA 3TZKA 2EFHB 1J00A 1NVFA 1G42A 4QO7A 1LJUA 3FTCA 4A15A 2ON6A 2X2EA 3IAS1 2DMRA 2I0FA 4PLPA 2FPIB 4ZVRA 1BGXT 2ZUWA 3A04A 1PJZA 2C2ZA 4NP6A 4WY2A 3H5WA 1EMDA 3CVXA 1X42A 2Q41A 5AESA 4EIWA 1ZOIA 3H87A 4HNAB 2Q6TA 4I4IA 4INAA 3AI3A 4WMLA 4JEUA 4W1QA 1AB6A 4KZKA 2I2BA 2EG5A 3DMYA 1H3FA 2Y92A 1RS0A 2PSEA 4ND3A 3ET4A 5JC1A 1U0LA 2HNBA 5BWLA 1ODCA 1LCIA 4NDNE 2O8BB 3EGXA 3G9UA 3ICCA 4F3NA 3HV0A 1ODTC 1QUFA 1U90A 1LDYA 1WB6A 4RE6A 4DCTA 1EUQA 1EJ0A 2VHCA 5LDHA 3KSAC 3UJDA 4YASA 1COZA 3A4YA 1H4TA 3BDVA 4IIEA 3U7RA 3GJSA 5C5IA 6ABPA 1KPHA 1UM8A 2G7ZA 2NPIA 3JVEA 4V0NA 3T5GA 4X90A 2VSNA 3VVLA 2HQOA 5KNCH 5EP3A 4L51A 4JS0A 5E4JA 2OCLA 4CUJA 3K2QA 4E5DA 3ASVA 4F91B 3ETEA 5KCZA 4A0HA 1L8XA 3PRHA 3SE7A 1UDRA 2JKZA 5HQJA 1CE8B 1PK7A 2NU6A 3L92A 1T1JA 1A9YA 3AB3A 3WP0A 3WMXA 3WL7A 2H2WA 5C51B 5KX5A 4Q7MB 2C94A 3A1SA 1N6IA 3RV4A 1MJNA 1ZGBA 1VQ1A 3QVKA 4G5FA 3TRHA 5C8VA 4H1HA 3FH0A 4B87A 3AM4A 3RU3A 1ZGZA 4MUAA 1O6FA 3EG9A 5IDVA 5TPZA 2R25B 3ZK8A 1H8HD 2GA9A 4QOHA 5JD3A 2QP4A 4NYJR 1Y1PA 1B0UA 2I4OA 5LC1A 1BWPA 1D03A 1O9HA 1J2UA 1N5RA 2BISA 2Q1YA 3O75A 3OC6A 4BUZA 4CM8B 3TW8B 1AV6A 1KEEB 1TM4E 3DFMA 3SBXA 1XEXA 3OHSX 1AM4D 2VJLA 5A4FS 1KR2A 4UTXA 4UVIA 3PWZA 5DNVA 4AJEA 3VVCA 3U4QA 5ED4A 4TSFD 4BRUA 1DVRA 2C2BA 2WI8A 3H75A 3SDZA 4BKRA 3OU6A 5KYUB 3VR4A 4OI4A 1AA6A 4KREA 1UL1X 4YA6A 4V1CI 1ZJZA 4HMOA 1VL6A 3DR5A 4KJXA 2YWBA 1JKMA 5AM0A 3V42A 3ZN2A 2X9GA 4QEKA 4ALNA 4F2WA 2OHIA 2XLBA 3LKDA 5BN4B 2HTFA 4KMMA 1XD9A 1QG2A 2OILA 4NOKA 1NSFA 3FFAA 1SKMA 2XW6A 1Z7BA 3FM9A 4MGEA 4RJTA 2QTMA 2D7DA 2B98A 4LJ4A 1NUQA 2CUZA 3D9QX 3K8QA 4FINA 4MO2A 1OASA 4RYDA 5DNWA 1KTVA 2I3ZA 3JXEA 4GRAA 4RVUA 2Q4TA 4UTOA 3NM6B 4DIDA 2GK6A 3V5NA 4Z49A 1I30A 2HNKA 2RGRA 1NA5A 2GWRA 4DNFA 1LSSA 1TFRA 3QH4A 2QVBA 3IUPA 2WU1A 3VA7A 1E6CA 1NU8A 2HDOA 3MS2A 4J7CA 4INJA 2G36A 4Q4AB 4O1HA 3RC9A 3F4LA 3HDQA 5AHOA 2HRQA 1U94A 3KQMA 2FPSA 3PX2A 1VLMA 3OCJA 1EVKA 1G20A 4RV9A 3RIYA 3OT4A 3PQDA 1R1DA 2QM3A 1QGUA 3AR6A 4E08A 2VBIA 4C3ZA 1VOTA 1HYGA 3USES 2PO5A 3GK3A 3OCUA 3RS5A 5A5GA 1VKNA 2YDYA 4X93A 3PC8A 2V8OA 3GO4A 2WICA 4YAIA 4ZYZA 3EWAA 1U99A 1R8JA 1JQLB 4WJKB 4K6MA 3TVDA 1NVXQ 2ZJOA 3EGVA 3GEPA 2QVLA 3CLRC 4DL9A 3PX7A 1H94A 1V11B 4TLBA 2JG3A 2Z08A 1R27A 3NTXA 2P0AA 2QL7A 4JLNA 4Q82A 4TRNA 3GVCA 3LUKA 5I7RA 4XTRA 1W5SA 3M5CA 5JBIA 4M55A 2HXSA 1YIOA 1L9XA 1AA9A 1P7CA 2FMTA 2I2AA