1AZNA

Crystal structure of the azurin mutant phe114ala from pseudomonas aeruginosa at 2.6 angstroms resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTAPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Structure of the azurin mutant Phe114Ala from Pseudomonas aeruginosa at 2.6 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport(copper binding)
total genus 24
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1994-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aznA00
3C75A 3PAZA 3MBWB 2OV0A 3FS9A 1JXGA 3NJHA 1J5CA 4YSSA 1NPNA 4G7RB 2DY2A 4YVNA 4E9VA 3NP3A 2GHZA 3FQYA 3PLYA 2FQFA 1NTDA 1GS8A 3WG7B 1WA0X 2BW4A 1FFTB 3DIVA 3OQRA 1BYPA 2I85A 9PCYA 2FQEA 3QJQB 1JZEA 4FAAB 1BXVA 2VM3A 1KCBA 3NJJA 1NPJA 1NZRA 2IDUA 4PCYA 2HLEB 3G5WA 3S8FB 1SF3A 1TKWA 4P5RA 5F7BA 1DYZA 5B7MA 7PAZA 1CURA 4YSQA 3QQXA 3ABGA 4GP4B 3T6VA 4F7KA 3WI9A 3QJSB 3CZUB 3OMIB 4E9RA 1UATA 1QLEB 1AG0A 2EINB 1JOIA 1CC3A 3X1NA 2FWLB 1X9RA 1M9WA 4WKXA 2GI0A 1A4CA 1WAEA 4NB7A 4AX3A 4DP7X 4G71B 5I6LA 4KNSA 1T5KA 3NSDA 2XVBA 2W88A 3QJRB 2BZCA 6PCYA 1GW0A 4KOCA 4EF3A 4A2DA 4DP2X 1JZJA 1OE3A 3UAEA 5B3SB 4BWWA 4HIPA 4E9QA 2GC7C 2RACA 1ZDSA 5B1KA 3TA4D 1FA4A 5AKRA 1AOZA 3ZX1A 1GR7A 2AFNA 1XB8A 1AS7A 2HX9A 3ERXA 1IKOP 4DPCX 3AY2A 1SF5A 1AZRA 3EH5B 1B3IA 4HZ1A 1L9PA 2WSDA 5PCYA 2FNWA 1BXAA 3FQ2A 4JKNA 3FPYA 2Q9OA 5I6KA 2QDVA 2W8CA 3FYIB 2UXTA 1GYCA 2PPCA 2YAHA 2XX0A 3NJLA 1XMEB 7PCYA 3NSFA 1RZQA 1URIA 3OMNB 2UX6A 3NJIA 3X1BA 2YAEA 4A68A 2Y1AA 3NJGA 3NSYA 2TSAA 4G70B 4YSDA 3PAUA 1KYAA 3PXLA 2X88A 2HRHA 3EHBB 4ZK8A 1BYOA 5AFAA 1AQ8A 1GS6X 2UXGA 1KBWA 1ILSA 1KDJA 1PZAA 5I6PA 1PY0A 2YARA 1ETJA 5D4JA 4M3HA 4BXVA 3T71A 1L9SA 2IAAC 3HEIB 3H4HA 3KW8A 5B1AB 3NJFA 2XXFA 2YXWA 3QJVB 2PPDA 2YAOA 5IY5B 3QPKA 4QKTA 1ADWA 3S3BB 1AIZA 1ASQA 4DPAX 3U25A 2R7EB 1JZHA 1ASOA 5A7EA 1L9TA 1ID2A 4HCFA 2AVFA 1PLBA 2YQBA 4RH4A 1GS7A 2PLTA 1CYWA 3D12B 2XU9A 3FQ1A 3SBRA 1AZUA 5FC9A 2X87A 2PCYA 3FU9A 2OCCB 4KO6A 1J9QA 1ZPUA 2WO3B 1I53A 2H5UA 3GDCA 1BXUA 2CJ3A 2VM4A 3CVBA 1L9OA 8PAZA 1NWOA 2DWSA 1M56B 3V9CA 3ASOB 3BVDB 2WO2B 2XYBA 2OJ1A 1JXFA 1ZV2A 1AS8A 2Y69B 1W6WA 2IDFA 1WA2X 2ZONA 3IN0A 3FPXA 2UX7A 6PAZA 1KBVA 5PAZA 2BZ7A 4NAJA 1GY1A 5B1JC 4A2EA 2YAQA 3FT0A 1PLCA 4AKOA 4YL4A 1ET5A 2BW5A 3ABKB 1M57B 3FSZA 4GP8B 4QLWA 1QHQA 4AKPA 1F56A 1IBYA 1FWXA 2QDWA 1V55B 4GXFA 3ASNB 4YVUA 1NICA 4HCIA 3AG1B 4DP5X 2XXGA 3S8GB 4BK5C 1ILUA 5D4IA 2VN3A 2FQGA 1V10A 3GYRA 3AW5A 1BQKA 2JXMA 1ZIBA 1SDDA 1IC0A 4G7QB 3OM3B 4M4RB 2XV0A 3ABLB 1AS6A 5AZUA 2XUWA 3OMAB 4E9WA 2BWDA 3N2JA 3FSVA 3TASA 4YSOA 1NIEA 1GSKA 4DPBX 2R7EA 1E5YA 3IE9A 5ANHA 2I7SA 3UAAA 5I5MA 2CALA 2E86A 1R1CA 1PAZA 4PAZA 3X1EA 3H56A 1HAWA 4F2FA 5D4HA 1EHKB 3DTUB 1BQ5A 2P80D 3AG4B 1L9QA 1JXDA 2GSMB 3NJNA 1X9UA 4MFHA 3NP4A 2ZXWB 3FYEB 2EIJB 2EILB 3FU8A 5B1BB 2PCFA 4BWUA 4E9SA 1SHXA 2BO0A 1KDIA 1IUZA 1AAJA 1XB3A 1E65A 4A67A 1A4BA 3V9EA 2IH9A 3HB3B 2CUAA 4E9XA 1KCWA 1A8ZA 1PCSA 3BQVA 4YSEA 3T6XA 3CDZB 2IDTA 2ZWNA 4YSCA 2P80A 2H47C 3IN2A 4KNTA 2FT7A 3NYKA 2BP0B 4CSZA 2EIMB 1CYXA 3KW7A 3NT0A 4G7SB 4WTQA 1ET8A 1IBZA 1AANA 2CCWA 3PAVA 5EHFA 3FSAA 3T9WA 2BWIA 3WNIA 3NJMA 1OE1A 3OD3A 3PPSA 2YAPA 1J9RA 3L45A 3SBQA 1NWPA 2YAMA 1E67A 4GYBA 2VMJA 4GY4A 2FJSA 1L9RA 4UANA 2YXVA 1J9SA 4UF7C 1WS7A 3FU7B 2NRDA 1MZYA 5B1JA 4FA7B 3ZIYA 4YSRA 2MRYA 2HXAA 2JKWA 4CSPA 2IDSA 1ZIAA 2VSKB 4HCGA 4K9JA 4KOBA 1BEXA 3UACA 3S3DB 1N68A 1JVOA 2LLNA 3UABA 3WNJA 2IWFA 4DP9X 4E9YA 1ET7A 1PNCA 4DP0X 3JTBA 2QT6A 1NIBA 4NERA 4Q8BA 5I6MA 5I26A 1AZCA 3S3CB 4HHWA 3WKQA 5B7FA 4ENZA 5I5IA 3PCYA 4YSTA 2PPAA 3T6ZA 4GP5B 2J5WA 1TU2A 1DZ0A 1YLBB 2N0MA 2AZUA 3X1FA 4KO5A 4A2HA 1SHWA 4KO9A 2FT6A 1RCYA 4X4KA 1NINA 2BP8B 2UXVA 3CDZA 2XWZA 3TBCA 1OCOB 1PF3A 1JERA 2A3TA 1SFHA 2HRGA 1PZBA 3NSCA 4N4YB 5F7AA 1JZIA 1SJMA 3CG8A 3GXUB 1WS8A 2BP0A 3UGEA 2PP8A 4HAKA 4N8UA 2PP7A 1KGYE 3DKHA 5B7EA 1N70A 2J56A 3X1GA 2GC4C 1NIAA 2YAFA 4DP6X 3FSWA 3CVCA 4W1TA 4BDVB 2DV6A 2J55A 3NJKA 4KO7A 1OF0A 4JHVA 1CUOA 1OCZB 2HX7A 1JZGA 5I6NA 3RYMA 2VW4A 4HHGA 1A3ZA 1PNDA 1MG2C 4W9ZA 2GBAA 5TK4A 2BHFA 3EH3B 3JT2A 4DP8X 5TK2A 3QJUB 1PMYA 2I7OA 4JHUA 2FT8A 2IDQA 1TEFA 1WA1X 3FU7A 5I28A 1VLXA 5I5JA 1JVLA 1PZCA 3AG2B 5E9NA 4UAHA 1SNRA 1AACA 4A2FA 4E9TA 2FTAA 1ASPA 2QPDB 1AG6A 2HZHA 4DP1X 3T6WA 1A65A 3X2QB 3EF4A 1NIDA 2J57A 2PPEA 2GB2A 1KV7A 1XB6A 2TSBA 4YSUA 3TBBA 2VSMB 3AG3B 2IWEA 1JZFA 2GIMA 2DYSB 1J5DA 1OE2A 1AR1B 3CVDA 4YSAA 3TU6A 2IWKA 1BQRA 4BWTA 3MX0B 3ZDWA 2PPFA 4AZUA 1W8EA 3AZUA 2AANA 3H4FA 1SFDA 1OCRB 1RZPA 4AKQA 4BXSV 2B3IA 1NIFA 2EIKB 2FQDA 4DP4X 2H3XC 2BP8A 2JFCA 1HFUA 2XX1A 3ABMB 4F2EA 3N55A 4A2GA 5LDUA 2HX8A 4P5SA 2AZAA 2PP9A 2XV3A 4G72B 3SQRA 1AZNA 2VW7A 1W6LA 1NDTA 4L0PB 1AZBA 1OCCB 2ZOOA 4TXVB 1EZLA 1E30A 1E5ZA 2IH8A 2DWTA 2VW6A 1ZDQA 1MDAA 2DYRB 1SDDB 3UADA 4BDVA 1OV8A 4YSPA 3IEAA 2Q5BA 1RKRA 1QNIA 2CAKA 1A4AA 4AI7A 1MG3C 1HAUA 1V54B 2CBPA 2QPEB 2UXFA 3IBOA 3WKPA 1TEGA 1PLAA 3QJTB 4KNUA 3SBPA 3ZBMA 1GY2A 4HALA 1MZZA 1J9TA 4Q89A 2XLLA 3WIAA 1OOWA 2MTAA 4A66A 5I6OA 2B08A 2XV2A 1BAWA 3EH4B
chains in the Genus database with same CATH superfamily
4WEUD 1FVCB 4ZFGH 1DLHA 1T04B 2YO3A 2FX8H 1LO5A 2WVVA 5LXGL 2AV1B 3QQNA 3AWEA 4M6AA 4Q9QL 4XXDB 3TBTB 3OLDA 9PCYA 1EO8H 3LNDA 5E5MB 3EF7A 4EXPX 4QF1A 4HISA 3L1OL 5HHOB 2E27L 1S7VB 3T2OA 3KLLA 2FGZA 3M1BA 3N42B 1BIHA 3QJXA 1MHPL 5B7MA 1RZKH 2Z4QA 4A04A 2IAMD 3NGBC 1JCVA 4GP4B 3VD3A 3QJSB 5EU3A 1G84A 3PF2A 3MV01 4HAFA 5HDOA 1YNKL 3U1PA 4YFLI 2CR0A 1L0PA 3MV8B 3Q2LA 2PN5A 4HKJB 2ILLA 3LS4H 1PTZA 1L6XA 1NC2B 4OFVA 4FTVA 1LEIB 1X5LA 1OT4A 3ZTJH 5F97E 1WZKA 5FF6A 3CN2A 5FA3B 1GYVA 3BQUB 1YEJH 1MCOH 3C2SA 1QZ1A 5DZJA 3DUSA 3MRHB 4TNGA 1UXLA 4W6YB 3GSXB 5T1KB 4L9LA 2OMUA 4KUCD 3TX4A 4PJEA 2IAMA 4OH2A 2CBMA 2XWTB 4QHNA 2B1HL 3D3VA 2OAAA 5KSAC 3ARDD 4A7GF 2BY2A 1GR7A 1QRND 1UADC 1JPFA 1XGRA 1AO7D 1SOKA 1V3MA 3QXUA 2V7NB 1HU8A 1EO7A 2DEXX 3EKCA 2HSIA 2ZCLL 1VAHA 3FTUA 1BMZA 2OR9L 4GRLC 1TJMA 1LO2L 2P7TA 4L9DA 4A6YA 4ZMQA 4L1BA 1FDLL 2VH5H 5D7IF 1DVUA 3FQXA 3RWEA 4IRSA 4M9OA 4I48B 4KTEL 2H1PL 3HNSH 4DHLA 3GJEB 5D1XC 1KTDA 1SMDA 1H3WM 3PUUA 1CTNA 3ARDA 3J2PA 1GCYA 1N7MH 3NJIA 2AV7B 1QRNA 2TSAA 3M17B 3PAUA 3RI5K 1I7RA 5D7KD 4UT9H 4TS6A 3FFCB 1MAKA 4P3WA 3WMSA 4XC3H 4AUJA 4K8RD 3BP5A 3DV4A 3S4SB 1N26A 3QZWA 4BQ8A 4HKZB 1N2RB 5LBVA 4B97A 1RFDL 4WEMB 5CM1A 3VI3F 3GUFA 4ZDHA 3N1FC 2JXMB 3WXWH 2CDGA 3VNYA 3MGTB 1U8IA 3BH9B 3KW8A 4LF3B 5T1LA 4U0RB 5I0WA 4N68A 3NJFA 3NTCL 4U1HB 2OS7A 1ETB1 3RDTC 2WGNB 1KPRB 3BMVA 4FOMA 2GI7A 4HF5H 4GQ9L 3V7MA 1UOLA 4QY8A 5AVQB 1MCQA 4N0RA 2CK2A 4G6JL 4YX2H 3VXRB 5HGBA 1I1FA 2QLVB 5LAXA 3I75B 5TE4H 1P6AB 4NO3A 4NKQB 1B9KA 4Q4EA 3V6OC 1IU1A 4M5TA 5C0BB 3IKKA 2R83A 3RLSA 3G9VA 4WHDA 5D7SH 5EU4A 2XWCA 4ZMZA 5A6LA 4MCYA 1FL6B 3EHBD 1R5WA 2Z34A 4IKIA 4MZ2A 3TL5A 4JFHE 4N5ED 5E8NA 1XTLA 3PGFH 4FABL 4B60A 1DANU 3JWDH 4MB4A 4F2MA 3KL0A 4BA8A 5MEQA 3GSVA 2D73A 3QUGA 5JHLH 4Y9GA 4P2YA 2DTMH 5EO1B 1ZV2A 4K94H 4GAGL 4UIKL 4E0RB 1A5FL 1ODUA 5DLLA 4PJCE 4LHQB 1EEZA 4KI5D 2DD8H 5KYYA 2R39A 1JF6A 3ZQXA 4ZSOA 5LAPA 3VMPA 3TNNB 3ZHNA 4Y4FA 5EEVA 3ABKB 3HHMA 8CGTA 2K6WA 2MTPA 5LGJB 3ZTNH 3PGDA 2D3JA 1MJUL 4JANB 4GSQA 3FK3A 4ZTOL 1IGTA 2NX5E 1OSYA 3IJYA 3WUZA 3DLQR 3BVTA 1CI3M 1T7XA 5IT2L 3T1WA 2ATAA 2ITEA 2ZTBA 4MJ5B 3R1GL 2AJSH 1I9IL 3VA2C 4R90L 4BCZA 3WNLA 2CO3A 5J06A 3OM3B 3IXTB 4U6YA 3HUJB 2O26U 3T4AA 2XA3A 3B56A 4PR5B 3CDCA 3RTQC 3UBXB 4B9PA 3EJTA 5LJYH 5LGHH 1IFHH 2Z0UA 5EULV 1KN4L 2I9LA 4LNRA 2WAQA 3MNVB 1T22B 3H3PL 2AK4E 4CDHA 1CL7L 4JRXE 2IQAA 2A9ML 3HNTL 3DX4A 1A4KB 1IGFH 1BQ5A 2E6PA 1DFBH 4W9HC 4XNMB 5F3HB 3KYOA 4FDWA 1GJUA 4X4ME 4PRPD 1CFSB 3NP4A 1ZGLB 3VFGH 5GJTL 3QZBA 3KYMB 4AV4A 4WHTA 4AH2A 1RAMA 5C0JB 5DD3H 5CZXD 3F7LA 3RGHA 1CCZA 2Z8RA 2IADB 4N2CA 4HPOL 3GMLB 1SEQL 3FT2B 4KKNA 2BO0A 2GAZA 4XOCA 2OTPA 4PJDE 1HHHA 5HGAB 4N2DA 4R7XA 3G5YA 5F89B 3ZYOA 3KPTA 4Z8FL 5CJOL 3T6XA 4X0NA 3I9IA 1HI6A 3FCSB 1MFNA 4JFDB 5EZLB 3SKMB 4L8SC 1H5BB 4F93B 5ACZA 1UB5A 1UD3A 1A7QL 2ZE0A 2ZCKL 4G7VH 5D96B 5F0LB 4PJIE 1E2ZA 3HIZA 3OGCA 2BP0B 4TQEL 3UZQA 5G55A 3O9WD 3QQ9D 3U4AA 4KKBC 2FGWH 2X4SA 1ET8A 3ARFD 2Z65C 1UB6A 2D7NA 2BZDA 1L0QA 4Y88A 2D8KA 4X4XB 3FSAA 3GWJA 2YBGA 3KJ4C 5F96L 3Q0HA 4KK9C 1MN4A 1YPZF 5LVEA 5D5MB 2BP5M 2XG4B 1S7UB 3U0PA 2DRUA 4TLUA 4WUUA 4M4RA 1N9PA 2NSXA 3RZCC 4W9DC 4MA8L 4Y4HD 1E9PA 4PRHE 5HYJD 1L9RA 3DGGA 1DVZA 4D9LL 1MZYA 5DMGD 3UTQA 3O9WA 3ZIYA 3QUKB 1JF5A 4OIBA 1S8DA 3NABL 1P7BA 3HG0A 2LE9A 1DQLH 4PJFE 4CSPA 3TOPA 5SX5K 3GSRB 3WLBA 3ARFA 4N8CL 1J5IA 1H3TA 1MDTA 4FQQB 5FO8A 1JVOA 1WYJA 5DGQA 1NFIB 4I4WA 4QI3A 4F5CE 2QT6A 4P2QE 5F1IA 4O2CA 3MJ7A 3ZPDA 3AGVA 2BNQB 1FYHB 3TBYB 3HC3H 5IEHB 1S46A 4FJ6A 5LQBL 1CR9L 4CW1A 4EDXA 3KYKL 2BC4B 2QGBA 3U7WL 5IB4A 4Z3JA 5IFAH 4Z3GA 3EJYD 3M07A 3D07A 4ELMB 3S37H 1KXHA 4NAMA 3X1FA 4UINH 1C5CH 3GSNL 2XA8L 4KO5A 1QG3A 3GF8A 4XOEA 3WUWG 2WOYA 1P5UA 2R2EA 4J3BA 1NMAL 3O6LH 2RAMA 1ZSDB 2DJ4A 1NBYA 1ZLUH 2HRGA 1YEGL 4FL4B 4JGNA 1SJMA 4OFKA 5KYXA 2NYKA 2K6ZA 1AMXA 3ILQC 2DMHA 5IK3A 3QT2A 1JHLH 4J3VA 1XTMA 1MHHB 3HHRB 5JORB 1WCBB 5AWNL 4Q2ZB 2V17H 1RIHH 1P4UA 1IBBA 4XN9A 1I85A 1TR7A 3NJKA 3EYOB 2JQZA 2NY5L 4PV9B 2PNDA 1I8IB 1DUYA 2XFXA 3FO1B 3FT4A 3LDBC 4KRPC 3KWTA 4AVIA 5JHDB 3MRNB 3HZKA 1QYGH 1DO5A 1Z5LA 4MMXA 5D8JH 2F19H 3EJQA 4QMEA 1ES0A 2ZAGA 2ZPKH 3QXAB 4CSSA 1FNEA 5CGMA 1QAWA 2D7TL 3GXMA 1BFOB 1E5AA 2Y25A 2IH3B 4P23D 4HEPG 2X4UB 4DP1X 4OUUA 4FLQA 2ADIA 1WF5A 1HILA 3TV3H 4L5FH 4XCEB 2PPEA 5ILTL 4YHOH 1DVTA 4PV1C 1T7WA 5EF2A 4OD2B 4Z5RB 3SEPA 1JZFA 2A6DA 3LEXA 4PCKA 2YPVH 5HTSA 2QGCA 3EYFA 4PU2A 5I16A 2CIKA 4Y5XB 4H1LB 1AC6A 5E2TH 1UQSA 2R0ZL 5I8CA 2LU3A 4XMVA 4L18A 2CRZA 3LVTA 3BHBB 3RWGB 2FSEA 4J4PC 4ZO6A 5F7FA 4ZQKB 2VXVL 5TQ2L 2EDOA 3ZKXC 5L2KE 2VXUL 4P23A 1KGWA 1RIUH 3LCYA 4PVMA 2J6EA 1BOYA 1AD9B 1VACA 2XCMC 1PZDA 3GSUA 1J86A 3WIFB 3GSWB 1BBDH 3GUTA 4ZX4A 2QADC 3BQUD 3RB5A 1U33A 4IMKA 2LGNA 4OIIL 3TIEB 4Y1SA 2VLRE 4NN5B 4AQ8C 4MXVF 4XZUA 3V0DA 4MKTA 5GGVY 4K7PH 4TXVB 1FP5A 3T0WA 2BSRB 2FBJL 2IH8A 2JB5H 2AJZB 2BY0A 1ZHBB 1ZDQA 4WI2A 4QHPA 1MRCH 2AMUA 5J3HD 1ITBB 1MDAA 4OLUL 1DANT 4YLCA 5TH2B 1TFPA 5JIDA 5DT1L 5K9KB 1HYRC 1U92A 3GO1H 4QHLB 4GKNA 3ATEA 3IEAA 4FEMA 1OGAB 4LMQI 1OD7A 3KDMB 1R4XA 5DZVA 1QFUL 2CHZA 2CBPA 1K4DA 1MPAL 3ETTA 5E00A 2RB8A 3DX6A 3F83A 1MFAH 3DGDA 1ZLSH 1LEGB 5KSBB 3G6JE 2OZ4H 4E41B 5GSVB 1F3JB 1S9XB 2R27A 3GGWB 1OOWA 3CLEH 1BHGA 3GJFH 3TT3H 2Q1EA 2IALA 4FQLL 3L3OC 4G3YH 3LZOA 5L88L 5FOBA 1HSBA 4OV6F 4G7RB 1HHIB 3RGVB 4UTBL 4N5UA 3MPCA 4XE0A 4NGHH 4M1DH 1IAMA 3FQYA 3BLKA 4TTDC 1PFCA 1CFMA 2YRZA 1KXTB 1CPUA 5I0DA 5IW6A 1WP6A 5JHAA 2BW4A 2XG5A 1VKXB 4DN4L 3HAEB 4UDUA 4J1UB 3QORC 2X42A 5KYUB 1TJIH 4K07A 1GIGH 3RWCA 4A7QA 4TSCL 1HXMB 1CFVL 4P5RA 2L04A 1P7QB 2NY0B 4KK8C 5JPMB 2ESVE 3P9MA 3KLKA 1K2DB 3HZYA 1NBZA 5FV2A 3VFPA 4FFYH 1AG0A 1N67A 2W38A 3ZHDA 2IMMA 5FKAA 3VVWA 1FHNA 3CVHB 1NFDA 4OM1L 2FB4H 5C0DA 2YGNA 4GKSA 2FJGB 4XMZA 3SDXB 1U9KA 3TZVD 1WWBX 1QSFD 3U30B 4PMEA 3AJ7A 3ZDYF 2OL3L 3STLB 3UCQA 2IV8A 3LRSA 3QIUC 3ZZLA 3NSDA 5KYWA 3RU8L 4APQA 1QFWM 2WANA 3NCYS 3POHA 1P6FA 3ROLA 4UYPA 2W9EH 3QDME 3NIGB 4ZFGL 2C3VA 1P5UC 1HNGA 4BZ1H 2FX8L 4L8DA 3RHWK 3GMRB 3LZFL 4KJQC 3MRLB 4J7RA 1HVXA 3MCG1 2HX9A 4LVEA 5L8LB 4POUB 4BE6A 4HUVA 4WY7H 1KXVA 1QSFA 5DO2D 2CUMA 2KKQA 1P84J 4WKZB 3RVTC 1EO8L 3VD2A 2WSDA 4D8PA 1KEGH 1NSNH 3ZN6A 5AD0B 5GGSY 1G7HB 1UT1A 4WWNA 5KVEH 4Y1AD 1SVCP 3K8LA 3JTSA 3FYIB 3G5VA 4CGUB 1HJBC 4U1NB 1D6EA 4NCC2 4EOWH 4FNRA 1UCBH 1M7IB 4NCC1 4NO5A 2QR0B 1MAJA 3MA7A 1XXDC 2VOTA 3BZ4A 5I6XC 1BYOA 3MREB 4MDIA 3MYZA 3UH8A 3LS4L 4LFHG 3ZYZA 1NA8A 4AQ1A 3X17A 3CZFA 2R23A 3EJRA 3MLUL 3T71A 2XPZA 1HH9B 4HUUA 3SQBA 1HH6A 1LO3H 2HYMA 4UQ9A 1E7VA 2A5UA 4NM8H 2NPLX 3AC0A 3NQKA 3ML8A 4F7CB 1JGDA 4F7EA 2YAOA 1AGEB 1E4HA 3OAZH 1MVUB 2A73A 3AXHA 5IJCC 3UOAB 4CC4C 1EZUA 1K8DB 4F33B 5MENE 4JRWA 5KN5B 3HRPA 1ANUA 1L9TA 3VYOA 2V2WA 3GMOA 1B2WH 5ETUA 1KIUA 3F6LA 5K9JH 2H8PB 3MRPB 5IQNA 5IMKB 4EZJA 1DQQA 4ANUA 4O02A 1INQA 4PWJA 3JUZA 2HTLC 3S96B 4F58H 4MASA 1BJ8A 5FIEA 1NCHA 3B7RL 4Y9BA 3SCMD 3EO0A 3MJGX 3HNSL 3C8KB 4J3OD 3DTXB 4EKJA 5LN4A 5I76B 3GXTA 4K55A 3LQAC 1JPGA 2H9GB 5SWSE 1S3KH 1N7ML 2ZKMX 3GMQA 3O2VH 4FXTA 1W6WA 3CK0H 4RFEA 5C0ND 3BZEA 1WT5C 3QZOA 4N87A 4UT9L 4HZAA 5CEZH 6PAZA 4DVBB 5MHSE 2G4EA 5IBLD 4XC3L 3REVB 2YEZA 3LJ3A 4WO4C 1MJ7H 3C09B 2EDWA 4F7TA 1GY1A 4AC4A 2ZUQC 3X3FH 3T8MA 5CLZA 1KB5B 2BW5A 4G9FB 3BFOA 3ZRCC 5J11B 4GP8B 4P5KA 3WXWL 5JA9A 4BHUA 5DDHA 3HPLA 5DMIH 3SCMA 3SKJH 5B39B 3MJ9A 1FZOB 4PWHA 4ZMNA 4HEME 3AXLA 4MJ6B 4UDTA 4HOZA 3APMA 2G75B 5HJ3A 5IVZB 1B88A 1K72A 3WY1A 4HF5L 1PS3A 1IB5A 5KVFH 4MGXA 1MCHA 5DHVB 1B6UA 3U6RB 4XCFH 2DM3A 4XN5A 3IMRA 1L7IH 2XV0A 3ZDZB 3BRFA 4HFUH 4G5ZH 4S1SH 1T20A 4HC1H 3W38A 5D7SL 1AIFA 2PR4H 1A22B 2EE0A 3B2UD 1XGQA 1EHLH 4MCMA 2BNQD 4X5LA 3IGKA 4L8BA 3L48A 2APBA 3IE9A 4QJ4B 1TZOA 4PREB 5EO9A 5EEZA 1CF8H 2E86A 1JN6B 3JWDL 5AYQA 5CU9A 3P73B 3KPQA 5JHLL 3TESA 2DTML 3U1QA 3Q01A 1F4YH 3ALXA 5TDOB 4Y2NA 4OF3A 1U8KA 4CSTA 1YYCA 2HFEB 4PJ7A 1UUNA 3BE1H 3IAQA 3V0FA 2DD8L 1JG9A 5CEYB 3MOQA 5D1ZI 2DIAA 2PCFA 4PJ8A 3CQPA 3SD2A 1U3HC 3GIVA 4GRWE 4NNYB 4C59B 4PJCF 4V1DB 5DC4B 3ZTNL 4AJWA 1AAJA 1BZ9B 2OXHA 2F61A 3BPNC 3H9SE 3S3PA 2AS5M 3HB3B 4D0CA 4L3EE 2J72A 5C92A 4PJ9B 1CT8B 1DJGA 1UGKA 5C0CB 2E0PA 4XMKH 3RFZB 2AJSL 3QUYC 2YLKA 3SDAD 3TJHC 4JO2H 4WHYH 5D2NB 1BG1A 4KGLA 4BKLB 5GZOC 2JKTM 3P40A 1KY6A 1HXYA 3E1ZA 3C60C 5E2JA 4PJAA 5FFOA 3RTLA 2BNRD 2PYFB 4HLZG 1NBVH 1OGSA 2WJ5A 1A47A 5LGHL 1IFHL 4M7JH 2AQ2A 5BZXA 5T5FH 4F8NA 1WAAE 1X6LA 4OJEH 3WGUB 3QR2A 5EOTA 3NJMA 2DB8A 2WINA 5DHYB 1O6VA 3FOLB 5CGYC 2NZIA 4QRPE 1RK1B 1FV1B 2JB6A 4MS6A 3BXNB 2NR6D 3L5HA 2J25A 1EXUA 5I19H 3VXUD 1IGFL 3BW9A 1DFBL 3F7YB 3SDAA 4JFWA 1KSRA 2DICA 4F9LA 2NRDA 2AGJH 2WN3A 4FA7B 2JCCA 3VFGL 4YSRA 4BH7A 1WQVT 2BNRA 4FFZH 2RCSL 5DD3L 3DPBA 3UACA 2ADJA 4O51A 6FABH 1E3XA 4E9YA 4I0PC 5G5DB 4JPWH 5CLWA 2J1KA 5GS3A 5I6MA 1IKNA 2EP6A 2Z91A 1TCRB 1HEJC 2HT3C 2YD2A 3KVQA 3Q9QA 4H25B 4JCWA 2MIZA 4KKCC 3F5WA 4OV5A 2NR6A 3I02A 4IM8A 3WTYA 4QXGL 3VXUA 3TBSA 2CUIA 1T66C 5DRNA 1BVKA 3T6ZA 5D1XE 3TN0A 3U48A 2Q76B 4G7VL 4PJDF 5T1DH 4BRJA 3L3GA 5HPOA 5TDNA 1HHKB 4TQHA 1NAKH 2NY3B 4HA1A 3QG6A 4RGNC 5FO2A 2PUQT 2VN7A 3K2MC 2FGWL 4M8UA 3FQUA 2CM6A 1RK0B 4PJIF 4XNQA 1RZGA 3TBCA 1PF3A 5F7AA 1PZBA 1LP9B 2W94A 3C6LC 2P9RA 3SKOB 3MRGA 1OGAD 2ENYA 3K5SA 1MREH 1PZ5B 5DCCA 3G5XB 3CFTA 1HNYA 1I4FB 5FYLD 5IIEB 3LEYH 4AQOA 1EAPA 2VL4A 3KPLB 3O4LD 4CN6A 4C57C 1AR1C 2GG1A 5T3XD 1Q0YH 3JQOB 4E41D 1D5BA 3RILA 1P84K 4JNXA 3KL5A 3O2WH 1DQLL 4RFOH 2ZP8A 3B83A 2QPFA 5DK0A 4Q9CA 1NBQA 5DRZB 2IMNA 2LV4A 3H2WA 2GBAA 4FNSA 4LHUB 3BPLC 1F4HA 2QKSA 2VMFA 1P4LA 4MJ4A 5F9OH 5L4FA 2FT8A 4PJFF 3V6OE 1HEZB 3VU1A 3FU7A 5FYKU 1PZCA 3OHXC 2WNGA 2Q6WA 4ISVA 3K6SA 4X2UA 4MD4B 2QPDB 1AG6A 5EF0A 3UTPD 3O4LA 1BX2B 1NDMB 5IFAL 3FKUS 1KNOA 3DBSA 5FPIA 5HD8C 1RIVH 2WUCL 5E70A 2FX9H 2JKRM 4G6AD 4NQDE 3S35L 3PWPB 3S37L 4ZW8A 1T2XA 4UINL 3IFOB 1C5CL 1BJ1H 4Y2DD 4WZ9A 3BC9A 4N2EA 4L1DA 5CBEA 4C56E 4F7PA 1OW0C 4MAYD 5LG6A 3O6LL 4RX4D 4LBEB 3CVDA 1E8YA 2IBGA 5JZ7D 1OGTA 1YSOA 3AY4A 1W0WA 5A2IH 3QDGB 1KV3A 2IANB 1NOLA 3FULA 4AITA 5FX3A 1J1OL 3ZDWA 4PJGA 1U2YA 1GOHA 1JHLL 4LLYB 1B4JH 1YHPA 1KZQA 1LWHA 3EADA 1OCRB 1TKWB 3BH4A 4JFZH 4WI5A 4BXSV 3KZ8A 4I0CC 2F2HA 3HVNA 3LKSA 2V17L 4ZO7A 1RIHL 1KENL 4HJJH 2EADA 4NOFA 5DD1L 4OCLC 3LZRA 4A2GA 4Y2DA 4W9LC 1DJWA 5F7MC 2QZQA 4MAYA 4OY9A 4RX4A 1UWFA 4L0PB 4NQEE 1OCCB 1MCKA 1T1YB 3AUVA 4NJ9L 2HMIC 1DDHB 4M43H 5CR8A 1C16B 2FWUA 1CE6A 1QYGL 2CLZB 4PJ8C 5D8JL 2F19L 5I74C 4UILH 3U9UA 2ZPKL 5KJRH 4HS8H 4H1LH 1ML0A 3FTZA 1IV8A 5HDRA 2QPEB 4U1LA 3TV3L 3L3DA 4L5FL 5IHBA 3NFNA 3V2AR 3GRBA 3B7YA 2EO1A 1EO5A 2YUXA 4JBSA 4YHOL 1QVOB 2BVTA 3ZBMA 1YCSA 3D85A 1NCWL 4M8VA 1MW1A 3GSNA 4HX1A 1J9TA 4JFFA 4Q89A 3HZVA 5IZ7A 1SJEB 2YPVL 4MNQD 5C0IA 1LEKB 3BPCB 1N5AB 4B9FA 4Z0XB 2X1XR 4ETQB 5ABDE 1ND0A 1T4KB 2ICEA 5E2TL 5HDLA 1TQBB 1JXGA 5ESAA 4IBQA 5EPMB 3RVVD 2G4GA 2H2SC 4NZJA 2R0LH 4OGXL 4FTVE 5JXAH 1RIUL 2MHAB 4K3DH 4JB9L 2F54B 1RZ8A 1SUJA 4RAHA 1FZKA 4IKKA 1AP2B 1BBDL 5TF1H 1QPXA 3ZY7A 1M53A 4QTIH 3ZVVA 5DJCA 3WY3A 5DHXB 2RD0A 2Z31A 3D3VE 1SF3A 2PTTB 4K7PL 4KITB 1G9MH 2QQNH 2RH0A 3EJZC 1C08A 2JB5L 4X5XA 1JK8B 2I5YH 4YZFE 5E99H 3ABGA 1MRCL 5ISZD 3LAFA 3OR6A 3VJ6A 3A21A 3FQTA 3CX2A 3SY0B 2B1OA 3HJ0A 3GO1L 3MROA 4MWFB 3QFDA 4LCUA 4KVPA 4UB0H 2MQ3A 4OKVA 1XH3B 4D0DB 3RPIB 1FZJB 1MFAL 1LVEA 5FR3A 1ZLSL 1D6VL 4PJ5D 1LHZA 5CBAA 4P46D 1G1KA 2OZ4L 3I9GH 1T7YA 3NZSA 2XVBA 2HKFH 3HAEH 1UH2A 4A55A 2WZ6A 4XMWA 5IBUG 4KVNH 3CLEL 1BPLB 1G7MB 3JUYA 1KMGA 3TT3L 4KTGA 4KH2A 3G6JF 2AXGA 4XBMA 2GEEA 5E9DD 2V5SA 4HPYH 1C12B 1Z1WA 4ORGB 4NGHL 4M1DL 4WWOA 4WSGA 3ZX1A 4FCHA 4CJ1A 2AFNA 4UIMA 3EFFA 3EGSB 3B6SB 1E6JL 4M61B 4GH7B 3VE0B 1XF4A 1LK2B 5KWYC 4MMZA 4PJ5A 3CFKB 3CVHH 3OX8B 1L9PA 1Z0NA 3GM0A 4G9FD 2FNWA 4P46A 4OZ4A 1TJIL 1GIGL 5TPWH 1A6ZB 1LO4H 3CIQA 4N2NA 1K5NB 2FBRA 1MY7A 4U3CA 2NUPA 2WBJB 5IB2A 2VR4A 5D1QB 1QR1A 3VQ1C 5E9DA 4AGQA 3JWOL 5BS0B 3QJHB 3EBIA 3FQNB 4WWKD 1LE9B 3X1BA 4FFYL 4K0OA 3FBQA 4FQHA 4NQCE 3UYPB 4X83A 4HWBA 3Q8FA 2FB4L 4Z7VB 2H2PD 4OD1L 5F7NC 3NEXA 3F7RA 1XO8A 1W72B 4M6OH 2QFRA 4QRUB 2APFA 1ZV9A 2VLJB 3LKQA 4G1EB 4X8JB 3JT0A 4GFTB 2GJZB 4DNLA 1FPTH 2Y3AA 1MWAA 3INUH 3NESA 4BZ1L 3QUXB 1AGBB 1WWCA 3EFDH 4WWKA 1IAOA 3LH2H 3UJTH 4UTBA 1B4LA 1Q9OA 5E2UH 2X4NB 4GUCA 4JM2C 5CSZA 1HL5A 1T6WA 3IXAB 2WHVA 2AVFA 4N1CA 4WY7L 5EORH 2FJFB 4HOMA 4FCAA 3VWJB 5CN1A 2LTQB 1BYNA 5IHWA 1RHFA 5EIIA 1KEGL 1NSNL 1J8KA 4X6BB 2A9BA 3E8UH 5KVEL 4IBZA 3CSYB 3EW3B 1I53A 2EH8H 3II3A 4CUCA 4W93A 5IV2B 3MFFB 3B2MA 5KBPA 2AQNA 4EOWL 1UD8A 1GMEA 1UCBL 1CICD 3MNDA 3X12B 1JWSB 4EI5C 2EJ1A 1ZD6A 3CHQA 3TO4B 4ZPVA 1IEBA 5EIIG 4Z7IA 3P4MB 4XGZA 2R4RH 4QYOA 3EBHA 1G9HA 2OL3A 2E56A 4YL4A 2DQCH 4JFXB 5B4MD 1LO3L 1PJ9A 1AGCA 4KDWA 4NM8L 1JZ4A 4OZGA 1DZBA 4HBQA 1YC8A 5F71A 2E9WA 3C5ZD 1A7PH 3MRDB 1CICA 2XXGA 3LV3B 4TUJB 5DURB 2YGVA 5A16B 4DESA 2Q3AA 1QWNA 2EDMA 1HQRB 4P9MH 1AR2A 3MOBH 4IEFB 2J6WA 4PRNA 1B2WL 3N44F 3OF6D 3PG2A 5CIPH 3WS3A 3KBPA 4AZ8B 4WW1A 3UIYA 5K9JL 3BUQA 3HLKA 5FM4A 2NXZB 2QQLH 3L9EA 3MBEC 1NIEA 2Y07H 4YHIA 1IGMH 2CG9X 2KPWA 1H3UA 4F58L 5CP3H 1J0HA 1TTUA 1TQVA 2KLTA 5JNYB 1MCEA 4YK4C 1K4CB 4AUYA 3D6GA 1LMIA 3TFKC 1KYOK 3X13B 1TPXB 3IFNH 3PE9A 5K9OB 2NY5C 3ZK0A 2Z31C 1S3KL 2PR9A 4JHAH 1CFTA 2Y5TB 1VHPA 1EJ8A 2VUKA 4FP8H 4K15A 3MO1B 3QAQA 3O2VL 4XT1C 2QHLA 5DJ6B 3CK0L 1QO3A 1MCFA 2ARWA 4OJAA 1WC7A 2A9DA 3OF6A 4X6DA 2V9RA 3HR5B 1Q9LB 1MJ7L 4MJIE 4OI8A 1OAUL 2WQUA 2XN9A 3ENEA 3RJDA 3X3FL 2OMVB 2Z1KA 2D4FA 5CS7A 4LCWD 2WQRA 5BXFB 1M05A 1UJTA 1ID5I 4ZUVB 1OANA 4WUUE 5DMIL 2W60A 4K5LA 3OWEA 4IQHA 4NXSA 3SKJL 1UJ3C 4Y4KA 1IUZA 3GMNB 5GSRB 4QPEA 1R46A 2DDQH 1BFSA 3HPJA 1A7NH 1NM9A 1Q0XH 3AU0A 5IB3A 1BEYH 3FONB 4LQ1A 2VXQH 5D70H 2QPSA 5BRPA 4IOFD 5KVFL 4QRTA 2FO4B 3BZDA 4F92B 2K4AA 5HVGB 1L7IL 3T4YB 3S35X 4HFUL 4G5ZL 2ICWJ 4S1SL 4HC1L 2CCWA 2PR4L 3ARTA 2P8LB 5I0ZA 1EHLL 4J2XA 1L0XA 2APVA 4N0UB 3RX8A 4R5VA 4AEEA 3DDGA 4K23H 1E9OB 5JIHA 3HRZA 4QJ3B 25C8H 3FOMB 2YWYA 1DCEA 1CF8L 4XXCC 3W0WE 3ZUNC 4BFIA 3FMGH 3FTGA 2C4FT 2X2JA 1F4YL 3RNQA 2A4EA 4WDIA 5CJ8A 5BPPA 3VFWA 2FX7H 3VFSB 3H0TB 1VA9A 3HZMA 3MZTA 2H6UA 2J1YA 3FCTA 3EO9H 5E94A 4BM7A 2G3NA 4FA8A 1MJJB 2WKGA 3FCUB 3MUGB 2X2HA 1MFMA 3LH8A 4TVSa 1JK9A 5F3BA 1NANI 4UOQA 1ZEAH 1Z5YD 5CILL 2QKIA 3L3KA 3HN5A 3U7AA 3WNJA 3IJHB 4GEJA 2JJSC 4ONGL 1N3NA 1U8NB 4NERA 3KCWA 4WV1A 4RBPH 1CQKA 4N0FA 1AZCA 3MGAA 1OTTC 1F0LA 1M9SA 2DQGH 3B37A 4GRWF 1LO0H 3ILPA 4ZUTB 2GEQA 1WK0A 1IQDB 5DRWA 3A6BH 4LCCB 4ZFZA 1JBJA 2BSDA 5EEXA 4XMKL 3D8MA 2JMRA 3TVMC 4JO2L 1EFXB 1F97A 4WFGD 4JY6A 2CA4A 5GRWA 4N6RB 4ZNEA 5A43C 4GMTH 4JO3H 4KJPD 3HS0B 2WKOA 2FT6A 2VT0A 3FNKA 3QFJB 3T3PB 2X4QB 1NBVL 4FFVD 5K39A 2DJMA 1T1WA 1SJHA 4M7JL 3DOHA 2IBZX 4WK2B 4Z7WA 5T5FL 4OZIA 3KR3H 3I3BA 4ZUSB 5IQOA 4I9WE 4X6CA 3Q43A 4G6FD 4NIKB 4YIQB 1NJ9A 5IUSA 1DN2A 1QHPA 3VG9B 4XX1G 3B34A 1TIUA 1WAAF 2JKNA 5JHLA 5EUOE 5I19L 1A6PA 3KGUA 2YAFA 2WXHA 1KC5H 4NKOA 3SD5A 3V4UL 2AGJL 2JV6A 3CVCA 4W1TA 4Z7OB 2WTRA 2F58H 2JCWA 2VUOA 1UOKA 3D2TA 4D0BA 5DWPA 2H7WA 4FFZL 4ZPTA 4P3DA 2VWEC 2FR4B 1J05B 4H2CA 1PNDA 1MG2C 6FABL 1J9CT 4NN7B 2B8OT 2BHFA 1IM9B 3FB6B 5J8OA 4AGNA 2ITDB 3VTTA 1TVBB 5F9DC 3GINA 4FXKC 1I8KA 1YA5A 4KKAC 1QA9A 4UM9A 5SWQB 4L8CB 3J7HA 2JKIS 1U8OA 1H6UA 3W9DB 5DR5H 5MEOB 1AKPA 4EBQH 3WFEH 4GW4A 5T1DL 1I1AB 3F6JA 3IDGB 4J27A 4RMBA 2XNAA 1NAKL 2TSBA 1IQWL 1UZGA 3GBMH 3K72B 2W0PA 3JVGA 3UO1H 3DX7A 2HPOA 2G3ZA 1WIPA 3IGLA 1BFTA 2FIRT 4PG9B 3VGDA 2OSLB 1U95A 5F6IB 4U6XB 3KWWB 3HI1A 2E47A 4Z95H 1H6EA 1M2VA 3PQYE 4D9QD 4TUOB 2HJKB 2F53E 1SFDA 3OKMA 2XI9A 3LEYL 4HWZA 4EIBA 1R3HA 2EIKB 2V33A 4JHBA 4KRLB 1ODAA 1PKQA 2V7HA 4Y5VC 5C0AB 4MCNA 4OFPA 1HFUA 1JJUA 1Q0YL 4JFEB 4U6VH 3ZJAA 1NAMA 1H15A 3VAEA 3O2WL 3LRGA 4RFOL 2ZUVA 1I3UA 4K71B 4WW2F 2WM0A 3I6KB 4XCNB 4HLEA 2MEJB 4ZZKA 3AS3A 1C8PA 5ANME 3SGKC 1T0MB 5C1MB 2HH0H 4N8VA 4DOHB 2F68X 2DQFB 5F9OL 3ZKMC 4XOBA 5D7IB 3L2LA 4IHBA 4QO1A 1U8HB 2JE8A 4Z76B 1CG9A 2CQVA 3T6QC 4BDVA 4OGZA 5E8PB 5FW6A 1DQKA 3GBDA 3E9UA 4BEIA 3L54A 1A1OA 5T33L 1D3CA 2BXZA 4P2RD 3U83A 5D7JC 3PL6B 4Q97A 1RIVL 1BPVA 2FX9L 2SEBB 5JPNB 2NTFA 5ICYB 3K0YA 3KJ6H 3FSOA 4QRRE 1RSFA 2H1LM 3EUDA 4JVUA 4V2BA 4L1TA 2N59A 5CR1A 2XLLA 3VCLB 1FFNB 3EDJA 4D8OA 2YXMA 2Y4SA 1BAWA 2R1YA 1SY6L 3PAVA 2Z8SA 5BQ7A 2O4EA 3AROA 3VXSA 1TO5A 1MHEB 1B4JL 1CXLA 1TO4A 2F18A 2IIJA 2FQFA 2NCEA 1YN7A 4JFZL 3MGOB 4P2RA 2WD0A 3FTYA 1OT2A 3P3YA 3LPPA 3D25A 4HJJL 4X4YB 3MU3A 2J1WA 2VLJD 1AGFA 4P2OC 2XJKA 5ENWA 3JWNH 5IOKA 4PCYA 1U58B 2Z3FA 3K6NA 2XTJE 4DTGH 2ZUYA 4WJ5B 4UNIA 4CVXB 1MIMH 1VFAA 3RKDC 3TO2A 2COVD 4QHMA 3QUXD 4CC1A 1YNLH 3DO7B 3CH1B 3BP6B 5E7FA 1KCLA 4UILL 3DO4A 5KJRL 1I8LA 3OMIB 4DO5A 3G04B 2AXJA 2QKIC 3T0AA 1S4IA 3UXFA 3S8WA 3ES6B 2NQDA 2VR7A 3O8XB 5HHPB 4I2XB 1P7KB 4UU9B 2YEQA 4L4VA 4RFNC 4MA1B 4GS7B 2W9DH 1YJDH 2HT4D 2GI0A 2XHNA 3KBEA 3S6CA 2VL5A 1HC1A 2B15A 5FYKE 1GMIA 1YMMD 1YUKB 3I50H 1MFUA 4BSWA 5M95B 2BWQA 3FB8B 4KZDH 2R1XB 5IQLA 3UEQA 2D03H 4A2DA 1JZJA 5HDBB 2DQDH 3V5DB 1X7QA 1J8HD 5A6IA 1R19A 5FHBH 2R0LL 5DZLA 4FZ8H 5CF3A 5JXAL 4K3DL 4QAWA 5L7XL 1AS7A 1IKOP 2FLBT 3EG9A 3H42H 2R9HD 3JWDC 3JVFC 1QTSA 2UZXB 1OIOA 4IRJC 5BVJA 4AG4H 5TF1L 5HHVH 2CGRH 4QTIL 1E6OL 1F45A 2YZ8A 1FYTD 3EAKA 3HE7A 4DUVA 2OCFD 1RSYA 3ZYIA 1Z5HA 1G9ML 1U0QA 1PZ2A 1RU9H 5F8QC 1SN5A 4Y9FA 2I5YL 3CGTA 4TULH 2DL9A 4NO2B 4RGNE 5E99L 5SX4I 3CSGA 3V95A 1IBDA 3A47A 5IVXB 1J8HA 3ULUD 3E6HA 4QOKB 4HUXB 5B22A 1T21B 1FC2D 2QHRH 2G60L 2X88A 1PDKB 2A74A 4UB0L 4F3FA 2DYPD 4YZFF 3RL2B 2YPLE 2AXHA 1NUFA 2NXZD 3ARGA 3QHZH 4HH9B 5T3ZH 3W39A 3O6MH 2C9PA 3I9GL 1FYTA 1G7LB 1ZA3A 2HKFL 1YY9D 2YPVA 3HEIB 4KVNL 1IM3B 4KY2A 4X8GA 5B1AB 1HOCB 3GHPA 4WU7A 1XH0A 2EYRA 1C5DA 5TE7H 3V0EA 1J11A 4OKDA 4HPYL 3ZO0A 3MJWA 1JV2A 3MV7D 3Q2VA 3UTTD 1GXEA 4U3XA 3NPSB 4Y16A 3U25A 5C70A 5CJQH 4Y5YC 1VZHA 2DYPA 2FYYB 5DEFB 5DHMC 3STBA 5LUMA 3WTUA 4HCFA 5JW5B 3OKNA 3LKRA 4POYA 4FMVA 1KLUA 3M45A 3CVHL 1IGYA 4GSXA 4PGZA 1BF8A 5EUKB 1T03H 5AOKA 2XN0A 1TNNA 2DJSA 2NUTA 1A02N 1OO2A 3DX9A 5TPWL 1RZFH 2ADGA 1LO4L 2C5DC 4JW3A 5EZJB 1DEEB 1W72H 4CNIA 5CFHA 1AQDA 4R96B 3APNA 1ZLVH 2CRYA 2WLIA 1BQHB 1IJNA 3IJEB 1DO6A 4UBDD 4I1PA 2Q7YB 1LNUA 1PX3A 3MV7A 3UTTA 1CDIA 1YPZB 2VDMB 2FATH 4K8RC 1WA2X 1T1ZB 2OMTB 4U3SA 3P77A 4NNXA 4O2EA 3EBGA 5EIQA 1V3KA 1H3GA 1I1YA 3CVIH 3MRQA 5ICXB 1DHKA 2WLJA 2IJ0C 3ARBB 3QPQD 5CWSB 5E4IA 4HBCH 5FKPA 4M6OL 1BBJA 1PLCA 2WV3A 3L2MA 4CN1A 1B90A 2O5ZH 3MV9D 3GJFA 1XL6A 4AUUA 4YDVA 2HFFA 4N9GA 3IFPB 1FPTL 3INUL 3FRPA 4JFVA 5DD6B 3UJJH 4OJFH 3VFMA 3S8GB 3EFDL 3LH2L 2B20A 1WIUA 3UJTL 3EJSA 1CMOA 5E2UL 1H6TA 2H4EA 4PG2C 3WAJA 1NL0H 1S9KC 1BQKA 3IFLH 5EORL 4UUJA 4LLVB 3UTSD 1UCTA 3CC5B 1JWMA 2Z35B 3HE6C 1UXWB 3IKCA 1CXEA 3QDJB 1ZA6B 4L4TE 4X8CA 4YSOA 5I1DA 2OK0H 2H26A 3WEAA 3P54A 3E8UL 3MV9A 4B9YA 1HKFA 4Y2LA 4ZO9A 2EH8L 3DIFB 1ACCA 1EZVY 1YN6B 4RZCB 4LVHC 1OLLA 1S5HA 2TRYA 1OQOA 3D06A 2EXTA 2VUYA 4NT6A 4AXWB 5TJWK 3LKPB 5I1GH 1HAWA 1J0KA 4FFYA 1EHKB 2X7LB 4KI5C 2HLAB 1Q4NX 1CDCA 4PJAE 2Y1VA 4NHCH 4UT6L 3NJNA 5D55A 4XB7A 4Q4IA 1OY3B 1ZT4B 3UTSA 2R4RL 5B8CB 4YO0B 5L4MA 4M7KH 4NC1C 4TSBH 4UQ2A 3SDCD 3AREB 5J56B 1AXTH 1FJ1A 1GZPB 4JUSA 1IFRA 1J87A 2BX5A 1SEBA 4JM4H 4QGTA 3KPPA 1KT2A 4JO5A 3M86A 2P24A 1A7PL 4JHWH 3RG1C 4YSEA 3BP7A 4MSWA 3BSZH 5F9AC 2X41A 2IDTA 3TBVB 2JCCE 5F7WC 3VDBA 2WJ7A 1F2XK 3MOBL 3WHXB 3WKMH 3BH8B 3QHTC 3HG3A 3DOSB 3MLXH 3NT0A 5FECA 3CE1A 4PS7A 5CZKA 2QQLL 4HKJA 4Y0GA 1SXBA 2Y07L 1IGML 2EYTB 3QUMA 4K2UH 1R3LB 1F4AA 4PIBA 5BRZB 1INEH 3V0VA 4Z3IA 5DFTA 3WNIA 4AL8L 1D2OA 2XY1A 3L3JA 3VXUE 3IFNL 3PPSA 3WN5B 4EN3A 3EYQD 1RJZA 2NNRA 5EU5B 2Y7LA 3D50A 3QISA 2FJUB 4NN6B 5BZWA 4FP8L 5JR1L 2VITB 1KTLA 4YBLB 5JLZB 3MLRH 4P99A 4YE4H 3B9AA 3TA3B 1JTOA 1U41A 4GW5A 4YHLH 5CZXC 3WLWC 4LL1A 1DBAH 3PWVB 5AW2B 3OGOE 4QCIB 2CO6B 4KKRA 3HOGA 3N6YA 4K9JA 4PBDA 4LESA 3ZDXB 2IPKA 1E90A 3ARGC 4FQXA 4JZJA 2MPAH 3QRBA 3BJLA 4UQAA 4Z23A 1KLFA 1NIBA 2G9HB 5DK3A 2DDQL 2WBXA 2EICA 1A7NL 2Z93B 3RRQA 1MNNA 2Y0SA 1BEYL 4HHWA 3VXPA 2VXQL 3GXNA 3TEZA 2CMRH 3IF1B 4ENZA 5A2BA 5EOQH 4TVPD 4F15B 1D5RA 5D70L 3GXIA 2OMXB 4L37B 3CBJB 1G7PB 4Y19D 4NWUL 1TENA 2VABB 1FORH 1FCCA 4OLVH 5CEZD 2AV7A 1CFQB 3RUGA 3M17A 1GJIA 4QRQA 5DZOA 1SHWA 1MFCH 4OIAA 2NY1B 5INDB 2NZ9C 5FO9A 3R7QA 1IL1A 1WZAA 3RVXC 4MCZB 4JFQB 2BP8B 2MQ0A 3ZHLA 3U9PH 2P5EE 1TT6A 3N5AA 4HKZA 4N4YB 3NSCA 4K23L 2YMXH 2COQA 2X0WA 4FA6A 25C8L 4XMUA 4JFTA 4Y4HC 5ADOH 2JI1A 4YGAB 2ARJQ 2PP7A 3FMGL 1VEOA 4HIQA 4M6NH 5H2BB 2C9AA 2FHFA 3D39D 4LSTH 2GC4C 4XNYH 5TDPA 1WWAX 5IWLA 3HC0B 4BFJA 1AQKH 4C58B 3UDWC 3L3OB 1KXQA 3S4SG 4Y2OB 4PEEA 3DHMA 1ZEAL 4LLQB 3PP3K 1W8NA 1DQJB 2FRGP 2IEPA 1EXGA 1P1ZA 3OKYA 3C6SA 2I7OA 4ZOCA 5AW3B 2I9TB 1WA1X 4MJHA 3UTPE 1LO0L 4DSYA 3UCRA 1SNRA 2V9QA 3QORB 1A3LH 3D39A 1CIDA 1SVZA 3A6BL 5FYJH 2HZHA 4NS0A 3FTVA 4Y9CA 5E4AA 3EF4A 3AWGA 1NGWB 2GFBA 2N01B 4YUEH 3SJVE 4GMTL 4JO3L 3FQWA 5I9QB 3AG3B 1FAIH 2LT9A 1HDMB 3LIZH 3QQ4B 4JJHA 2BY3A 3LN5A 3QUZD 3QXDB 5KBDA 3KR3L 2XWBA 2JIXD 2WXFA 2JKLA 4JQVC 4JR9H 3FO2B 3QI9B 3AT0A 1QW8A 4QXWA 2P49B 1MW2A 2H3KA 3L81A 3NZ8A 3TH3T 3S5LB 2AJ3B 2AP2A 5LGJA 3LQZA 5C09E 1CZ8H 1H0DB 5A3ID 3W57A 1TZHA 4HWUA 3EGXB 1LJMA 4JFFE 3VXNB 4NXKA 3JWOC 4W9FC 3UC0H 4Q6IA 5I17A 1DSYA 2Q86B 4J6RL 4PJXE 2F58L 4OFDA 3QWOB 5EUOF 3VFUA 5FA4B 4WJG3 4PP1D 4HZLA 1VB9A 1NGXA 1W6LA 4X98B 2CRMA 4MNGE 2O72A 3QUZA 4GQQA 3U4EB 4CVUA 2VXSH 2JIXA 3EDFA 2YBRA 1E5ZA 4KKLD 1XF2B 3DX8A 3UBXA 4LL9A 1KTBA 4ELDA 4LPCA 2F08A 5AOJA 2FEEI 4EAEA 2PWGA 2WYHA 2RA1A 5DR5L 4JFSA 3BN3B 3WFEL 5GPRA 4EBQL 1EXHA 5EU6D 4RIRA 3FHAA 3AS2A 3GJFK 5BJTB 1VF5C 4HALA 3FU5A 3P11H 4IU3A 4W81A 3WY4A 4XNMA 5F3HA 3FRUA 5C0RH 3SE8L 1F3DJ 2CR3A 3GBML 5HGDA 3UBXG 3LHPH 3GSQB 3UO1L 4R7DB 5T5FA 1GOFA 3LYRA 3L5JA 5IMOA 1NGZB 1K9TA 3PAZA 5KSUB 3E6FB 4WNJA 4A38A 4QIRA 1V7MH 1AKJD 4JAMB 4IIQA 4Z95L 3FT2A 2PCPA 3VH8B 3VRIB 2CPCA 3DRQB 3IETA 3TP4A 4G43A 1BLIA 1WTGT 4H40A 2AF2A 3AM8C 4POZC 1BQLH 2V5YA 5EOCH 3BQUC 3KPSE 1WA0X 3W3BA 5IROD 1FFTB 2VYRE 5EU6A 4BZ2H 3MA9H 5MI0B 4U6VL 1LK3H 3H53A 2C8NA 4JFDA 3MX0A 1E27B 1HN1A 4JRYE 1IM3D 3W82A 4FFZA 1MCLA 1U8PB 2AQQA 3P02A 4AMWA 1OSZA 1BQUA 4WTWA 2AJVH 2HH0L 3ZT7A 4XVJH 2Q3ZA 1WBYB 1Q1JH 3PDGA 4DZBA 2ED6A 1AKJA 1R5VB 2JI3A 2DLGA 5L8JB 3UZVA 4AY0A 4ZXBD 2W95A 3ALPA 4FHBD 1S7UA 4HETA 4IJ3C 5IROA 4GKZA 5C0FB 3KGRA 1I75A 1O7DE 1A4CA 1LD9A 1AXIB 1NCCL 2OM5A 3DXAD 3SOTA 4F9PC 4G71B 3B9VA 1URZA 1I8MA 4JY4A 3B7SA 3BP4B 2XWJA 1F11B 2DLFH 4GT0A 4LARH 1SGKA 4YZWA 3HG5A 3EUUA 3L7FA 3N43F 1ZLWH 4Z6AT 5EBLB 1QFWI 4HIPA 2CLVB 4E9QA 4K9EH 4HK0B 4CVZA 4WEEA 4OI7A 1WH0A 4RSVA 1N59B 2IPTH 4I5BB 4L1SA 1U93B 2OPCA 5FM5O 1UM6H 5DRXB 3D18B 3DSFH 2L8AA 1UD6A 2D2OA 5EBMA 5E6ID 1AZRA 1U8QB 1GHFH 4G8GD 1F13A 3DXAA 1QSED 4U0RC 1XL4A 4AW7A 4ZFFA 1A7BA 4JVPA 2YD7A 4DTGL 1BQSA 1R5IB 2EKSA 4ONFH 1MIML 2XVLA 3DBXB 1F58H 2BERA 3O6FD 1XMEB 3SIKA 5HVHB 3RWJB 1YNLL 4ZO8A 5FUZH 5J9PA 5IQ9A 1WFJA 1ZHNB 1DVFB 4ZFOB 2UX6A 3V0JA 1GOGA 5ALBH 3E0GA 3PXLA 1CXFA 4JG5A 2ZNXA 2X10A 5D1ZD 1ED3A 2WMPB 3PHOB 1DQDH 3V6BR 4DERA 3CFUA 1XIWD 2W9DL 1YJDL 5E6IA 4EPSA 4G8GA 3EJPA 5IP4A 2A6KA 3L3IA 1QSEA 3VB8A 4BXVA 3I50L 4WK4B 4XPGL 5CINH 3EYVB 1BOGA 4FQ1H 1QACA 4KZDL 4JE4B 3V6FB 4FI8A 3OAZK 4LEOB 4XBGA 2D03L 4XN1A 4CU8A 2WIMA 2GCYB 2DQDL 2KZBA 1AFVH 3KWXA 3DDFA 5EO0B 5H37G 1KTCA 4XBPA 5HHMB 4FZ8L 5A7EA 5D1ZA 2X09A 2XZCH 5DQJB 5IEKB 1ZT7B 1U8LB 3H42L 1XIWA 1XR8A 3LNEA 4NRZB 3ARED 4IOSD 3D12B 1WZLA 4N2IA 3LPGA 1E5UI 1VGEH 4HQQH 3SBRA 3WEBA 4AG4L 3WENA 1OM9A 4WRLA 2X87A 1GZHA 2CGRL 5HHVL 4HVBA 2XY2A 5ALCH 3QGVA 4JDZA 3A4FA 2NXYB 4IDLA 4NRXB 1ZPUA 4AJ0A 3EH1A 5E03A 2W91A 2HAZA 1RU9L 3T0BA 1Z9NA 4TULL 3MRBB 3WIIH 5GGTA 4OJDH 4YDMA 2L0DA 3SE4C 5IW1A 1IAIH 2GT9B 3N9GH 3QEHB 2QHRL 5GXBB 2P1YA 1PD6A 4K5MA 3EFOB 5H94A 3KCPA 1YDPB 4PY8I 1KBVA 2BVPA 1M6OA 5JYMA 1KGCD 5DJ8A 4ZQKA 3WXVH 3QHZL 1HL4A 5T3ZL 1MF2H 5GZND 3O6ML 3W11D 1MSPA 3W2DL 4MVBC 1DL7H 1O6SA 1ET5A 3RIFF 2QV4A 3CDFA 1M1XB 2AK4B 1GZQB 4OCMC 4L48A 3O3DA 4J28A 5MEPA 1SDYA 3KHQA 3QPXH 4JQXA 5C9KA 2C1PB 3S34H 4H1LG 4XWOC 5TE7L 1F42A 4U1JB 3U7YH 2C3HA 3MRKB 4ZX6A 2ZAIA 1S9WA 2GIXA 4X5PA 4Z0BL 4X6DE 2FQGA 3D2UB 5CJQL 3OAUH 2XN9E 4QTHA 1S7RA 4NQVB 2MQGA 3BO8A 5C0EB 1IC0A 2HVKA 1WD9A 2XBDA 4NC2B 4PVNA 2B16A 4E42B 4Z78B 3ABLB 4PSRA 1BD2B 1T03L 5LLIC 1TVHB 2J2ZA 5G4OA 1Y18A 1RZFL 4OCXH 5I1EH 1LEGA 1DVYA 1Q94A 2N3JA 4NZFA 1I3RA 1W72L 2BMKB 4AVHA 2PYED 5ANHA 4W9GC 1H5BC 4GO8A 5D96C 2JTDA 4RA0C 5DMKB 4F2FA 4NBXB 4PIRF 2FATL 4LOEA 3D7PA 3QIWB 1X9UA 3NCCB 1PQZA 1U6AL 2EDHA 3CVIL 3GRWH 2VLKE 3SO5A 2GY7B 4HBCL 4XAWL 8FABB 1QFWH 5FCUH 1PX8A 3KXFB 2W07A 3CSPA 1KJ3H 3PXHA 2O5ZL 1OAYL 2ZUXA 2PYEA 1RJYA 2D9QB 1W0VB 1EHXA 1KELH 5DEGB 1W0YT 1F6AA 1HCYA 3FTSA 4OJFL 5J6SA 2CJSA 3QRLA 1P7QA 3TONA 1DVQA 4PJFB 3SB3A 1XT5A 1NL0L 3DUUB 1A6UH 3C08H 3L1GA 4B27A 3IFLL 1HL9A 1ONQA 1OSPH 3COOA 3GTVA 4Q6YA 2OYLA 4OBSA 3KW7A 2JKJA 3ARQA 3HAEG 3LRMA 3CVHA 5ESQB 5BQDA 4NUGH 1FIEA 2H0FA 1FF5A 2PMZA 3G5ZA 4DETA 3U2SB 4UZGA 5IJKC 2OK0L 5SWZE 3SDXA 2WGXA 4JPIB 2WZAA 1K8IB 4IBSA 4U1SB 4NZTH 3HLAB 1HZLA 4KX9A 1OE1A 5DFWH 3UO8B 2BIPA 2DQIH 3H7BB 2ZZUT 3IPBA 2BSED 4XX1E 3W9EA 3PDOA 4L4JA 5I1GL 4FXGB 4ZNEE 5GS2D 3FU6A 1JIBA 3ZO9A 3K80A 2E5EA 1WS7A 1H3XA 5B1JA 1FNSH 2A77H 3GMRA 3K5RA 1SYSB 1E4KC 4FL4C 4Z7WE 4M7KL 3DRTB 4TSBL 4X6CE 2OW6A 4HCGA 1AXTL 1O0VA 4PJAF 3T0DA 4JJ5B 1FZMB 1RUQH 4XP6H 1NLDH 4KH9A 4JM4L 4KXZI 2F8IA 3T1FB 4FYSA 1A1NB 2HWZH 5E8OB 4MBRA 2BSEA 2GK0A 3D09A 3IU3A 5IVOA 4JHWL 3VI4E 3KPOB 3S98A 3WN6A 4ZG1A 4G82A 4WFGE 3BSZL 4NYLB 4X9BA 3P9LA 4U1NA 5KVGL 2Q7AA 1JFHA 3WKML 5KAQG 4AGOA 3QH3B 1E4XH 2OSYA 5EEYA 3C5XA 3KH3A 3MLXL 2RFXB 3U46A 3QFGA 3ORJA 2VJXA 2JCCF 1NCUA 5D6DA 4R0LB 1RCYA 4K2UL 1PVHA 5K59E 3LKOB 1INEL 4KQ3H 4AMXA 1IGCH 3VFNB 4AENA 4PGCB 3F85A 2OJEB 2VISB 3WE6B 1HH9A 1IKFH 1RY7B 4HJ0D 2NT0A 4ODTH 5T1MA 3TWCH 2OMYB 1U4EA 2ZSWA 3TF4A 4HD9A 1Z9SB 4YE4L 3GB7A 5AOLA 1I3VA 3JZYA 2ATPB 1KF9B 1DBAL 4Y5XC 1K8DA 4F33A 5IF0B 1J0IA 1F00I 4XB8A 1W8OA 5LO7A 3FBKA 3J8F7 4CAGA 1SUHA 2AEOA 2ZWSA 5GRJH 3HVDA 1JMZA 2UUDK 4J3SA 5HGHA 2EIDA 4H5SB 3FTWA 3PFUA 4MDJB 2VLLB 2MPAL 3EO1B 3SGDI 3TXAA 3FJTA 4PTUA 3CFIC 2IDQA 2VDQH 4G8EB 5I5JA 4RAUB 3PREA 3WHE1 2CMRL 1UM4L 1AYRA 1ASPA 3C8KA 2YN5A 1ZVSB 3DMMB 5E6SB 5DVLA 4B5EA 5EB9A 3MRJB 4NN5C 2BDNH 3X2QB 2EE2A 4JDVA 1FORL 1G6RA 5DJDA 3VWKD 2F1BA 4OLVL 1BVOA 3PWUB 4OFQA 5CIPA 3I6GB 4ADIA 3FN0H 1MFCL 1BVNT 4DVBA 2DL2A 5KBMA 2UV3A 3V0HA 4PYHA 4YSAA 2ZOUA 3SE3A 3WFHA 1YNTB 43CAB 3HN8A 2YMXL 2WUBH 1SQ2N 2Y36H 2OXGA 4BWTA 3PGCA 5ADOL 1ZGLM 2BOBB 3POCA 3Q9PA 4XC1H 3VD0A 4G8FA 4GG6B 1B4TA 2PO6D 4M6NL 1SXCA 4LSTL 5B39A 1ZS8A 3K46A 4XNYL 3VWKA 4J3XA 3OSKA 4F2EA 3IGAB 5EZIL 1AQKL 2W65B 3KNBB 4F8TA 5JQIB 2FUQA 5B38A 2AZAA 2WZ5A 4JMXA 3NFPB 3SKNA 4HW6A 2F74B 2D0GA 2ED8A 2JI2A 4RSYA 1BSIA 3RGVC 3CPLA 2BHYA 2KUTA 2I60H 2ZX6A 3VXSE 3RY5A 3Q2WA 5B39G 5KS9B 4D9RE 2OTUB 4R7NA 1T0OA 4JFOB 4JM2F 4P2RE 3F00A 3PIQB 3QCVH 4ES9A 2YJLA 2PO6A 1A3LL 2Y2YA 1OPGH 2CO7A 2XKUA 4U0QB 5FYJL 2C26A 1MG3C 4PREA 4P4KD 4PUBH 4RQQA 4ZW6A 3N1GC 5C3TA 1FNAA 1FO0B 3IBOA 5EBWA 1RPQA 3U2IA 4AQAA 2NLJB 4ODUA 3T8XA 3GD1C 3P73A 4NRYA 3QJFA 2GJ6B 2WOBA 2GITB 5IMLA 4YUEL 1PPIA 2NY0C 5JPMC 4DK3A 5CU5A 4XCCH 1HK6A 1FAIL 2CLRA 3LIZL 5CNHA 1XQ4A 3MRIB 4KQ4H 3U1SH 3WIAA 3A22A 3L6FA 3WFCH 3R0NA 4PMFA 4JR9L 1TJGH 1ZXKA 2EC8A 4NC1E 3CSFA 1A6AA 1MUJB 4RAVA 3UL4A 1REIA 3G6AB 5AYTA 4L4VE 3U30C 4I18B 2X9ZA 5F2FA 1CZ8L 1H19A 2NNXA 2DLHA 4P5MA 3C12A 4WFFD 4PRIB 5I8EA 1G7QB 1JZ3A 4RMQA 1R3KA 3CMOH 1ZT1A 2UY6A 1CT8A 1CQYA 3NG5A 4U1KB 5DD0H 1TQSA 1A3RH 1MI5B 4EUPB 3OJDB 5DS8A 2NYYC 1UD5A 4U4IA 3NIFB 5MERA 4OD3H 2OMZA 2VXSL 4N2LA 2DQUH 4WWPA 4PJXF 4WFHE 4MS8D 4EQ2A 1QUNA 1ZKAA 3HBPA 2Q20A 2YQGA 2BSTB 3V5KA 1KPUA 4KK5D 1CC3A 2YN3A 4G7YL 3FL7A 3VB9A 1BREA 4XHQA 3FOLA 4CMHB 1A7RH 1RK1A 4MD0B 3X11B 4AE1A 3VSQA 2NX5D 2P44B 2DQMA 2DQHH 3A4AA 3AAZB 3F7YA 3PHQB 5C0RL 3QQ3B 5D93C 6PCYA 4HS3B 3LHPL 3HNVH 1J8HE 2XDHA 1B0WA 4OZHB 4BFKA 5LBSH 2KMWA 4YBQC 1JZ6A 2L7JA 3L3HA 1OP3H 1V7ML 3BIKA 1QFPA 4GBXD 1ZVYA 1HJCA 4N0CD 4AV5A 4FZEH 4L5FE 4X7DC 5IG7B 3WJJA 4HIIA 1XGYH 3SDDD 5I1HH 3DVNA 1BQLL 3KLAB 4H25A 1X5FA 3QQDA 3RY4A 4U33A 1FYTE 2X6BA 1K6QL 4BZ2L 1FGNH 2FH8A 2NY4D 2NX5A 4U1IB 3SGDH 4KZEH 1R34A 1LK3L 3GEFA 4PN6A 4JRXD 1HSAA 5DSCB 3QEQB 3P0GB 4IBLT 3EOTH 3N44B 4PLJD 5BW7C 2WXLA 1GC1C 5JDSB 3IDNB 1NUDA 1XF5A 2WNXA 2N7AA 4ZS7H 4YN3A 2AJVL 3LQAH 5E1AB 1YMHA 2LLGA 2UWEB 3L9YA 3KLQA 4XVJL 2V2XB 1Q1JL 1QTYT 3K2KA 4PP2B 1XH2A 4KAQH 1RK0A 4GBXA 2X6UA 3VSVA 3PWLB 3SDDA 1VENA 1XAKA 2WYIA 2EXYD 3A24A 4P0DA 5AL0A 2X9YA 3VGGA 2VDLB 5GRVL 4W68A 4X0KB 4ABWA 2YD5A 5IIEA 5AW8B 2VZ3A 3DETC 3KPLA 5TD4A 5C07B 3AQXA 4JRXA 3ULVH 1YY8A 3BWSA 4LAQH 4PLNC 3UBGA 4KJWD 1FNHA 1UH3A 3JSSA 5DJZA 3VRLE 2DLFL 5FGSA 5FWRA 4LARL 2BINA 2Z8WC 4HIXL 2XETA 1UASA 3MV7E 3OKDA 4P59H 5ID1A 2OSXA 4AEHH 3IWUA 4K9EL 3IM1A 1AMYA 3QPKA 4EXKA 1NCNA 2AQTA 3C09C 4K7FB 1Z9MA 1B0RB 1UM6L 2A6IB 2ITFA 3DSFL 4CMMB 4AL8C 5BUAA 1ID2A 4QXTB 2DWDA 4DEPB 5J11C 2ZNWA 3IRCA 1GHFL 4PJDA 5LCVL 4TL4A 4Z3EA 5IHZA 3ILDA 5FC9A 1L6ZA 2ITCA 3DJSA 3K4ZA 1RHHA 2XC8A 1D7CA 4PRHD 4ONFL 4ZMPA 1F58L 4LHUG 2YWZA 1BXUA 3REWB 5FUZL 3RY6C 1NC4D 2PXYD 2ISDA 1AXSB 3Q1SH 3OLEA 4QT5A 2P5WB 5EF3A 4NKDB 2PF6A 5ALBL 1TLMA 1MFBL 4OVUA 2Y69B 2AI0H 4QRFA 2IDFA 3GPSA 2KQMA 3L9RB 3MLWH 1DQDL 4P2QD 4LK4A 3A6CH 1TZ8A 3C8DA 2QSQA 2QTEA 1AGDA 3AMKA 4OGAD 5CJXC 2VDOB 2DMGA 3O4OB 1DJYA 4MNHB 4QRBA 3KPMA 1VZGA 5CINL 2W9LA 3DK2A 4DKEH 4FQ1L 4PRHA 1A21A 1ORSB 2CGYA 2HJFA 4P5TD 5FXCH 1V55B 1Q72H 2Q2EB 5K1VA 1NC4A 2PXYA 1AFVL 5AW4B 3U36B 3VSTA 1O75A 3TH2T 7FABH 3CLFH 4DGIH 4Z7NB 3OB0H 3QIBD 2CD0A 3ZE0B 5EDSA 3D05A 2XZCL 4GRWB 1MFEH 1WRFA 4P2QA 2JKSA 4YXKH 5JIPA 1S9VB 4HQQL 1Q9WB 1VGEL 3WD5H 4TNEA 3WL9A 3FSVA 3HB3C 5HHOE 3F62A 2V2TB 3T0EA 4PJ9C 1IAKB 1EDYA 1QVOA 2FJHB 3UAAA 3RFZC 1CD8A 1RUKH 4P04A 4B53A 1SJEA 3WIIL 4AK2A 4XP1H 1R1CA 3VFVA 2VR8A 4PAZA 5D2NC 1U8CA 1NKGA 3BPCA 3QIBA 4Z0XA 1IAIL 1YYMH 3AG4B 5CD5C 3MV8E 1A2YB 1TTAA 4LPXA 4XCYB 2ZF8A 3NJVA 3R8QA 2IF7A 2PW1B 3WXVL 3JWNG 4LQFH 1F1DA 3H2PA 3FU8A 1MF2L 4Z9KB 5KVEE 3KPRB 1Q9KA 1DL7L 4XMXA 3OSVA 4N1EA 4QRPB 2J20A 3C5ZC 1OT1A 1HQ4B 1EUUA 4DQOH 3BWUF 3QPXL 3V9EA 3WFZA 5J12B 3Q6FA 5ECJE 1ZLDA 3U7YL 1BLNA 2ZWYA 4NHUB 4X5WA 5J1AA 4U31A 3QXVA 2UVFA 3P4NB 3OAUL 3ZHFA 3LNGA 3L4UA 3SYCA 1QEWB 1YEEH 2N1TE 4MWFA 4KHXL 3SY0A 4U1GC 4EDWH 4G7SB 3QNXB 5E51A 4Q9QH 4X6DF 2H6PB 1IZJA 2VERN 4GUPB 4RDBA 1T5WB 4M4PA 4UM8B 5HYSB 4B9CA 5L2KD 4OCXL 2WSPA 1XGPA 5I1EL 1DE4A 2IBBA 4I77H 1AD0A 1NEZB 3L1OH 5FFGA 4R2GB 5CCJA 2KZKA 3L45A 3CHRA 2ZX5A 4RISH 5JIKA 4ONHA 1M71B 4PWGA 4WCYH 3SDYH 1E4WH 2VLRD 4P2CG 4EZKA 3T08A 1XSKA 3V4PB 2NY3C 4YPJA 3RUGE 4PTTA 5LHDA 1CYGA 1EJOL 3OAWA 5E1HB 3RX7A 3IJSA 3EGDB 4JG1H 1MQKH 4LAJH 4LDLB 5GS1A 3GRWL 3QK0A 1RJLA 1UWGH 1FI8C 1QFWL 5KOMC 1CL7I 4KMQA 5L2KA 3OXSB 3IAGC 1U36A 4HFWB 1KJ3L 4JZOA 4JY5H 5KVGH 1OP5K 4OTXH 4ZAKD 4R4ND 1IGJB 5C6WH 5KZCD 1HHGB 3FH5A 4Y5VB 3B9KD 4WW2B 1A64A 5EFIA 1KELL 3B1TA 4BK5A 1K5NA 1E5CA 3WKNA 2WAHA 2OYMA 3F04A 2CDEA 2VLRA 3HHSA 4H20H 4YSTA 5D1QA 3RIAF 1SBSH 2YSSB 1KGIA 1OQXA 2VKXA 5FK9A 3TNMB 3MCLL 1A6UL 5GGRB 1OSPL 2WIIA 2LU5A 2N0MA 2NSQA 3K74B 4A2HA 3MACL 4FG2A 4GW1B 3LN9A 4LHJB 4NUGL 5C0BE 4W6XB 2ZJSH 4Z7VA 1QSZA 4NUMA 2KT6A 3NK4A 4F57H 1LO2H 3IRPX 1OCOB 2X4PA 4NZTL 4ZAKA 2WVTA 3B9KA 3CG8A 4R3SA 5D7JB 2DQIL 4MA3B 3CHSA 4NZDA 1R6VA 3G6JA 3P4LA 5KVFE 4OF7A 3ARWA 1JWUB 2Y06H 4IS6A 5C8JA 3ZT6A 1OP4A 2J56A 4MMYB 3V6ZB 3G7TA 2GJZA 1WICA 3BN9D 3RL1A 5EC2B 1XHHA 4M03A 4XPAH 3FSWA 1FNSL 1JNNH 2ESVD 2R0WH 4KJYB 2XPYA 2HX7A 4GRMB 1MLBA 3HG1B 2R29L 1RUQL 3VWJA 1HWGB 2VN6A 3MLTA 1G9EA 3DVGB 1L4IA 3WDHA 3P3RA 1PMYA 2IV9A 4Z7WF 4ZMVA 4X6EA 3WJMA 4X6CF 2HWZL 3D4YA 4MB5A 3GI8H 2Z92B 1X5AA 3F2LA 4EVNB 5M94B 5ICZB 4AYSA 1J1PH 1A1MA 4IBWA 2B4CL 5EEUA 1JD9A 2XICA 4TKWA 1A65A 1NDGA 1DLHB 2WQXA 1IVLA 1E4XL 3QDMD 1LWJA 3VI4F 4FFVC 1LO5B 2WVVB 3CFJA 3TO4A 1KOAA 3HUJE 1TQCB 4YSUA 5GS0D 1ORQA 3CZKA 3V4VA 5A40E 4KQ3L 4BKTC 1MH5A 4B7IA 2G2NA 3VXOB 1KIRA 5BCAA 1IKFL 4ODTL 4YPGA 4WNQA 3FO0H 3TWCL 3ZE1B 5K59F 1OGPA 3MSPA 3IDJA 1BVLB 3OKKA 2FQDA 2Z4QB 3B43A 2BSSA 4JG0H 3QDMA 4APXA 1CBVH 3S0PA 1A5FH 3N55A 3I6SA 3SE9H 1QPKA 2IFGA 1BZDA 1AZNA 2WLHA 1TQBC 2VW7A 2WWMD 2R2HA 3ZKQD 5GRJL 1F3RB 2DS4A 1NCIA 2ZOOA 1EZLA 4X7SH 2VW6A 1KJVA 2EDNA 2VDQL 2APSA 1GGCH 4YFLF 2EDBA 1MKFA 3DUSB 2YD6A 3X13A 4JFDE 4L9LB 2BDNL 4PJEB 2IAMB 4ENED 3FHEA 4BFFA 4QHNB 3OR7A 1P6WA 4L1LA 1T4WA 5IUCA 1AHWA 3ETBF 4R90H 5DJ6A 4DGYL 5FDWA 1JPFB 1RUMH 1PG7W 4A66A 5E7BA 2MTAA 3HKFA 4GI8A 5MEND 4ZUWA 4UOJA 2EDXA 3S88H 3ZKNC 4ODWA 1I7TA 2M83A 3CFDB 2WUBL 2OV0A 2Y36L 3HG4A 4JN2A 3FC8A 5F7EH 5CAYB 1ZS2A 5D5ME 1KN4H 1A0QH 5JUEH 4IGBA 1IEHA 3HBZA 4XC1L 4AYGA 3FQXB 2ZWZA 3NP3A 3RWEB 4IRSB 3TEYA 4HIHA 1NTDA 3H6JA 4U2ZA 4OT1L 2CWRA 2NW3A 3WG7B 2A9MH 1BYPA 2I85A 1WPCA 3KS0J 3ARDB 3RVWD 2O6CA 1FO0H 1QRNB 4M48H 5SWSD 1I7RB 4OZFA 2VKWA 5MENA 3S8FB 5CJBA 1DYZA 2I60L 3BP5B 1HESA 3DV4B 4M93B 5MHSD 3QZWB 5ITFA 1D9KD 3DHJA 4RCAA 1UXSA 4XO5A 4C47A 3QCVL 4ZDHB 5C7ZA 2CDGB 1OPGL 1E9OA 5BV7B 5T1LB 4PUBL 4UQBA 1UOWA 5DJ2A 1TZGH 2R2BA 5ERWB 3WOVA 3B2DC 2VC2H 4ELME 1L6PA 4YXHH 2WBJC 1T5KA 1EWHA 4XCCL 5SWSA 3BWAB 1GYAA 1W15A 3I2CH 2W88A 3N1MC 4TQEH 4KQ4L 3U1SL 4NJAH 4PPTA 2RTTA 3WFCL 1E5BA 5HGBB 4EUPH 2NW2A 5LAXB 1XD0A 4LPTA 1KLGA 4NO3B 3FF8A 1D9KA 5F9WB 5E8DH 4FQCH 5E1IA 4OLXH 5EU4B 3VD9A 2C9UA 1Y1DA 4HU8A 3VD7A 2VE6A 4HXAH 4MCYB 4O58H 1NCJA 3PFQA 3FHQA 5E8NB 1JZDC 3WDJA 4HEMA 2H32H 3CMOL 4G59C 4LGPB 4F2MB 4Z3HA 2OW7A 3GSVB 5MEQB 4KROD 2PETA 2Z7WA 4TNWF 5DD0L 5BUGA 1A3RL 1RULH 1OVZA 4L3CA 3MRMA 3QUXC 4F8OA 2VJ8A 3ZRFC 1F5WA 3FZUD 1EEZB 4QKXB 3MN8A 4OD3L 2UXTA 2DQUL 1YYLH 2XX0A 3NJXA 5KYYB 2JLLA 4ZSOB 1B3JA 3BKMH 3PABA 4ZUSA 2LTQC 2Y1AA 3SE6A 4ZW7A 3PGDB 4LLWA 2HT4C 3EHBB 3RVUD 5E1GA 3PRZA 4X99A 1Z6JT 2Y7QB 1ZE3C 1IGTB 3EJUA 3RAJH 1YUHA 1A7RL 3IJYB 1XR9A 2YARA 2NY7L 3H9SD 3KYKH 3LSOA 5KUMA 2ZX7A 4L3ED 1FFPA 1FBIH 2OQJA 2DQHL 3B9DA 2HVBA 3HNVL 4KZCA 3TO4C 1OM3H 4ZOBA 5LBSL 1NMAH 5A2CA 2ZXBA 1MIEH 3FO9A 3T4AB 3ARPA 4OGYH 3S9DB 3OAYK 1IM9A 1K3ZA 2VSCA 4FZEL 2R9HC 1TVBA 4KMLB 4XN4A 1XGYL 2I9LB 5I1HL 4LNRB 3F8UB 5C9JA 1GJWA 4U1MA 2WXQA 2YQBA 4RH4A 3H9SA 2EZ0C 4LB8A 3CX5K 1TZIA 4TTGA 2IQAB 4XH2A 4L3EA 4KZEL 1AZUA 3WCYA 2EDFA 2E7DA 2VRAA 1UHVA 3N41B 1UWEH 3EOTL 4XB3A 5F7DA 3KYOB 2VZUA 3ME0A 5AOMA 2HG5A 4N2GA 1T6VN 5E4OA 3BPOB 4ZS7L 1PIFA 5HI3C 2H5UA 3ULUC 3LQAL 3MRRA 2EDRA 2VM4A 4WHTB 4AH2B 5KSAD 3K72A 1NWOA 4KAQL 3ZL4H 3OPZH 1HKLH 2WO2B 1OSEA 2OJ1A 5C2BH 4GQZA 4EI6B 4FG6C 4I13B 2GAZB 2NXZC 4IW4C 3R4DA 5DQDH 3RFRA 4LSUH 2Y7SA 4AEFA 1HHHB 4GRLD 3WFBH 1WFOA 4XMPH 3KE0A 1FH5H 1YY9C 5KSBE 3ULVL 1TPXC 4LAQL 5ACZB 1UB5B 4QLWA 3CH8A 5KVMC 4AKPA 1ACXA 5D1XD 2QDWA 3OGCB 4FLRA 1KJMA 3UZQB 4ZMWA 3ALWA 4P05A 4P59L 1SXSA 4AEHL 3Q6GH 5EOCJ 5KSAA 3NRQA 3LPWA 2D9CA 2X4SB 4A1RA 3VRLF 1UB6B 2FEDC 1PG7H 2YJQA 1F6LL 4WGWB 3GYRA 2LHAA 4Z76A 4JZNA 4LSSH 5BRQA 4ZFOL 5FLVA 1FRGH 3ZZ1A 2ZX9A 4DPRA 5TQ2H 4GRLA 5CKAA 4WUUB 5H35A 4M4RB 4BZ2A 4PB9H 5LGYA 4W4OC 4NEHB 3OMAB 1ROCA 3TASA 1E9PB 5E0QA 3N1QC 2YRPA 3DGGB 3HI5H 5JPNA 3B3IA 4LSRH 4U6HA 4HCRH 1E5YA 5D1XA 3RDTD 4PM1A 3UTQB 3O9WB 1S8DB 2ZP9A 3VFRB 3WLBB 3ARFB 1BF2A 5FM5M 2ENJA 5JQ6H 2XQ0A 1EEYB 3GEWB 5FO8B 3QXTA 1KYDA 2OP4H 4I4WB 2AI0L 3FQRA 5F1IB 3MJ7B 4M8QA 2GUYA 3MLWL 4P9HH 5L4JA 1BP3B 3A6CL 2UZYA 3SDXE 2DOCA 4HH8A 2PWEA 4I3SH 5E5LA 1BA9A 5GHWH 3MZGB 2EDDA 4CW1B 4EDXB 5HYJB 1PFOA 1IE5A 3MRFA 4DKEL 4LO9A 3FB7A 1QPPA 1H3PH 1SHXA 1O5PA 2Y9RT 3DROA 3RDTA 4B9KC 5BZDA 3B2VH 4OCYH 1AZZC 1XB3A 1Q72L