1AZNA

Crystal structure of the azurin mutant phe114ala from pseudomonas aeruginosa at 2.6 angstroms resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTAPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the azurin mutant Phe114Ala from Pseudomonas aeruginosa at 2.6 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport(copper binding)
molecule keywords AZURIN
total genus 24
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1994-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aznA00
8PAZA 3CVDA 1WS8A 4YSUA 2GHZA 1ET5A 1I53A 3PAZA 5I5JA 1OE1A 2FTAA 4NERA 3S3DB 2DWSA 5FC9A 2QT6A 5D4JA 4BXSV 3OD3A 4UANA 1OE2A 3CVCA 4F2EA 2IH8A 1BYPA 2VMJA 2TSAA 2OCCB 3SBQA 4MFHA 2IDQA 4HHGA 4BDVB 1EZLA 1PLCA 2IWFA 4HIPA 4E9SA 4RH4A 1ID2A 1ET7A 3PAUA 4AI7A 1AS8A 3QJTB 3WKQA 3BQVA 1L9RA 2QPEB 2GB2A 3S3BB 1J9SA 4YSCA 2AANA 2XVBA 1OV8A 1MG3C 2ZONA 1JXGA 3ASNB 4DP5X 3FQ1A 3QJRB 1JXDA 1GW0A 1BQKA 4KO6A 1KGYE 4G70B 1A4BA 4YSEA 4YSAA 3NP4A 1NPJA 4E9VA 2XV0A 2UXFA 4CSPA 2FT6A 3V9CA 3EF4A 3HEIB 1IC0A 3NJIA 3FU7A 4ZK8A 2BP0A 3S8FB 3L45A 2UXTA 4DP9X 5F7AA 1AG6A 1M56B 2ZWNA 2EINB 4DP2X 4P5RA 3AZUA 4CSZA 1SF3A 1XB6A 4N4YB 3PXLA 3EH3B 3QJUB 1V10A 1JVLA 4YSTA 1AIZA 1A65A 2HXAA 2A3TA 2PPFA 1IKOP 2I7SA 1PZBA 3TBBA 1L9TA 2YAOA 3QQXA 5D4HA 1JZGA 4EF3A 3NJKA 3IE9A 3NJJA 4G7QB 1SDDA 1AACA 2YXWA 4M4RB 4JHUA 2NRDA 3FSZA 3FPXA 2HX7A 2CUAA 3T9WA 4AKOA 2I85A 4A66A 5A7EA 1KBWA 2CAKA 2GBAA 3AG3B 3GDCA 4AKPA 3ASOB 3PAVA 4AZUA 2IDFA 3IBOA 3GYRA 5B1KA 3QJSB 1GY2A 4G71B 1F56A 2TSBA 1NWOA 4G72B 1HAUA 2BWIA 2MRYA 2BW4A 5I5IA 1AS6A 4YSPA 1PNDA 3OQRA 5PCYA 1BQRA 2PCFA 1AZUA 1JZHA 2VW6A 5I6NA 3NYKA 1MG2C 1BYOA 1CURA 3NSDA 3FU9A 4AX3A 4GY4A 3TU6A 1R1CA 1CYWA 2H47C 5I6KA 1QNIA 2JXMA 1GY1A 3NJMA 3X1NA 1ZDQA 4PAZA 4F2FA 1MDAA 2QDWA 3FSWA 2PPCA 4KO5A 3NSCA 1A4AA 2OJ1A 2VW7A 2YAHA 2FQDA 1ZPUA 5B7EA 1V54B 1TU2A 2JKWA 1BXAA 1ZV2A 3AG1B 3WIAA 5EHFA 4DP1X 2YQBA 1CC3A 3ABGA 1KCBA 3H4HA 2Q9OA 1BQ5A 2P80A 1KDJA 1PLBA 2W88A 1OCCB 2E86A 1QLEB 1X9UA 2EIJB 1JZFA 5D4IA 1NIDA 2AFNA 1YLBB 3SBPA 3SQRA 4GP5B 2LLNA 4KO9A 2EIMB 2IDUA 3CG8A 1N68A 3FQYA 1ET8A 1BXUA 2FQFA 3FYIB 2XXGA 3DKHA 3U25A 2P80D 2WO3B 3UAEA 2YXVA 2XV2A 2EIKB 1OF0A 3UAAA 4KNTA 2CALA 1OOWA 4DPCX 4A2GA 5I6LA 3DIVA 1E30A 2IDSA 2VW4A 1GS7A 1W6LA 2UXGA 2J5WA 1OCOB 5B1JA 1NIAA 2PPAA 4DP7X 2HX8A 2PLTA 4G7SB 1NIBA 4UAHA 3WG7B 1PZCA 3CDZA 2UX7A 1M9WA 2HX9A 2J56A 1IUZA 3NJNA 2IDTA 1SFDA 4BDVA 4E9WA 4KNSA 4DP8X 2VM4A 3NT0A 4YSQA 1TEFA 3FYEB 3S8GB 1PMYA 2YAMA 5B1BB 4QLWA 5B1JC 2WO2B 2PP9A 2GC7C 2VM3A 2W8CA 4YSSA 1L9PA 2BHFA 3UADA 1BEXA 1L9OA 3FPYA 4HCGA 4DP6X 1T5KA 2ZOOA 1HFUA 4NAJA 3X1FA 1BAWA 2XUWA 1WA0X 2XXFA 2AVFA 5IY5B 2BP8A 4KOCA 4KO7A 3ZBMA 3QJVB 3CVBA 3WKPA 1WS7A 1ILSA 2IH9A 4HAKA 1GS6X 3ERXA 1B3IA 1NINA 2GIMA 4Q89A 3FT0A 3IN2A 4JKNA 1AANA 2IWEA 4A2FA 4GXFA 3H56A 4DPBX 1CYXA 3T6VA 1TKWA 4E9RA 1L9SA 1J9TA 1AQ8A 3JT2A 1JVOA 1JZEA 1AZBA 1PY0A 1KDIA 2R7EA 2DV6A 3NJLA 4YSRA 3G5WA 1ZDSA 1NICA 4QKTA 2DY2A 1PNCA 1QHQA 3FQ2A 3FU7B 1SJMA 2XYBA 4YVUA 3S3CB 1BXVA 3OMIB 2QPDB 4YVNA 1E5YA 5TK4A 5I6OA 4HHWA 1IBYA 1VLXA 5AFAA 3ZX1A 1FFTB 2N0MA 3FS9A 1SF5A 4A2DA 3TASA 2Y69B 3AY2A 4UF7C 2YAQA 3QJQB 2FNWA 2J57A 4YSDA 2XU9A 2R7EB 2FWLB 2PCYA 2PPDA 3NJHA 3ABMB 1E65A 3D12B 5I6PA 4GYBA 7PCYA 1E5ZA 1KBVA 4BWWA 1CUOA 2VN3A 3JTBA 2H5UA 1UATA 4YSOA 4HCFA 4N8UA 3UABA 1XB3A 7PAZA 3CDZB 1N70A 2I7OA 5I26A 3WI9A 3OMAB 3RYMA 1JZJA 3OM3B 3T71A 4M3HA 2IAAC 1AAJA 1J9QA 1ILUA 1JZIA 1SHWA 3X1BA 3X1EA 3EH4B 5PAZA 3FSVA 1PAZA 3N2JA 1MZZA 3TBCA 4DP0X 2UXVA 4G7RB 3H4FA 5ANHA 1A4CA 3NSFA 2FT8A 4GP4B 2DYSB 2FQGA 3PCYA 1MZYA 1KCWA 1ADWA 3X1GA 1GS8A 2J55A 3GXUB 3T6WA 1NDTA 1SHXA 2B3IA 2Y1AA 1TEGA 2BW5A 9PCYA 3MBWB 1AOZA 2VSMB 1ASOA 4HZ1A 3UGEA 4KOBA 2GSMB 1W6WA 4GP8B 2CBPA 3KW8A 4F7KA 2BP8B 3ZDWA 1L9QA 1OCZB 2X87A 1E67A 3SBRA 3NSYA 2YAFA 5B7MA 3C75A 3TA4D 2EILB 4X4KA 1PCSA 1AZNA 1AS7A 3FSAA 2BZCA 1AZCA 2X88A 3ABLB 3WNJA 3X2QB 4A2EA 2AZUA 2FT7A 3HB3B 1M57B 3AW5A 1DZ0A 1SDDB 4W9ZA 1A3ZA 4K9JA 1ZIAA 4FAAB 5B1AB 4ENZA 1PF3A 4YL4A 2AZAA 1JERA 1XB8A 1GR7A 1AG0A 3PLYA 1NIEA 2XX1A 4A68A 1NTDA 1SNRA 1FA4A 2MTAA 1W8EA 5AZUA 2XV3A 4Q8BA 1WAEA 1V55B 5B7FA 1URIA 3N55A 2OV0A 3CZUB 2PP7A 1KYAA 5I6MA 1NWPA 4TXVB 4DP4X 1JOIA 2YAPA 5LDUA 4NB7A 1ZIBA 4BWUA 5I28A 3IN0A 1NZRA 1KV7A 2BZ7A 3MX0B 4E9TA 2JFCA 4WKXA 5AKRA 2PP8A 6PAZA 3ABKB 4KNUA 4L0PB 4P5SA 1J9RA 2GI0A 2BWDA 2B08A 2HRHA 2FQEA 1RZQA 2Q5BA 1OE3A 2GC4C 3EHBB 4JHVA 3ZIYA 2UX6A 1A8ZA 1WA1X 2QDVA 3WNIA 1OCRB 1X9RA 1PZAA 4E9QA 2DYRB 4BWTA 5I5MA 1XMEB 3KW7A 4A2HA 4A67A 3DTUB 4W1TA 1NPNA 3T6XA 1AZRA 2FJSA 4HALA 1ASQA 1RCYA 3UACA 5E9NA 1JXFA 2XWZA 3NJFA 3NJGA 2BO0A 1GYCA 4HCIA 5F7BA 4BK5C 1IBZA 3BVDB 5TK2A 1J5DA 3QPKA 1ASPA 1ETJA 1GSKA 2ZXWB 4WTQA 1FWXA 1EHKB 2PPEA 1WA2X 2YARA 2BP0B 3AG4B 5B3SB 3IEAA 2CJ3A 4FA7B 1NIFA 4AKQA 2XX0A 3PPSA 1J5CA 1DYZA 2YAEA 1SFHA 2HRGA 3FU8A 6PCYA 1RKRA 3EH5B 3AG2B 2HLEB 3T6ZA 4BXVA 1AR1B 2HZHA 2RACA 1PLAA 2CCWA 2WSDA 3OMNB 2VSKB 2IWKA 2XLLA 4E9XA 4DPAX 4E9YA 2H3XC 3V9EA 1RZPA 1HAWA 2DWTA 3NP3A 4PCYA
chains in the Genus database with same CATH superfamily
3T8MA 2DH3A 3ZSTA 5IJVB 1P4IH 3QUYA 3D85D 5C9JB 5E9AA 2OMZB 4Y19B 1NBYA 4NERA 1S9VB 2DWSA 2XZAL 2OMXB 3O0RL 5HI4D 3RP1A 4E36A 1W80A 3EDEA 4AGNA 4XE5B 3LKQA 3GK8H 3H42L 2TSAA 5F6IB 3QRBA 2OPCA 5GIRB 2IDQA 3GZQA 1J86A 1U3HA 4FQXD 3B2UC 3PV7A 5EPMB 3CH1A 3OAYH 5C09E 2AEQH 3O6LL 1KCRH 4BFGA 3LZQA 5F0MB 5TE4L 2GABA 4QRTA 3LKOA 2QKIA 3AVEA 1CIUA 3K6IA 1OB0A 1WBYB 3H9HB 4FXLA 1KZYA 1UKQA 2QV4A 2WPGA 4XBGB 4CILA 2V2XA 2AXGA 2OS7A 3M8OL 3E6HA 2XTSA 2IPTH 1NMBL 3H42H 1UWGH 3UZVB 4AW7A 3W39B 2W95A 1QFUL 4LPCA 4WVRA 5KN5B 3MLZL 5KSAB 5LWYH 5AKSA 2Z31C 4PJXA 3BVNB 3VI3E 2CO1A 3V5HA 2BY1A 3ZYZA 5D9SA 4GSDH 2QADC 5EUOF 2DLFL 4KX9A 5IJKA 1XB6A 2YGPA 4J3TA 3LIZL 3F5WB 3PJSB 3EYFB 5CR1A 1KT2B 3BN9D 4NEHB 4B0MM 3KXFD 4JFXB 4N20A 3Q1SH 2PPFA 3QEQD 3EO9L 3FT1A 3QI9D 1Q9LA 4W4NA 2FD6L 4EUPA 3OR7A 3V4VL 1T89C 3FCTA 5ALCL 4EVNB 3BFOA 2NUPB 2LW3A 1LMKA 3F05A 4AKOA 1KBKA 1ZT1B 1XT5A 3ARTA 3SDXF 3WNNA 3FO0L 3FDWA 2J6WA 3NCEB 3QZWG 2ZNXA 5EEVA 1OPGL 3FUFA 5BS0D 4YEFA 3FZUD 1OF2A 2BCMA 1G9NH 2Y9RT 3DA0A 4V11A 3FTSA 3NIDF 1XMWA 3MBXL 1OEZW 4U1IA 2ZUYA 2NUTA 1HESA 1HN1A 3KLAA 4LVOC 5I1JH 4G7YH 3DOSA 3LSOB 5KYYB 3CX2A 4M8RA 1JNHB 3NFSL 1I7ZB 1A3QA 4P4KB 3QNZA 1IAKB 2GT9B 4GT0A 3PQYD 1XTMA 2Y5TA 4ORZC 3SCMC 4Y4FC 3I50H 1H3PL 3IAPA 3PDGA 3U36B 5L0QB 4JRYB 3MV11 5H94B 3GJFK 3L4CA 3CWGA 1QTYT 2P8MB 1L0XA 1SLVA 1MSPA 2QDWA 3FSWA 4XRCA 1TKWB 3NIGF 1T0NA 5AD0A 4JL2A 5E2VL 1JL8A 2FQDA 4E9LA 5HYJA 1R3KA 1B0RB 1YUHB 5KVGL 3AG1B 1F1DA 4W68A 3D39B 5AKTA 1TZIB 4Q9RH 3G9VA 5F1NA 3H4HA 4NFBA 4JFPB 2JKJA 2NZ9C 5CF3A 5T1LB 3D48R 5DJAA 4PRAB 5DRXA 4YL9A 1CGWA 2J7LA 4Y5VA 5GRVK 1T7ZA 2N59A 5G5DA 5F6IC 3BEWB 3G5YB 1VESA 3ARRA 5T3XH 3ZYOA 2JJUA 2R4RH 1M1XB 3F7PC 4B6ZA 4XNUL 1CFSB 4LRNH 4F92B 1JYWA 5GSRA 3WD5H 2YPVL 4M29A 1SLWA 1KNOA 4C4KT 4ETYA 1KJ3L 1XSIA 5C6TL 3N85L 1EXUA 2WKLA 3QP3A 2A6JA 2GCYA 3EJQA 3RUGE 1FLTX 3BZ5A 2XKNB 4Z7QE 3DXAD 3TFKD 4XBMA 1EX0A 4PY8J 2PW1B 2XV2A 3D8MA 3WMSA 2C3VA 1VFMA 3QIUC 3S5LB 1QYGL 1EXHA 1BJ8A 2VW4A 4MB4A 4LSDA 1ADQA 5E6IC 4L4JA 1PKOA 2FYYA 4WU7B 1DBKL 4XWGH 4G9DB 3HG5A 4J2QA 4JMXA 3GDBA 3AACA 4P3DB 5FOBB 4ZDHA 5IMLA 4UZSA 5I0DA 2EIZB 5FWRA 2NXZD 2R2EA 5GGVY 1N19A 4PN6A 3AQZA 3HJEA 3UJIH 5D7SH 4NZTH 4G43B 2X38A 5HTSA 2IO5A 4FEMA 4AQAB 5J6GB 4HXAH 4HT1L 5DCCA 1FFOB 3JWDC 4OZFA 4OVVA 4XZUA 25C8H 1RZJL 2WKOF 3DVGB 4ZYKA 2WAQA 1LE5A 1OGAA 1VENA 3FUNA 4FP8H 5D1QE 2C9XA 2DQDH 2NY0C 1HE7A 5KVDH 4RGND 5D2LB 4X5PA 2LU4A 2MFNA 1I75A 2B1AL 5GGQH 3P30H 1I4FB 1UXMA 4GAGL 4GQRA 2I69A 1BAWA 3SY6A 4LE8A 1DVZA 3KH3A 1TEYA 5AB1A 3E6FA 2J2ZB 2V3DA 4FHJA 1S7VB 3MROA 2CKNA 1LILA 1E4WH 3D4ZA 1I8KB 3QJZA 4DK3A 2VZTA 1OT1A 1V7NH 2J8OA 1HKFA 2P5PA 3V4PA 4U0RC 1KT2A 1UASA 1AANA 4A2FA 2AITA 4LSRL 3S35L 1J9TA 3AJ7A 1QLEL 2EEBA 2BWQA 4F7PA 2AMUA 3AT9A 5D1ZB 2YZ8A 4WFFE 1U8NB 3I6KB 2A77H 5EBWA 3ASWA 2GTQA 1XF2A 2WXHA 3Q8BA 4ENED 3UIYA 3FN3A 1UB5A 4WWKB 4FEIA 4NJ9H 3WY2A 4YWGH 1KXVA 5AZ2L 1ND0A 2G5BA 3HRZA 1SHMA 1I7UA 4M1DH 4PBXA 1T7VA 3ZX1A 2QQLH 1B2WL 4KGLA 4P59L 4FFYA 4NZTL 2KQNA 3QIWD 1FC2D 1QBLH 1QFPA 3QG7H 2FNWA 2J57A 2YPKA 3ULUD 1M53A 1NKGA 3A0OA 1KGCD 3IMWA 1GPOH 5T5FL 4KVPA 1XF1A 4YXLL 2IAND 1AHWB 1LK3L 3TN0A 2AJ3A 3OKDA 5SWZB 3QFJB 2Y0SA 5KVDL 3VMPA 3KXFA 4AL8C 5SX4I 1XR8A 3ARFB 4AMWA 2F8XC 2IQAB 4BSWA 4OLEA 2NXYB 4GT7A 5DD5L 4FFTA 2CJUH 4KJWC 3F7KA 3HN3A 3CE1A 1A2YA 1MEXL 2ICEC 2WLMA 3R0NA 1AAJA 2OR9L 2R0LL 5DZNA 5T3ZL 4D9QE 2DPKA 5A6LA 2PYEB 1VHPA 4HMEA 4P2QA 3EBAA 5GGSY 5DA0B 1CICC 3NEOA 5JHBA 5MEND 4LHUA 1SQMA 5J6HA 1WZ1L 4P2OC 1N2RB 1SOKA 4QRUB 4GBXC 3OJ2C 1ZA3B 2WVSA 2AJUH 4CBZA 4DTGH 4Z7UA 4N8VA 1IGYB 1GZQA 3IFLL 1Z7JA 3DETC 5DJZB 3EYOA 4KDTC 1K6QL 1S7WB 1UZGA 4FFYH 4K94H 1GRWA 1K8IB 4YMPA 1I85A 2FQGA 4S1DC 1NGXB 3B2UD 5KVFE 5JA8B 3CFEA 1SYSB 1UJ3B 4PJHE 2YSSB 3GHPA 4E68A 3UTOA 2OR9H 1WK0A 1NGXA 5IFJA 3CFCH 2J1KA 3UGEA 4CU7A 3NBNA 1Q0XL 4MJ4A 1RZJC 1A6TB 3L7EB 3L4UA 4LOFA 5DJDA 5IUCA 1NDGB 5D1XD 3ILDA 4M6OL 3VX1A 2X87A 4H1LA 3MV8D 4XPBH 4WSJA 4NZRL 1P4LB 5L4FA 3TPKA 4AEFA 4G80B 3UYOD 2EILB 3MA9L 1UOKA 5DQDL 3U83A 1KOAA 1P5UA 2QQQA 4XNAA 4R84A 1TUPA 5KG9A 2NYYC 1P4IL 1X5YA 2FX7H 2VT0A 3VWKD 2X9XA 3GJFB 1UWXK 4OD2A 4XH2A 4PJFF 4QUOA 1YECL 1CFMA 5TE7H 1UM5L 3S96A 4MD4B 1YEJL 5GSVB 1IAIL 1MFUA 3GHEH 2R1WB 5DEJA 5KZCD 1RJYB 4KKQA 4N0YH 4HEPA 2X4SB 5IZ7A 4HUMB 3D50A 3HRZC 4PTTA 4YL4A 1E2VA 2BVPB 5JO5B 1NSNH 3IWVA 3MACH 4WU5A 1XIWD 1XL4A 5JIQA 3CFIC 2AVGA 3MRBA 4JFFA 4JG9A 5CLZA 3OKEB 4PJEF 4ENEC 3DYOA 1MJ8L 2ZUQB 4RX4A 2CG9X 4FP8L 1F1AA 3CX5J 5B7FA 1EIBA 2F19L 2PP7A 4UNIA 5BVJA 2WIIA 2Z7UA 1JOIA 4LDLB 4XO9A 2IOMA 4N2OA 1THAA 3PDOA 1RZJH 5GS0D 2WZPA 4KI5E 5D71H 3C2SA 3MX0B 5AAMA 1L5GB 2D7TH 3MUJA 1ZT4A 4YK4C 4O2CA 4ZX4A 2GI0A 2VGLM 3CNKA 1A64A 4I77H 1UZ6E 3EHBB 4JZOA 5H4YA 4OSUL 3WNIA 1U91B 1I9EA 5IP4A 1CN4A 4QHLA 4KXZH 4LRIC 4P49A 5DJYA 1FAIH 3V4PB 4UNVA 3ELAT 1KPVB 5I6XB 2RH0A 1RZKC 2YD5A 4RQQA 3TO4D 5EN2A 3PYCA 4GKNA 4OGQC 3T4AC 4BK5C 4TTDD 3AS1A 5KWYC 5TK2A 2DYPB 4GBXB 2XQYG 4YFEA 1LD9A 1A6VL 1VZHA 5JZ7D 4HWUA 2WCSA 3EDKA 3PP3K 4IU3A 3EDFA 3OXRA 1FDLL 4PYGA 5C0AA 3DURB 3G08B 4B5ZA 2VUYA 1EGJL 3HNTL 2DQGL 1GAFH 3GS4A 1Q72L 4XC3L 3L1OL 3VM7A 1QPPA 3VFSB 4ZUVA 4I5BA 3GZPA 3DUSB 1AGFA 4YBQD 5FGCE 2H32A 4G9FA 4FYQA 2EDMA 1S8DB 4U2ZA 3QDGE 2XN1A 3GSWA 5DD1H 5I0YA 1MJUH 1HIMH 4YDKL 3ELQA 3ARFD 2NZ9D 4UINL 5EU4A 3SGDI 3DO4A 1CD1A 2CM6A 1BG9A 2AXJA 4LKXA 3WNMA 2VMEA 3LMJH 4ZI8A 1TJIH 1JP5A 1NCWH 1URLA 1ETZA 4EDWH 3FO9A 2WLHA 2AJZA 4X9GA 3ZKNC 8PAZA 1KN4H 4X8CA 4HAGA 2P5WE 5ILTH 5LGHL 4WU5B 5IVXA 1P7QA 4MA8L 3D06A 5EOTB 3RDTC 4LEBA 4JMNA 3GBNH 5FC9A 1F4XH 4C57C 2A9AA 4IS6A 5EH1A 1CTNA 5LN4A 2QGCA 3FF7A 5AOMA 4WWKD 1N5YL 2ZOTA 2VB5A 5I71B 1SDAB 1IAKA 3K0YA 1Q0EA 1JZ3A 5I30L 2HH0H 4Y2LA 5CCJA 5KYNA 4I0PD 4LSQH 1TG8A 3PGFL 3BQVA 3O3EB 4OCRH 4TNGA 3ZW3A 4YSCA 1E4KA 2VABB 4JDEA 2ZOUA 3KYNA 1AXTL 3CCHA 4ZMLA 4JO4H 2ZONA 5HJDA 1W16A 4Q74A 4DP5X 1U8HA 2X6MA 2E56A 1MCDA 1U6AL 1JXDA 4PB0H 3BEWA 2G60H 4L9LB 5MEPB 1A4BA 2H6PA 4QKXB 2QHRH 4E9VA 2AGJL 1OIOA 4N2LA 3DYMA 3WFEL 2YMTA 1YHPA 1BWMA 3LS4H 4PJ5D 2AQ1A 4E5XG 1NLDH 3MREA 3KBHE 4XBEH 2WQVA 2YPKB 1EO5A 1BZQK 3MTXA 3WU1A 3FB8A 4G6KL 1KJVA 3PGDB 2R4SL 1CZ8L 3KYMA 3LN5B 3T4YB 1SF3A 1FGVH 3GZOA 5K9QI 4OT1H 4XO5A 4Z0XB 3X11B 4EXPX 1FZMA 4MMXC 4WK4B 1JG9A 1CLOL 1JPGA 2GY7B 3FBQA 2F74A 4EIGB 3LN4A 4F7EA 3BAJA 3QUKA 3BUTA 4KRNA 3ZQ9A 2ZKMX 2EE0A 2G60L 3EJJX 5C1MB 3DUSA 4PREB 1NC4D 4Y7OC 4K7FB 2FGZA 1FYTD 2FCBA 4MDJB 3TT1H 3K1KC 4ZTOL 3OZKA 1ZHBA 2NY5L 3Q6FA 4KXDA 5C0BA 2ZUWA 3GTNA 5IB1A 1S2EA 3QSKB 1KB5B 5GGVH 3BO8B 3QDJA 3ZQWA 3UC0H 3QIUB 4LLDA 5JA9A 3MJ8A 3US9A 2GBAA 2L7QA 1YQ2A 4UQ3A 4HXBH 5D8JH 3B37A 4KZDL 2VN4A 4G8GE 2XRAH 2JB6B 2UY7B 1EK3A 5JUEL 1MJJA 4TSCH 1EZUA 3SOBL 2NY6B 4UT9H 1H0DB 2WB1A 2O61B 2NSMA 1PNDA 2OCJA 3II2A 5IKCA 3BP4B 3CSBA 4MVBC 4JRWA 3RIFK 1UXWB 1RUQH 5E8NA 1D7DA 5C6WH 4F58L 1IBFA 2NTSP 5CJQH 1IFGA 1OGAE 1BZ7B 4ABVA 1AIFB 3B3BA 1QNIA 3UJTH 1D6EB 1MFBL 2X0UA 4JY6B 3LXUX 5J6GA 4BSVB 4ECNA 1SM3H 4HLEA 4WUUB 4XNYL 4Y1SA 3SE3C 3DPDA 3C6LA 4WDIA 2FJHA 4QXGH 5B7EA 2XFXA 3O9WC 5J12C 4P4RA 4NZ8A 3IXAB 1WAAA 2YQBA 3WTUA 1TXKA 2AQQA 1WCBA 3DMMB 1R24B 2Z7WA 3ECBA 3NH7L 2FJGB 5BZDB 1B88A 5DZVA 4B9YA 4DVRH 2AXHA 4DGVL 1J12A 4JCWA 4R4FL 1PLBA 4ZS7H 1Z0MA 4OJFL 1X7SA 1FVDA 4APQB 3ZKMC 1MCCA 4UT9A 3TBSA 4DK6A 5AOLA 4H8WC 2IALA 4PBWD 4UILL 2X6VA 3GSNA 1A1MA 4Z0XA 1XGUA 1EXUB 4OGYL 1U42A 3GXFA 1ED3B 2WUBH 5HBBA 2HTKC 5CZVH 2FEEI 1R34A 5DUJA 3SQRA 3L9BA 4GP5B 2E8YA 3C6LD 3PY9A 3AROA 4NENB 2B1HL 2AQPA 3MV9B 4NRXB 5IVOA 4DEWA 2B0SH 5JNYB 3JWDH 1KYOK 4X98A 3SOBH 1E90A 1XF4B 4LDCA 4KWUA 3QARA 3B3IA 1BXUA 1W72A 3UAJC 1A4JB 2AI0H 2Y5EA 2WJ7A 4A7GF 1DQTA 5LAPA 1HHGA 3OPUA 1IB5A 1AFVH 3D5OF 2R69A 4HIXL 4XNUH 4RGNE 4X80H 1VFBA 1X4YA 4QWWC 4ELKB 3Q9PA 2J5WA 5GGUA 3GMNB 4WFGD 4EI6B 4NENA 3OKNA 2WLLB 3Q2CA 1NIBA 3UTQB 1JV5A 2G0LA 4K5MA 3N6YA 2Q3XA 4MJIB 1YYLH 1LHZA 3QG6A 1GZQB 4ANUA 3QQ9D 5FKPB 3CXDH 5SWQB 5C97A 1HYSD 3CLWA 1JV5B 3VYPA 5IV2B 2N56A 4A7QA 4DP8X 1N0XL 2VM4A 3E8UL 4M8UA 5HI3D 4J1UA 3G5XB 2R1XB 1HZHL 1RK7A 2QADB 4Y19E 1T66C 4PS8A 1T80A 1KIQB 2IOIA 4BZ1A 3MRGB 1H15A 3MOAH 3HZVB 1NCAL 3DO7B 2ZPKL 4HCGA 1I7RB 1PS3A 2WXJA 4RAVA 3X1FA 3P3YA 2XXFA 3E9TA 1KN2L 4KOCA 4XP9H 1UD6A 2A0LD 1DJHA 2GQHA 3CVBA 1CXFA 1R47A 2H0EA 5HGDB 2KZWA 3UMNA 4XPBL 3ZYJA 4XMWA 5DD3H 1L6XA 4OM1L 4H25B 1CFVH 2IDCA 1ED3A 1RH8A 1AYRA 3KPPA 3MRNA 1AGFB 2MOVA 1CYXA 1W8NA 4GXFA 4IRSC 4O2FB 3T6VA 3TJPA 3VRLE 3WUWA 2ADGA 3PL6D 1FVDB 4APQA 3UJJL 2D9CA 2OK0L 2NNCA 3AAZB 4JQVC 2UVEA 2V5MA 3DURA 3G08A 3GUTB 5GS0L 2HP4A 1Y07A 3PPEA 4YH6A 4B5EA 5DUPL 1Z2KA 2TAAA 2DKUA 1J0JA 4FC3E 3FQ2A 4U1HB 5FFOA 2RTTA 4FFZA 1U3YA 5E24E 4Z7VF 3OMIB 3FOMA 2QPDB 4IIQA 3IKKA 4NM8H 4ZMPA 2UV3A 3VI3B 4XX1G 4EJ1C 1A4KB 3VXRB 3ZVVA 3QNZB 3LS5H 4JKKA 4JAMB 1DQJA 3FCSA 4PWKA 4XPHL 1CD1B 4PGBA 2EDBA 4XMTA 5TPWL 3JV6A 1THCA 3UERA 4JCLA 3N43B 3GMOA 3SGJA 5DSCA 3R06A 2DM4A 1KBVA 4BWWA 3MNVB 4MAYC 5E1AB 1LO3L 2NW3A 1IGIH 5GS2D 3EFDH 4DN3L 2GPZA 3VFVB 4ZUVB 3UABA 1HSBA 3MOAL 1ZSHA 4RDQF 2RQ8A 2ZP8A 4QXWA 2DMBA 3WKYA 5GS1B 5EU7C 1MN4A 2N7BA 2NSQA 5FYKU 4CSTA 1FI8C 4JQXC 4K3EL 4JFWA 4HQQL 2IPKA 2CK0H 4RGMC 4OSUH 3WJLC 4Z3JA 2XVKA 4PGBB 4XNMA 2OSLB 3X1BA 1EDQA 1JCKA 3BSZA 3EH4B 1G7QA 1S7SB 3VSUA 3INUL 5I74C 5L8KB 3IPFA 3OSKA 4PLKD 3HKFA 3CXDL 1UZ8A 4MJHA 4NQCD 5C70A 2WOBA 2VXVL 1V27A 2YLKA 1MW1A 5ABDE 2VSCA 3ZTNH 1CD9B 5D1XC 5CP3H 3ZY7A 5JPNB 2VAAB 4OCYH 2P43B 1IKNA 2MEJB 4L8DB 1JSYA 1NBYB 3HAEH 3ZR6A 4HETA 3BMVA 1USZA 1EEYB 4Y5XB 4HWZB 5ERWB 4ZUUB 2HT4C 4TSBL 2Q7YB 5IMOB 3PP4L 4A2LA 1RZIB 5IVNA 4HK0B 3ALPA 1Z5YD 4Y1AA 3GSUB 2F74B 5CWSA 1WDAA 4P48A 3N06B 2XXCB 1S46A 4AUJA 3EXJA 5J1AA 2D3JA 3VI4F 3LN5A 1UB6B 2WIIB 1HHKB 3B56A 3LEVL 5BW7A 1ZLUH 3LQZB 1AC6A 2XFGB 3RGBA 3ZDWA 4L29A 2Y2TA 2F54E 5DWUH 4YLQT 3TA4D 3MRJA 2X53A 2HG0A 3O41A 1RV6X 2FSEB 1OP5K 2QLYA 3FAXA 3I6LE 3GC3A 3I02A 3IJSB 4MD5A 3K6SB 3MRKA 3HMXL 4X6BB 5GRWA 4LARL 3QFDA 3VXTB 4BCYA 4KUZL 2DYPD 4GBXD 3X2QB 3G5VA 2V9QA 1DFBL 5HHOD 1P1ZB 1E5UI 1SXZA 4ODXB 4DKTA 2BFVH 3QUYD 1WT5C 4WV1C 1UB6A 4WZ9A 3MO1B 1RUKH 1CFQB 4M1GL 4PRAA 2O72A 2YD8A 3EADA 3DX8A 4YPGB 5GGSA 3HUJE 4RZKA 5LBSL 2J43A 1HNYA 5DMGC 2MQCA 3H7BA 4D9LL 1JYNA 3APCA 1IGFH 1SEBB 4PP2A 3KBPA 4YXKH 4H2AA 5AZUA 3NCXA 1YMHB 2QVIA 4Q6IB 4ZPTA 5I75B 5DZOA 3QDGB 1TZOA 2PCXA 1S9WA 1AGEA 1NFDA 3AS3A 4NB7A 4YDIL 4JFVA 4FMVA 4HJ0D 3ARGC 4HJGB 4YHIA 2Y25A 3BKCH 4H0LC 4FTVD 1X5ZA 1KUMA 1LDSA 2JFCA 1NGYB 1S3KL 3RL1A 1HILB 4DFIA 4X7FC 1F00I 1T1ZA 3NQIA 5CHNB 3QCVL 3BWAA 2FX8L 4IBZA 5DJ2A 3BI9X 5HYSA 3B5GA 5DJYB 4J3SA 1FZJA 1RD6A 1ACYL 1PZSA 2G9HA 1BLNA 4JM4H 4NS0A 4ELMB 4QXUL 4IBWA 4JRYD 4OIBA 3IKCA 4P3CL 5TJWK 4PH8A 2GTWA 4HJTA 3VUAA 4A67A 5DMKA 5LDSA 1EJ6A 4OKDA 3Q48A 1UA3A 1W0VA 2JWYA 4FZEL 4IK7A 3ATEA 3U9PL 5IVZA 4A2MA 2AXWA 2AERT 1IKFL 2WNWA 5D2LE 4JPIB 3FMGH 3UYRL 1I3UA 1QQDB 5DJXB 1HYRC 3EYSH 3HC0A 4ERSH 5IBLD 4R3SB 4L8SB 4MLSA 5I76A 3MCG1 1T1WA 4QHMB 3RFZC 3QIWC 3AG4B 3UH8A 5FCUH 4GRWF 3RDTA 4PJ6A 3K71A 4M43L 1HL8A 5MENE 4ISVA 3AU1B 5C0DA 4WV1B 3S2AA 3L3JB 4NRYB 3RHWK 5BPPA 2OBGA 3NVQA 4PS4H 3G6AB 4I18B 1XBRA 4ALAH 1H3XA 15C8L 5D7JA 1VGEL 1GJIA 1S7VA 2CO7A 3PWJA 4ONFH 4U1LB 2IWKA 2WBJB 1UXWA 4ZMAT 5J13B 5M94B 1R9FA 5EA0H 3V9EA 4P5TC 2APSA 4PCYA 3K6NA 3G04A 4H8VA 4YHMH 5A2BA 1R3HB 2HVJA 1IM3B 4PI0A 4FLOA 2CK2A 1P9MC 5I23A 2C9PA 1MNUH 4WW2B 2EDJA 4UANA 1ZD6A 3KPMB 2H26A 5C3LD 4CADB 2B59A 1QSFB 3UYPA 4RAUA 3WIIH 3ZGIA 1ID2A 3MV8E 4I0PB 5K5YA 1I7TB 4HCRL 3T2OA 4BHUI 1GMEA 5DRZA 2H45A 5IHZA 5JQ6H 3V8CA 3DGGA 1E50A 5FPIA 2DQUH 5KJ7E 1WZKA 2ZX6A 3QFJE 5EO9B 3NOIA 1G7MA 2X6BA 2X42A 1JXGA 3BVWA 1NGPL 2O5XH 3JZYA 3Q8CA 5SWZD 4LSPL 3LN4B 3QDHA 2F5AH 1JWMA 4WEEA 3SGKC 3L3JA 4NRYA 4ZAKA 5C7ZA 4F15B 4YSEA 2Y1VA 1INQB 4N22A 5AAPA 1JGUH 2PYEE 4PVMA 2RJMA 2DM7A 3VD7A 4F8OA 4Q6KA 2HJKB 3SYPA 1JZ2A 1IC0A 2Y2YA 1T1YB 8FABA 4ZW3A 1AP2B 3REVB 2OJZL 2B16A 1TVHB 5I9QC 4EDXB 2ADJB 5E8PA 2R8SH 2B77A 3ABZA 2AQSA 3FO1A 4OD3L 3RZWA 4D9RD 4I9WE 1KLGA 3RGVD 2J4WL 3K6OA 1XV8A 3N40P 3NIGE 4WHYH 2MCPH 3BRDA 2I7SA 2Y1ZA 2J20A 5I1GH 1S7RA 1ZVYA 3FU5A 2ED8A 3MV9A 4ABWA 3L9EA 1LTXA 3LEYL 3POHA 1RUQL 1N6UA 1FAKT 4JFQA 4GQQA 4RMBA 4LLVA 2NRDA 3V6OC 2XWEA 2ZYRA 3X12A 2E9BA 5HHQB 1YMMB 3O6FC 4PG9B 1T3FB 2ZOKB 3C6SA 2I27N 3LOWA 2CAKA 3TTYA 1DBJH 4D3CL 4FE9A 1NDMA 4Y8AA 4MNQA 2R8SL 5I16B 3X12B 3HE7C 4XRCB 4WHDA 3C6LC 1HL5A 5HYSG 3OKKB 2A4CA 1F56A 4Q9QL 3K8KA 3PIQB 4U4BA 2Q7YA 3U6RA 1LP9F 2QVFB 4G6FB 1ORSA 3FTYA 3N0AA 2WY3B 3LNFA 5I8CB 2Z31A 2G4EA 1IMHC 4HUKB 2AK4E 4LGRB 3G5ZB 4NQQA 5HD8D 3NYKA 2J5LC 3TV8A 3TZVA 2HUHA 3RDJA 5JPNA 4YS4A 1VF5C 3C2AL 3MOQA 3BLPX 1KN2H 2WUCH 2X4OB 2DKSA 3QUML 1JWUB 3VMOA 1KJ2A 3BAXA 3H9ZA 4J3OF 4MJ5B 2WK2A 1T0OA 4W6YB 3X1NA 4M5ZH 1G9HA 1HQRA 2X10A 3DX9B 2WWOA 3RI5F 5FUCC 3UTSD 5A2IH 4X6BA 1ZV2A 2UZYA 4ZAKB 1SUHA 1XFPA 2DS4A 1OHQA 4YLCA 3SZKC 2EYTB 4G6JL 3VWKA 4J3BA 4PHXA 3V0GA 4OV5A 4GRWE 4N2IA 3MKGA 2VL5B 5DUML 2Y5TB 5CCKH 4TQ8A 2VR3A 4WEBH 1YEGH 1KEML 3VQLA 1JMZA 4OR1A 4PWEA 4ZX5A 3QQ3B 3DOSB 3AC0A 2PCPB 3A6CL 4PSPA 4XNBA 2XPGB 1UD4A 3D3VA 3ZJAA 1Y6KR 2DMHA 3RRQA 2AJVH 2VDQL 4U1KA 5JXEA 1MOEA 2AFNA 3ALXA 4ODHH 1TQVA 3TBVB 4Q2ZB 5KSAA 5J56B 1NFIB 3K72A 4PV1C 4KI5F 4IKKA 1XCTA 3HI6L 2FQFA 4EN3A 1XGYH 5I17B 1E8ZA 5D70L 4L4VA 4TNWK 5D7HA 2E6JA 2N3JA 2CALA 1OOWA 2P4AB 4WF7A 1A21A 3B5HA 1E30A 4GG8A 2WWKO 1Z9MA 1MWAA 2Y7QA 4ZW6A 1F41A 4OJCA 4XVJH 2HJFB 4X6CB 4MX7A 2WKOA 5FXCH 5T3XE 2PO6A 1P84J 3WLBA 3A47A 1GHFH 1IC5H 3N1PC 4LQFH 4JGUA 4G8IA 4J4PD 2FHFA 1QWNA 2Q86A 2BMKA 3MFFA 3WFDH 1RHFA 2EC9U 2PUQT 2NW3B 5C0RH 4BHUA 3DMMC 1WQVT 3EJYD 3VGHA 3F7VA 3PFUA 3OZ9L 2Q20A 4PJFA 1H15B 5I0ZA 1HX0A 2OMXA 3PWVA 4AH2B 1FJ1A 4JPVL 1O7VA 4F91B 4IDJL 3L3IB 2VQUA 3BKML 2FLMA 4ATTA 3DECA 5IVZB 3ZZQA 5LJYH 4G1EA 1SVBA 2XKNA 4OGAD 3VGFA 4YQXL 1VPOL 5BS0B 1IAII 3L3DA 4BKSC 2UZXB 3ME0B 5DEGB 5FF6A 3C9NA 3FQTB 3TF4A 4QRTB 1KPUB 1BPLB 3RX9A 1ZTXH 5HD8C 3VRIA 1DLFH 4JRYA 3OMZA 3C12A 2O30A 1WD9A 1Q4NX 2EDQA 5GRUH 5F9OL 2VLJB 2O6FA 2PO6D 4E9RA 3F2LA 3LRSB 4V1DA 4WGWB 1XGQB 2C8NA 2WTOA 4TMPA 5CLXA 3VWKC 2OSWA 2K1MA 2XA3A 2XTJD 4MASA 4PJ5B 5E03A 2F15A 5C08E 1X6LA 2GY5A 3OAZK 5DD6B 4PJ8C 3F7YB 3B7SA 4UOQA 3D0LA 1DBJL 4D3CH 4XPFH 3CGTA 3MLVL 1LE9A 1DJZA 3TGXA 4NI6A 4WLCA 4YBHA 3QPXL 2K4WA 4TSAH 4UZUA 5F9DC 5FYJU 2OQJB 3KS0J 5E70A 3DJSA 3KPTA 5ECJE 2VZVA 2EXWD 3FS9A 5KSAD 4F33A 4ZO8A 3UC2A 1XSKA 3HFFA 4FFVD 2MCMA 2OZ4A 3TH3T 5C0EA 2CRMA 1CFQA 4XAKE 1JAEA 1R5WB 2YKKA 4OUOA 3GIZL 4TQEL 2BDNH 4YSDA 1M6OA 4LSVL 4IK6A 3ZKXC 2HYMA 3D12B 3PGCA 1ADQH 1IFHH 5G2NA 3TO2B 2V3EA 4Q52A 4LSSL 3CU7A 3D0VA 3PREA 1CFTB 3SPCA 1AR1C 4RMVA 1UATA 4LIQH 4OCXH 5EZLA 4OQ1A 4WCYH 4F2MA 2ATPB 1TZGL 3FKUS 4P2RD 5JW3L 4FXGA 4QT5B 3RYMA 2HVKB 5DK3A 2QSTA 4YHOH 2OP4H 4W9CC 2IAAC 1WRFA 4LCVA 1SHWA 1J9QA 1XD0A 1T21B 5EU4B 3O3AB 5TDOA 1NH6A 1DP0A 1RK1A 3V4UH 4K3JL 3HUJB 3MLSL 1UB5B 1EHAA 4UB0L 2E7LA 3TCLB 4M48H 1IFHL 4AEEA 1A4JA 1XF3B 1Q9WB 4G6ML 4QRPE 3H4FA 4FNLH 1U9KA 3P4LA 4AVIA 4JO1L 4M5YH 4YN3A 3GJEB 4H20L 3S2CA 3PCYA 1I82A 1KCWA 1KPUA 4PTUB 2E7HA 4OZIB 5FHBH 1WT5A 4WV1A 3CTTA 3MJGX 3GKWL 1KULA 4X4YA 1ASOA 2DI7A 3AUVA 5ESAA 1JZ8A 2LOEA 1RIVH 2B4CL 3P4NA 4QOKE 4PRNB 4U1SA 2J5LB 4PIBA 5E6UB 2PWGA 3WJMA 4OB5H 3BO8A 3ESVF 4PJXB 5TE6L 4DOHB 5ANMA 3L5XH 1N0LB 2BXZA 2V7HB 2AJVL 2VDQH 4N2BA 4Z7WF 3LMJL 3PE9A 1TTGA 4ONGH 1PJWA 4EZMA 4GUQA 2WD0A 2BERA 4JKPH 4ZNCD 2XFXB 1CDGA 1A6WH 3KLSA 4R7VA 4UTBL 5AW0B 1E6OH 2AJYL 3T65B 3WIFB 5KYWA 3QDME 4YHNB 4AQ1B 4AQOA 1RIHH 2XSKA 3JWOL 3SKJH 2ZCHH 5T33H 5EULV 2FT7A 4FADA 4MMZA 3IT8D 2WBXA 1TDQA 1QFWL 5FYKL 4YC2B 3QO1B 4R2GD 3RA7L 1BZ8A 2HJFA 4K9JA 3L7EA 5CD5D 3PGDA 1E8WA 2CDGA 3ECWA 5E4EC 3DV4B 5HYSB 2AK1H 1CO1A 4HHAA 4JFDD 2YEVB 3V0EA 5F70A 5KW9L 2AJSL 4ZFOB 4ODVH 2X4UA 4PJAA 2Z9TA 1WE5A 1GXEA 5EORH 2CLZB 2NYYD 4X9YA 4EZKA 4DZ8A 4Q8BA 4PJDE 2NZ1A 4KQ4H 2BIIA 2C3VB 2EDHA 4LHUD 3CZUB 1E27A 3KYAA 3JWNC 1TENA 3FUMA 4EKJA 4Y19A 4ZQKB 2Y6TE 4ODWB 5HYEA 6PAZA 5KVFL 1U8IA 5ICZB 3QXAA 4KNUA 4LLDB 3TV3H 4S1DD 4QHMA 1YY9C 3ZIYA 4GINA 2B8OT 3P3TA 1GYVA 1A8ZA 2BHUA 3EHBC 4N86A 3V4UL 2E27L 3ARBD 3BGMA 4GQ9L 2G2RB 3DTUB 1Z6JT 5GGRA 2EE3A 4KRMB 5D7JC 4UDUA 2H8PB 1WG3A 3MV8B 4DO4A 5K93A 4FKEA 5KVMC 2GAZB 3CC1A 4XN9A 4XMLL 4CVWA 3QNXA 1OLZA 1TO5A 4NHUB 1DE4A 4NUPA 1OM3H 3VFNB 4WTZA 2Z8RA 3HC4L 3WEAA 3ZDXE 2AK4A 1AHMA 1CU4H 4PJ7A 4QHUB 3LEYH 2PPEA 2BP0B 3FB5B 3P4MB 3VFNA 1P9MA 1G7LA 2X4PB 1KG0A 4M61A 2OTWA 4E0RB 4MA1C 3QG6B 3UL4A 3NPZB 5CN2A 4XXDA 4LHJB 5I8EA 4ZPVA 3MXVH 4NWUH 1N26A 1OTSD 5K9JL 2ZD0A 1XF5B 2B9BA 4QXGL 5B1CA 5TGBA 3EG9B 3EH5B 4OCMC 4KHTH 4EI0A 5D7IE 4BA8A 1HH6B 5E8OB 1LP9A 5CGYD 1I9JL 3RAJL 4P5TB 3Q5TA 3EBGA 4HSAC 3MV01 4JDEB 4LPXA 1NAMH 4KAQH 4OUUA 1EGJA 3AXLB 2PXYD 3NP3A 3EDJA 4DGVH 3NIGB 4M61B 4LZKA 2XWJB 2FJUB 3VA2C 2HG5B 2EECA 1FGNL 1N3NA 4EMZA 4L3EB 5D4JA 3OD3A 2HKFL 4JR9L 4TNFA 3LPPA 3B2VL 4GI9A 2KDGA 2P52A 1W91A 2DIAA 3VU2A 3LKRB 2M8XA 1RURH 2EYSA 1ZTXL 3PAUA 3T77B 4UQBA 1QTSA 1A6AB 3QULA 1JFHA 2HFTA 5A3ID 2JH2A 2GB2A 2J44A 5JIKA 1DQKA 4HKJB 1A9BA 4NC1C 5F1OB 1XTLA 4TVPD 2G5UA 2ATAA 5E8DL 1HQ4A 2QELA 3KHQA 5JHDA 3QJHB 1QZNA 2ZOLB 5AB0A 5CAYB 1YNTA 2BPBA 4E2OA 4LEXL 2NY0D 4P05A 4JANA 4L0YA 2DLHA 1NUNB 4YDJA 2ZXBA 4X50A 4XN5A 3HS0B 2VITB 3MRBB 1TZAA 3BW9A 4K94C 2UXTA 4OTXH 1DBML 3W5NA 3T4AA 1NCBL 4BK5A 3QISA 3F65A 2VDPL 4IJ3C 4XZ4A 3X13A 2XNAA 4DP2X 2X70A 4XP4H 3QC5X 5ITFA 3ZHFA 3HLKA 3LB6C 3R18A 2X0VA 2JKSA 3DDFA 1BVNP 2MSPA 3KPRD 5FGBC 3CAFA 5L4IA 1KB3A 3U4BH 2VUKA 2BOBB 3OJDB 3CFKB 3ARYA 3DROB 2ADYA 1DEEA 2VCOA 2Y7QB 4PJCA 3O3DB 4RISL 1KTJA 3CMOL 4OCWL 4Y4HC 4GRWB 3RWGA 3VWJB 5KW9H 2FZ3A 4A63A 3VXPB 5LB1A 4ZUTB 4BFRA 1HSBB 4NJAL 1JHLH 3P73A 4TPRH 1H3VA 4RMQA 1JZ6A 2F54B 1WO2A 3H2QA 4F1ZA 1OQXA 4NNPL 5I1EH 4WI8A 1ACXA 1H9VA 2BS9A 4RGNC 4NDMA 5B1KA 5B8CB 4L8CA 4MZ3A 2NY2B 3U1SH 1DL7H 3UJJH 2ZP9A 4XMXA 4UV4H 5EBLB 5GRXG 4F8LA 3ISWA 4KITB 4AQEA 4RVBA 4PJIE 4RA0C 3C5ZA 2F53D 4U0RB 1YUHA 2BNRD 3NIDE 2HLAB 2VLRD 3E3QE 4ESKA 2V2TB 2VWEC 2HRPH 4N0CC 4F2ME 1FZMB 3F6IA 3QIBB 1CCZA 3WL9A 1A6UH 4PHZA 2C1OB 3NSDA 3FU9A 4GAJL 1U8LB 4N0YL 2XVGA 4PJGB 4Z7OB 3MPCA 3VFUA 4WFEE 1KENL 4A1RA 2QQKL 3X3FL 2FRGP 5IBUB 3EYQD 1H3UA 1MQKL 2F5BH 3W1ZA 3KDMA 3O8XD 4ZOCA 3PU7A 3WIAA 1TETL 2XA8L 2CXGA 3P1VA 2EO9A 4LBAA 4PRPA 3QEGL 5JPNC 4YX2H 1Q8MA 4JJ5A 4A39A 1MWOA 1O0VA 4QLRA 1G6RL 3LZPA 1FNAA 2Z1PA 3QNYA 1BQ5A 1BFTA 3QCTL 4OF7A 2X89D 3M8OH 1KPRA 3WN6A 3HUJF 4OKVB 1CI3M 1BGXL 1SZNA 1DSFH 2WXGA 4J6RH 3CSFA 5IESH 4O02A 2XXMB 4ODUB 4RGMB 4U1GC 3I9PA 1T1ZB 3UMTA 1B0RA 3WHE1 4OZGE 2VRQA 4X80L 3U6RB 2DJSA 4WNSA 5ID1B 1FAIL 3PGCB 5IGXL 2OZ4L 3SJVA 4KO9A 4FFYL 4WWKA 4RWYL 2J3SA 2R23A 4GMSL 3VTMA 2DF3A 3S48A 4QY8A 1QLRA 3VFOA 4EOWL 4LCIH 2YA1A 5CKAA 4BUHA 2CUHA 1HH9B 2VLJE 5IJBC 3UO1L 3EBHA 4YBLB 4O02B 4UM8A 5L88H 4JZJB 3FT2B 1OF0A 1CTMA 1RP9A 3L3IA 2G3MA 2IBBA 4PJ5E 1QFHA 4PS7A 3KEDA 4Z7QF 3WCYA 1GZPA 5HYIA 1W6LA 3MUUA 4OIIH 3QCVH 4DP7X 3MO1A 3MBEB 4AMKL 4K23L 1FUNA 2EZ0D 4YDNA 3QA3B 4BSWB 4JJ5B 1EJ8A 4V1DB 2F58L 3C8DA 4R5VA 3TYFB 3VFTA 4WI2A 2RFXA 4U6YB 4D9RE 2J56A 3GI8H 1FE8L 3QFDB 1QACA 5TDPB 5K9KB 3L4WA 3ARWA 4M5YL 4EDXA 1EERB 2AQTA 2XHNA 1N9PA 2YAMA 3O41B 1A1OB 4XWOC 5DD0H 3UTSB 4AWJC 5CJ8A 4K8RC 2VM3A 2F5AL 1CYGA 5C08D 2AXFA 3O2DH 1U3HB 1JPST 1UH2A 5C0GB 3EBIA 3LQMA 5CBAA 1I85C 1QAWA 2VUOA 3U30B 2OMTB 2BP8A 3KL0A 3RHWF 4KO7A 2DAVA 4MZ2A 4R96A 3UFIA 4AMKH 4G8EB 4KX8A 4FL4C 4H0GA 5C09D 3F58H 4KMTH 2MJWA 3AREB 1AE6L 3H2WA 4LSQL 1S5HB 1MW3A 4KDWA 3R1GL 2Z7ZA 2X1XR 2VIRA 3NGBC 3FT0A 4N3TA 3WGVB 1DBMH 43C9B 2Z34A 1RQ5A 1SBSL 2CJSA 3S5LA 2FEEL 1MJ7H 3RVXD 4WSKA 3X11A 4MX7B 4WI6A 3G5WA 5ETUB 1RIHL 5IM7A 3JV0A 1YMMD 2RA1A 2YFNA 3MA7A 3NCYP 2Y07H 1ZLUK 3COOA 4PLJC 3F3HA 1HU8A 1VIWA 4OZIE 5ELIA 5TK4A 1NOAA 4UILH 4UQ2B 3RJDA 1N0LA 2V7HA 4LCYA 4MNGB 4MDRA 3UEZA 1VB9A 3QRGH 1JHKH 3A6BH 1SF5A 4HJSA 4ONHA 1GGTA 2IPUG 3AY2A 2LU7A 1RURL 4QOKB 4L3EA 1RJZB 4KROD 2GITA 1CDUA 2GIYA 5K9QG 1E65A 1SRDA 1HT6A 3I9GL 4KKNA 4NPKA 3V2AR 4OFYD 4OD2B 2AV7B 3SKMA 1YEIL 3PNWB 4JVPA 2Q8AL 3VD0A 2EIBA 1BM7A 1U8CA 2XY2A 4N8UA 4WI7A 3D0AA 1NC2B 3VGAC 3TCTA 4NNYA 1EDHA 2ZUVA 3I75B 3HNSL 2ODHA 4NLAA 1FP5A 2V0AA 4GSXA 1JYXA 1AKJD 5FKAA 1FNLA 2WXIA 3OM3B 5DF0A 2E3VA 3QRLA 3L54A 1YG9A 4APQC 1UWEH 3W9EB 2XWDA 1LNUB 2ROXA 3L5WB 32C2B 1DVYA 2Z0BA 3T2LA 1RHHB 1I8MA 3X14A 3TBCA 2W91A 4GQ9H 5IW1B 2GEQA 1PZ5A 4DP0X 2LFEA 2QSQA 4KTGA 1MCRA 1SOSA 2NY7H 1BSIA 3GSNH 2AK4B 3HTLX 3FK3A 3OHXC 4PJDB 5KVGH 1B6UA 1BGXH 1U8JA 1KYUA 3IFPB 3C09C 4TKWA 1K4CA 4FNTA 1W15A 3DVFA 5F93C 3N50A 3D2UA 2X4OA 3RWDB 3UZQB 2CLVA 1IGYA 3X1GA 3JZ7A 3BZ4A 2Y1AA 3HC3H 3QR1A 2CLRA 3IDMA 5BO1L 2ARJB 3E2HB 5IM7B 5KSBA 1I8MB 4FYTA 3VFGL 2YWZA 3BGMB 3D4YA 1KYOJ 4WNQB 4GMSH 5FK9A 1JHLL 3FU3A 4TPRL 5H35B 2D3LA 3IGUA 4QGYA 4EBQH 5JOFB 3ARED 5E23A 1FYHB 4NQED 2QZ5A 1HEHC 2YAFA 3PWUB 3FH8A 1TYJA 3DRQB 1K85A 2VDOB 2NUPA 1DVUA 5FK9B 3ILEA 3GTVA 1PCSA 5F88B 3SPVA 3DGCR 4HEME 1MI5E 4OAWB 2EAEA 5D7IF 5H37G 5SWQA 1Z3RA 3SDAD 4Y16C 1OSZB 2YRZA 2CHXA 3GLDA 1Q1JH 3FRPA 5HI5C 2MPAH 2NY3C 1KEGL 1G6RA 1NM4A 1BZEA 1G4MA 1QBMH 3I9AA 1B0WA 2WUCL 5D9SB 1ZIAA 1UYWL 4DEUA 2NNAA 1M42A 4POYA 1A6ZB 1E4JA 4PRBB 3APNA 3TBYA 25C8L 2HN7A 4KKLC 1UM6L 3O3BB 3H54A 5FUOL 3W0WA 1JPSL 3CC5A 1JXKA 1LNUA 5L6YL 3NG5A 2QR0B 1J0ZA 4Z8FL 3MNWB 3FUJA 3IGFA 4MWFA 1CGUA 1KYAA 3VXUB 4DUVA 2V2XB 2QFPA 2YSTA 4XBGA 2XQYK 5LDUA 1WIPA 4HS3A 4I9WD 3HE7A 5E8DH 3K8LA 5HJBA 3IJYB 3VXPA 5I28A 4YHZH 2LU3A 3HLAB 3MRFA 1SXAA 2F1AA 1N59B 5TE7L 3KYKH 4X6DB 1ZGLM 4X6FB 2W1NA 2YK1H 4RIRB 5LQBH 2VDMB 3GSRA 4QD2E 3C60D 2YS4A 1CXHA 2Q5BA 4OFVA 5DT1L 5IMOA 1TJXA 5CP3A 1HCZA 4IU3B 4PY7A 4UQIM 4X5QA 2ZF9A 1MFCL 2FWOB 4KROC 5TQ0L 4E42B 4Q9CA 4X5XB 4NWTL 1AMYA 3CJJA 3K2KA 4I87A 3D52A 2YD1A 5EN2B 4QRSA 5EOQH 2CUMA 5ESVA 4U7MA 4A2HA 1IBHA 3STLA 2B2XL 4TVPL 1D9KD 4FFZH 1CT8B 3MRPA 4HALA 2WQSA 5HGGS 2VDNH 2F18A 2KZ1B 3BW9B 5KANG 1JXFA 2DWEA 3RQ3A 4CAGA 5C9JA 4QHLB 3BPNB 3Q43A 3JWNH 3KGSA 3HHSB 1IT9L 2YA2A 2CDGB 2X4NB 4JZOB 3HCVA 1LLAA 4X9BA 1GSKA 5F3HB 3SPIA 4TM9A 1NCAH 1XIWC 2IPKB 1ZHLB 3PF2A 5I71C 2LLLA 5B3SB 3IMTA 4F3FA 3QQ4A 1NIFA 4LVNC 5DEFB 3TYGL 5JLZA 3WDJA 2FUTA 2CO3A 3ZDYF 1XHHA 3HVNA 5HHNB 5KBMA 3P0VL 1KELL 4OM1H 3T6QC 1F3JB 1NJ9B 1RKRA 2A83B 4G6KH 4JFDE 3H9HA 5CKGA 5KYUA 4IBVA 2CCWA 1T6VN 3CSTA 1JF1B 3GXIA 3OMNB 3QFJD 1FYTB 5E08H 5AUMA 5F7HA 1BWWA 2MQ0A 1RJLA 3U1SL 1D7CA 3MV7A 4GEJA 2KQMA 2E9JA 2LU5A 4M6MH 4F37K 4YSOA 5HDOA 1ZK9A 4F20A 4M7KH 4D2NA 5FDWA 2P42B 2CR6A 4P2RA 2BJML 2JV6A 3DXAA 4YO0A 1CD8A 3LRLA 5JDSA 4LNRA 3DHPA 1MWAH 3QHTC 1N6QL 4HIIB 3U82B 1V3KA 3Q5OA 4IRZL 3SJVB 1Z3GL 4OM0H 1KCVL 2D8KA 3CDFA 2YGNA 1MKFA 2V9RA 4MFHA 1JGUL 1CK0L 1WZAA 2ZTBA 1D5RA 1ET7A 2YBRA 4RH4A 4ABQA 4DVBA 5KSUB 1A7OL 1J9SA 3DETD 4GXUM 2JB5L 4D0DA 2AANA 1FNSH 1PLGH 1DJGA 1GYWA 3ZZSA 4JJOA 1ORQB 1T4KA 2GJ6E 5CJ5A 2PXYA 2QVTA 4LCWB 4YUEH 1F0LA 4IQHA 5KS9F 4PJIB 4Y1AD 3OB0K 1KCSL 3D39A 4HIJA 2VN6A 1T0PB 1J8KA 3TJHC 4LLUB 5EC1A 3VXTA 3UTPE 3DTXB 5A16A 4F2MB 3EF4A 1EEUA 4ANVA 4OF6A 2R23B 4M7JH 4HOZA 1HJBC 5CINL 35C8L 3C9NB 1JGEA 2P1YA 2WBKA 4CRPA 5C0RL 2VXVH 1JGDB 2OTUB 5C07A 1NDMB 1J1XL 3T2PA 1HHKA 4KI1A 1HJCA 2J8UF 3JYBA 7TAAA 1I7ZA 5LKNA 2V8LA 3WFBL 2R27A 4KZ0A 2R0ZL 4AL8H 3ZXAC 1AIZA 4MD0B 1QSEA 2HXAA 3E7JA 3HZYA 4NP4L 5ALCH 4ETQA 3C5ZB 1PKQA 1O9WA 1OD7A 1P53A 3UP1A 2NUTB 3NJJA 3L2LA 1GTFA 4HLJA 1WP6A 4DEPB 1N64L 3UAJA 1IGJA 1JWSA 2YXWA 4ZZFA 3W2DL 1OAXL 2OAAA 3GMPB 1CLZH 1J8HD 2CCLA 3R4RA 4L2LA 3RWHA 4UT6L 4W9IC 3T9WA 3VQMA 3OKDB 5SWZA 5C0FA 4PJXE 4JJHA 4AYFA 1KXQA 1EVUA 5E8PB 4GSDL 3AG3B 4ORGB 1XF4A 4PJAE 5DHMC 1UQSB 3UJIL 4ZMWA 4AJWA 2OFQA 2VXQA 4J4PA 1LQSR 3EOBB 4V2BA 4TUKL 1GZHC 5E0QA 5ETUA 4AMXA 1EJOL 2Z6FA 5I5IA 1Z5LA 2WGXA 3QO1A 2PCFA 1JZHA 5CUSL 3QCTH 5HHOE 2H6OA 1BG1A 1BM3H 4HGMA 2OCFD 3C5JB 5TH2B 4NC2B 4N0FB 4X5LA 3ARPA 4Z9KB 1OT4A 1NGWA 1QRNB 4F24A 5IT2H 3ZO9A 3AT8A 5DQJB 1ZXQA 3NJMA 1NMCC 4PAZA 4K5OA 1UJ3C 3R1GH 2XG5A 3WMQA 1QRNA 2OJ1A 3FTXA 1YEKH 3PWLA 3A67L 1UOWA 2VQ1B 4P46A 4G8FA 3HMWH 2DWYA 1RZKH 3P4NB 5FHAL 3MRLA 3KR3H 4TNEA 3OKMB 3N44F 2GTZB 1BA9A 1OSPH 2M26A 3FCGA 2H0FA 1SOXA 3ENEA 4FQ1H 4GW1B 2XQYA 3VDAA 4MHHG 4BQBA 5EU3A 1H5BB 1BZ7A 4G83A 4IRSA 3N1QC 3O2DA 4P9HH 1CICB 3MDJA 3TBYB 1MLCB 5E00B 3K3QA 4U6YA 3WTXA 4K3GA 2P28B 3GIVA 3ILQD 4ZMOA 3CZNA 1SQ2N 2GW5A 4M4RA 1EFXD 3IDJA 5E2TL 5KZCB 3ETBF 5E9DD 5LBVA 4IIQC 3T0DA 1HNFA 1FL6B 5GQBA 1BOYA 2HPTA 3V4VB 3H8NA 1OB1A 1OAJA 2DQ6A 4F8TA 1MREL 3ZRSA 2FBRA 2DH2A 4CN6A 4JDZB 4NN5B 1R3LA 1YJDL 3DOHA 3B6SB 4NRZB 4W9KC 1G5GA 4XXWA 1FN4B 4PJEA 4MA7H 1SJVA 4G9DA 5DMYA 4HMCA 5GS2H 1X9LA 1KCVH 3RIKA 4CW1B 3AT0A 4KFZC 3UBXA 1KIPA 3MLTB 3LEVH 3T8VA 3ESMA 4PTTB 4AYBA 4AIOA 4WI3A 1EWHA 5IR1B 1DDTA 1RZFL 3IMBA 1IQDB 2PLTA 2Q2LA 4LVNB 4F37F 5IFAH 3WNLA 4OCRL 3EDDA 3LZNA 2YGOA 1F02I 4AQ8C 1TFHA 5D7IB 4K3JH 1OSEA 1U8QA 2VH5L 1JTTA 4EXKA 5HHQA 4WO0A 1G9MC 5IMMA 5AL8A 3JYCA 2BSTB 4WSGA 4YSQA 3PNRB 2KZKA 5LUMA 1PMYA 2NY7L 2V9TA 4N1CA 4HJEA 2DMKA 1FG2A 3PHOB 2G9KA 2OXHA 5IW1A 1IEBB 5JHDD 1VSCA 4KK6C 4KRPD 2JIXA 3VNZA 5HYQB 1HWHB 2BHFA 3E8VA 5HDLA 3AXLA 4MXQD 1L9OA 4JFHE 4F93B 7CGTA 1GHFL 1IC5L 3AU0A 1I3VA 2OJEB 2AK1L 4H8HA 3TBTB 5DHYA 3HA0A 3GI8L 3QJVB 1GGIL 4HS6A 4GRMA 4K8RH 4WJG3 4J1UB 3ERXA 2NY0B 4M5ZL 3L9RB 4DKEH 1A66A 4ZX3A 2DJMA 3IN2A 1JF6A 2UWEF 1C7SA 3SN6N 2UY6B 1INQA 3BAIA 4JFXA 5T5NF 5I16A 1LO0H 4PCTA 4HVBA 4AEIH 4KBPA 1IGML 2OR7A 2VLRE 1KDIA 4KKBC 2DV6A 3FTWA 4U0QB 1BYNA 3C87A 3V5DB 3CVIL 3UX9B 1X5MA 3ZU8A 1HOCB 3FU7B 5HGAB 1HWWA 5KN5A 1NCIA 1NBQA 1E4XI 1E5YA 2CBMA 4JO2L 1SXCA 1T66D 2WLIB 3SPJA 1KWKA 2MPVA 2H8PA 4HHWA 1ZK5A 3JSSA 4TSCL 3T2QA 4AGPA 1R17A 3NRPA 1URZA 1HI6A 1A1NA 2OTPA 4FI6A 2X1OA 2CH8A 4YXLH 3N1GC 4LL4A 5B3JF 3OSVA 4XE0A 3HFMH 5D1ZI 2HJLB 7PCYA 4PJCB 1F97A 3OAWA 4HKBA 4HFUH 3QDJD 2CIIA 2NX5E 1QBLL 1IRAY 1INDH 3KCPB 3HZMB 2QTVA 3QG7L 4PV9A 3OG6B 1UGNA 4LAQH 4ACPA 1T04B 2Z8SA 4I5BB 5JW4N 1U33A 3EGSB 2HRPL 4JFUA 5CP7A 4MMYA 5D71L 4AZ8B 4IRSD 3RIAK 4WHTB 2JK5A 2LT9A 4FLRA 3V6BR 2EE2A 1PTZA 3ARGA 3PWNA 4HH9B 3STLB 4PJEE 1D7FA 3E2HC 2NNRA 5A2JH 3IRCA 1U8KB 4ONFL 3AABA 1FL5B 1FZOA 2PMZA 5HYJD 3HS0A 5D7JD 1O6SB 5D1ZA 4MGXA 2ZKHL 4MCYB 1P6FA 3HZMA 1RI8A 4MJID 2QKSA 5DRZB 3OHXB 1SLUA 2RGSA 3AUWB 2EDKA 4S2SB 4BELD 2DYSB 3JTSB 3KL3A 3Q8EA 4HUWB 3I85A 3TF7C 3RZCB 1GS8A 4Y0GA 4HLZH 2XPYA 1EHLH 4OGYH 3ZKQD 1RAMA 1TIUA 1U4FA 5C8JA 1KXTB 3F85A 3UZEA 1A9EB 1UYWH 3QQ9C 1F1GA 3O3AA 1D9KC 1F3DH 5TDOB 5LGJA 5HGAA 2IH3B 5DLLA 4P4KC 2D3NA 3ZDYE 2HH0L 4JKWA 5KVEE 3O6FD 5GZNC 4J3UA 4JFZL 3ZTNL 2AS5M 3FRPB 4JFFB 1QVOB 2F7RA 5BUPA 1OAZH 4N9GB 1G7PA 5IQMA 3R8QA 5CLYA 2BJMH 1YDPA 4FQIL 1MY5A 5C0CE 5C9KA 5FA4B 4PLJD 5FGBA 3BLKA 3TNMB 3PXJA 3CLEH 3U1PA 1R0AH 5FOBA 4OFYA 3IMUA 1LDPH 3C8KB 1A3RL 2C7UA 1YC7A 5CEZH 1F4WH 4HIHA 2L4OA 1QQDA 2WTRA 3LXAA 4YHKH 4NQUA 3RUGA 5DK0B 4ENZA 5H4ZA 4A68A 1JUFB 5G4NA 1W8EA 3PXHA 3TA3A 3IJYA 4AITA 2NY4D 3S5YA 1V7ML 2E5EA 3SDAC 3CHSA 2OV0A 3OV6A 4PD4J 3IMSA 3LXCA 5I6MA 3WHXA 3KLQA 2BXYA 2R2CA 5DVMA 2XTLA 5ITBH 3UTTE 1L6PA 3L7FB 2BZ7A 2G4GA 3K6FA 3DJZA 3NGBB 4D8OA 4BZ2A 4QO1A 1YNKH 1KN4L 4OCXL 1T2XA 3V7AE 4LFHG 3OHMB 3AREC 4P2YA 5DXWA 4FL4B 3P3SA 2CPUA 4HA1A 5DI8B 5EOCJ 4NQDB 1SHSA 3BWUF 4HUCA 2YMXL 4F9LC 1X9RA 2GJ6A 4R7DA 2WZAA 4UOW0 4BWTA 1NGQH 3P2BA 1S9WB 1NCCL 3I3BA 3CCHB 2XBDA 1PX4A 2LVEA 1OSZA 5EG6C 4CKVX 1QUNB 2WWMC 4NBXB 3LVTA 3M1BB 4YHPA 5F1NB 2W81C 4ADIA 1BIHA 2QPUA 5CIPA 1U93B 3FRPG 1AXTH 4B96A 4QRQA 4UT9L 5LQBL 1TCRB 4WK2B 4ELMF 1G84A 3BGFB 1FL6A 4ICWA 3V4VA 1OM9A 1TNMA 3D85A 2G2NA 2GJ6B 1EJFA 2P8MA 4GLRI 4MZIA 3UZEC 2WHVA 1W72B 1A3RH 3BUYA 2D7QA 4FCAA 3T0EB 3ECQA 5HI3C 4LT7A 4XB3A 3E80A 4M6NL 1T1XB 3HB3C 2MHAA 3GSXB 3BZEA 4TUJB 1DUZA 3AG2B 4XNYH 4YBLC 5FO8A 4JM2C 1NLBL 4ZO7A 5D7SL 2AV1B 1JIBA 2B59B 2WSDA 3MFGB 4PWFA 4EDWL 2Y6SC 1XIWA 4E9XA 3OJMB 1MAKA 3B2XA 1UOLA 4LLWA 5FGRA 1RZPA 3OQ3B 2ZCKL 2YUXA 4S1RH 5IQOA 1IAMA 4DVRL 1AGDB 2XWBA 3GSQA 3IXTA 2JTYA 4MSWA 2Q10A 2FTAA 5CIPH 2KHAA 3BAEL 1JRHI 4QTHB 4KK6D 4MNGE 3GMMB 5CJBA 1FNGB 1Q9OA 1OE2A 3CVCA 3WS3A 1OP9A 3VD9A 1ZOXA 4XMKL 3KPQA 3PDDA 4NUJB 5D1QA 2YMOA 5EDSA 3N5AA 2P7TA 1EZLA 3C5JA 3SD5A 3BDXA 2X41A 3FO2A 4MA8H 1GGYA 4R96B 5BV7H 2A2QT 4EI5D 2VXQH 5FM5O 4JG1L 1UWYA 2XICA 3SKMB 4X5RA 2CJTA 3ZMNA 4B27A 1E9PA 3EOYG 1OSPL 2XVBA 2Q6WA 1QHPA 1EO7A 2ZKXA 5FO7A 2K9FB 3RIAF 3DX6A 1UT9A 3PJSA 1YEDA 5DK2A 1I1AB 1OT2A 1RJZA 2YD4A 3CZGA 1ACZA 1FVCA 4GEIA 3L3GB 1L7IL 5GHWH 3WS3B 2IAMA 1R5IB 1JN6B 3BDBA 2E9IA 1AD9B 1QFUH 3IWUA 1FL3B 3EJZC 3KPPB 4JE4B 4O2FA 1H3WM 5IESL 2YD3A 4HBCL 3OAZH 2UXFA 3K5SA 4S1QL 2DLEA 5EU3B 1FIGH 1M7DB 2BRRH 4QRRB 4PU2A 3RWHB 4F9LA 3MA7B 3LPOA 4PRHB 4ZK8A 4C58B 3DX1A 2FBJL 4DQOH 3S88H 5IUSA 1UG9A 5F7AA 1LE5B 2XIDA 4KTYA 4Y2DA 4CN1A 4JPKL 4CSZA 1JYVA 2L7JA 1MUJB 1HS6A 3PXLA 1JDAA 2DQEL 3WFHB 4G43A 4O58L 5DDHB 2WXNA 1GOFA 3MRGA 4JPSA 1D5BB 3BZDA 3QUMA 4JAMA 3HW7A 3WYRA 4MQ7B 2Y06L 3VDBA 4ZTOH 1CTOA 2DQJH 1I8IA 2I9LA 1KYFA 2F9BT 3NJKA 2A4EA 4LESA 2F53A 2NX5D 2V17H 2WVUA 2X3AA 2ZSWA 1NSNL 3AY4C 3MACL 4JPWH 1NBZA 4WJ5B 4L18A 4QR7A 3FSZA 1WUZA 3PQYE 4NYLB 5IFAL 5CGTA 3ET9F 4WTZG 2IIJA 1ZGLA 1I1FB 1RZFH 5E51A 2DM2A 1KC5L 4X4ME 4OLUL 3MUY1 2WTPA 3FB5A 1VFAA 3P4MA 5BV7L 2R4SH 2V2WB 3T1FA 3HBPA 4AKPA 3VFPB 3ZO0A 4O9HL 2IDFA 4Z1PA 3M17B 3QWOA 4G71B 4NHUA 1U8PB 3ZE1F 2ESVD 4KRPB 1HEJC 4FNSA 4Q7DA 4WO4D 4PGEA 2IGTA 1AZUA 2XTJE 3OLDA 4L1BA 3ULVC 2E6QA 3TO4C 1YAIA 4MCNA 4ZJ9A 5CM1A 1HZKA 2R1YA 2ZSVB 5EO0A 5B4MD 1RMFH 1MNUL 4JLRA 3Q2LA 4PY8I 2CLVB 3V79C 3TU6A 5E2WH 3MR9B 1G9NL 1AQHA 4F7TB 2EDOA 3GPEA 5LCVL 2AP2A 4H8WL 3OJVC 1GJUA 1AYOA 1QLFB 1A6PA 2IALB 5FM4A 2VW7A 2D3VA 3FMGL 5EU7E 2OXGA 1BPVA 1TQCB 1CD0A 3EFOB 2HLAA 2X4QA 2UWEE 4KY2A 3CFUA 4CMHB 5BRZE 2CGRH 3B4NA 3IETA 2CNYA 2NT1A 3OKNB 4R4FH 4L4TA 3L17A 4U05A 4B53A 3KEHA 3KXFE 4TLKA 5I8KL 4LQ1A 1NMCB 2C5DC 3F7VB 3MBED 3U2JA 3KPLB 3VXOB 1MCWW 3IYLW 4G3YL 2FNBA 4GAJH 4TQHA 1JF5A 1NAMA 3GEFA 2FO4A 3WFHA 2DDQL 1XQ4A 3BXNA 2EVFA 5J11B 1IC7L 3P73B 2FGWH 3NRFA 1DLFL 2K45A 4M7LL 3D18B 3O11A 4QAWA 3CG8A 2X7LB 3VFRB 3OXSA 5A2CA 2NOYA 4V33A 4HV8A 4GNKB 4Z3EA 4ZW7A 5C7XH 3GNMH 4HKXA 1LO2H 2OMYB 4X7TA 1JXJA 1IEAB 1DVFC 4XP1L 5I6LA 2VISA 4MQTB 3DIVA 1YNLH 3W11C 4EAEA 1WGOA 2Z1KA 1Q9LB 2PTTB 3CFBA 2NY4B 3NIFF 3NIFB 4RWYH 4WO4B 1CBVH 3WG7B 1VADB 3V4PL 1BAFL 4DAGH 2UX7A 1WHPA 4Y9FA 1AGCA 4PGCB 1M9WA 2GI7A 3QAQA 3C5ZC 3F5WA 4QYOB 2QEJA 3ARBC 5EEUA 1TEFA 3BVNA 1CL7I 1PQZA 1FL5A 2RALA 4NT6B 5EUOE 5CGBA 2FLBT 3IMVA 1ZT4B 4NAMA 1MCPH 1TYRA 1NKRA 1UM5H 3L6FB 2WXLA 4PJCE 1HQ4B 5HVWA 1MI5D 4WFFD 1E6OL 2UYLA 3TH2T 1J1PL 1BEXA 3O3BA 1SY6H 2J1XA 3FPYA 1F8TL 3QULB 3NPSB 1GAFL 2RIKA 4NHCL 2OP4L 3KWUA 3I2CH 4OF8A 2BZDA 5IBTH 4OT1L 1XAKA 3ZHLA 2VLLA 3M7OA 1OHZA 1KJ2B 1F6AB 1IAOA 1QI4A 1PL3A 2R0KL 1IZJA 4XP9L 1RZ7L 1NEPA 2YKLL 4LCWE 4K5PA 4DK5A 3RL1B 3KH4A 5ICYA 4N2EA 2UVFA 3IFNH 1PG7X 4KJPD 4WI4A 3WE1A 4AG4L 3KPSE 3LH2H 1PY0A 3JUYA 1KTDB 4BYHA 4POUB 3DIFB 1L6ZA 3CVHH 4QTIH 5D93B 1NICA 3Q6FB 3FXIC 5ILTL 2BVQB 4ZUWB 3HBQA 4IU2B 4M7ZC 3S3CB 5I18H 2ITFA 1CLYH 1H6EA 3E38A 5E4EB 4YVNA 3FT2A 3BAEH 4PP2B 1FNEB 3GD1C 2YBGA 4DUWA 2JELH 2EDEA 1FFTB 3BH9B 5B39A 2B20A 5HYJB 4IBQA 3DHJA 4BKLA 3UC0L 1GVIA 2YAQA 2VJXA 3B1TA 1P5VB 4PJ5A 2F19H 4XP6L 2DJ4A 1M6UA 3TJEL 1KJVB 1TPXC 3Q44A 1E5CA 1OAQH 6CGTA 2ERJC 1S7XB 3KJ4B 3L2NA 1XH1A 1TF4A 1OAUL 3EYSL 2EE6A 5JOPD 1U6AH 4K7PL 4O51B 3QUZA 1N70A 4Y88A 5C0CB 2JMRA 5CFHA 3C08L 1WV7T 4AYDC 1CDBA 3T71A 2IQ9L 2ZP0T 4JCMA 1KFGA 1IGJB 4OZGA 2IVFC 1YMHA 4Q6IA 4IGBB 3MJWA 4HK3J 1U93A 2F7OA 1E9QA 1MZZA 1IKNC 2K70A 4NC1E 1UUSA 3K46A 4RRPG 3WAKA 2NXZB 1D3CA 4PR5B 4QCIA 4TRPL 3B9EA 4H8QA 5L9DH 4WW1B 5IW3A 3NZ8A 3LZRA 4GP4B 4HD5A 5J6SA 4JY4A 4BZ2H 4XNXH 1KYDA 2PR9A 5ICYB 1YPZE 4Z0BL 5MERA 2YR3A 4NKMA 1CJYA 3FRUA 4OM0L 3R0MA 3LTVA 5EFIA 2PXYC 4UMGA 2WM0A 4XOBA 1TMCB 2OMNA 4OF5A 5GGVL 4C83A 2CQVA 4P06A 1HK6A 4PJ7B 4QHUA 4XB8A 1MUJA 2ZUSA 4NQDE 5DD1L 4F7KA 4H0IA 5CZVL 1KB5L 1L9QA 5J0BA 2QZQA 3L4ZA 1H8LA 1K6QH 1YN6A 4JRFA 4OZ4B 2NY1B 1ZLDA 1BIIB 3G3LA 4CKQA 2CKBA 3MUGA 1J5HA 4WY7L 1RULH 5CILL 4TVPE 4NCC2 2DL9A 5ALBH 1NCUA 2G2RA 3C8KA 1MHEA 3MNZA 2IOOA 2BOCA 3DUUB 3HBZA 3QBTB 3ZE0B 2F08A 4H7VA 3PRZA 1T6WA 2WBJA 3W11D 3GSVB 4TLUA 4F7PB 2I24N 4IKJA 1LWRA 4M5SA 1U8CB 2YD6A 4K9EL 3TEZA 4TUJA 2Y72A 3OHXA 2XTJC 4EKXA 1PF3A 3DJ9A 1NCHA 5F96H 4TYUA 4XOEA 3LHPL 2C9UA 4PJ9C 4R0LA 4PJ8B 4DIXA 4NQEE 4J23A 1SGKA 2J2ZA 3EYUL 3N55A 1MCJA 2XG5B 2W0FB 4HFWA 3ZDZE 1FF5A 4IRJB 4JFOA 3T08A 5JPMC 4FFZL 5K9KA 2AEPL 4MSWB 1IAIH 1NZRA 2E47A 4PR5A 4NKDA 2VO5A 1BZOA 3BP7B 1UKSA 1AQDB 4U3HA 4ZODA 5BZWA 4NUGH 3UOAB 1T0MB 4YHML 2YN3A 3DUHA 12E8H 2JJTA 4L0PB 1DFXA 3RL2A 3L4YA 2IF7A 4F7CA 2V6HA 2DRUA 4KQ3H 5E4OA 1RZQA 3O4OB 3DVGA 2ZOLA 3O4OC 3IDNB 4EI5C 3TA3D 1Z9LA 3JV6B 4JFFD 5E2JA 2Z8WC 5D7KE 4YHNA 3KPLA 4JM2A 2EIZA 3SIKA 5EEXA 2AAAA 1E9OA 3APMA 3BD5A 2Q7AA 3JTTA 4HUUA 4PG2A 2DQCH 4LOEA 5DRWA 1U8MB 5BRZA 3I74A 2P26A 1FSKC 3KG5A 1O75A 3SKOA 1B2YA 2V17L 2W65B 2EACA 2ZXWB 1NCNA 4MJJA 5FYLE 5C0IB 1YYMH 5EU5B 5E0FA 1BBDH 4K9EH 3OR6A 3VJ6A 2XN9A 4IBTA 1ZSDA 1YEWA 2Q3ZA 2IPUK 5KJRH 4TN9A 4XPFL 5ACZB 1D5MA 5L4JA 1MCIA 4UOW1 1VFUA 2J6EA 4AVHA 4NO0B 1QW8A 2HLEB 3LS5L 4FQJL 3R8BB 4N8CH 5IQ9B 1A6VH 3ULSB 4KVNH 2CR3A 3E3QC 1FO0H 3FB7B 4GI8A 1TETH 2ADIB 2XA8H 3K2MC 2XZQH 3JWOH 4PGZA 4Q4EA 2QVKA 4UU9B 2ZJSL 1WS8A 4FJYA 4YSUA 5C0JA 4HMDA 1R5VB 2ZYIA 2MQ3A 1TVHA 4NNXA 1FG2B 1QX1A 5MEOB 3ZTCC 2WN3A 3RGHA 2WQ8A 1QOKA 5FO9B 5IFHL 2FAUA 4YHLH 1BYPA 4HSQA 4PW9A 3UP6A 4E9SA 5HHVL 4BDVB 1PLCA 3WL9B 4HIPA 1A1MB 2UYLB 3K8MA 4H5SB 5BOZG 5DEZA 5F7FA 1LP9E 1N5YH 1J10A 3L95B 2ADIA 1IM9A 1WFUA 3VSQA 4OLVH 5H94A 5LXGL 2WSPA 4MLIA 3N85H 2XCMC 4ZAKC 5ERWA 1MF2L 3DI3B 3DRQA 3BIKA 4JN1H 4N0RA 1U4EA 5IB5B 1J5OH 4B60A 3B7RL 2YOAA 3L4TA 4JGJA 3BJ91 3T3MF 3KWWA 5EC2A 2PABA 4TSBH 4HIIA 1N12A 2JKIS 4KJQC 4PJEB 3GKZA 3GLAA 5DJ0B 3RBSA 1GGUA 1O7SA 3UAJD 2PTVA 4NCC1 1XR8B 3ARFA 2ZUTA 3MFFB 1UZ8B 2QHRL 3BZ4B 1TITA 2FO8A 4JBSA 5JR1L 5DJCA 3MSPA 2VC2H 2FZ3B 1W8OA 3L45A 4FQLH 1AI1H 3W56A 2VYRE 1AG6A 1M56B 3OF6D 5BXFA 2OSLA 2ZCLH 5FW6A 2H3NA 5IEKB 5HI4C 4ODSH 1QO3A 1RSYA 2DQIH 2EXWC 4HKXB 2HLFC 4X7TB 5C07D 3V0IA 3JT0A 2OMUB 4HUNB 4R7XA 1F3JA 1NJ9A 1Q38A 3OZ9H 4XOCA 3EGSA 2WYZA 1OXYA 1XO8A 4CBPA 1P6WA 4PCKA 3TIEA 5GJSL 4FFWC 1II4E 1E28A 4X8GA 2BSSA 1TVBA 3BEVB 5LHDA 4AYGA 3GQFA 1BQLL 2G75A 2KZBA 5F96L 2CXKA 4JPQA 5F9AC 5GISH 4B7LA 2P5WD 4KKCC 5IROC 4OQTA 1B4JL 2V2TA 3BP5B 4JS7A 5CEYB 1CGSL 1DQVA 2HMIC 4GG6E 3TIDB 4C59B 2OX5A 3V0HA 4MCYA 4K8RD 3GDCA 1B4LA 2O6DA 2IH1B 4XVTH 2BVYA 3PWVB 3WSQL 5M95B 4NSKB 1U95B 3CPLB 3VRJA 2AABH 2D9QB 2W0FA 4FNRA 3KE0A 2VLJD 4FQXA 4K55A 1XGTB 3QH3A 4XR8C 1HAUA 2NMSA 1DZBA 4KJYB 1AS6A 4JO8A 4YSPA 1P1VA 3MV9D 2BOLA 4LCUA 2YJQA 3P11H 5GRYA 4ZMVA 2H0JA 1CF1A 3LKRA 3CHPA 2EH8H 4GIAA 3B9AA 1JVKA 4P3CH 3WLBB 3P69A 1BYOA 4ZG1A 2FEDD 4X6FA 1GGIH 2BY3A 3DX7A 3RVVD 3D05A 3U7WL 4L8BB 1S7UB 4HS3B 4LOUD 2Y2WA 1UQSA 1A3LH 4F5CA 4YNYB 4LPUA 2VLKD 2WQUA 4MNHB 1TTUA 5J06A 2IADA 1A0QH 1PW3A 4R97B 5EHFA 4AEIL 1ZLVK 3K72B 2VZ1A 4FD0A 1BX2B 5HY9B 4HZAA 1GPOL 2HA1A 3VTTA 2CO6B 5IB4A 4NO2B 5EUOB 4DKFH 5AW6B 4N0FA 2IBZX 5E5UB 3UYRH 3QUXA 2KI6A 3CMGA 4G8EA 4BEIA 5CZXC 3NK3A 1HH9A 5K9JH 4OF3A 4UWQB 5JXEC 4BSJA 1X9UA 3AWGA 5E8EA 5HPMA 5L2KB 4I1PA 4N8CL 2J8UA 3QXDA 3HKZA 4ZW8A 2IFFL 3TM6A 2QVMA 4K4KA 1AH1A 2EKSB 1KGXA 5DLMH 4E41B 4O5LH 1D6VH 1KY7A 1D7BA 1LEKB 1UCTA 2GG1A 3OL2A 4J12A 1AOHA 4GO8A 4IOIB 4NPYB 1CBVL 4CMMB 2CHDA 4MRCA 4H88H 1I9JH 1M9SA 5DUMH 4HIJB 1RY7B 3N3EA 3Q9QA 2ZX7A 1ETZB 2FECL 2P5WA 3IGKA 3D69A 4NUGL 4K94L