1AZNA

Crystal structure of the azurin mutant phe114ala from pseudomonas aeruginosa at 2.6 angstroms resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTAPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Structure of the azurin mutant Phe114Ala from Pseudomonas aeruginosa at 2.6 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport(copper binding)
total genus 24
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1994-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aznA00
3JTBA 1E5ZA 5I26A 1JOIA 2HZHA 1RKRA 5B7EA 3S8FB 1ZV2A 2RACA 1GS8A 3ZIYA 1OCZB 3QJSB 4YVUA 2X87A 3ABKB 2Q5BA 4FAAB 1ID2A 2ZWNA 2EIKB 2FNWA 3OMAB 1OE3A 1BYOA 3EH3B 3UABA 4CSPA 3CDZB 4HCIA 3FT0A 3X1FA 4A67A 3WG7B 2EINB 5D4JA 3WIAA 3WI9A 1A4CA 3KW8A 2I7OA 1HAWA 4GYBA 2W8CA 5FC9A 3ASNB 1AS7A 4KNSA 4W9ZA 2FJSA 2JFCA 1X9RA 3T9WA 4KO9A 1JXGA 2Q9OA 1IUZA 3IBOA 2ZXWB 3NSFA 2AZAA 3T6VA 1WA1X 4EF3A 1AZBA 4HIPA 1GSKA 3U25A 4RH4A 4KO6A 1SNRA 3ASOB 4N4YB 5EHFA 4HCGA 3UAAA 4A68A 2XX0A 5B1JC 2WO2B 2P80D 4BDVB 4AKOA 2GIMA 2GSMB 4HHWA 1TKWA 4YSRA 2CUAA 1JXDA 3GDCA 1JXFA 3H4FA 1BQKA 3OQRA 1JZIA 3EH4B 3IN2A 5PAZA 2XYBA 3AG3B 4E9XA 1OE2A 1A65A 2HXAA 4G70B 5I6MA 3JT2A 1J9QA 2FQFA 3CG8A 1HAUA 3SBPA 1ET7A 3AG4B 1NIAA 1JZFA 1XB6A 5B1JA 5IY5B 1X9UA 2YAHA 4P5RA 3NJLA 2DY2A 4YSUA 1JZHA 2HRHA 3FU7B 4G7RB 4ZK8A 2UXVA 1IBYA 5TK2A 4UF7C 3AY2A 2OJ1A 1AQ8A 3N55A 5I6PA 1NWOA 3GYRA 1QLEB 1CC3A 2IDQA 2IDFA 1AZRA 2AZUA 1L9QA 2FT6A 2YAEA 5I5MA 2YAFA 4G71B 2UX6A 5B1BB 3CVCA 4BK5C 1AZUA 1OV8A 2BP0B 4E9QA 3PAVA 3G5WA 4DPCX 3AG2B 1A8ZA 3NSDA 5B3SB 2XV3A 1M56B 2DYSB 1URIA 1V54B 3DIVA 4BWTA 1AR1B 2J5WA 5F7BA 3HEIB 2H5UA 1FA4A 4UANA 3FPXA 2CAKA 1GR7A 1J9RA 2BZCA 4DP8X 2OCCB 4KNTA 4N8UA 2BWIA 3NJNA 3H4HA 1E5YA 1L9PA 2A3TA 2XWZA 1W6LA 4E9TA 2PPDA 3QJUB 1JZGA 2PPAA 2IWFA 1HFUA 1ADWA 1AZNA 1CYWA 2LLNA 1SF3A 3CDZA 3RYMA 4A66A 4G72B 2PCFA 2YQBA 3DTUB 2HX7A 3QJTB 4UAHA 1J5CA 1WS7A 3BVDB 3AW5A 3X1EA 2WSDA 2PP9A 3FQYA 1CUOA 2J56A 4KNUA 2DYRB 3TASA 1ILSA 1BXAA 3ZDWA 3DKHA 1ETJA 5I28A 1AOZA 1ZIAA 2B3IA 4F2EA 2J55A 3NT0A 1XMEB 2UX7A 3CVBA 3T6ZA 1XB3A 2N0MA 2DV6A 2EIMB 3ABMB 9PCYA 2VW4A 3HB3B 3OD3A 3AZUA 3D12B 1I53A 3QQXA 1JZJA 1L9RA 2CJ3A 1AANA 2VW7A 5PCYA 3T6XA 4DPBX 3EH5B 1PNDA 3KW7A 2BP8B 3FSAA 4L0PB 4YSCA 1WA2X 4AKPA 1NDTA 1L9SA 2FT8A 4GP8B 1ZIBA 2CBPA 1E67A 1ET5A 1A4BA 4DP0X 2XVBA 2Y1AA 5D4IA 3UAEA 4K9JA 2GHZA 5I6NA 4KO5A 2XUWA 3WNIA 2QDVA 3WNJA 1AG0A 4KOCA 2TSAA 1E30A 1GY2A 2DWSA 2YAPA 4Q8BA 5ANHA 3PXLA 2HX8A 2I85A 2FWLB 2QDWA 2BW5A 5I6LA 1JERA 1W6WA 2FQDA 3FPYA 2UXGA 8PAZA 1QHQA 1GW0A 1JVOA 4ENZA 2UXTA 2XXFA 3SBQA 2DWTA 1NPJA 4YSEA 4AI7A 3NSCA 3PAZA 5D4HA 1SJMA 4DP6X 1W8EA 1SDDB 1UATA 2HX9A 1E65A 1PNCA 1WS8A 2IAAC 2YAQA 4AZUA 4F2FA 1ASQA 3ZX1A 1TU2A 4F7KA 1JZEA 1KDIA 4KO7A 4YSDA 1FWXA 3UGEA 2VSMB 1L9TA 2MRYA 3SBRA 4BWUA 4YSQA 1ASPA 3EF4A 2IH8A 2XLLA 2BHFA 3CZUB 1KBWA 2H3XC 3CVDA 1IKOP 2VW6A 3NJFA 3QJRB 2XX1A 2R7EA 1SHXA 1AACA 1NZRA 4A2DA 2EILB 4M4RB 2FTAA 2TSBA 2VMJA 4X4KA 1CYXA 1BYPA 2BW4A 2BWDA 4YSTA 2PPFA 1J9TA 1ZDQA 3TA4D 2PP7A 1MG2C 3X1NA 3X1BA 4GY4A 4DP9X 1ASOA 2AANA 2VM4A 4CSZA 5B7FA 1GS7A 3ERXA 3X2QB 1KYAA 4A2EA 3V9CA 1KBVA 3NJGA 4MFHA 3WKQA 1PLCA 1OCCB 4G7QB 4YSPA 2FT7A 2HRGA 1TEFA 1SFHA 2OV0A 2IDSA 1GS6X 2IH9A 4JHVA 6PAZA 1NIEA 3FSVA 3PLYA 1AAJA 3NYKA 2AVFA 2GB2A 2EIJB 3FS9A 5TK4A 2X88A 1PAZA 5B7MA 4DP2X 2B08A 3AG1B 3NJJA 2ZOOA 4GXFA 3FU8A 3T6WA 4AX3A 1PLBA 2GC7C 4YSSA 2UXFA 5E9NA 2FQGA 4FA7B 4E9RA 1ZDSA 4WTQA 2YAOA 2QPDB 2XXGA 1WA0X 2HLEB 1ILUA 4G7SB 2IWKA 1NTDA 2PLTA 3PAUA 4BXVA 2XU9A 2PP8A 3MX0B 4NB7A 4E9VA 2JKWA 3OM3B 4BWWA 4TXVB 4DP1X 4E9SA 3UADA 3N2JA 1QNIA 2IDTA 2QPEB 2I7SA 4BDVA 3OMIB 1MZZA 4JHUA 1OE1A 3S3BB 1NIFA 2BZ7A 4GP5B 1CURA 2ZONA 1AZCA 1PZBA 4P5SA 1SDDA 2BO0A 3IN0A 5B1KA 3L45A 2FQEA 1BXUA 1VLXA 1KDJA 1KGYE 4HAKA 1A3ZA 2H47C 3NJIA 2GC4C 1AS8A 1MG3C 1AS6A 2YAMA 1KCWA 2IDUA 3FYIB 5LDUA 2NRDA 3IE9A 3FU7A 4YSAA 2JXMA 3UACA 1OCOB 2VM3A 7PAZA 2CCWA 3T71A 1PF3A 1EZLA 2AFNA 2W88A 1OOWA 5I5IA 1GY1A 2WO3B 4E9YA 2IWEA 4JKNA 1BQRA 3BQVA 4GP4B 4QKTA 2YARA 1R1CA 3C75A 3QJVB 1GYCA 4AKQA 1DZ0A 1RZQA 2BP0A 1NICA 1L9OA 2PPEA 3QJQB 3ZBMA 3S3CB 2P80A 1PZAA 4YVNA 1MZYA 3QPKA 1J9SA 3PCYA 2GBAA 4BXSV 1MDAA 1B3IA 4DP5X 5I6KA 4HCFA 2QT6A 2Y69B 1N70A 4YL4A 3FQ1A 1SFDA 1V10A 4KOBA 1AIZA 4NERA 3ABLB 1WAEA 3FSWA 5AZUA 3V9EA 1M9WA 1PY0A 1SHWA 2CALA 1XB8A 1KV7A 1V55B 4QLWA 5A7EA 1NIDA 1ZPUA 4HALA 3NJHA 1BEXA 3FSZA 2E86A 3FYEB 4M3HA 1NINA 1PCSA 2XV0A 3OMNB 4PAZA 3SQRA 3NSYA 1NWPA 3TBCA 1F56A 4HZ1A 4NAJA 1SF5A 7PCYA 3X1GA 1NPNA 1OCRB 2VSKB 2VN3A 1AG6A 1RCYA 5B1AB 1IBZA 1YLBB 3FQ2A 3IEAA 1M57B 3S8GB 4YSOA 1DYZA 2PPCA 6PCYA 5I6OA 1JVLA 2GI0A 2PCYA 1NIBA 4A2FA 2YXVA 5F7AA 4W1TA 4WKXA 5I5JA 3EHBB 4A2HA 1IC0A 1N68A 3S3DB 4PCYA 3NP3A 4Q89A 1BQ5A 1TEGA 3NJMA 2BP8A 1KCBA 2MTAA 1A4AA 1ET8A 4DP4X 3FU9A 3PPSA 3GXUB 2R7EB 1EHKB 1PMYA 1J5DA 1FFTB 5AFAA 1BAWA 3TBBA 1PZCA 3TU6A 3NJKA 4E9WA 1OF0A 2J57A 4HHGA 1BXVA 5AKRA 3MBWB 4DPAX 3H56A 3ABGA 2XV2A 4A2GA 1PLAA 3WKPA 2YXWA 1T5KA 4DP7X 3NP4A 1RZPA
chains in the Genus database with same CATH superfamily
1E5ZA 2ZCKH 1DQLL 3PWUB 1HESA 4ZMYA 3FO9A 3BZEB 4WNJA 1XEUA 3ZTDC 1YMMD 3CQQA 1A14L 3N1GC 3VXSD 1L0PA 2FJHB 2WQSA 2MIZA 1B9ZA 3I75B 3GI9H 4HSAC 2AXGB 3VTTA 2F8OA 3WY1A 3O9WD 5JZ7D 3PYCA 4JJHA 2WO4A 3AS0A 2NYKA 1HSAB 3BP5A 3I2CL 4P59H 4Y8AA 2HTLD 4RFEB 3GMPA 1KN4L 5CINL 5L8KB 1U8QB 1RU9H 2BIHA 3BUTA 4BIKA 4L5FL 4KNSA 4W9ZA 3TTSA 4NQUA 2Z6FA 5CLWA 2Q6WB 3L9RA 2QSVA 1IC7L 1T1WA 1GC1L 1JXGA 2R29L 4JRYD 3D05A 3IFNL 5HYJE 3CFBA 4ZOEA 2AV7B 1WA1X 2RJMA 1RHHA 3ZSSA 1U8CB 1YEHL 2ZF9A 2F1EA 4EN3B 3S36H 5DK2B 4HWUA 4RH4A 5EU3A 2Y07L 4LF3B 4CDHA 4FQ2L 3B2MA 3FQTB 4G8IB 3QQDB 5AW2B 1OCWH 4K5OA 3BKJL 4A68A 1A4JB 1ML0A 3W38A 2HFGH 2A1WH 1USQA 3BH4A 3GS0A 3UZVA 1IQDB 4V11A 6FABL 1PVHA 2IANB 4MXVF 4KK6C 1CU4H 1E4XI 3VFGL 5FECB 1MHCA 4E41E 2BERA 5J6HA 1WBXB 1ETZA 4NQQA 2VDNL 2IPKB 3CD4A 4TUUA 4P2RD 4AQ8C 2OL3B 2I9TB 2G60H 5IFJB 4KUZH 4NRYB 4H1LA 5I1DA 3FFDB 5EOQL 3NA4A 4QXUL 5K69A 1J86A 4L0ZA 2Y6SD 3CV5A 2Q10A 1CI5A 4J4PC 4MJ5A 2AABH 3QNYA 4NQEA 3VRLF 1VERA 4RA3A 43CAB 3QUHA 4OLZL 5DFAA 5A2AA 2AZUA 4KPHH 4EKXA 5KVDH 2WXQA 2VDKB 1VKXB 1LWRA 2WTRA 1M7DA 2VLKD 4PUBL 2EXWD 3TFKC 3WE6A 3DJSA 2WLIA 1E4KA 5KBLA 4GRMA 3RP1A 2OSLB 4G9FA 5AW8B 5B3SB 3QIWC 1GYUA 4HJGB 2B5IC 1BQUA 4CGTA 5DJZA 3VVWA 3D39B 1WHPA 5I0WA 3O2VH 3ZE0B 4UANA 3HA0A 2CAKA 2K7PA 4UT7L 4H2CA 2AQ3A 2DL9A 3K46A 2Q86B 4KNTA 2BWIA 3HNTL 3O2DA 2XWZA 2PPDA 5C2UB 3BP7B 3M1OA 5HYSB 3T0DA 1DVXA 4PG9B 2YPKA 3QFJA 1PPIA 2E74C 3UTZA 3QUMB 2EYRA 2LLNA 3G04B 5IQNA 5E1AB 5TE7H 4K7PH 3X13A 5I15L 3OR6A 3QORA 4ODTL 1HL5A 5D1ZA 1R5WA 1JWMA 3CSTA 1PG7W 4K23L 5DJXB 4JDVA 2PXYD 1SJHA 2ZZUT 3ULSA 2NY6D 3VXMA 3TOPA 2ED7A 2XN9A 5FUZL 4EEEA 3C09C 2H41A 3DBSA 4ODWB 3BHBB 1IL1A 1X3DA 2DYRB 1BXAA 1K4DA 2QGEA 2EDMA 2GSGA 3IU4H 3HBPA 4OGQC 4XP9H 3U4EA 2CCLA 1A1MA 3F5WB 4F2EA 5CJ5A 4CILA 2V5RA 1RVFL 2QZ5A 4NKMB 2G5RA 1FFOA 3OF6D 2FAUA 4GQ9H 3ULUC 1A5FH 3CH8A 1T3FA 2PWEA 5L2KE 1AANA 5PCYA 1NAKL 4ANWA 4AGOA 4ELMA 1IAII 3R18A 5GGQH 4H0HB 4AKPA 1NDTA 4GKOA 4L8CA 4KK5D 4W81A 3BPOC 5CP7B 3KJ6H 5KVGH 4PJCE 5GSVA 1F3DJ 4M9OA 3ZTNL 4N26A 4DO4A 4MJ2A 4EIGB 3QEGL 4I18B 3ARDA 1C5CL 1OO2A 3M8OL 2GHZA 4FFWC 2NY4C 1HEZB 1A7QH 4H8PA 4PJGA 5BJTA 3QQ4B 2Y72A 2IMMA 5LLIC 1YYLL 3F65A 4YLBA 5E2WL 5A2IH 4XCFL 4XMZA 3LMJH 2XFGB 3EIFA 2RQEA 4XVUD 3IDJB 1Y18A 3FUEA 4L8SA 1RZGA 3X11B 3C5JA 5KZCB 4B60A 3N41B 3LZNA 4PJAE 3W9EA 3OAWA 4M5SA 3KGSA 4OZHE 5GZND 5GZOD 1OD7A 4FNQA 4MJ6A 4MJIE 4FA6A 5I1AB 1MAMH 2NXZC 1G9NH 1E0OB 4N2GA 1I8MA 1RV6X 3DPBB 1NCNA 4Z8FL 1WFUA 4UBDC 4FXKA 3EYOA 3OZ9H 3ZKMC 2XA8H 3HBQA 4L18A 1XR8A 5BRPA 5KS9E 3EJZD 2J1WA 3P4MB 1EXUA 2OK0H 3CZUB 3SE8H 3ARFB 3HFFA 1FBIL 5EA0H 2DQFB 5GJSL 3TCTA 2WB1A 4XBPA 1AACA 3QS2A 1XXFC 2D3LA 1JPST 4MRBA 1W8OA 3I9GH 2FTAA 3OKEB 1NM9A 1CFNA 2A6JB 2DQGL 3IDMB 4KROD 4LVOC 1GOFA 4R90L 3UBGA 4MWFB 3K6SA 2PP7A 3MREA 3RVWD 2VXUH 1SDAB 3BW9B 2WBXA 1CXHA 4BYHA 4WFFD 4PWEA 2VDOB 5AUMA 3QI9B 5T3XE 3RVXD 1Q1PA 1MCBA 3QZMA 4P3DA 3RWIA 2NX5A 1SBBA 4F7EB 1WQVT 4NN7C 3U0WH 5FM5M 2APBA 4CVZB 5KSAC 2O6FA 3RZCA 3QZWB 5L7XH 4ZUUB 5KBNC 2IH9A 1W0WA 4RGNE 3CC5B 5ADPH 3REWB 3QO1A 4YDLB 3CBKB 3ULUL 4IBVA 4IKJA 3WNNA 2VITB 1XF3B 4OGZA 3GHBH 25C8H 3QDHA 4MLIA 2WUCL 1SXSA 3IU3B 4IBQA 1S7RB 5I1IL 4ZAKD 2BMKA 1JF6A 4GRWH 4D9LH 3QPQD 1ZV9A 5IJKC 3T8MA 2GC7C 1I3RB 1WTGT 5KG9A 3IDIB 4EI6B 4OCSL 2NW2A 1ZDSA 2YAOA 3CMOH 1O9WA 2A74B 3ZRFC 4CAGA 2VL4A 2OMXB 1XZWA 1CDIA 2FIRT 4R7DA 3QHFH 4KXZH 5F1IB 4G7SB 1H3TA 3KZ8A 3QGVA 1JHKH 3Q5YA 2WXNA 3S4SG 3QC5X 1MWAH 2EYTA 4XNMB 3LVTA 1BVKA 4GAFB 4W9EC 4IRZL 4TXVB 3HNSL 2JJTC 3BWSA 3N2JA 3U48A 1S5IH 2QFRA 8FABB 3A22A 1INEH 1BX2B 5DO2C 1ZSDA 1WCQA 2XQBH 4XPBH 3S3BB 4P46A 2CSPA 3OAYK 4XN4A 4KJYA 4L3FA 2BZ7A 4R2GD 5TE4H 1SEBB 3KWWB 2FUTA 4S0HA 4Y16A 4TVPH 1KTDA 4WK2B 4JLRA 4R7VA 3T0VA 3BWAA 1BECA 1WT5C 3V6BR 2EKSB 3P2TA 1KGYE 2IGFH 2PCFB 4HWZA 4N8VB 5JXAL 3FT4B 4CBPA 5HYJD 1HI6A 3EHBC 5FM5O 2IDUA 2GVYA 2DH2A 4IRJD 3V9FA 4YSAA 3L2LA 1BQLL 3GSOA 3RVTD 2EDTA 2Z8WC 4JHAL 3WN6A 2BFVL 3N1FC 4A6YH 2J1XA 3GXPA 4U1SB 1DDHA 3P77B 1UB5B 4N0CD 4LKCB 5CF3A 2OMVB 2A9NL 3C75A 3PWPA 3MOBL 1EGJA 2HPOA 5DJ2A 3U1SH 1RZQA 2GTZA 4GH7B 2GIXA 3IDGA 4PJBE 4HF5L 2VUOA 2P80A 3S3CB 1SMAA 1DLFH 4E41D 3EO9H 4P57B 1NEZA 5ALCH 2HP4A 3QDMB 1TZ8A 3ENEA 3ZYIA 1VADB 2DKMA 1CK0L 5GZOA 3EG9B 3V9EA 1K9TA 5B8CA 1KYFA 4YE4H 1PY0A 2CDFB 1HWGB 4QRPE 3UO1H 3N85L 5DA0B 5TQ0H 2EVHA 2IPTL 3MV7B 4XC1L 3FYEB 1JRHL 4DK6A 1KMGA 4HGKC 1SF5A 3V6ZB 1I7ZB 4NHUA 4YNYB 5LN4A 1I3GL 4F9PA 4BINA 1EAJA 1UKSA 5JDJA 1GZHC 2UZIH 1CBJA 4IKIA 2NR6D 1I8IB 4FGMA 1PFCA 5I66A 2ZSVB 1KPRB 3MXVL 1F4WH 4UM8A 4P2OB 1JN6B 5GSRB 3S8GB 5DQ9A 3W0WE 4GKSB 1L0QA 1IGCH 1TUPA 1T04B 4EUPG 1VENA 1R4XA 2WPGA 1HJCA 3SYAA 3WIFA 3MLYH 3J27A 3BVVA 1UYWL 3G6DH 3FFCB 4L5FE 1DJXA 4LPXA 3DX7A 2H4EA 3D3VB 4ZW5A 3NIDB 4LOUC 3HHSB 4BZ2A 3LZFL 2ORBL 4LKXB 4PJHF 3APMA 5TE6L 2QBWA 1MFUA 2F58L 4JFTA 5DRXA 1JS4A 4JPSA 2BP8A 1KCBA 4PV8B 2VZOA 4G8EB 4KRMB 1AP2B 1BIIA 4XI5D 5F2FA 4LMQI 1ZHLA 5E6SB 2R7EB 1XAKA 3PIQB 3FHQA 3VFSA 4CN6A 2OYKA 3MRIB 4HAFA 1F02I 2ZQKA 1ZD6A 4JFYB 5H37A 1CE6B 1MELA 4LLUA 3EOAA 1HXMA 1L4IA 3LSOB 2V6HA 4ODBD 4JKWA 3LNDA 3Q8FA 4OLVL 5CIPH 1UEMA 3AXIA 1ID5I 5C1MB 1PLAA 1T5KA 4M6ML 4DP7X 4GMTL 1H3GA 5D2LB 3ESOA 3MCLL 3VW3L 1J5HA 4Z7VB 2DBLL 5E4IA 1V3JA 1Q0EA 3KG5A 3CLEH 1AIFA 3IJEA 4KFMA 5L2KD 5T3XH 4V1DA 4XN8A 3F05A 3ARBB 2WM0A 4HG4J 4KK9C 2ADJA 3ABKB 1AD9A 4KX7A 3FOLB 2N3JA 3TYGL 4QHMA 4TTDD 1P4BL 5F9DC 1DUZA 3V0IA 1XSOA 3CU1A 3FU3A 3HG5A 3HZKA 4UT9A 3FUJA 5ETUB 5FXCH 3VNYA 4ECNA 3FT0A 1RZ8B 1FNEA 2J20A 1T5XB 3CFMA 1E4XH 5C07B 3ATAA 1ZLDA 4GT0A 4JFFE 3DARA 4XMVA 4HSQA 1AS7A 1HKLH 4RIRB 1OB1B 2DQIH 2EUZA 4O02A 3ML9A 1QHOA 5MHSE 1JV2A 1MVFA 2IG2H 2ZXWB 1S7QB 3L3IB 1I75A 1QKZH 4UT6L 2G0KA 3JUZA 3ULVF 4E42B 2BM3A 4Q7DA 1JPEA 1KCKA 5DMKB 2FR4B 4UI2A 1JWUB 3GI8L 1G9MC 4HKBB 4PFEA 4FADA 4YBLC 3E6FA 4Y1SA 3EBIA 4FQXB 3HC0A 5EFIA 3STZA 2CKBH 3MA9H 4MJID 5AKVA 1AGDA 2CXGA 1LK2A 5AEAA 4YHZL 3TO4D 1PSKH 5CSGA 1DN0B 4FQCH 3ILPA 1JZIA 4G8GB 4XCYA 3ZQWA 3S98A 4PJFE 2VGLM 5JOFB 4BFGA 4WSKA 1RAMA 4OFKA 3MUHL 4QRUA 4APXA 5ID1B 3OB0K 3SSGA 1XHHA 1G7PA 3HUJE 4Z7OF 4UB0H 4DSYA 3U9UA 3F58H 1ET7A 2AJZA 3MV8A 4YLQT 4Z3JA 1QR4A 2MCG1 2OYPA 3GNML 4PJ9D 1X9UA 3EH2A 3T2PA 5TDOA 3N0PB 4P5RA 3KS0H 5BCAA 1WE5A 1JZHA 4LEEA 4PY8J 4YXLH 4ZK8A 5ICUA 1E7VA 2W07B 4G80B 3OAZK 4AC2A 1S9XA 3B9VA 2GK0B 2VMEA 3CN3A 3OX8A 4HQQL 2OMZA 1LTXA 1X5FA 1F58L 3DWTA 3GLZA 4TRPL 4FEMA 3F62A 5E4EC 3UTTB 4Z3IA 1WUNT 1DCEA 3I9IA 1KPVB 3N0AA 3N9GL 1PLGL 4O58H 4OGAC 4FL4C 4YR6B 1YY8B 3RGVA 5LWYL 3EGXA 3RAJL 4NKIL 1O7DC 1UFUA 1LO3H 1D5ZA 2HVKB 5JDSA 1IC5H 3EF7A 3ZXAC 5TTRA 4PIRF 3UTQB 4FFZH 2PW2B 5TJWK 3TNNB 3TIDB 4RGND 3FTGA 5E6UB 4ZJ9A 1N2RB 4YDKH 4KQ4L 3P9LA 5HGHB 1FG2A 3PXJA 2VMFA 4FLSA 1IGML 1XD0A 3SGDH 4E9TA 1HZLA 1O6SA 4WF7A 4KDVA 4AM0Q 4G3YL 2ZP9A 4L4JA 5EOCL 4CMHB 1IAIH 3RYMA 3KPRD 5HHMB 4OJYA 1DQLH 4HLJA 1NGWA 4S2SA 3CSGA 3N50A 4XAKE 3ZTJH 2BNQD 4GPVA 4K7FB 4QHKJ 5AVYB 1WS7A 5IF0B 5I8CA 5IVZB 3MJ9A 1J5CA 3L3OC 1J5OL 3DX0A 3MRMB 1A14H 2MQ3A 3FQYA 4OZGF 3PRZA 5HDOA 4FNRA 1RK0A 1DEEA 2WINB 3D4ZA 5I1LB 4IRSC 3U83A 2K9FB 3NCFB 4D7PA 2R1WB 2BPBA 3U46B 1N5AB 3DTXB 3T65B 2ITCB 2VN4A 2MOGA 3I2CH 4ZMQA 1JWSB 5DZ9A 5IQOA 3A4AA 3MCG1 1KTLB 5IVXF 1S7VB 1FZOB 5CFAA 3MU3A 4HUWA 1W72A 4GQPH 3ZT7A 1GZQA 2OXHB 1G9ML 4L5FH 5D7LA 1X5MA 5FYLL 1DBBL 3LPPA 3DK2A 3L3GA 2BY1A 5I16A 4F8QA 1GC1H 2R29H 3IFNH 1NCOA 3DURB 2EIDA 1BZQK 4WEBL 5AW6B 3ZT6A 5CJOL 2G2NA 4WHYH 2Q7YB 1YEHH 1OZTG 2VWEE 2G2PA 3POCA 4LCCC 1A0QH 2MWCA 4FQ2H 3HZMA 3QIUD 4ZO7A 4JFWA 3BKJH 2NNRA 5GISL 4WHTA 3ZRCC 4AIOA 4OZFB 5TGBB 4M43L 4LSSL 1YY9D 3QNZB 1CLZL 3WSQL 3EGDB 2MQ0A 3PP3H 4ANKA 2BW5A 4HBQA 3T0EB 1HEHC 1WD9A 4C55A 2VDLL 1BFVL 3S5LA 3GSUA 3E8UL 1A3RH 4LCWB 3SCMC 1T7VA 3O3EA 1IB5A 4LFHG 3SDAD 5JIQA 1KG0A 5CU5A 5EC1B 1IGTB 4EI5B 2BXZA 5FCUL 4FJYA 4GMSL 2OP4L 2GJ6B 2JWYA 4MNHA 3AU1A 4OQ1A 3MTXA 4QXUH 3Q2VA 4TNFA 2X2IA 5EOQH 4WJKB 5INCB 1F0LA 1AZVA 4NENA 5FA4A 2KMWA 1XR9B 1YEDB 4BWUA 4OM0L 1BEYL 4OLZH 4Z3HA 1QWUA 4R4BB 4LBAA 1UVQB 1QYGL 3UC0H 4F33B 4CL7A 3NSXA 3P30L 2BVPB 4HWNA 1M53A 4R83A 5T5FL 5JORB 4PUBH 2EDEA 1SLWA 1PEWA 1XIWC 3NJFA 4N22A 5JPMC 1RH8A 4HUVB 3LRSB 1W0YT 2FNBA 3HR6A 4ZMNA 2AQNA 3V0HA 3DTDA 4FQ1L 1RZKC 3U36B 2NW3A 1RZ7L 1CYXA 2H0PA 1J9TA 5BPPA 2DQCL 3MGOB 3IJSB 3W0WD 1Q9OA 2WCPA 3GSNB 1I4FA 2QVMA 3WD5L 2CK0L 4FNLL 4UT7H 3ZDXB 3NRFA 1CFQB 2Y7MA 2YGOA 3ZW3A 1IKFL 3ECVA 4FNSA 1Q72H 1BPLB 4RRPG 3B9KC 3L4ZA 1M7IA 2OYLA 4JPIB 4TQHA 2PTUA 3UBFA 2N7SA 1TEFA 1E6OH 1K4CA 2NT1A 4MSWA 2BNRD 2WQ8A 3NFPA 4DAGH 4IKNA 5I15H 1MFNA 4ODTH 4OQTH 1UWGL 3PLYA 1LO2H 3NQKA 4R6UA 2P7TA 3WUZA 4K23H 2DZEA 3MOAL 1W16A 3LCYA 3VWJD 5EEYA 3GMMA 4LLDB 3BMVA 3CPLA 4ZSOE 2FLMA 3NJJA 1KLFB 4HIJA 2NXYC 5EUOE 4ODUA 2PABA 4IGBD 1WV7T 2MMXA 3FOMB 4NQSA 1RVFH 4E9RA 2DQHH 4YK4C 4ADGA 5KYUB 1V05A 3NRQA 2X4TA 1GTFA 2DMKA 3CDGB 3MRRB 3TF7C 1Z9PA 4P9MH 4NZTL 5D93C 1NAKH 5KANI 1A6TA 1BD2B 1UXSA 2EP6A 1OTSC 1OQOA 3E2HB 4PBWD 4X5WB 1MCSA 2XWDA 4ZOAA 1HC1A 4NXSA 4R7LA 2BSBA 1XGTA 3FRPB 4OFQA 3WFDL 2ESVD 3KYMA 4PTTB 4CJ1A 1T1XA 3EW3B 3PUCA 1IGFH 5I18H 4G6KL 2PO6C 2NUTA 1OHQA 4QF1B 1OM9A 3PWNB 4CSSA 1AGEA 5KWYC 5GJTL 4M02A 3ZTNH 2G9HB 3F04A 4GKZA 3X14A 3HVNA 1BG1A 3MO1B 3QEGH 5DWUL 1TQBC 3MBXL 1C5CH 2ZKMX 2K0RA 3GJEA 3Q2CA 4KGLA 1OW0A 3O11B 4TNVF 2K7QA 2WIIB 2ZOUA 4WI4A 1NIFA 4YDIL 3TA3C 2VDQL 4M93B 3W39A 2WLJA 4ZUVB 3OHXC 1KCLA 1VFBB 5SWQB 2MQCA 1G5AA 4JFFD 3OKKA 1VLXA 4KK8D 3HN3A 3SPCA 1YN6A 1YYLH 4WUUB 2UY7B 5E2WH 1QA9A 4XCFH 5FS5A 1OP9A 2AMUA 2FO1A 3D50A 5K1JA 4KKQA 4CKVX 4HDIB 3FU7A 2OTUA 4K3GA 3TN0A 4K2UH 1LJMA 1YNLL 2BS8A 1U95A 3N42B 4OCMC 1AQMA 4WV1A 3VFOB 1H9DA 5IHUL 5JW4R 1VACB 2ALAA 4E9YA 4Z8FH 3KVPA 4L48A 4GIAA 3U4KA 4XVJL 4GP4B 1R1CA 3GM8A 2JKNA 1FFQA 3LQAH 2DTMH 3KWUA 4PJ8B 4G6AD 2NCMA 3K6IA 3OXSA 1VRSA 2KZWA 1FBIH 1VFAA 4LSUL 5LXGH 5FV1L 2CO4A 3D2UB 4PWKA 3MGTB 1NCJA 3OPUA 5KYYA 3IFOA 2ZUXA 3HS9A 1UZGA 3H6JA 4OFYA 3ABLB 2CG9X 3H6AA 1MHEA 2DQGH 1M9WA 4GUCA 4R90H 3AGVA 1FN4A 3FQXB 4G6JL 4XNUL 2B1OA 4KV5F 2DEXX 3CFQA 4EDWL 3TBCA 3NSYA 4JPQA 2GJJA 3D09A 4RNRA 5DLML 3TVMC 4AQOA 5L6YH 3OBAA 4PJ7B 4OF7A 1KTRL 2FRGP 1WYJA 1YNTF 4BH7A 1NUDA 1MCOL 4N2CA 4W68A 4UYPA 3WV0A 4B0MM 1NMBL 2VN3A 4RDQF 2M26A 4GAGL 3H8NA 4YSOA 2EDDA 1EHNA 4PJEE 4ACTA 3MMEB 4IK6A 2AK4A 1FE8L 3RGVD 5HHXL 4JFEA 4JHBA 2YXVA 4HMEA 2Z34A 3K72B 4S1DD 2WUCH 5I1IH 1P7KB 2MNWA 5E6IA 3ZPDA 3VJ6B 2BOLA 5GGSA 2CHDA 5A40E 4W6XB 3MFFB 2K3TA 4MNQE 4S10A 4H8WL 1SYSA 4EDXB 4OCSH 1T20A 3DO3A 3MRDB 4HFWB 4TVUA 5AYUL 1A4KA 4YEEA 3MRCB 4N1EA 1H3UA 3II3A 1X5HA 3QCUH 3MYJA 1CDGA 1QMUA 2BDNL 2Z8RA 4CC0A 4XR8C 3T0XA 1CGSL 1XCWA 3CN4A 4MD5B 3OGCB 5HDBF 3VM7A 2NY0D 4P9HL 4B3EA 1UA6L 4AYBA 1CO1A 2B4CL 1U93A 1M6OA 1MCRA 1PZCA 2UZYA 3HNSH 3G6AB 1OF0A 3QP3A 1DDTA 3ZDZE 4MS6A 4QRTA 1SXAA 3MBWB 1OP3H 1UASA 4ZRGA 1I3VA 1U91B 1VDGA 4PP1C 5D7IE 5IB1A 3VE0B 4F57L 2P9RA 3T4AB 2HVJA 3Q05A 3PHSA 2F2HA 4G6FD 3D1MC 3CFEB 3NABH 4RESB 4D0CA 1AY1H 4F91B 2LTQC 4KJQC 4YPGA 3VFWB 4YVUA 1AH1A 1AD0B 3AQZA 3GBML 4IIQB 4PJHA 3UZQA 3ZDYF 4AYSA 4TYUA 4GUOA 2ESVA 4WI6A 3UABA 3RL2B 2XBZA 5GS0L 2VC2L 5DCCA 1LXMA 1EDYA 2YJQA 3G9VA 4GAYA 1J88A 4AQEB 5I0VA 1A4CA 4JFDA 4JHAH 2CPUA 4HBCH 2BFVH 2F53D 3LB6D 3PWLA 4O4YH 2ENQA 4GYBA 2W8CA 2FHBA 4B95C 1T89A 2WYHA 4Q56A 5DGQA 3QZWG 3OKOB 4KTDL 3CVHB 4S1QL 4U2ZA 2FEEI 5CMAA 5BXFA 5CCKL 3VG0L 4ZX4A 4EIBA 3O3BB 4HLZG 4QHUA 4XZUA 5I30L 2OW7A 4HF5H 2R1XA 1DQTA 5F93C 3OXRB 3ILEA 5HSFA 5DD5L 2EIBA 4FFVD 5MP6H 2KUTA 2LV4A 3F83A 5G5DB 1BDYA 1HHIA 3ZTEA 1AC0A 1CK0H 1GXEA 3M17B 3K2UL 2D3NA 1TXKA 3G6JE 4Y4KD 4RFOL 2RGSA 2LHAA 2E9JA 5AW9B 3RWGB 4LNRA 2IPTH 4LHUA 2NSQA 4TL5A 1KFAH 4XC1H 4DOHB 3GB7A 4NWUL 1JRHH 5L0QC 3EZ8A 1YPZF 1TQSA 1I9JH 4PVNA 1XF2A 2FQFA 1HAUA 4MA3B 2D7OA 4XNXL 4ZS6C 2NQCA 3NK3A 3AJ7A 2CRIA 3MXVH 4CW1B 5E9DA 1LEKA 1H5BB 5JIHA 1DJIA 1E4KC 1HTYA 3VI4B 1BW8A 3QC6X 5TK2A 2UXVA 2Y25A 4PQXA 1M4KA 3GYRA 2Y7NA 2JCCA 5CD5D 1QBLL 2OMTA 1UYWH 2IDFA 5FYLE 2O6DA 2ARJQ 3TJHD 1J0IA 1Y6KR 2L7JA 2ORBH 1ZHKB 3LZFH 3K0WA 4OCRL 5D5MF 3LXCA 5TE6H 4J12A 3BRFA 4N8VG 2F58H 3ELQA 5C0DA 3QIBB 3F64A 3MJ8B 4Z7QF 2W95A 5DD6B 3K8LA 3B5HA 3UBHA 1BQHG 1UT2A 2WZAA 4CKQA 2DYSB 3T3MF 2OL3L 1LP9E 2V2XA 3HEIB 5D1ZC 3SKNB 2HFEB 1Q1JL 3S48A 4Y19B 3AMLA 5KJ4A 1UTDA 2CLZB 2BZCA 1GCYA 1ZTXE 2HFFA 4G1MA 4JQVA 1VFOA 3FO2B 1DZBA 1XX9C 1X6NA 3QJHA 3CFDB 4K8RC 1I7UA 3TGXA 4FZEL 5M95B 4MDJA 3W3BA 5AG9A 1RIHL 1KXQE 1S9VB 3VFVA 3D69B 1BOGB 4KC3B 3WBDA 1J0HA 2VDKL 3HFML 4IDJL 4M6MH 2APSA 2QQNL 4GMTH 2V2TB 4X7TB 3VW3H 4AJYV 2DBLH 1MFVA 4ZX6A 2GABA 3NMEA 4M1CC 1ZLWK 5EEUA 1ZT4A 1DO6A 5EU6B 3BVDB 5C0IB 2WJ5A 3N44B 3PDOB 1S3KL 5J13C 4GI8A 2YFOA 5GHWL 1TFPA 5AZEL 2FK9A 3TYGH 2D03L 3BD5A 4FKHA 3QDGE 1P4BH 2V3EA 4A7VA 3V0WL 1E9QA 3APDA 2ATPB 4WGWB 2DV6A 3ARDC 3FHEA 3ABMB 4JFUA 5JIMA 3HB3B 3AZUA 4HULB 2OTWB 2R0WL 1UZ6F 2BVQA 1JZJA 3EJRA 3APCA 2VW7A 4U7MA 2E7CA 2PR4L 2NUPA 2VZTA 1TVBA 5ERWA 4QWWC 4UIKL 3VSTA 2Z7WA 3QUML 5JNYA 5DZNA 1G1OA 2A0LD 1EJOH 5FKAB 4XNDA 2Z31B 3E6HB 3VGGA 1T7YA 2WKGA 3ZMNA 2WBWB 1ZWIB 3F00A 3DUHA 3HE7B 3AXHA 4NCC2 3VXTA 4UT6H 3LZLA 4HHAA 4X99B 1JNNL 1ORSB 2G2RA 3H1ZA 3GI8H 5EU4A 3W11C 4KO5A 1P6AB 1HH6A 1NEZG 1VCBC 4Y4HD 3G5YB 2TSAA 1GY2A 4OZGA 4YHZH 3EYVB 2GITB 2I85A 1NLBH 4OGYL 4R5VA 1E7UA 5F7KC 1YC7A 3QHZL 2UXGA 2YXFA 1R46A 4JNXA 3CIAA 1GW0A 1BVNP 2UXTA 4P48A 3F7YB 1XTMA 1T0NA 5IVXA 4LNVA 1GYAA 1HWHB 1XMWA 5KSBE 1N4XL 3F6JA 4F93B 3GNMH 4HS6B 4K07A 5LAPA 3V4VA 1ZGLP 1BVZA 1F8TL 3NUKA 2Z4TA 1P0SE 1TQWA 1YAIA 4BD4A 3K2MC 4XPAL 3UAJC 3KXFA 5IIEB 3WTYA 3KLKA 1X7QA 2F74A 3L5WB 4KTEH 3DPDA 3HI6L 2OSWA 1FWXA 4Y4KA 1EEYB 3VSVA 2BHUA 4HLEA 1KJVB 3C60B 2F5BH 2RIKA 2ZOLB 4GSQA 1DBMH 2Y2WA 4N2OA 2X9ZA 5DMYA 2XLLA 1O0VA 3MV9A 4RBPH 4MMXC 3ETSA 3N9GH 3MLZL 2WVVA 5LWYH 5FAAA 3GMNB 4NKIH 1CG9B 1U8PB 2FWUA 5ESQA 2VMJA 3NACL 5DK0A 5C7XH 1FH2A 2D4FA 4L3EE 2AKRB 4WDIA 2NPLX 5BZDB 1UWXK 3W1ZA 3II1A 4FMVA 4DP9X 3VWKB 5ISZB 1EAPA 1E43A 4FI7A 2EDJA 5DVMA 3MNVA 2FB4L 5E8NB 1IGMH 2N7AA 2V8LA 3RKDC 3TJEH 3V9CA 3VXPA 1IGYA 4G3YH 1PLCA 1G43A 2ODHA 5EOCH 4PCKA 5F1NA 3S0PA 3ARZA 1I7RB 2AI0H 2WMPA 3JVGC 5HVWA 3PF2A 4ANXA 5C9JA 3FB7A 3N1MC 2RR3A 2YUVA 1AHWA 5D7JA 1JPSL 1BBDH 1T1YA 1Q0XL 3NFSL 3CJJA 4IU3A 1BF8A 2OFQA 3D85D 3KS0J 3GIVA 2ZOTA 4C56E 5BV7B 4KKZA 2EIJB 2BSED 3FQWB 4I1RA 1J5OH 3Q3GA 3HCVB 3QQNA 3TBTB 3K71A 4OLXL 1EQWA 3T0AA 3QISA 4XX1G 4OM1H 5EUKA 3DOSB 1OGAE 2XJKA 4P4RB 3FU6A 2AW2A 2H2SD 4X4ME 2D73A 3DX8B 1B0IA 2VDOL 3EJSA 4P2QB 4TUOA 1UOKA 2CJUL 3ARGB 2X1PA 1F4YH 3D08A 5EDSA 3CIQA 4ZXBB 4XB7A 3SDCA 2R51A 1KC5L 3AM8A 4XTRD 4Y16C 1DBBH 5FYLH 4XXWC 3RL1B 3FT2B 4G2AA 4UDUA 3VI3B 4NO0D 5C0BD 3WTTA 3DMMD 4G7VL 2X4NB 4QO1A 1KIRB 4BXVA 4XX5A 2JKWA 4WEBH 4Y2DD 3UADA 2B9BA 3BN3B 5CJOH 2QPEB 1OT4A 4MVBD 4BFEA 1IBBA 2K6WA 5D2NA 5D7KD 1OE1A 4AVIA 1OAUL 2X4RB 3C6SA 2ZYRA 4GRWF 2IF7A 1C16B 1LD9B 1M2VB 1RIUL 2VR8A 1WWWX 4LSSH 4M43H 1ANUA 2BIPA 4MA1B 4P5SA 1CLZH 3HE6B 1D9KD 5AOJA 4RSVA 1ZTXH 4WU7A 4H26A 3C6LA 5D7EA 3KPQB 5JO5A 3V6FA 2NTSP 2CHNA 4HPHA 4HAKA 1OQXA 1ULVA 1FNAA 1BFVH 2V0AA 2VDLH 3IF1A 4OCYL 3E8UH 4N0UB 1HS6A 1LQBC 1F41A 3QXVA 5BRQA 1UZ8B 1ZLUK 4PJIB 1ZLSL 1TENA 4Z76B 3NIGE 1QFWM 3GUFA 1O5DT 3UACA 2VM3A 3FO9B 4GO6B 4DGYL 1U4EA 2Q3ZA 4GMSH 3IAPA 5IBLC 2OP4H 2W88A 5EPMA 1KBGH 1P4LB 5E5MB 4PGDA 4N2LA 3GSXA 4Z3TA 4MZ2A 5B8CC 3KLDA 4AM0B 3L3HB 3O6LH 1B2YA 3NOIA 4OM0H 1BEYH 3UPCA 3HJEA 2FEDC 2WVUA 4UOZA 3NFNA 1MRCL 4P23D 1QYGH 4F7TA 3GHEL 3P30H 3LH8A 3PJLA 1F6FB 5T5FH 2VCOA 2HTKC 4HKZA 5DD0L 3QDJD 4NKQB 2O5ZH 1SPDA 2WBKA 3B56A 3QUZA 4F8OA 4MBOA 1CF1A 4FQ1H 1RZ7H 2XTJC 3IS0X 5C6WH 1FGNL 5JW4Q 3CSYA 5CGTA 4POYA 2L04A 2DQCH 1QEWA 1T1WB 3PHOB 1XB8A 5JHDE 4S1SL 3PV6B 2CK0H 4FNLH 3RBSA 1T83A 3PL6A 3RHWF 1DQJB 1RHHB 1ZPUA 4ANUA 4MGXA 3QCTL 2KT6A 3BZ4A 1IKFH 4FFYA 4ALAC 1WH0A 4U1JB 2JK5A 1X7TA 4P5MB 1E4HA 5D1ZI 3UTSE 4ZZFA 2JKLA 3MBED 5L2JB 3LKPB 4QD2E 4XN9A 5DVNA 2IH3A 3IDYB 1DLHA 4JY5L 4NM8L 4GKLA 3PAYA 4UOW1 4XBEL 1KUMA 5SWSE 2R1YB 3UYPB 3BZ5A 1FO0B 3MR9A 4MB5A 1MHCB 2JI1A 3MOAH 4Z23A 4OZFG 1DQVA 4KRPC 2DQMA 2AEQL 1OPGL 3SJVB 1R0AL 1UH3A 2B20A 3DSFL 2EXSA 3T1FB 1C7TA 2CO7B 4PCYA 1AE6L 4PN6A 2ERJB 4OLUL 1N8OE 2WANA 3HMXL 2OLDA 4M8QB 5AKTA 4PJ6A 4DHLA 1RJCA 1DVQA 3QNYB 4DP4X 5D96B 2BH0A 4NZTH 1CI3M 3W81A 5MEPA 4LL9A 4FABL 1TT6A 5C0AA 5I1GH 1M7DB 4TNWF 3WFDH 2YKKA 3OB8A 5C0GA 2P8PB 1EJ6A 3GXDA 2OMBA 5GJTH 1QSEB 2WLIB 1XO8A 1V8HA 4UINL 2JF1A 3WEXB 2H1PL 3K1KC 3P02A 4Y0GA 3QDGD 3LYRA 4G9FB 5DWUH 3MBXH 5LAXB 2AXFA 5T8IA 4GG6A 4N0YL 4AV5A 2P5ED 5DJZB 3WY3A 4AGNA 5LXVA 4YDIH 1P7QD 3WGUB 2VDQH 4NP4H 3VRJA 1ZLVK 2Y4SA 1J8HA 4FTVA 4RVBA 4IU2A 4PMFA 4YXKL 2NZ1A 1GS8A 5GGRA 4MCZA 4U1MB 1S7SB 1IO4C 5EO0B 3QQ9D 1XD1A 4LCYA 4PWIA 4U1NA 4EE2A 3ECQA 3QFJB 2FNWA 3WHXA 1OANA 2EYRB 4KY1L 4Y2DA 3ZRSA 3QORB 3HR5B 4A67A 5IR1A 1D6EA 2YUZA 3NA9L 1OAJA 3I02B 2IAMD 1ITBB 1JWMB 1YNLH 4LP5A 3WI9A 4HJ1A 4JDVB 2G4EA 1RLBA 4ZMVA 1SJHB 3ULSB 2YS4A 5IHUH 3CU7A 3VXMB 2WYTA 4MDIB 4XCNB 4EOWL 1G9EA 4A63A 2FJSA 3QWRD 5E7FA 3OKNB 3UAFA 4MTMA 4ZUWA 4XNQA 4OFDA 1A1MB 4JFOA 3QR1A 2AZAA 4W6YB 2WXKA 2C7UB 4IKKA 4ZO8A 1NQBA 5HGAA 3L2NA 4ZI8A 3U25A 1T3FB 2QMJA 5CEZL 2Z8SA 2IEPA 5E70A 2WLLB 5K93A 1DL7L 3VG9B 4Z7QB 1WEJH 5AVZB 3SYQA 4L8CB 4NQVB 2HKHL 1MJ8L 1YMMB 3IGUA 2YC1A 5CGYD 4PHZA 3VXSB 3FUHA 4G6JH 4MNGB 3BJ91 4XNUH 5DUJA 5GSVB 3V2AR 3WENA 3EH4B 5D7SL 4NQDA 1XSJA 3IN2A 1ADQA 4E9XA 1AGBB 1J9QA 5DLMH 4RWYL 4N0FA 4P23A 4U0QB 3O9WB 1XWVA 2W5PA 1AZZC 3BISA 3U6RA 1T7ZA 1OTUC 4FG6D 2XDHA 1MCOH 3D39E 4PJGB 1NMBH 3QDJA 5BJTB 4GAGH 3D25A 1G7IB 2YRPA 3J07A 3ULAB 5IB3A 5I76A 4HCRA 4ZOBA 1N10A 4G7RB 2XSKA 2VLJE 1FE8H 2OJ1A 2VRAA 2H8PA 5HHXH 2BIQA 2OTPA 1CC3A 4JRYB 3MRNA 3S3SA 3KYNB 1Y18B 1TTBA 4L8SB 4Z7WB 1RZGB 3C5JB 3RPBA 2GSIB 2OX5A 1FORL 4XNAA 2BHYA 3FQNA 4H8WH 2P5WA 1SRDA 3L7FA 2CDEB 4U3HA 3V4LA 1OTTC 4X6CE 5AYUH 1M71B 3DK0A 5T5NG 4JM2F 4FXKB 3SBWA 3L08A 4OF5A 1DQKA 3STLB 1M56B 2BDNH 1CGSH 4KQ3L 1IEHA 2WNWA 3B7YA 1FA4A 1UJ3A 4C56D 1YPZA 4J28A 4P9HH 1UA6H 2QKIA 4ZMOA 2B4CH 3AGWA 4NT6A 5FGRA 1NAMH 5DJ0B 3Q5OA 1NCAL 3A67L 2BSCA 4IBTA 1OGAD 2F15A 3P73A 4P2RB 5D1XD 1UCTA 2WLHA 3KDMA 1NL0L 2QLVB 1HFUA 3LIZA 1P2CA 1U8KA 4QAWA 1AZNA 4NI6A 4F57H 4DUWA 3FN0L 3OJDA 4WNSA 1QWNA 3ZN6A 3IVKB 1OK8A 1W9XA 3WFCH 2FECL 2CMRH 4H7VA 4R97C 1XGRB 4K9EL 4PRNA 4DFIA 1COBA 5DVOA 2KPWA 2NY2C 2YEQA 4P3DB 2BNUB 3RWIB 3U1PA 1HH9A 1AQDB 1MVUA 3L54A 3WDIA 3GBMH 1E9OA 1ILSA 3ZDWA 4HKXB 3ARED 3RZCB 1DJYA 3H0TA 5GS0H 2VC2H 3DV4B 3D4GA 4E5XA 1F3JB 4XMKL 2YSSA 5E95B 2UX7A 3UJIL 4Z77A 5F88A 4R3SA 1X5JA 1QR1A 1FNFA 4RQQB 5F7DB 4AEHH 3KYOA 5T1LD 3RB5A 3CUPA 1IFHL 3FO0L 3VXRE 2P5EA 3D0VB 5IJCC 2R2HA 1P7QA 3FULA 3ZHNA 5E9AA 1TQTA 3RI5K 4D9QE 1PNDA 1BQSA 3FSAA 4S1QH 4E36A 2VR3A 3VG0H 5IROC 4JANB 5DEJA 3T8XA 2J88L 5I30H 4P06A 5DJ8A 1A6UL 1NC2A 2VAAA 4MD0A 5FFOA 1PDKA 5CN2A 1KB5B 3PWVB 5DD5H 2PYFB 4FE9A 1FNGB 4I3RL 3WNLA 1JGEB 4UQ3B 2JIXA 2Y1ZA 4LPVA 3L3JA 1HINH 1OAZL 3FB6B 1KY7A 5CZXC 2QDVA 3FQ4A 5ACZA 3K2UH 5IFHH 2DQDL 3ATFA 4RFOH 1LO4L 3CFTA 4LEOA 2PXYB 2ZG1A 5E00A 5ANHA 2NY6B 4HJUA 2C7FA 3OR7A 5G2NA 2OZ4A 2DM4A 1S4IA 4AMWA 5HGBB 1PX3A 4POZC 2Y5TB 2VMDA 1ZSDB 3VDBA 4ONFL 8PAZA 3M1BA 2DM7A 2KERA 1ZA6B 1QHQA 2LAAA 4P46B 3V5DA 4JRWA 2R39A 4N5EC 1IM9A 4Z0XB 1FFPB 3D52A 4PG2C 3PE9A 4XNXH 2XOTA 3PQYE 1Q9LA 2R0KL 3TP4A 1HHGB 5D4HA 4TQPA 5F0PB 2YAQA 4NLHA 4X7SL 3QA3B 3MLTA 3ZX1A 3PS6A 4AG4L 5DJDA 4KGJA 5GGVY 5GRWA 3UP6A 4J3OG 1FG9C 3VQ1C 3SDXF 4P4KD 4OJAA 1L9TA 1HI6B 1QBLH 1M7XA 2BLFA 2DWXA 5DUPL 2BHFA 1AQHA 4TSBL 1QSFA 1ZK9A 1T21B 1DSWA 3KGTA 3FAXA 4Y7MA 5ACLA 4TL4A 4S0SD 5ABZA 4Z7IA 3HG4A 3A4FA 5ICXA 4AWJC 1PX4A 2FVNA 5HHNB 5FYJE 5DYOA 2TSBA 1M05A 5GGSY 3O0RL 1XF5B 2WTPA 3EOYG 3RTQD 1KF9B 2OL3H 4NC0B 3IDGB 1Q1JH 5LO7A 4IMLA 2AJVL 1AGFB 2X70A 3VFNA 4JDZB 4ZMLA 3OLDA 1IC4L 3RIFK 4DFHA 5E24E 1OY3B 5DRWA 1LE5A 1A6PA 4XC3H 2FJFA 4X6FB 2VDKH 3HFMH 4FDWA 2QQNH 4N8PA 4ES8A 3PUUA 2YQGA 1K8IB 4JREC 5I82A 5CCGE 5JW3L 1RPUA 1A22B 3GSRA 2VSDA 4UQCA 3TNMA 3QUXA 3GSVB 1NPUA 5DZPA 3NCBB 4AEFA 1U6AL 3JV4A 1S3KH 4GAJL 4R5TA 3MROA 1U8HB 1IIKA 5GHWH 3IDXL 1EH9A 5AZEH 1XCQA 3WJMA 5J57B 2D03H 3D0AA 5CGBA 3QXTA 3GSNL 4UM8B 5IK3A 3V0WH 5I1CL 4RMTA 5J6SA 3WXWL 3FCSA 4TV3A 1Z9OA 5D1XA 2QPDB 4DNLA 3IJ9A 1FJ1B 3QHTC 4JO4L 4MCYB 2R0WH 4KROB 5B38A 4IBYA 2X5PA 4I87A 3WIFB 1CL7H 3LH2L 2PR4H 3DUUA 3Q0HA 4D8PB 3QWOB 3ZIMA 4UIKH 1AFVL 1QTPA 4F8LA 3QUMH 3NGBC 3TCLA 2FECI 1FYTA 3L3KA 2DLFH 4MASA 5EOTA 2PP8A 3HAEG 3H3BC 2R0LH 3FO1A 4XP5L 1GVIA 2IXQA 3MRKA 2NLJA 1WC7B 1OAXH 1BIIB 3OMIB 4PTUB 5J9PB 2DLHA 1ZHLB 1JNNH 4J6IA 1WVZA 3BPLC 4AL8L 1I1AD 1KGWA 4LRIA 5DC2A 3EJUA 3VFSB 2ZX5A 3BSGA 1OAQL 2FSEB 3EJTA 3H54A 4WV1C 1DFXA 3IN0A 1KBBA 4P2YA 4JGNA 2DLGA 4XGZB 4JQIA 4NNPH 4OI7A 4OGYH 4PLJC 3QDME 3B3IA 4ZAKB 3O6FD 4PD4J 2R56L 4OZIF 1P84J 4LDCA 2ZCHL 4LHUG 4NYLA 2L7UA 1N4XH 2JXMA 2LOEA 5FGCB 3VH8B 1I1CA 1AIFB 3IJEB 4NRZA 3HHRB 1F8TH 1NBQA 3QUKA 4WTZA 5FWRA 3SE6A 1R3LA 3LAFA 4XPAH 4N8CH 2J43A 4RMQA 4YBQC 3T5WA 2RHEA 5IEKB 2WHVA 2EVGA 3HI6H 1BQRA 43C9A 4GRLA 2GAZA 4QHMB 4X6BA 1TQVA 2G75B 3D33A 7FABL 3HZKB 4AUYA 1CJYA 1DZ0A 1NICA 5DD1L 1L9OA 2PPEA 1FNEB 3H2QA 4HWBA 4JHZA 4ZODA 5D6CB 3IFLH 2IOMA 3MLZH 2CLVA 3VXNA 1A2YB 4RLDA 4F37F 4ENEC 1N70A 4PB9L 3WN5A 1F1DA 1V10A 4U1IA 1L0XA 1AHKA 3NACH 3V4PL 5CHNA 3D3VE 4J3OC 5ENWA 5E8EA 2JB6B 1JV2B 5KTEL 3NPSB 4M4PA 1RZIA 4PRIA 3RPIA 5FKPA 3LEXA 3BDYL 2VLJD 3G5XB 5INDA 3HIZA 1KYOJ 1E27A 5HYJB 1Q90A 1VCAA 1GZPA 4NGHH 3V0AC 2FB4H 4L4VA 1FL6A 3OB0H 2FEJA 3ZOAA 5E6IC 4UAOC 3FU5A 3E6FB 1YMHB 4ODSL 4MRCA 2F1AA 3HC0B 3DLQR 2QV4A 1U8LA 2VSKB 4RMUA 5CEYA 1F90L 3DO4A 3ILPB 1VESA 4L1HA 1JPSH 5DSCA 3EJQA 1Q0XH 1IC1A 1BSIA 5DFWH 2YD0A 5JIKA 4Q58C 1NIBA 3RTQA 4YHYB 4QRUB 5DJAA 1G7PB 1RULL 3GXTA 2YOAA 4OLXH 3MV8B 4WKXA 2AJZB 4Y2OB 5D6DA 4AYFA 1BFSA 2H1LM 4IS6B 4KJWC 4U6VL 2AS5M 2WVSA 2X28A 5TDOB 3IFPA 3PNRB 2A9BA 2E5EA 4JR9L 1MNUL 4AY0A 1TEGA 5BQ7A 1KIQA 1NCCL 2LLLA 2VDOH 4R4NC 2AK1L 2X42A 3QRGL 5EF0A 1R3IH 3IPEA 5AVTB 1DVZA 1MW0A 3KL0A 1NFDE 3OX8B 1T66C 1NMCB 1NLDL 1E4WL 4L8BA 1NGQL 4U1HA 5C71A 4A6YA 1WBYA 1Y1UA 3D8MA 4G7VH 1DBKL 2ZXQA 1LK3L 4LAQL 2WOYA 4LP4A 5DK3A 5LBSH 1HCFX 1P9MA 2D3VA 1UT9A 3EGXB 5C07E 1NBVL 5KVFL 3ULUF 3DA0A 3S35X 3FUFA 2TAAA 4P5KA 1QVOA 1OAUH 2YXWA 5EOCJ 1ZVNA 2KLRA 3JTBA 5I75C 1RJZA 1C5DA 1RIUH 4UU9A 2BJML 4L05A 2IBZY 4C4KT 1IAOA 3VXRD 3P9LB 2Y36L 2R69L 3VO0A 3SYCA 4D9QD 1T89C 1OCZB 1OHZA 2ITFA 2ZJSH 3W2DL 1A6AA 2IALA 3QXDA 4AQ1A 4BE5A 1IBHA 5JW4N 4QGTA 4NQXA 2NSXA 2J21A 4KI5E 1HNGA 1HWWA 1E8ZA 2XIIA 1GA2A 1ZEAL 2PCPA 1ZLSH 4QRRD 4O2CA 2CBOA 4FTDA 4ZFFA 4G8GE 4QJ4B 3U4BL 5I8CB 1X5LA 5CEXB 3B7UX 3OPZL 1INQA 4PREA 1I1AA 3O81A 4LRNL 2F8IA 4K0OA 5T3ZL 5IHZA 2XPZA 3ARQA 4PLKD 1RK0B 3DVNA 3DSNB 3T9WA 4L1DA 3H42H 4WWOA 4Q52A 4NM4L 3VX1A 2DIJA 3GHEH 3NSFA 4XXCA 4MMZC 1PY9A 2Z7ZA 4QIRA 3R8QA 1WP6A 1R34A 2ITDB 3FHAA 5DD0H 3BZFA 2VZUA 3RURA 4HUWB 1EEQA 1KCUL 2E9IA 1D5MA 4PRBB 4N4YB 4OZHA 3PQYD 2FL5A 2I69A 1M1SA 4YDNA 2XX0A 1IEAB 3CXFA 3F01A 1S7UA 1FGNH 5BS0A 5F7UA 5I16B 5L2KB 4OFPA 5C0CD 5IG7A 1Z9NA 1QLRB 1BQKA 4S1SH 1N8ZB 3F6LA 1NGXB 1ZOXA 5JA9A 2A73B 5D72L 4TUJB 4JL1A 5EWIL 4DKAA 5L88L 3ESMA 1QBML 5H4YA 3SDDD 3CVHL 3HZMB 1IJNA 4HOMA 3ULVC 4P5TA 5D70L 5K9OA 3KGRA 1JF1A 1SHMA 1INDL 2VH5H 4B5ZA 2XWCA 3C5SB 5IY5B 4JY5H 2K9UA 4NM8H 5B3NA 4Y4FA 4HPYH 4XBEH 5CIPA 2W81C 4L8DA 5FYJD 3ETBJ 2DS4A 2HRHA 3KCPA 4RMSA 3W57A 4L0YA 4ZG1A 2IQ9H 3E7JA 4X4XA 2Z1PA 3GSUB 3QUGA 3S5LB 2XPGA 5FOBA 1TTUA 2HJKB 3NQIA 3O3EB 2JKIS 3QNFA 1F4AA 1R0AH 4TNEA 1ZT1B 4NQCE 4I3SL 2YAEA 3JUYA 1KG0B 2P48B 4PJDF 5HHME 3FQRA 3RJDA 5F3BA 4JQVC 4ZPVA 1QO3A 4HIXL 5T1KA 1VSCA 3R4RA 4I3GA 1ZA3A 5GRUH 3HMXH 5J56B 4E9QA 3I9PA 4OCLC 1A8ZA 1UADC 3MLUL 4MJIB 2GY5A 1RD6A 5F1KC 1ND0A 2EEAA 3TO4B 1YUKB 1URIA 1GHFL 5ICYB 2J5WA 4FABH 2IH1B 3PJNA 2ZWSA 3B2UD 2XCMC 1G7HA 1R47A 2JV6A 3AY4A 4Z7UE 4QRFA 2Q8AL 3DGDA 4YWGH 1QTSA 5M7QA 1XSKA 4OD2A 4H20L 3QZPA 3QQ3B 2B2XL 3DHJA 2GEQA 4QHLA 4TQIA 4FHKA 2NW3B 3LKOA 4N0YH 5FYKD 1B4LA 4PJ9B 4IHBA 4M8VA 4PEEA 2EZ0D 5IMKA 5F1OB 1AOHA 2ZAIA 1FL3A 1KJ2B 1XBDA 2BVOA 1IM3D 4YXKH 1RUML 4X0KA 4TS6A 1H15B 3EO0A 2V9RA 1UEYA 5HI3D 2YMXL 2VB5A 3QUYD 2IQAB 4WQOA 5JHLA 1OXYA 4PJ5D 5TF0A 2UVEA 4D3CL 1TTRA 4L29A 2VQ1B 4MSWB 3LY6A 4KY1H 3NFPB 3WHE0 3LDBB 3INOA 4JM2A 2DEWX 3OTTA 1IIIA 2LU3A 3NA9H 4KMTL 4MYPA 4JRXA 3RWHB 2J6EA 3B9DA 1FZMA 4KKLD 3T0EE 1TSHA 4X6EA 1ORQA 4DPBX 3CPLB 4M00A 4WSGA 4AV0A 4LCWE 4EOWH 1MUJA 3BCDA 4LIQL 3CC1A 3CTTA 1MN4A 4UTCA 2GBVA 1R19A 3Q8BA 4YHOL 3S37X 3S6CA 4L4TA 5EORH 3QDMD 3MLPA 1E67A 5ECGA 2ZKXA 2C1OA 1U8NB 3MPCA 1BWWA 2BSRB 2I26N 2JCWA 4HISA 4QRSA 4OCXL 3WYRA 4QXTA 4H40A 3G08A 5CEZH 5C0JA 3KPRB 1SZNA 1UXSB 5ANMB 1DL7H 5I6NA 5LGHL 4QRRA 3HS0A 4F9LA 5L4JA 1HNYA 2BNQB 3KYMB 3OAUL 1T1XB 2HKHH 1MJ8H 2E7MA 5F3HA 3PXLA 2NUTB 3P4OA 4BKTC 2JQMA 1BM7A 1CTNA 1AGEB 2C4XA 3OC5A 3O4OB 2J8OA 3DBXB 4FFZA 4GKZB 3X14B 5A6LA 2F1BA 4RWYH 3JZYA 1R5VB 2HKFL 2WWOA 3FZUC 1JVOA 5HHQA 3OG6B 5BOZG 4JKPH 1BZ7A 4Z0BL 5F0JB 5ES4B 1MFEL 2VLRE 2HT4D 1Y0LA 5BVJA 3VD2A 1O5PA 1WFJA 1W8EA 2VRKA 4IW4C 1WS8A 1NGZB 2CKNA 2C1PB 2WBJA 2ICWB 3ZDXE 1EXHA 3H3PL 5GS1A 4OSUL 3Q8AA 4D9RE 3QZBA 2GTQA 1JXJA 3GZKA 5DEGB 2PMZA 5B39B 5EV7A 2HN7A 2O61A 2XWTB 1LMKA 2OTUB 1BFOA 1CXKA 1EAOA 3HC4L 2ZWZA 1JMXA 2WZPD 3TN0B 3CFUA 4I4WA 2XKNA 4ZX5A 3CZKA 2XX1A 3SDDA 3QIUB 1SUJA 3FK3A 2FX7H 1QFWH 1TVDA 2EEFA 4UQ2A 4YSTA 1CFSA 3IGFA 4CVUA 3KMDA 3D48R 4KQ3H 4WI3A 1MCWW 5D7JC 1KNOB 3X1NA 4EZKA 2X53A 3OXSB 2ICEC 1VFAB 3BUDA 2ZCLH 2VM4A 3BIBX 5F9WC 5IM7A 3BAEL 4J4PD 1NCAH 3A67H 3IFOB 4LLYA 3SDAB 1SYVA 2P49B 2R29A 4ERSL 4YMPA 1MFCH 1NL0H 1TITA 1BD2E 4CRPA 4NDMB 2J2ZA 4XZ4A 3FN0H 1EEUA 1FN4B 2OXGB 4J3BA 2XG5A 2GTWA 4K9EH 3NYKA 2ATKA 3L1EA 3B5GA 1MF2L 3ATEA 2F5AL 3GIZL 4HIHA 5TK4A 4QCIA 3DJ9A 3MLSL 3QIWD 4W9IC 3RDTA 3V5HA 3VTAA 3BEVA 3OKLA 1HIML 5C0NC 3UIYA 2HT2C 4XMKH 4YSSA 3UJIH 4GG8B 3UBXG 1NMAH 3LPOA 1HSBB 4N1HB 5D2NC 5EIQA 2OMWA 2AK4B 2X2UA 4DJMA 1J8KA 2OJZL 1IFHH 3FO0H 5HGDB 4OZ4B 5F7WC 5D1QE 3W0WB 1TMQA 2YQ3A 3IAGC 1NFAA 1J0YA 4UWQB 3SE4C 1LMIA 3UZEA 3WIHL 1E42A 5GGSB 1IM3A 1OL0A 3GGWA 4PJXF 1U8IA 2BSDA 2DOCA 4EVNB 2J88H 3C6LC 4OW6A 1CFVH 1N12A 2VISA 5SX5K 1T20B 1A6UH 3GXIA 3B2DC 3GRWL 2EUVA 3EUUA 4XMUA 2J12B 4FQXD 4JHUA 2A6DB 3TV3L 4WKZA 2BNRB 2XZQL 4JQXA 1I1YA 4H5SB 4WWKA 4AGQA 1OAZH 5F7HA 2GPZA 4N2NA 3WUWA 5FA3A 2ZKHL 3KPNA 2DQDH 2WWNA 1AKJD 1LO4H 2EDXA 4G83A 3EUDA 3ZL4L 5EEWA 3VWJB 1M6OB 2UZYB 4AZ8B 4LLQA 4U7KA 2YOCA 3L5IA 5LBGA 4QRTB 2A7BA 4ONFH 1MG3C 1V5JA 2VMCA 4IGBB 5IB1B 4KKCC 4HH9B 4WI5A 4EBQL 2R0KH 4KH2A 4JX0A 4W9LC 3UEQA 1A9VA 5IZ7A 1M1XB 1MQKH 1PD0A 4X7SH 4H88L 4AG4H 3G5ZA 4TOYL 2IWEA 4FFWD 3RVVD 5D96C 4M4RA 4JKNA 2ESVB 4NSKB 4PJ7E 4CSTA 2PN5A 3RGBA 4HC1H 4RGOL 3RNQB 1CTOA 4F7CB 1NFIA 4ZD3L 5AB9A 3BP4B 4OZFH 4ZTPL 1BVOA 5DUPH 4ZX3A 4YH6A 4FG2A 4X5LA 2W80C 4YVNA 5JA8B 3CZEA 5KOMC 1G87A 1RJYB 2GBAA 2GY7B 3MFGB 5I17A 1ZGLA 3D87B 4WIQA 5B1CA 4HCFA 2ZYSA 3LS4L 1EJFA 1P1ZB 1J12A 1HT6A 2QSQA 4H8QA 5E1IA 3AAZB 4NERA 4GEJA 7TAAA 3MRPA 5BXFB 5ICZB 4JFFB 2X6CA 3B3BA 2YWYA 3AMKA 5KYNA 4OZIA 2W60B 4YDJA 4QLWA 2ED6A 2AJVH 3NJHA 3ETBF 3FSZA 4M3HA 1GGTA 5J06A 4LLMA 3UYRL 4JN1L 4UBDD 1F56A 4LVNC 1J8RA 2CBTA 1U8MB 4WO4A 1IC4H 3QSKB 4XO5A 4OIAA 1MLCA 3EOBA 4NQCD 4PLOB 3ZKMD 3UMNA 4DKEL 1AMXA 2WZPA 3RFZB 3FFOA 2JVUA 2O5XH 3RE0A 3QXUA 5EG6C 2AQRA 5FHAL 2RAMA 4HKJB 3IJ8A 5CD3A 4LXFA 1OT1A 5B1AB 3FQ2A 4AGPA 2VSCA 4A7UA 1GCFA 6PCYA 5JW3H 1GGCL 1NGPL 2WCGA 1P6WA 1JVLA 2F54A 1K8DA 4YZFF 5H2BB 3UPRA 2HRLA 4E0RA 4AQ8A 1U6AH 4GAJH 1Z3RA 3IDXH 4TPRH 4N25A 2OMNA 1D7DA 1U30A 4GSXA 1NEPA 2YEZB 5I1CH 2R9HC 3GSNH 3WXWH 4KHTL 3NJMA 1BVLA 1B9KA 3KWVA 2NNFA 1PZ2A 4JPKL 5HYQA 4JO4H 3IWVA 4X8CA 1A4AA 3O6KL 3PPSA 4HJ0D 5KSAD 1DP0A 1TNNA 5AKSA 3DI3B 1C08A 4A38A 1D5IL 1AFVH 3PABB 1SDYA 3VM5A 5AFAA 2EVJA 3VFTA 4BE6A 5KAQG 4XP5H 1FO0L 3OKMB 4A37A 1TF4A 3O8XA 5MEND 1NBZB 2GCYB 4KRNA 4KXCA 1RZJC 5HPMA 1KXVA 2AAAA 4UDTA 4AL8H 1NFKA 3O41A 1OAQH 2HH0L 3RGVB 1ZLWH 1LEGB 3WLBB 4Z7OB 1BM3L 1G7LA 2XRAH 3T0ED 2HFFB 4G1MB 1FL5A 3UX9B 3QJHB 4WW2C 3BE1L 1I7UB 1T80A 3K6FA 2R56H 5DEZA 1GGIH 3IMBA 5ID0A 1KN2L 3O3UN 4OV6F 2ZCHH 2ZUSA 1JNLL 3LV3B 2W0FA 1NOLA 2GUOA 3B43A 4KITB 1D5BA 3MLRL 4QHNA 1NUFA 5D4JA 1BOYA 4GW4B 1T0MB 3L1GA 4M7LT 4DOHE 5EU7C 2WZ6A 5DO2D 3BT2H 3SKUD 4HK0A 3SO5A 2QSCH 4DTGH 2NY0B 5AAPA 4XBGA 1GAFH 4XN2A 1X9RA 7FABH 2HWZL 5I6XC 3IDUA 2QHLA 3MUGA 5JXED 3H85A 2Z35A 2J3SA 5DD1H 3QULA 3EO1A 5I5RA 5EC2A 4UM9D 1AZBA 1ZS8B 4UILH 3VI4E 1BA9A 3KPSD 1DSYA 3VA6A 2BVQB 2VLRD 4PB9H 1TVBB 5ERWB 5TQ2L 3VXUA 1DVFD 3T6QC 2H26A 5JNYB 4HGMA 5KTEH 4QLRA 4CVXA 3MLWL 1WFTA 3HZVA 2NDGA 3BDYH 2VQ4A 4JO5A 1DUYB 4D9RD 2ZUQB 3VXTB 3BVNA 4DW2L 4U49A 3X3FH 2VZ3A 3JT2A 3KBHE 3MJWA 2LABA 2G2RB 3CG8A 4RISL 3SN6N 3M1CA 4ODSH 4IRZA 3JV6A 4W93A 1O7SA 1SVZA 1KGCD 3L5XL 3VACA 1XB6A 4OZGB 2XXMB 3KR3L 2WXOA 2F53B 1F90H 4Y19E 2Y3AA 3HI5H 4Z6AT 4WENB 3SBWC 4QUOA 1U3JA 5JPNC 2FBOJ 2Y23A 5I6PA 1NWOA 1FGVH 3ES6A 1UJ3C 1ZVSB 1T5WA 3EYQD 1UM6L 2J1ZA 3WE1A 5IVXB 1RLWA 1T2XA 5IUSA 4ZUSA 4K71C 4U6VH 2YAFA 4DPRA 4Y9CA 1MNUH 3BH9B 1EVUA 4B9KC 3CFCL 2BP0B 1BD2D 2AK1H 1DVSA 3PAVA 4C47A 2OSYA 5MEOA 5EBLB 5DS1A 3F7VA 4Y4KB 1CGTA 2HLAB 2DRUA 4WNQB 2QGDA 2ZWYA 3ME0B 2RCSL 2X1OA 3I6SA 1NLDH 3DIVA 1E4WH 1UWXH 3HNVL 1FAIL 1UD5A 4LASL 4R96A 1NGQH 4YC2C 3FPXA 2EE6A 2PWHA 4LAQH 2C9SA 2F7IA 2QEJA 4LGPB 4QJ3B 4X0NA 3RU8L 3RY5A 2AITA 3RY6C 3QEQE 4LLVB 3QH3A 4PI2A 1NBVH 3JWOL 5FM4A 3OSKA 5KVFH 5BUAA 2Y1YA 1XF4B 2X1QA 1N6VA 2Y2TA 3AXLB 2X7LB 4LOUD 3JXAA 3K6NA 1SF3A 4NBXB 1JHLH 2NY7L 5H94A 4A66A 4ZBJA 3K0YA 3QRLA 4FMKA 3K5RA 5DS8B 2Y36H 2R69H 4XRCA 5D1QD 2FHCA 4X5RA 2P44B 3BUYB 3MNVB 4NZ8A 1I8KB 1YEFH 3QEUA 2FYYB 4APQC 4Y9GA 1KEML 3TASA 2PETA 3MACL 4BUQA 2C3VA 1AVAA 4WW1B 2B3IA 5C9JB 3L48A 4RX4D 2AJ3A 4A55A 4Y7OC 5B3JF 1AHWB 1Z3GL 2X9XA 2RA1A 3WNPA 2N0MA 2EIMB 3BCFA 3VXOA 1C8QA 3U4BH 3GIVB 4Q4EA 3OPZH 3ALPA 3DOHA 1WDAA 3K71B 4JKMA 4LRNH 2X9YA 5T3ZH 1YUHA 1A9EA 5IW1B 3HOGA 5B4MC 3KJ4B 3H9SD 1B0RA 5IQ9A 4BCXA 4JJ5A 1WA2X 5IVOA 2VKWA 4WI0A 4B50A 4PB0L 3T4YB 1EO5A 1ZIBA 4W9HC 2WNGA 5ILTL 2FD6H 3D2UD 2DAVA 1PIFA 3LJ3A 1A4BA 4I9WD 2KDYA 5A2LH 4HMCA 3CZSA 2WAQA 4KK9D 2NYZA 1HN1A 1I82A 2DJ4A 2LLGA 1KCUH 3NTCH 5EBMA 2QPUA 4BA0A 3SDCB 3KBPA 2J7LA 4Y5YB 2XUWA 4AENA 2OMUB 4Q8BA 4QO1B 4KMLB 3P3SA 4XPFL 3CHXA 3GI9L 2F7QA 4I85A 3B8SA 2DF3A 1KZYA 4M1DH 3I50H 5HPOA 5D72H 3P0VL 5EWIH 4Y9FA 1CICC 4HUKB 3V6OA 1QBMH 4NJ9L 5CN3A 5FO9B 3NG5A 2FUQA 3UJTL 3CVHH 4ENZA 4A7QA 3ZE1E 1FZJB 5C6PB 3SBQA 4YSEA 1RU9L 4PP2B 1TCRA 5KW9L 1Z9SA 1WT5A 5EB9A 4F27A 3LKRA 3KPSA 1E2ZA 2AVGA 4LOEA 2Q20A 2OQJB 2WOBA 3BGMB 4H26B 4LEXH 5ISZE 1KB5L 3V6FB 5TDNB 2P43B 3QRBA 1KDIA 1G7QA 3M88A 2XQYK 5IHWA 4G59C 1F6AA 3UGEA 4EKJA 5K59E 5I8KL 3LXUX 2AEOA 4W4OC 1KCRL 4I3SH 2IH8A 2Z93A 1PG7X 4WWID 3QE5A 4X9GA 2B16A 2ED8A 4NUJA 3IXTA 2WQUA 4HWEH 2VLME 4HIXH 2HFGL 5KBPA 2RH0A 3QJRB 1MCLA 4I1PA 1U21A 1URZA 3B2XA 4Y4HB 3MLUH 2CDGA 3BFOA 3HJ0A 1A47A 5GPRA 1GHFH 3WFBL 4PJEA 3NFNB 4NPYA 4G7YL 5I8EA 2R59A 1VEPA 3T2QA 4HKZB 3FCBA 1NJ9A 1M6UA 3QUXC 4HP5A 2Q8AH 4F2MA 4DKDC 3QUZB 2BWQA 1YVLA 3NZ8A 3ERXA 3HG1D 1P5UB 2R23A 1JPFA 2LU4A 2WGXA 4KUZL 2B2XH 2KZ1B 2V7HA 4RAUA 1IMHC 2L7QA 2ZNWA 1WAPA 4F24A 3BWUF 3BLKA 5EZLA 1V3LA 5FHBL 3LD8C 4N6RA 1T0PB 2VIRA 1IZKA 3WS6C 4C57C 4DQAA 1BF5A 4UT6A 4JY6B 4HEMA 2DKUA 3PPEA 4M03A 4Q14A 1K2DA 1FHNA 3BZ4B 3UBXI 1RUMH 1B4RA 2YMXH 4CU7A 4ZW3A 3FTSA 5IBUB 1IFGA 1XXDC 1RXLA 5AD0A 3ELAT 3F85A 3WMQA 1G9NC 3MZGB 1FF5A 5F7MC 4YXHL 4D3CH 1QZNA 4AIZA 1GL4B 5HI4C 1DLHB 1R33A 1AO7D 2Z92B 5DZOA 3TYFA 5IV2B 3DVGA 2IADB 3AVEA 5D7IA 2EDWA 1DR9A 3SGEH 4R2GC 2PYEE 2WLYA 4LRIC 2GJRA 1ILUA 4HUXA 4N0UE 3TBWA 4DCQA 1HHJA 3IJHA 1G6RB 2FZ3A 4PJIE 3T3PF 2D0GA 3AT0A 3BQUC 4YHOH 2UYLB 3MCKB 3LQZA 4K94H 5JIPA 4E9SA 1EWHA 1SOQA 2HRPL 3L6FA 2NY3C 5TE7L 3VXQA 1M3IA 3TZVA 2BOCB 2I7SA 4OCXH 2H6UA 4ZFOL 4IRJC 4K5LA 3ROOB 5GIRA 5MEPB 4IRSD 5LGHH 1CTMA 3RVTC 4ZMPA 5C0AB 2DWDB 3D85B 3ZKSD 3OAUH 3ZE0F 5C0GB 1JUFA 1ERNA 3IU4L 3US1A 2F61A 2JJUA 4DN3L 1YNTB 2NY1C 1RUAL 3C2AH 3L17A 1PZUB 4H25A 3H9SA 3UGXA 4CA4A 4D0DA 4GI6A 4GRLC 4B9FA 2AXFB 32C2B 3ILDA 4J3VA 5EN3A 2YAMA 2DQTL 4GQ9L 4ISVB 3S4SA 3DRQB 4WY7L 2C9QA 2YPLD 3VRJB 4Z0BH 1MFEH 3AB0B 4HJJL 1KT2A 1XGUB 1AR1C 1BZEA 4JGJA 3H3PH 4MCZB 4C4KO 4OSUH 1FFNB 3G6JA 1TZHB 1J1XH 2Y5QA 4PJXA 3KJ6L 1U41A 4NO0B 5C0BB 4BA8A 3MRGA 1NDMA 3B6SA 2Q76B 3BKML 3WHXB 5FW7A 4X9BA 1FRGL 2BX5A 4JO1L 4PGEB 4Y2DB 2COVD 2XWJB 1JYVA 3HC4H 1CXEA 4Y2LA 4UTBH 3BIKA 3MYZA 1ECZA 3K1DA 5F9JA 4KZ0A 3AWGA 5HDBB 3CZLA 3K4ZA 3R06B 3S88L 2BHZA 1JV5A 3NCJL 3SCMD 3FQ1A 4PS4L 4AEEA 5JOPD 5AZUA 3SJVE 5M94B 2OJEA 1D9KB 4Y19D 5I8OH 1XTLA 5EO9A 2BOBA 3U2JA 4XXDA 5IB4A 1IBFA 2XIBA 1XSIA 5J1SC 3QJFA 2KKQA 1KJMB 2VQUA 3NRPA 2B39A 5D6DC 4NQEE 1MAML 7PCYA 4ERSH 3T0WA 2DQJL 2C34A 2V7NA 1TJIL 3IJYA 1OD9A 3OZ9L 3FB5A 5J89A 3CZFA 3ZDYB 1M57B 4BGLA 4QNPE 1MNNA 4XI5C 4PVBA 3SKOA 1H6TA 1FVEA 4NQDB 1MF2H 3GIZH 3GM0A 3ESPA 3EDKA 3FUKA 5CP3A 4G9FE 3MLSH 4N0FB 4P23B 3ROLA 1QRNA 3U6RB 5C0EB 1TU2B 5ITFA 4Q6IB 4Y9BA 3TO2A 4QXGL 1RFDL 3QDJB 5DO8A 3CN2A 2PUQT 3N41F 4AMKL 2CGRL 3BPNB 1P9MC 3QEQD 3EYSH 3KYKL 1QD0A 1ED3A 2AAVA 3EFDL 5JW4M 1R24B 2H8PB 2OJZH 2VXVH 2L8AA 1ET8A 2VXUL 2Z91A 5CBEA 2FATH 3TF4A 2ZXAA 1BZ8A 2DIEA 1Z5HA 3CFKA 5J3HD 3QFJE 4OI8A 1H0DB 3WIHH 1OP5K 2NQDA 3MA7B 3CXHK 4JVWA 4M5ZL 2PCXA 3KLHC 3IMRA 4GW5B 3TH4T 1OAYL 4KI1A 4NO5B 4AIEA 5L7XL 5B39G 1YEKH 5BV7H 4OFIA 4X80L 3HPJA 4EUPA 3VXME 3MBEB 2XN9E 1IQWL 5AKRA 3TV3H 2ZOKA 4GXVH 4LCVA 2ADIB 5T5FA 2NXYD 2XZQH 3AG4B 2X1WL 1MREH 3NP4A 3DVIA 4LOVA 5F89B 25C8L 1I1FA 4PRPA 1MJUH 5DFVC 1YPZB 4OKVB 5I26A 1R3HA 2QKIB 4Q4IA 3GMQA 1ZV2A 1KIUA 3MRHA 4NT6B 1LP9B 3LNHA 1BJMA 2K3HA 4NQTA 3P73B 2BVEA 1EV2E 2NY5L 1CE1L 4ELME 5K9QI 1OTSD 4BQ6A 4RFNB 1ID2A 1P2CB 5F6IB 1JYWA 3VGFA 3LZPA 3OJDB 3SYOA 5CS7A 1IEBB 4MAYA 4YFEA 3BUPA 1FLTX 2EIZB 1YMME 1MJ7L 3MUUA 3UDWC 2NTFB 1S6NA 2PO6D 2KQNA 4PRNB 5AALA 1QPXA 1JK9A 3EFFA 1MWAL 4BHUI 3KW8A 4H88H 1HH9B 3GFUA 3ISWA 2VR9A 5D5MB 3C60D 5FC9A 3ASNB 3KPOB 4TOYH 1E9OB 1S5IL 3TA3D 1SVCP 4YFDB 3HRZC 3F3HA 4BUHA 2A9ML 3C8KB 3H0TB 3LEYL 3MJ7A 1T6WA 3NIFE 3CQFA 4PJGE 1IUZA 4ZTPH 4E5XB 1JNHB 4H8UA 4MB1A 3R7QA 4H2AA 3SHSA 4ESKA 3SZ6A 4R3SB 3GWJA 3L4WA 3QDGB 4JHWL 4CADB 3T3MB 4X5XA 1TYRA 3KYOB 3ZE2F 3ZTJG 2BIMA 2P5EB 1F11A 5KSBA 3U0TA 3LS4H 2R2HB 1P7QB 1FSKB 2YPLA 4P5TC 3GHPA 1CWVA 2H3KA 2X6UA 2ADFL 3M7OA 4HCGA 2A6IA 2CQVA 4Z7WE 4WI7A 3HI1B 2IGFL 3NCYP 4BDVB 4X8XA 1SMOA 2CUIA 4UIMA 4Y4FC 4XNZB 2BINA 1EAQA 1NC2B 2CIIB 4IM8A 2B14A 3UYRH 5AAWC 2RFXB 4JN1H 2FLRT 1EJ8A 1DFBH 2JIXB 3WAKA 1J1PL 3ZYJA 4DVBA 4DKEH 1G4MA 1GSMA 1X4XA 3MRFA 3WNKA 2IAMB 5FHAH 2VLMD 1FCCA 1JZFA 4FYRA 5E00B 3OR7B 3NJLA 1N0LB 4MDRA 3SCMA 1GGCH 1NGPH 2QR0B 4XCEB 3BOVA 4L3EA 1F2QA 4PGCA 3ZO0A 4Z7NF 3QAZB 3BRGC 4RGNC 2B1HL 1QLEB 2VERA 3FU0A 3GZQA 5ALCL 1TCMA 1BBJB 4JDEB 4A7GF 3O3AA 2YD9A 1Q9LB 3AY4C 4YDZA 5C0FA 4L2YA 4G71B 3IXAA 4KHTH 3CSBA 3LXAA 4JPKH 2NX5E 5TQ0L 3PFUA 5CWSA 3DDFA 1VEOA 2DWEA 3RX5A 3IETA 2ZX9A 1D5IH 1XIWA 4RZCA 4FQLL 5JPMA 2WXFA 1B88A 4DP8X 1K5NA 1TO5A 5SX4H 2P8LA 3L4TA 1YDPA 1FO0H 4I2XA 2V9QA 5ICXB 1F4WL 2HLFD 3TIEB 5GS2H 1VGEL 2EVFA 2L4OA 3RUGB 2E4FA 1M05B 1M2OA 5HVHC 4X4MA 2XY1A 2FDBP 1XGZA 1TTFA 1CQYA 3JWNE 4R26L 2Z0BA 3G6DL 1X4ZA 3MJGX 2HH0H 3B9KA 3QEHA 2XQYG 3CK0L 1BM3H 2PYED 3BUIA 3WUWG 5DT1L 4NO3A 3GJFB 2AQ2A 1CUOA 3BE1H 2K45A 4QT5A 1LWJA 4KNUA 4WTWA 3WS3B 1KN2H 1UQSB 3DKHA 1JNLH 2FJFB 2P24A 4PW3A 4CNIA 4MXQC 1A02N 3WIIL 2COQA 4YGVB 3AQDA 3MLRH 4MZ3A 3U82B 1WUZA