1AZNA

Crystal structure of the azurin mutant phe114ala from pseudomonas aeruginosa at 2.6 angstroms resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTAPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the azurin mutant Phe114Ala from Pseudomonas aeruginosa at 2.6 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport(copper binding)
molecule keywords AZURIN
total genus 24
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1994-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aznA00
1AOZA 5B1AB 2MTAA 4YSSA 3NJIA 1SDDA 4UANA 2IDQA 2PPAA 1TKWA 3AG2B 4E9WA 4G72B 3HEIB 3MX0B 1SJMA 4JKNA 4BXSV 4F7KA 2IWFA 4KNUA 2PCFA 2OJ1A 1WA2X 2BP8B 2FT8A 4YL4A 5D4HA 1YLBB 1BYOA 3FS9A 2FT7A 1HFUA 1PLBA 1PZBA 2BHFA 2QDVA 5D4JA 5B3SB 4E9RA 2PCYA 2VW6A 3FPXA 1IUZA 3N2JA 5A7EA 1NZRA 2HZHA 3TBCA 6PAZA 4A2HA 1WA0X 1XB3A 2XUWA 1VLXA 1OCOB 5TK4A 4PAZA 3NSCA 1ET8A 1SDDB 2XXFA 1AG0A 1NICA 2CUAA 2YAMA 4DP5X 1BXAA 1PLAA 2XYBA 2VW7A 2WSDA 4QKTA 4MFHA 4DPCX 4AKOA 5I5IA 4G7QB 4AX3A 1JZEA 1TEFA 1NIAA 1M9WA 3QJTB 2R7EA 4FA7B 2ZXWB 1AS7A 4KO9A 3QJUB 4YVNA 2XX1A 2TSBA 2BZCA 1BYPA 1JXFA 4YSOA 4BXVA 1E67A 5B1BB 2IDSA 1AANA 1KBVA 2XV3A 1PNCA 1AS8A 2I85A 2Q9OA 1B3IA 4EF3A 1A4AA 5I6MA 1J9QA 3C75A 3NJGA 3V9EA 1OCCB 3ABGA 2I7SA 4YSPA 1JXGA 3PCYA 3PAUA 4KO7A 4TXVB 1BXUA 2AZUA 2JKWA 1MG3C 2R7EB 1SHXA 4W9ZA 4AI7A 3TBBA 4G7RB 2OV0A 1JXDA 3WNIA 1ILSA 1NDTA 1PZCA 2BWDA 3NSFA 2VN3A 4HIPA 2QPEB 3AZUA 1CYWA 2HRHA 3IEAA 2B3IA 1BQ5A 2VW4A 4YSRA 3WIAA 1URIA 1N68A 3OMIB 1GS6X 2Q5BA 2VMJA 8PAZA 2IDTA 4UF7C 5PAZA 5LDUA 9PCYA 4N8UA 1NIBA 2N0MA 5E9NA 4AZUA 3FU8A 4FAAB 2RACA 2BO0A 3RYMA 3CVDA 5I6OA 1NPJA 3S8GB 1QHQA 1ZV2A 3GXUB 3PAVA 4UAHA 3FU7A 2B08A 2FT6A 3OM3B 3S3CB 5F7AA 1ILUA 3CZUB 4P5RA 5FC9A 5B1JA 3UADA 4WKXA 3TA4D 3DIVA 1AZRA 1GY1A 1KCBA 2DY2A 2XU9A 2FQEA 2CBPA 1JOIA 1WAEA 2AZAA 4GYBA 3S8FB 2HRGA 1A3ZA 1L9QA 3T6WA 1V55B 4YSEA 1NTDA 4NB7A 3ABLB 1GR7A 4ZK8A 5EHFA 1OV8A 2WO3B 1I53A 3NJMA 4DP1X 4DP8X 3PPSA 4A2EA 3CDZB 3DTUB 4E9VA 1AAJA 2A3TA 2XXGA 1AG6A 3X2QB 1DYZA 2GI0A 1J9TA 3EH5B 5I28A 3HB3B 1JERA 1FWXA 4GP5B 4E9SA 4DP0X 4AKQA 3GYRA 2EINB 5TK2A 2BZ7A 3NJHA 3X1BA 5ANHA 2YAEA 1OF0A 1ZDQA 4CSPA 1JZHA 4DPBX 2EIJB 1ZPUA 1AR1B 1BQRA 4W1TA 4Q89A 1RCYA 1A4BA 1OE3A 2OCCB 1NIFA 3IN0A 1KV7A 5AZUA 1ET7A 3WI9A 1AZUA 2YAOA 3FPYA 6PCYA 2YAQA 4YSCA 1KCWA 1GS8A 1KDJA 1HAUA 2XLLA 3AG4B 1L9SA 3SBRA 3ZIYA 1KGYE 1PCSA 2XWZA 1KDIA 1ASQA 1NIEA 5I5JA 1SFDA 1R1CA 2DYRB 2J55A 3QJRB 3EHBB 1NINA 2VM4A 2XVBA 5F7BA 5IY5B 2HX8A 3H4FA 1XB6A 7PCYA 1WS8A 3FQ1A 4HALA 4NAJA 1PZAA 4DPAX 1BXVA 3NJKA 3ASNB 4L0PB 3G5WA 5I6NA 3AY2A 4E9TA 3CG8A 1OE2A 4A2GA 2H5UA 1KBWA 4QLWA 1MZYA 4YVUA 3SBQA 1AZBA 3QJQB 3FU7B 3IE9A 4KOCA 4HZ1A 2EIMB 4KOBA 5B7EA 4JHVA 2YXVA 1T5KA 1PY0A 2PPEA 3QPKA 3T6ZA 4A66A 1V54B 2JFCA 1J5DA 2DWTA 3DKHA 2QPDB 2H3XC 2W8CA 4A68A 4E9XA 2EIKB 3EF4A 2H47C 2YXWA 5I6LA 4N4YB 1F56A 2CALA 3WKQA 3ASOB 2EILB 2GB2A 4BWUA 1CC3A 4BWTA 1CURA 4X4KA 1W8EA 1L9OA 3FQYA 1L9PA 4NERA 4AKPA 1ETJA 3FU9A 2I7OA 3S3DB 1W6WA 1E5ZA 3WNJA 1W6LA 2ZONA 5I5MA 2IWEA 3MBWB 5AKRA 4WTQA 1EZLA 1JZIA 1FA4A 1XMEB 3IBOA 2X88A 2PPCA 1ET5A 2CCWA 3GDCA 3H4HA 4G70B 2HLEB 3U25A 4KNTA 2P80A 2GHZA 1FFTB 2FWLB 4HHWA 2BP8A 1IBZA 3NSYA 1WS7A 1CYXA 1JVLA 3CVBA 3TASA 2BWIA 4BWWA 2XV2A 2Y69B 3FSWA 1PAZA 3T9WA 2GC4C 2YARA 1RZPA 3NJNA 4DP2X 1IBYA 1ZIAA 3QJSB 2UX6A 2FQDA 4BDVA 1MDAA 3JTBA 4BK5C 2ZWNA 1GSKA 5I6PA 4DP9X 1NWPA 1SF5A 4GP4B 1KYAA 3UAAA 2MRYA 3KW8A 1GY2A 1X9RA 1SF3A 2FTAA 1A4CA 4YSQA 1E5YA 1BQKA 1QNIA 5I6KA 3ERXA 1PNDA 3NJLA 3UAEA 2QDWA 2IDFA 3L45A 2BW4A 3SQRA 1V10A 4JHUA 3X1FA 4YSDA 2IAAC 1ASPA 1NPNA 1CUOA 3H56A 1ZDSA 3NT0A 1GYCA 4DP7X 2VM3A 4HAKA 1IKOP 2HXAA 4P5SA 4HCGA 4HCFA 2GBAA 2BP0B 2IH9A 7PAZA 3FT0A 1DZ0A 3D12B 2VSMB 1AQ8A 2UXVA 2P80D 3UGEA 2WO2B 3X1EA 2DV6A 4A67A 3T6XA 1JZGA 3FSZA 3X1NA 4K9JA 3T71A 2NRDA 2FQGA 2TSAA 3UABA 1GS7A 4DP6X 4CSZA 1X9UA 1A8ZA 2DYSB 3FYEB 5B1JC 4YSAA 1MG2C 4KO6A 3ZX1A 1J9SA 4A2DA 1BEXA 3ABMB 1AACA 4Q8BA 2FQFA 2YQBA 2FJSA 1AZNA 4RH4A 2CJ3A 1EHKB 5B1KA 2X87A 3OD3A 5PCYA 4E9YA 1JVOA 2QT6A 2UXTA 1J9RA 4GP8B 3T6VA 2XX0A 2FNWA 3WG7B 4ENZA 2IWKA 3EH3B 1OCZB 2ZOOA 2BW5A 1E65A 2PLTA 3UACA 3BQVA 2VSKB 1M56B 1PLCA 3OMNB 3OQRA 3PAZA 5I26A 3SBPA 2W88A 3PLYA 2Y1AA 4GXFA 3PXLA 2CAKA 4M4RB 1NIDA 4G7SB 2HX9A 5B7FA 3FQ2A 2GIMA 3QQXA 3TU6A 3N55A 3ABKB 1PMYA 4PCYA 4F2FA 2GSMB 1QLEB 4HHGA 4YSTA 3ZDWA 3FSVA 1WA1X 3NP4A 3CDZA 3V9CA 1AS6A 2BP0A 3QJVB 1J5CA 3NJJA 1L9TA 3NSDA 3AW5A 3KW7A 5AFAA 2YAHA 1TEGA 1ADWA 4G71B 3S3BB 3WKPA 2PP9A 3AG3B 5B7MA 3NJFA 1IC0A 1GW0A 2PP8A 3AG1B 3BVDB 2UX7A 4BDVB 4YSUA 2J5WA 2XV0A 1NWOA 5D4IA 2E86A 3EH4B 3JT2A 2YAFA 2JXMA 2PPDA 3NP3A 2UXFA 3IN2A 2YAPA 4DP4X 2PP7A 1E30A 1BAWA 3ZBMA 4HCIA 1ZIBA 4E9QA 2LLNA 1AZCA 1JZFA 2J57A 3X1GA 1OOWA 1A65A 1SFHA 3FYIB 1JZJA 2AFNA 3CVCA 4KO5A 1M57B 3OMAB 2DWSA 2IDUA 2HX7A 4GY4A 1UATA 2IH8A 1N70A 1HAWA 1MZZA 1OCRB 1ASOA 2J56A 4A2FA 3NYKA 2PPFA 4F2EA 1SNRA 4M3HA 4KNSA 1RZQA 1TU2A 1L9RA 1OE1A 1SHWA 2AANA 2GC7C 1RKRA 3FSAA 1ID2A 1AIZA 1PF3A 2UXGA 1XB8A 2AVFA
chains in the Genus database with same CATH superfamily
4WTZG 2F8IA 3CSBA 3TL5A 3O2VH 1R3LB 2EDNA 3R19A 2O1AA 4GRMA 5C9KA 3M1OA 2Y24A 2DQUH 4MJIB 1CFTA 1A7NH 1C16B 4NWUH 2N7SA 2KZWA 4FG4A 1PKQE 1OB0A 3KPRA 1PJ9A 3CQPA 5DMIH 3T0ED 3MGTA 5CN3A 3SPGA 4P2CG 1WA2X 5JW3H 2AQ2A 4P4RB 1UA6L 4NNYB 5IR1B 3LEXB 4G1EA 3QIWC 4NM4L 2XVGA 1TZGL 1A9VA 1WFIA 2QR0B 4L4TD 3CXDH 1DBBH 1PLBA 3CU1A 5KYNA 2VDPH 5D4JA 1T5WB 1QW8A 5DK2A 4NJ9H 2PCYA 5I0DA 4LSUH 2X5PA 4S1QL 1MCOL 3DXAA 4UINL 3ILQC 5D7LD 3EYFA 4Z7VB 5DA4A 1AGEA 1F4WH 4F3FA 3A21A 1LL1A 1CTOA 4MJ5B 2KYIA 2VZUA 3MJ9H 4NM8L 3OBAA 2J3SA 3T4YB 4CGTA 2DQGL 1I75A 1I7ZB 3S5YA 2VW7A 4QKTA 3EO9L 2LLGA 2RQ8A 1MI5B 3F00A 3HJEA 1NIAA 4M9OA 5B4MC 2J8OA 2ZXWB 1QLFB 1OB1B 4JX0A 9CGTA 4PJ8D 4POZC 4FRWA 1ZTXH 5D9SA 2APXA 4ES9A 2GJZB 4WAFA 2NDFA 3WLWD 5CUSH 4HDIA 4ODSH 1B88A 4OJEH 4X99A 1B90A 3TN0A 1N64L 1QEWA 2G5BA 1CFVH 5AKTA 3CSTA 1RZGA 2X4SB 2J8UF 3QUZA 1NAML 1ACYH 4W6XB 1ZVSA 1DJWA 4ZUSB 2LE9A 3QWQB 4UT6L 5CEYA 2R0ZH 4P9HC 2ZX8A 3QNYB 4HIPA 1U8IA 3F7QA 2AJUL 2I27N 4N0CD 1T03L 2AJVH 2NY5C 2Z6FA 3CSYA 3EGXB 4HT1H 3RX7A 3C6LA 3RB7A 2Z64C 1FI8C 2VWEC 4WY7L 1VFAB 3VXUD 4APQC 2HG5B 1GS6X 2Q5BA 2GJ6A 2H2PC 4W93A 1OK8A 1FO0H 3TNNA 4PEEA 3WIFB 1KJ2H 4LLWA 3KWXA 3VI3A 7TAAA 3EYFB 1TJHH 4MGXA 3BRFA 3AGVA 1EEYA 1R3HA 5EFIA 3FC8A 3QZWA 4PRDA 4IKIA 4XWOC 1BIIA 3UEQA 3VQLA 5DJ2A 4PGEA 1M7UA 4GKNA 4PJ9D 2FHFA 5GZOC 1BQLL 1T6BX 3PGCA 4UAHA 3P1VA 5HHQB 1FZMA 4CKQA 1Q1JH 2G3NA 5KW9L 3CXFA 4I0PD 5FM8A 3DDGA 4IRZL 3BE1L 4WKXA 3EDKA 4PJHF 1DLFH 3P3RA 3N1MC 4L4VA 1AZRA 3GSOB 2BM3A 4IK7A 2XU9A 3UDWC 1T0NB 1TZIB 2AJXL 3TA3A 2CDGB 3LQZA 5ABDE 3T6WA 2CA4A 2Y6TE 3IMBA 4ZNEE 4NZTL 3KBEA 4JO2L 4WFGE 2FO4A 3REWA 2AGJH 3HS0A 3U82B 1OV8A 1CO1A 3A23A 4N2NA 2JCWA 4PJAF 1ORSB 1MPAH 4Z18A 5IVOA 1JZ7A 1G9NC 2QADB 5JHLH 3BJ91 4Q9QL 5H4ZA 3NN8B 4UQCA 2Z31A 4UOQA 1PD1A 3ZMNA 1B0RA 4BH8B 4I48A 3SBWC 3G6JA 5IVXB 12E8H 1Z9PA 3A4EA 1RY7B 4PH8A 4Y4HC 5G2NA 1KEGL 3U79A 3BH9A 2EXYC 1W0WB 4XE0A 4OFDA 5TK2A 1RMFL 3MRRB 1XZWA 3WJLC 2YAEA 3BO8B 5I8OL 1Z7JA 1FPTL 3S35X 1VFMA 3RL2A 5I6XC 4AYEC 3HMXH 5IROC 2VDRB 1HYSC 6TAAA 4W1TA 4I0KA 3ZHDA 2O6DA 5AZ2L 4NQVB 5GRUH 4Y4HB 3HG5A 1IEAB 2DLFH 3W5NA 1A3RH 2JLPA 3DYPA 3RKDD 4U1HB 4FG2A 1MVYA 2WTRB 2OR9L 3HBPA 1MRCH 3AG4B 1NCTA 1RZKL 5JUEH 4A7UA 5DR5L 3NSXA 2OTPA 1CDYA 4XP9H 2VDLL 3BEWB 5ANMB 3LZRA 5FHAH 3U2SA 3TBTA 5IHUH 2LQRA 3NZHH 5BQ7B 1GGCL 4WEBL 3POCA 3GD1C 3KS0J 3N43B 2VXSH 3V4VA 1EUTA 4NC1E 3H4FA 2X53A 3GPEA 3FQ1A 5D7KE 5T1KA 1UA6H 1XIWC 3H9SE 2OYKA 2DQCL 4HOMA 1BZ9A 3GRWH 4JZJA 3GS7A 4JANA 4R26H 5EZLB 3TGXA 1TO4A 3FCSA 4TUUA 2H0EA 4HWUA 4XCEA 1NBVH 1EO7A 2BY0A 3TBVB 3EYUL 3JVGC 2FJHA 2FSEB 1FN4B 3RZCA 3DIFB 2K70A 5CINL 1Q9OA 2D03H 4DW2L 3FONA 4X4XA 3GM8A 5I71B 4MSWA 1OAJA 3BIBX 2Q8AH 1JV5B 3GMMA 4LIQH 1A6VH 1Y07A 4QI3A 2HVJA 3VD2A 2W8CA 1U3HB 3VI4A 2M8XA 4N4YB 3TFKD 3HC3H 1HXYA 1HVXA 1DSFL 3MYJB 5E5RB 1DQKA 3BAYA 2IPUK 4HEPA 1ADQL 1NGZA 2MOVA 3ARYA 4YHOH 5J1TC 5LAXB 2EILB 3AY4C 2GB2A 3KPNA 5LCVH 5E08H 3QC6X 5KOMC 4X4KA 1H15A 2CUIA 3V5HA 1GL4B 3QO1B 1ZMYA 2P8MB 4WCYL 1HWGB 1F4YL 3O6FB 3ETSA 4G80A 1B6DA 4GS7B 3W3BA 3ELQA 3EYSL 5DUPL 5C9JB 5KZCB 4HS8L 3DTXA 4P3CL 5AVUB 4F20A 3IFLL 1ZHKA 4G43A 4OQTH 5DRZA 4ZW3A 2ZF8A 1QFWM 2EXWD 4JS7A 1ET5A 4Q2ZA 4BQ9A 2HLEB 2ATKA 4XAKE 2WINA 3L48A 2HUHA 2QL1A 1PY9A 5IIEA 1E2VA 1FFTB 3LN4A 3GXPA 4JQVC 2R0ZL 3VXMB 2YRPA 1DL7L 4JRXB 1H3TA 3NSYA 1ZT1B 4YHML 3S2CA 1SOXA 4C56A 4FXKA 3IDMA 4ZSOA 3E80A 4IBZA 4E5XA 2YARA 1BMWA 1X7SA 5FYJL 3NCEB 4OZFH 4LVHC 1UXSB 1T04B 1ZLUH 3B9VA 4NN6C 2QZQA 3PGDB 4BFRA 4GP4B 3D18B 1NMCB 1F18A 3IE4A 1PS3A 1A4CA 3N3EA 2AEPL 1PNDA 5JHMA 3BKYH 2HB0A 3VYPA 4G43B 3MBXH 4JFDE 3Q2CA 3QXTA 4MAZA 4HJEA 3NCBB 5IEKA 2L04A 4UM8A 5IFAL 5GGSB 4OV6F 3BZFB 3IRCA 1XDTT 4X5RA 4L5FL 3PWUB 3TZVD 2G5RA 2NQDA 3MJGX 4F7MB 5ICYB 4KROB 1F3JA 4ODHL 5EEVA 3SIKA 3OKOB 4IHBA 2WLNA 2EEBA 1KPUB 3P77B 1WBXA 1Z5LA 4M8QB 4WTXA 4AYBA 4BEIA 2H9GB 5AALA 1MCSA 4BFOA 2EE6A 1XF4A 2K78A 3COOA 1M2VA 2UWEA 5ITBL 1DJHA 2C1OA 3QEGH 5CIPA 1OP4A 4XMZA 4IKKA 2DV6A 2V2WB 5AQ0A 3VXPB 3ROOB 4OLZH 3FBKA 3T71A 4NENB 3P02A 2X6CA 4CSSA 2W07A 3B7TA 1SYVB 3D51A 2L3BA 1WCBA 1SXCA 4FLSA 3G3LA 3IFNL 4NZ8A 3K7UA 3WD5L 4ZFOB 4ZMVA 2BFVH 4PBXA 1H8OA 5ALBH 3BQUC 3H7BA 4POYA 3MRLA 3NN8A 2FJSA 1YJDH 3GB7B 4PGCB 4PWJA 4E9YA 1SEBB 1S7UA 4OLYL 2Y4SA 1TNMA 1A02N 1WAAE 5D1XC 3UPAA 5C0DA 3ZRCC 4N3UA 4L48A 1KLGB 3ZY7A 2EDDA 1J0HA 4ENZA 3C6SB 2AK1L 2ZCHL 1A3LL 3D87B 4I0CC 5I15L 5KTEH 1U91A 3JVFC 3OAZH 3MBEC 4OIFA 3SDCD 4IRSD 3TNMB 4D0CA 5F9JA 1CDUA 4S0TD 3BQVA 2RFXA 2XVLA 2XZCL 4WHDA 3OMNB 4PJGA 4DT2A 3WHXB 5EBLA 1QW9A 2QHRH 3SGEH 1KTCA 2A73B 1KFAL 4U1IB 4Y2DD 5CZVH 5EO0A 5HD8D 4J3OG 3AQZA 3CSPA 3QXVA 4OLVH 5CJ8A 1AXTL 4M9PA 3N55A 4AW4A 3FMGL 1AI1L 1INDL 4DKFL 4F2FA 3EGSB 2CHWA 4I13B 4HFWB 3RWJA 2O72A 1GTNA 4CU7A 3EGXA 4GB9A 2P43B 1VFBB 2Z65C 5BOPA 3AT9A 4WJKB 3SE3A 4BQ8A 4KRPB 4LP5A 2WPGA 3KW7A 3QDGA 1NKGA 1E8XA 4G6KL 1YECH 3GWJA 1ETZB 2OJEA 3CFTA 1VIWA 2XKUA 2ZOTA 4IIZA 4DAGL 1LEKB 4HETA 1ZT4A 3G6JB 5IVXA 1IC0A 4LIQL 4Z0BL 1F2QA 3Q6FB 2H0PA 3V5DA 3GLAA 2Q7NA 5D4IA 1JGLL 2JTYA 5HPMA 5FECA 3LKPA 3NRPA 4NIKB 2K7QA 4YK4B 3PGCB 4XXDA 4JPIB 1TENA 4OTXH 1FNSH 4GAYA 4OF6A 3ZDXB 2P5WD 2CWRA 1YEKL 3X1GA 4R97B 1BPVA 2A99A 2H45A 3QJHB 3G6AB 4FQ1L 1E4WL 2EC9T 2Q87A 3CVCA 5E9AA 2DWSA 3BWZA 4AG4H 1KIUA 1ORQB 2QGDA 3B2UD 1MVUB 5FO9B 1FDLL 1HAWA 4CC4A 3OC8A 2PR4H 5I1GH 1BAFH 2PPFA 4IBVA 1H3UA 4R97C 3KDPB 3F7YB 4EDWL 4H5SA 3MLSH 4P2QA 1A7RH 1QPKA 1XF5B 5C0CE 1TJIH 2AANA 3J7HA 4ZPVB 3QQDB 4JQIH 5DWUL 4PJGB 4B9PA 3OAYK 5CCHE 3WKNA 1KTDB 1CS6A 1O9VA 1QSFA 3MJ9A 3ZOAA 2GJJA 4ZFFB 1O75A 2MTAA 3GZPA 3DYOA 3O11A 4YSSA 4KZDH 3U7WL 2ZX7A 1UGNA 4R26L 3KL0A 4G9FD 3V0GA 1ZS8A 5A6IA 1FH5H 3D85B 4P57B 5E8PA 4BXSV 4ONFH 3FUEA 4KDTA 3MCG1 3CQQA 4JVPA 1LK3H 1NC2B 4XCFL 3I84A 5LXGH 2NY6D 5LHDA 1MF2H 1BAGA 5B22A 4APXA 3FFCA 5C0CA 2BINA 2J7LA 1T2JA 3L3DB 3D3VD 1UC6A 4UUJA 5AW5B 1OD7A 2J1KA 3FULA 3MROB 5DHEA 4RAUA 3S5LG 4E5XG 3CZFA 1IUZA 4HBCL 1AOHA 1Q9WB 3S37X 4GAJL 1HZHH 3DMMD 6CGTA 2WLMA 4D2NA 3MQIA 1E4JA 5SWZA 4XNQB 5AW2B 3BD5A 1SDDB 3H7LA 3O9WC 5EH1A 3LH2L 3WS6A 1DQJA 2MPAH 2H32A 3CHPA 4QJ5B 4ZPVA 5LCVL 3CFCH 5D5MA 3ZUCA 2EDWA 2V2XB 1RI8A 2N7AA 3LN5B 5LGKA 4FLOA 1WAAF 3RZCD 1N64H 4GI6A 2Z4QB 4PJEA 2B1AL 3MGAA 1CGWA 3R06A 1NGWB 5KBKA 1FCGA 2EDKA 3KPSB 4L37A 5HHXL 5IVZB 3GMOB 3GI8L 2EYTA 1QD0A 4BXVA 2L7EA 5D6DC 5E8DL 4FLQA 5KJ4A 2CM6A 1FYTE 1B3IA 2X0UA 2R1XA 4Q2ZB 4RGNC 3M8OL 4H26A 3NJGA 4UT9H 5F89B 2WUBH 3DHMA 5HPOA 2XBTA 2IGFH 3ATEA 3L08A 5IG7B 1FQ9C 5JDSB 3W5MA 4WI7A 2VXSL 4AQEB 3U0PA 2H2SD 5BRPA 3FQNB 4OD2A 3QEQA 2QSCH 4XB8A 1GGYA 2YGOA 1TMCB 3VRJB 4LSVH 1HHKB 1NAKH 1UKSA 3Q2NA 4AYDC 4KUZH 2YEVB 3SKNA 1QUNB 5E8NB 2JQMA 1AXIB 4A7SA 2G3XA 4XHQA 5JHDD 2GSGA 2R0LH 5I0YA 4OFVA 1BYNA 5IWLA 4MB5A 4PV9B 1O6VA 1KJ2B 2Q3ZA 4OCNC 3TBYA 3FT9A 4HPYH 4FZEH 3QHZL 4YUEL 2DWEA 3GINA 4JUTA 3PRZA 2A73A 4U1IA 5D1QB 1Z5YD 4I4WA 3HC3L 4OGZA 1RUPH 3HI5L 1SXAA 1T21A 5HDQH 1MNNA 3S3CB 4YXLL 2RFXB 5DFWH 4YDZA 2Z4QA 3DETC 5IJKA 3HN3A 4LE8A 4QEGA 3QZOA 4UOW1 5E24E 3IKKA 1BZDA 1FL3B 1PZ5A 2XPGB 3TURA 2I25N 4N25A 5L4IA 4LEOA 2X4QA 4WSKA 2DZEA 4R2GC 1S3KH 4RMQA 3CSGA 2YEZB 2PTTB 2TRHA 3EYSH 5DUPH 2X4RB 3DOSA 5KVMC 1A9BB 1XF3A 5ESVA 4FQXA 1ANUA 1R33A 5LNGA 1UVQB 4ZYKA 4Z0BH 2A3TA 3TIEB 1NANI 3NIGF 3JV4B 5GGTA 4FZ8L 3JV5A 4NI6A 4GUOA 1DYZA 1SY6A 2ORBH 1QRNE 3MJ8B 3MRLB 3ZO9A 4GNKB 3ULUF 4X8XA 3I75A 4F5CA 5KSBA 4KQ0A 4YJZL 2E56A 1Z9LA 5D6DA 4G6JH 4DP0X 3MRKB 1ZANL 1F11B 1X4YA 1ZS8B 2MMXA 3NCYP 2ZKYA 2IWGA 3CFJB 4V11A 5MEPB 1KTKE 3RU8L 4DPBX 4L05A 1DVFA 4RCAA 2DD8H 5JNYA 3BP4B 1TZOA 1NAMA 2ZUYA 3ILPA 3HPLB 4HKZB 3WIIH 1ZA6B 3VG9B 4KV5E 5GHWH 2IPUG 2X4OB 2D7OA 3GSRB 4OW6A 4WWPA 1NIFA 4HCRA 1NCCH 4H44C 3VXNA 1OAYL 4A7GF 1FNLA 3QZWG 3EFDL 3CFKB 4LPYA 5EBWA 3BHBB 4PJEF 1A7RL 1L3NA 2NY7L 2F53E 5GS0L 1GRWA 3KLKA 1A1NA 1MVUA 4FXGC 2DKSA 3HE6C 4IHOA 4N8VB 2C8NA 3ZIMA 3NACH 4MMZC 3NZ8B 1KGYE 2DW5A 1UYWH 4WK2B 4G5AA 1DQML 1KTBA 1SFDA 3SBWA 1KBBA 2HRLA 3O6KL 5C0AD 4ONFL 2QGEA 3OHXC 3UO1H 1IGFH 2ESVB 3BP6B 5IY5B 1FFPA 5FUCE 3Q1EA 2J21A 1T83C 3QRFM 4PS8A 1GGBL 4X5WA 3QUXC 4E9TA 2X3AA 4PI0A 4Q9CA 5KAQF 2J72A 4AV0A 4IRZA 5J57B 1FYTD 3CZFB 3SDDA 1RULL 3D39D 3EJQA 3NZUA 4GUPB 4BCYA 2CNZA 3OZ9H 2XG5B 2BSDA 3LQMA 5IBUG 3N43F 5LBVA 5I8CB 1TYJA 5M7QA 1JXKA 1V7MH 1OM3H 5EZJB 3L9RA 1A6PA 3WS6C 1ED3B 2P7TA 3WD5H 5IJCC 4X7SL 3NESA 1O7DE 4QHLB 2IADA 1QI3A 5F1SA 2E7BA 1WTGT 5AW0B 5D1ZB 1TFHA 2EIKB 3EF4A 3FTUA 1KEML 1LE5A 1R5IB 1CDCA 1ZJAA 3HBQA 5C97A 1U93A 2BSSB 4RGND 5D7HA 1XBDA 1W8NA 3U4KA 2ZCLL 2CALA 2PYEB 1N59A 5MEOA 1CC3A 3FRPA 3QG7L 5I1GL 4QHPA 3O2DL 4NFCA 4MCNA 2O30A 1ETJA 5D2LE 5G5DA 4IOIB 4LVNC 2Q7AA 4X9IA 4YHMH 4TNWF 4YFEA 2AEQH 3QWNA 3IDGA 1R9FA 3V6FB 4XCNA 5KSAD 3OKKA 1R3LA 3JTSB 3RZCC 1XH0A 3I85A 3MKKA 5EC2A 3GXIA 4CVXB 4ZMAT 2YMXH 1NBZB 3FKUS 1IZJA 1ZGLB 4FKHA 1BQHA 4D9RD 2OMZA 1CD9B 1JI1A 1X4XA 2I9TB 4Y9BA 1G84A 4PUBL 4DKFH 3A6BH 3VXUE 4E2OA 4OLWH 4LCYA 2ZWSA 3TZVC 3RWIA 1BLNA 3VG0H 1EBPA 1ZAGA 3FT3B 3HB3D 4J3WA 5HJGA 3C09C 2PTUA 2UX6A 5CBEA 3BPLB 1THAA 2W0FA 3JTBA 4JLRA 4HBQA 3RP1A 5IV2B 2AQ3A 3UJTH 4M4RA 3B5TA 1B0GA 4U33A 5TDNA 3MLTA 1G9ML 5F0JB 1IVTA 3RTQD 4UOJA 3GNMH 1RXLA 3H2PA 2XACC 3WHXA 2HN7B 1KCRL 4ZQKB 4FYSA 5DD5H 1CLOL 4D9QD 5B8CA 3GXDA 3NJLA 3CX5K 3QEHA 3QEUA 1QFWL 3N6YA 1SVZA 1Z3GL 3MACH 3KWWA 2JCCF 2HP4A 1YEKH 3UG3A 4DP7X 2YPVH 4I0PB 4BFBD 4JVWA 1KXVC 1F3RB 2D31B 2XRAH 4WFGD 3SKOA 2IAND 4Y4HA 5I1EH 3DIDA 4G8IA 3BYYA 4WU5A 7PAZA 3WTVA 2Z7UA 3VGHA 1NCHA 5HHPA 1TTUA 3C5ZA 4XNDA 2ZUUA 4JDVB 4U6VL 3PQYE 1ZSHA 3MROA 5FYJD 3VXRE 4RMRA 1FCCA 1XTMA 4JM2C 3WU1A 3NIGE 1M1SA 2XG4B 4UV4H 1U8IB 2WTOA 3VRLE 4YSAA 1LD9A 4AIZB 3T65B 3CMOH 3FCUB 1BEXA 5TE7L 2PXYC 1FHGA 4UQ3B 5CHNA 4DKTA 1P1ZA 1PIGA 4Y2OA 1WBZB 2R69H 4KUZL 1OLLA 1KJ3H 4B9KC 2MWCA 1FAIH 5LGHL 3P9MB 4G9DB 5KBNC 4MWFB 3S4SG 2DQIH 3WGUB 2QSCL 4QNPE 2EEXA 4WLCA 3GSNH 4FKEA 4HMDA 3BSZL 3U0TB 3BZ4A 4J8RB 4W6WB 4GP8B 3HUJA 4WJ5A 5CU9A 1LNUA 1RUKL 4MMXC 4UB0H 1CICA 3D69B 3FRUA 4WQOA 4G8EB 5J13B 2R8SL 2ZOOA 3ECBB 3RPKA 2WXKA 1BG9A 2GTZA 5AWNH 4JDVA 2HH0H 1EAJA 1R24A 2PLTA 2WKLA 5HGDB 4PRPA 3U30B 2YC1B 1QVOA 3RIAK 1H3PL 3EJPA 3WFCH 2F08A 1OXYA 2YPVA 3QHZH 4YUEH 3VXTA 2ISDA 3KLLA 2DQEH 3CDCA 2R59A 5CUSL 2DBJA 1KIQA 4ZO8A 3ZZ1A 3D06A 1PLGH 4Z7OE 1YEFL 2VMEA 2E5EA 1FGVL 4HKBA 1BOGB 5EF1A 1SGKA 4JFYB 5ID0B 2RIKA 3T3PB 1BFVH 15C8H 2X7LA 3QUZC 4A2MA 2DN7A 3UTSE 2NCEA 1T5WA 4XVSL 5DK2B 3KZ8A 3NJVA 4K8RC 4M1GL 3NMEA 4MDJA 5FGBC 2JQAA 2A6DA 3DLQR 1KCKA 4K3EL 3CUPA 1KOAA 4QDGA 1G4MA 5D72H 1SY6L 1PL3A 1GW0A 2FX8H 4HWBL 1JF6A 3VWJD 3ZKQD 5EOQL 1HSBA 1MHCA 4EOWH 3GDBA 1DCLA 2E86A 1KB5L 3EGSA 1N6QH 2BNRA 4OUUB 3K2UL 3B6SB 4DWHA 1HHJA 5DJCB 2H6PB 1XT5A 3WTTA 4UIKL 5H37H 3D2UA 5JW4R 5KBMA 2LU5A 1X5YA 1KLUB 2B3RA 4NJ9L 4MMYB 5CU5A 1VF5C 4Y4FD 2AHIA 1D5XA 3WHE1 5T1MA 3F7VB 2BSSA 4KKCC 1E40A 4GY4A 3GTVA 3IJYB 3ZVVA 2ETWA 3U7YL 3MNDA 1KCSH 5K9OA 2AMUA 2EYRB 3DVIA 3HVDA 3NYKA 4F2ME 4YMPA 3VFSA 1II4E 2K7PA 2OJZH 4WSGA 5FYKE 1SXSA 4I9XA 3FTXA 3TPUA 4EI5B 5DK0B 3SCMA 4AXWB 3SHSA 4YHLH 1XB8A 3RWGB 1A5FH 3KDMA 4OCWH 1N0XH 1BLNB 4XCEB 1CVRA 1BZ8A 3FCSB 1MPAL 4HIQA 4XRCA 4TVPL 1E2WA 2ITDA 5DD3L 5GJTL 1FNAA 3WTSA 1TJGH 5DO2D 2FT8A 3TA3C 4PBWD 1AC0A 1Q9OB 4BJLA 1U8PA 2WKOF 3O81A 2Z31B 1HFUA 2D0HA 2QDVA 4XI5C 5BVPH 1FYTA 3MPCA 3P0VH 2IJ0C 5A7EA 2BCKA 4JRXD 2PXYD 4PS7A 3ETBF 4BE5A 4HWEL 4RNRA 3IGLA 1IQWH 5DVLA 1DVXA 2J8HA 2EICA 4QRFA 4Y9EA 5DHVA 4JM2D 5L8JB 2R2BB 4JN2A 4AGPA 4FQHB 1JNHA 2WSDA 3VM7A 3P9WB 4LLMB 3SDAA 5T33L 4JG9A 1ONQA 5CEZH 4UTCA 4NEHB 4N0YL 1T3FB 4YHKH 4YX2L 3ECWA 5JOPD 4YBHA 2VQ1A 2AKRA 3JWDC 1EDQA 4KJYB 5E4AA 3PDOB 1UURA 5ESAA 3DUHA 5C86A 3LZQA 1T20A 1U8PB 2X4UA 1TVBA 4RWHA 1XL6A 1FF5A 3OLDA 1RSFA 3LXBA 4GKSB 1G7IB 2I85A 4ZW8A 5IBTL 3L2LA 3Q8CA 4X4XB 2ZUQB 1XSIA 4TXVB 3CC5A 4MMZA 1F6LL 2H8PA 4S1QH 2JKWA 3VFTB 3UJJL 2VR9A 3TEZA 3G6JF 4WI3A 4H0GA 5HHOB 1F4WL 3DETD 3QYCA 1GMEA 4BHUI 2AJXH 4OBSA 2Y25A 1CFQB 1PKOA 1OOAA 1AR2A 3H3KA 4QXGH 3DSFH 1MFMA 4AIEA 4BZ1A 2JB5L 3GS0A 3IEAA 1WITA 2DQTH 5HDBE 1OY3B 2A2QT 4BV1A 5E5UB 3WEAA 2P8PA 2K3TA 4QWWD 5L8LB 5GGUA 5GGTH 1CBVL 4LAJH 2YD2A 3PIQA 4G8GB 3ZW3A 4LSQH 2PO6B 2Y07H 3BUDA 5EBMB 1CB4A 1JK9B 5ID1B 3L3JA 1U8JB 2LTQB 4YXKL 1EIBA 4XHJD 2W9DL 2QVFB 3EYQC 2BO0A 3FCGA 1KYUA 3GNML 3K4DA 5EU4A 3GI9L 1SXZA 2B59A 3CCHB 1VACB 4QTHB 5AB1A 3ECBA 2D3JA 4IRSA 2IANB 3A3YB 4FYQA 3V55A 3HRZB 5I1EL 1U42A 1SJHB 4B9CA 1P4IL 2F54D 3UZVA 4UU9A 5B1JA 2IV8A 2F74B 3MRHB 1WGOA 1I8KA 1OALA 5CBAB 1Q72L 1YEGH 1BDYA 1UM4L 1IL1B 4UYPA 1XH3A 2COQA 5EIIG 5FO2A 5I0ZA 5DQDL 3R1GL 4KX7A 5FM5O 3BT2H 1CI3M 4GYBA 4RETB 3UC0L 3QJFB 1MY5A 3KPSD 4JG1H 3GMMB 3I6GA 1UD8A 4F9LC 4WUUA 3VI3B 2A4EA 1DBJH 5ESAB 4BSVA 5IROD 5H8DA 3R18A 4NUJB 5H94A 1JCKA 5K9OB 1HZLA 1BOGA 3TEWA 3G5ZB 2H3KA 1AKJA 1XSKA 2ARJQ 4XP9L 3CDZB 1LD9B 3DTUB 4YFLI 1E8WA 5CD5C 4X98B 4ISVA 4X83A 2GFBB 2XZZA 4X9YA 4Y4HD 4B6ZA 2I5YH 4MCYB 3WFBL 4AMXA 2PWHA 1F02I 2EADA 5LGHH 2ZXBA 5A6LA 1DEEB 1HH9B 1WLHA 5L7XH 1YEHH 1F6FB 3LPGA 3TVMB 5JMOC 1ACZA 5DJAA 5KYXA 3U0WH 4PVBA 4ODWA 4IRJA 2XTJE 5FWQA 2EIJB 1LM8V 1J0JA 1SLVA 4R3SA 3FCBA 5BZXA 5JLZB 2F61A 4LSSH 3U7YH 4G7VL 2NUTA 2QQKL 1U8MA 3A4AA 1YDPA 2QHLA 1LWRA 1U8QA 5CKGA 3VFGH 1B2WH 2F5AL 1CGYA 1J1OH 4M56A 3DJRA 1PX4A 2R51A 5AAMC 1LXMA 2NY2C 3GKWL 4N0UA 2OQJA 2G60H 4QO1A 4WW1A 1VERA 4JO4H 3H9SB 3T4AC 4RBPK 2HJLB 4AC4A 1NIEA 5D2NC 1AY1H 1IFHH 3PV6B 1ROWA 3FT1A 1XTLA 4ONHB 1UWEL 3QJRB 1NGWA 3GGWA 5E2TL 3S96B 2JB6A 4UQEA 4DTGL 4HA1A 1JHKH 5EMYA 3C08H 1PD6A 4G1MA 4QXTA 1G7HA 4XOCA 3K4ZA 3NCJH 5D96B 1MLBA 2WQVA 4P2RE 4H8WH 5KYYA 2WK2A 2H26A 3SDXF 2CK0L 3IE9A 15C8L 1NFDB 1PY4A 4AYMC 1JHTB 4XVSH 3PWLB 1E6OL 2Z0UA 4MXVF 3RIAF 4FQPA 5H37G 3EUUA 4CKVX 3DKHA 1FYTB 2RAMA 3KYOA 4NRXA 1TVDA 2N56A 2ZX6A 2HRPH 2A77L 4NO3A 2QGBA 4F2MA 3QSKB 2G3MA 3QS3A 4MHHG 5I82A 4G6MH 2E0PA 1U8CA 5I1IL 2VJ8A 3GMPB 2AV7A 4QGTA 1G0YR 1MFAL 2BSTA 2CRIA 2VNCA 4JQIA 4Y88A 2FSDA 1GZHC 5GISL 1U3HC 4PW3A 3DRTA 3CK0H 4R7NB 3ZPDA 3VXSD 3WJMB 1UH2A 5JQHC 1YJDC 1M05B 3WNJA 2DPKA 2GY5A 1EHAA 1AHWA 4Y5YB 5CD3A 4Y2DB 1UJ3B 4MAYC 1F58H 4HIIB 5HDOA 4HISA 1KYFA 2XN9A 3WY1A 3HHSB 4OCWL 2MHAB 4AIXA 4I3RH 1F5WA 2C9VA 4PB0L 2YN3A 3G5VA 4D9LH 2CHNA 1BWMA 3POHA 3VXOB 4RX4A 3ISRA 1ZLDA 3O6FC 3QI9C 2ED8A 3DUSB 4XGZA 3OG6B 1FIEA 4AZ8B 3C60A 1WS7A 4FXLA 4ELME 4DAGH 1DVQA 3MU3A 1TQSA 1QI4A 4TQEH 5MEND 3O3AB 1BFVL 4GLRH 1ZT4B 2EDRA 3OHMB 4WVRA 1JPEA 4ONGL 3SDAD 2YMTA 2A6KA 2FYYA 1I3GL 1GSKA 3BUTA 3BWUC 3FB6B 1D5BB 3QORD 4ZODA 4P07A 1Q94A 5DMKB 1Q0XH 1MKFA 1I1FB 2VLKD 1XCTB 1DFBH 1E5YA 4L9DA 3VSVA 4IIQB 2VISB 2I9LB 1A1OA 3MZGB 1Z9SA 2UYLB 3QCUL 1R0AH 2MHAA 4GBXA 2KQNA 5IKCA 3V4UH 2CZNA 5DGRA 5CP3A 5E2UH 3VRIA 1V10A 4PRHE 4U6VH 3M7OA 3L1GA 2BVYA 4RDQF 1FDLH 1RZ8A 4YSDA 1ASPA 4F7TB 1MLCA 3PHQB 2B59B 2WO4A 1GCYA 1D7FA 5HXMA 2VM3A 4JJ5A 1P84K 4HAKA 3QFJE 4NBXB 2DKUA 3PP4L 4JRLA 4JY5H 5BRQA 4F9PA 3D08A 4C4BA 1QLEL 1ADQA 3FU0A 5BVJB 1LP9E 3BQUB 4NKMB 5DRXB 3UZEC 4PRBA 4WNQA 1KN4L 2Z7WA 5I1AB 1FAIL 4NZDA 4PWHA 4ZOBA 1LEKA 3MV7B 4PJBB 3ES6B 5HHVL 1O0VA 2DDQH 3EBHA 3OC5A 3H9HB 2AI0H 4HEMA 3KPOB 3LEXA 2BY2A 4G1EB 4KRMB 3SDDD 4Z1PA 1MG2C 4M6AA 3ZTNH 4J3UA 3WJJC 3CIAA 4Z7IA 4NJAH 1GGTA 4Q8BA 2NX5D 5GRVL 3NJXA 4N6RB 3RHWF 1X5LA 4Z5RB 2R56L 2ZOLA 3B9EA 3CVHH 5TE4H 1F8TL 5C2BL 1RQ5A 1KIPA 4LGPB 3WFCL 4R4FL 5F3HA 4JY6A 2H3NA 4OB5H 3VGBA 4R83A 4L5FE 2DOCA 1RPQA 1FVCA 3LEVL 1L0QA 3LKOA 1IAKB 4FNPA 1IX2A 1T83A 3WG7B 3ZDZF 3H2WA 4BIKA 3MVSA 4XMKH 1XR8B 1DDTA 4LSRL 3DARA 5I1HL 1IAIL 1ODAA 2JSFA 1HI6A 2NR6C 3OQRA 4TNVF 4TSCL 2NDGA 2HVKB 2NT0A 4XR8C 5JOEA 5F1NB 1G7JA 2JLLA 3F58L 2BRRL 4FQQA 4JCWA 1SEBA 3O2DA 4OCRL 3TU6A 1ZWIA 4Y16A 1FV1B 1DBMH 4B41A 5L2KB 4YSTA 2BS9A 3MV8D 1WA1X 3B1UA 3MOBL 4FQXB 5EUKB 2B5IB 4XX5A 1AS6A 1BGXL 1J88A 4H8WL 4IBQA 3WSQL 1AHKA 2VZOA 2KPNA 3GPSA 4DPRA 4JEGB 5AFAA 4OGAC 3QQ3A 1KUMA 1ADWA 3EO0B 2A4CA 1RZ7L 2KDGA 3P11H 4Y4KD 3RJDA 4L2YA 3J8F7 5DHVB 5C0BB 3WNOA 1DE4A 4EKXA 2E8ZA 2UX7A 4JDTL 4AEHH 3KPSA 4M3JA 4OZFA 1F41A 2EDLA 4IOSD 4P2RB 5TGBA 2EDJA 3WCYA 1ZY9A 1YO4A 3FUDA 4U1SA 1OWRM 4Q6KA 4O2CA 4LRNH 4WENB 2JI3A 4AUYA 3GHEL 1RUQL 3N1GC 3U4BL 3E8UH 1CD1A 4EDXB 2WXOA 3NH7L 4XPTL 4AQZA 1FZJA 4CJ1A 4PD4J 1TG8A 1DANU 1AQMA 1B0WA 5KVEL 5EOCJ 2JCCB 1QBLH 4KY2A 4XN7A 4X8CA 4B27A 2P46B 2X4UB 1IFGA 2XN1A 3OMAB 4HUMB 4NWTL 4OQTA 5I75C 1UQSA 2MCAA 25C8H 5SV4A 4EBQH 4ZMPA 3NQKA 2N1KA 4ODTH 3N04A 3GIVB 2VLJD 1SXNA 3NZ8A 3LQAH 4AYFB 4A2FA 1KLFA 3HZYA 4AITA 4M3HA 4XMPL 5IZ7A 1ZSDB 3RWHB 1AIZA 1XIWD 2CMRL 1PF3A 2ADJA 3IBEA 5JA8B 3RUGA 4JHWL 4WK4B 3DPBA 3EBAA 4E9WA 5D1XD 2GIYA 5GRXG 2P8LA 5GGUB 3VFRA 2Y5EA 3HFML 4IJ3B 4LBEB 3AWFA 2DQGH 1OTTC 2XWCA 2P28B 3MI6A 5EZJA 3TEUA 4N2MA 5IEHA 4TPRH 5DUML 4ACPA 3TLRA 3O4OB 1Q9LA 2ADFH 3RKDC 5KVDH 2WGNB 3KWTA 4XTRC 4AM0B 1A6WL 4UT7L 1U2HA 3VAEA 2WWKO 4IS6A 2KLSA 2R29H 4N85A 4WNJA 1OP5H 3ZE1F 1NLDH 1A6ZB 2GKIA 4XCYB 5DJ0B 3RWHA 5IOKA 2NR6D 2OMBA 3NCXA 5EB9A 2YQGA 3RDTA 1OAUL 2APFA 1MWOA 4IDJH 1CFVL 4UM9A 2XIIA 1AH1A 4NC0B 3DV4B 4G6ML 4P4KD 4FA7B 3GHPA 3U7WH 1CDGA 3QJUB 5CMAA 5AVZB 1Q1JL 3OWRA 4QF1A 4DEWA 5T1LB 1E9QA 4TOYH 2VJ0A 5D7KD 4FI7A 1J87A 4YSOA 3V4PA 3ZT6A 1JDDA 4MZ3A 1QABA 3TT1H 1MQKL 2VN6A 1RK0B 2VLLB 4QOKE 2K6ZA 1J9QA 2IH3A 4N86A 4TQIA 3V9EA 1BZ7A 3X14A 4X5QA 4UDTA 2APTA 1BXUA 2ENYA 3DGCR 3PJSA 4X6CE 1IGYA 3VJ6B 1HCVA 1T1ZB 2D8KA 2PNDA 5KVGL 2P5WE 2Z8SA 2V3DA 32C2A 1MY7A 1NDTA 5D6CB 4BYHA 3BAJA 2WHVA 4NCC2 4XNUH 3T8MA 5BO1L 3ENEA 2RA1A 5GGRB 3CFJA 4G3YL 1CYWA 2HRHA 2GSIA 4K7PL 4N5UA 1I4FA 3CHXA 1EZUA 4GW5A 2WXHA 1OIOA 4Q4EA 1E4XH 4CMMB 4M7LT 3LEVH 5HGAB 5AOLA 5LBGA 5EEYA 3ZMEA 3ARTA 4U4BA 3QORB 2ADIB 4M6ML 4GG8B 3RA7H 3LVTA 2DH2A 1FBIH 1U92B 2C1PB 3FOMB 4RFNB 4UT6A 5AL0A 4R4NC 2ZPKH 2WN3A 1A4KB 1WFJA 5LUMA 1SRDA 1N5AA 1OWWA 3AXHA 4XMWA 4YR6B 2YD4A 3ETBJ 3D2UD 4HWZB 4U1LA 4JFQA 2YD7A 4HD5A 4DQOH 1OSPL 1DBML 5F7AA 3UADA 4PJ5D 3ZTJG 5C0AB 5EZPA 4M7JL 5C0IB 1KN4H 1ECZA 3D4CA 2HRGA 2ZYHA 2YPLA 1L9QA 2H6UA 2WWMD 2IBZX 2YGQA 4L3CB 1NAKL 2EE0A 3UG4A 3IKCA 2LFGA 5KZCD 3MRPA 3NJMA 1I53A 5H35A 1TTFA 4MS8C 4X4YB 2BVPB 2XNAA 5LGJA 4DEUA 2FR4A 2IFGA 3DJTA 3KCWA 4K94H 3L3OA 5L0QC 1A7OH 4UINH 5ENWA 2QZ5A 1Q90A 3CN4A 3P73A 1G7PB 4NRXB 4XODA 4AJVA 1J9TA 2X44D 4QHLA 1CXEA 1P4LB 2CGRH 2WXNA 5G4NA 5FYJE 2GJ6D 1MRDH 3Q8FA 2BCMA 2CDGA 1E27A 1JZDC 3LQZB 3T08A 2OR9H 1O9ZA 1YEDA 1DDHB 5LAPA 4L4TE 3DPBB 3RGVC 1DJGA 1TQWA 1J05A 3LEYL 3U6RA 1OF0A 3UTZA 1JZHA 3DA0A 3ARBB 4HJJH 3TP4A 4FHKA 4WFHD 1OGPA 3GSVB 4F8QA 2B77A 3U7AA 4MQXC 1U4FA 3LQAL 4LO9A 2XIBA 4M93C 3LV3A 1QA9B 5CGTA 3VXTB 3C08L 5D7EA 3IU3A 3KXFE 2KS0A 4P2OC 2Y5TA 1ZD6A 2Z0BA 3JWNG 4IKJA 3KPLA 4OVUA 1A14H 3P73B 4B97A 4U05A 1R24B 5HGDA 3UAJA 3SKMA 1CN4A 2CD0A 4DJMA 2YGNA 3B7RL 2HG5A 3QH3B 3RDTB 3ATDA 2X4NB 1L4IA 3KPPB 4Z3TA 4ACTA 1MFBL 2G30A 3T0VA 2XKNA 2YIHA 4PY8J 1NEPA 1EEUA 5F7BA 5D70H 4QKXB 2AGJL 2WUCL 4DHLA 4ABWA 2X4OA 1GZQB 4JO3L 4DZ8A 1GGIH 1I31A 1Q0YH 2K9FB 4DN3H 1RUMH 2FYYB 3BKML 1HYSD 4PREA 3Q2VA 4HHAA 3ARED 2E6PA 2H5UA 3QUZB 4JLRB 1T1XB 1R3JB 3QQNA 1BMZA 2XQYK 3G7TA 2IIJA 3IGFA 5T1DH 1ITCA 3UL4A 2IH3B 1G9NH 1HS6A 1RPUA 1PSKL 3D3VA 2NCMA 3P11L 2MPVA 3PP3K 4AVIA 5F3BA 5SX4I 2F5BH 1EXUA 4PN6A 2OMZB 4GEJA 2F2HA 4M4PA 1MAMH 4P5MA 4X4ZA 1YUKB 2CGYA 2BOCB 4MJHA 4WWKD 5F1KC 5IBUB 5EA0H 3GRWL 4MRCA 1TQVA 3OSVA 5IJDC 3IM1A 3GUTA 4N2HA 3C8KA 2NY2D 5ABAA 1NCDH 2FBOJ 5KSBF 4QYAA 1YNTA 2BNQA 5EIQA 2BOBB 1IBDA 3KPQB 1WF5A 3RUGF 3Q48A 2VDMB 4B9FA 3NPSB 1FFOB 2FDBP 3GHEH 2JTDA 3GBLA 3U4BH 1WWAX 1BIHA 2HKFH 4ZW6A 5KSVA 3R4DA 3V6OA 1RFDH 1X44A 4MKMA 1GPOH 1YYML 1IE5A 2IWEA 1ZHBB 3QIWA 4JCMA 3VI3F 3P40A 3T3ME 1NMAL 3SKJH 5DFVD 4LEBA 3ZT7A 3CCHA 1T1ZA 3OF6D 4PJFA 1AVAA 4YFDB 4ZNEA 3MNZB 1A66A 1FVDA 1OARL 4MXWH 1LQSR 2PYED 5T5FL 3VFVB 2FIRT 4JFED 4PJ5E 2C4FT 5C1MB 3E6HA 1G94A 3PWNA 1GIGH 4UZGA 1RMFH 1MFEL 3D9AL 1KEMH 3T9WA 4QOKD 1B4JL 4NT6B 2WLIA 3DTXB 5FYLH 3MX0A 5C9JA 1KB5B 4KJPC 4ELDA 4KK9C 3AACA 4AY0A 1R6VA 1N0LB 1ICTA 2YUXA 4PMFA 1E9OA 1RZ7H 4DP9X 1HU8A 2MOQA 3WEMA 1XGTB 1VFUA 3GBNL 2LLLA 2PO6D 4UV4L 3KS0H 2NOYA 1AC6A 4GW1B 4URTB 1OAUH 5ACMA 5C0JB 3INUL 3H3PL 3FUHA 1INEL 2WW8A 4R7XA 4DUVA 5B39A 2IDFA 3BN9D 3H6JA 4YHZL 1DBKL 3MRNA 1MCCA 4TTDD 3MR9B 1NUGA 5BPPA 3K91A 2AQPA 2W81C 3IPBA 3P0YL 1ZKAA 4XHJC 3D4ZA 4C4KO 4FTVD 4JDEA 3LNDA 1WP6A 1C08A 4XE5B 1S7SB 2ICEA 1KBPA 3WXVL 2OYPA 2OMVA 4Z7QF 5L2JB 4PJ8C 4PRPD 1IKOP 1T5XA 1RIVH 2P8LB 4LLYA 2VR4A 5AYUH 3UTTE 3D12B 3ULAB 4U0RC 1AQ8A 1QR4A 4L8BB 2WIIA 1SMDA 3T2OA 3I9IA 4IIQA 2VRQA 4OZGB 5EO9A 4CN4A 3ARRA 1P6AB 1PZ2A 4ZXBC 3T6XA 4NNXB 1OW0A 2O5YL 1ZK9A 1AXSA 2X1XR 4AMKH 3A67H 3PFQA 2IALA 3T2QA 4OB5L 4QAWA 1QFUL 3KG5A 3C2AL 4MBRA 1TJGL 4Q52A 4MZ2A 2XZQH 1HEZA 1G9MH 1Q4NX 4QJ4B 4Z3HA 3FQNA 4G6KH 3TEYA 2CXKA 4LXFA 4KZEL 3IDYC 4YDVB 2DBLH 5AAMA 3HZ3A 3ABMB 1FPTH 1JXJA 3TJPA 2BRQA 3QIUA 4I9WD 1M1XA 2Y1ZA 2KERA 3RL1B 3MJ6A 3ZR5A 3SD5A 1YPZA 3EO1A 2EXTA 1SHSA 3BX7C 4TNEA 3QNZB 2GK0A 2Q20A 2UXTA 1U58B 5HJBA 2ICES 4KAQL 3QDGE 1JJUA 3QZWB 4TUJA 4TUKH 5ITFB 4UQIM 2EIDA 1MNUH 3DJSA 3MCKA 4PGDA 2W07B 5CZVL 4M62L 2WBKA 5JHLL 2CDFB 4OCRH 3D85A 1D6VL 2ZXAA 3EUDA 4HMCA 4FNLH 2NY1B 1FZMB 3MO1A 1YNTF 3EOYG 1WSST 4L4TB 4NUMA 2VLRA 4P2OB 2VDKB 4R84A 3IMSA 1QSFB 1T21B 3EAKA 2MKLC 2BJML 4OQTL 1PLCA 5D71H 4LOFA 3K71B 1E43A 1YNLL 3MJWA 4UIKH 3NCWA 3PLYA 4IEFA 43C9B 5AEAA 3MGOB 2DTML 4YFLF 5D7JC 3AB0B 1PAMA 1S5HB 1OTSC 4JDEB 1QKZH 5D8JH 4JPWL 2GSMB 3PABB 1RPKA 4I1RA 3OQ3B 4GIOA 3RFZB 4EPSA 4XI5D 5AW3B 1J48A 3P9LA 4K07A 3N42B 1L9TA 1NL0L 5DFVC 3DX3A 4XN4A 5CXPA 5IROA 4F92B 4KDTC 43CAB 3P0GB 4YAQB 2FD6H 4QXGL 4NO0A 2VYRE 1HHKA 5JHDE 2JWYA 3G5VB 3I75B 2Z91A 2WBJB 4BDVB 1AYOA 1BWWA 4H8UA 4PGJA 3E6FA 1CJYA 1YYCA 4XMUA 3FZUC 2JXMA 4U1NA 3LY6A 5DVMA 2Y7QA 5I1CL 5BUAA 2PP7A 1EXUB 3PWNB 5INDA 2LLNA 2EJ1A 3VFWB 4L5FH 5EC1A 3QDGB 3QQDA 2X7LB 3MTRA 4MRBA 1USQA 3T2NH 1RH8A 2CR6A 5GS0D 4HK0B 4KKCD 1MIMH 1JFQH 3U4EA 5T8IA 1XZ0B 1E28A 4B9GA 4R5XA 2BIIA 2YUVA 1WZKA 3QAZC 4OGXL 5I17B 5HYEA 3B2PA 3FTWA 2Z35A 3RURA 1NBYA 3FRPG 5CD5D 4JPKL 1JZ2A 2CO6B 3EZJB 3VCLB 1PD0A 4H88L 3BZEB 2KT6A 1RZQA 3V9FA 4F7PA 1HHIB 4IKNA 4XP5H 1JNHB 1RKRA 1SVBA 3FSAA 3UO8B 3NGBB 4GAYB 1HHJB 5DJCA 4KH9A 4N0FB 2IAMA 1S7TB 3U6XA 2ZCKL 4JRYD 1BVOA 1WIUA 4YHIB 5B1AB 3BKMH 1M2OA 3NJIA 5JDJA 2V3EA 3QWOB 1YEIL 2V5TA 3ESPA 2J5LC 4LCVA 3L1FA 1I1YA 3FDWA 4FQJL 3TZVB 4Y9CA 5FUZH 1KNOB 3JV0A 3LS4H 1X9LA 4X6FA 4FQCH 2UZYB 3RIFF 5IB1B 1OT2A 1S9XA 2E27H 5AOMA 2WJ7A 3U6RB 4GKNB 3DGGA 5E1HB 1TPXB 1CLVA 5LDSA 4LLUA 4DN3L 4OFYA 5B3SB 1PZBA 4Y9GA 1FZOB 3UZQA 1AGBB 3FW6A 4K23H 3ZRFC 1D9KB 5K59F 5DVPA 4FS0A 1P6FA 4S1DD 1C5BH 2GTWA 3DO4A 1MCWM 2CKBB 2J73A 4QO1B 3IDXL 4L8SC 5TK4A 3UBGA 4PV8A 1DBKH 1GW6A 4W9FC 1LK3L 1NICA 5LXGL 3EFFA 4F80A 4XOAA 4MNGB 5EUOB 1N26A 1V05A 2DMKA 3EH1A 1BEYH 2FH6A 2VAAA 3OB0H 2WWKT 4QAMB 4Y5XA 4ZT1A 5A40E 4NBZB 4RZCA 2X4NA 3KJ4B 4Q6IB 4PU2A 2DQJH 3KPMA 4MD4A 3ULVH 1DVYA 1U8CB 2R7EA 4KI5D 3VXSA 4RX4D 5F9JB 4KO9A 4ATTA 1BAFL 2UUDK 5EU6A 1RZIA 4MZRA 2Q86B 1U36A 4NO5A 5KVFE 3JUZA 2Q10A 5T5NG 1QEXA 1UM6H 5DDHA 1OPGH 2EH7H 2XN9D 3OGOE 5F96L 3WNNA 2PW1A 4HUKB 4OFQA 1NGPL 3DOHA 4LAQH 5F7WC 3VM5A 4I9WE 3T0AA 3DX1A 1D2PA 1GSMA 1OCCB 2EE2A 5LG6A 5I8EB 2I7SA 1FAKT 3W37A 3EFOA 3HI6L 3FQWA 2OR8A 4M7ZC 4F27A 5ADPL 1YAZA 1BF2A 4GMTL 3HHSA 2CH8A 4FKKA 2JJUA 5JZ7C 1KYOK 5HHPB 2MQGA 5D2NA 1CFBA 3PJNA 2CK0H 3UYOD 3EFFB 3ARBA 3CMGA 3II1A 1ZA3A 5D5ME 4QRTA 4HU8A 2LAGB 5LJYH 2QPEB 4FFWD 1GGIL 1P69B 3WS3A 3PUCA 1I1FA 1BQ5A 4YSRA 3WIAA 1PBYA 1H6FA 1HXMB 1CGTA 1TJMA 1HHHB 4P46A 4QRSB 4Z76B 3RTQB 2NYZA 3UX9B 4OIBA 2UYLA 5PAZA 4YBQC 1A1OB 2WXPA 3LHPL 4JKKA 1NIBA 2IEPA 1MHEB 4Y1AE 4XPHL 2CCLA 4BZYA 1P0SE 4ZO9A 4TVPE 2AAAA 2FO4B 2E7MA 4QHKJ 1M4KA 2E9WA 3CVDA 3T04D 4P4RA 2Q2EB 1QHQA 5EA0L 1W72L 3MUY1 4XNAA 3UCRA 1CGUA 4Z8FL 1MH5B 3SY0B 3SE4C 2XQYA 1INDH 1PW3A 1VEPA 3K2IA 4LPXA 4W81A 5EEXA 3GQFA 1LE9A 3WUWA 3O6ML 1NSNH 1YY8A 3MZTA 2NY3C 3AFLA 4LSSL 1KCBA 1P5UB 1FL5B 2OZ4H 2CKNA 3QPXL 2AZAA 2QADC 1KTRL 3IJ9A 2QQQA 1ZTXE 4AVKA 2WANA 5A2CA 2R1WA 3J2PA 4JJ5B 3OJMB 1U8JA 4GSXA 5C6TH 4C57C 2C1PA 3FOMA 1I7ZA 3PE9A 1JRHH 5I17A 2G60L 3W0WB 1BIIB 4PGEB 4DP1X 3PPSA 4F8PA 2AXFA 3ZSTA 3O41B 1JYWA 2APWA 1PZ3A 5DD1L 1T4KB 4TULL 4EUPG 1CL7I 4O4YH 1AY1L 1IFHL 1NGYA 5ELIA 3WUWG 4KC3B 5D1ZA 5C08A 4B0MM 2J6WA 2EKSB 5DFAA 1OAYH 3RVWC 5I30H 3ARFD 1T0OA 1CZ8L 3VFWA 1YPZB 3EO1B 4LSUL 3ZKMC 1QG3A 3GI9H 5KSAC 3E6FB 4CSPA 3N40P 3LOWA 2UZYA 5DJDA 5IB1A 1R3KB 2FNBA 3HG0A 3MKGA 5BRZA 5E8OB 4XP4H 1G0XA 1UXWA 1Q9LB 2FX7H 4Q89A 3KYKL 3QPQC 2I9TA 1A4BA 2YOCA 3L4TA 5T1KB 3W2DH 3SGKC 4XTRD 5EU3B 2FEDC 3IJ7A 1PQZB 4TTGA 5DTFA 4NFBA 1HHIA 1K2DB 3NSJA 2EVHA 2VLMD 3S0PA 5C0FB 3C6LC 4Z7NF 4GW4A 2D7QA 3VXRD 1LDPL 1F4AA 1CR9H 2C7UA 4XVJL 5CAYB 1BBJA 1F6AB 3HG1D 1D5MB 1NINA 3A24A 4H2CA 3GSRA 3VA6A 4M5YH 1AGFB 3VD4A 3FT4B 1A7BA 5TFSH 2X9YA 5DD6A 4NM4H 1U8QB 1AGDA 1M53A 1A8JH 2V0AA 5DJDB 2CLVA 2P24B 2V5MA 1JWMB 4NHCL 5CSZB 2W80C 4MD0B 1XEDA 4IBLT 3PXJA 4WGVB 3MCKB 2D7TH 3A67L 5E6UB 2EDTA 3ZHNA 5AZ2H 2DQ6A 3QG7H 2PPEA 1YYLL 2CHXA 2WXQA 1REIA 1WGVA 3SYOA 4LPTA 1RZFH 1JPSH 1J5DA 5C08B 3UBXA 4LGSB 4A68A 2DBLL 4ANUA 4HZLA 3WKMH 2PTVA 4P3WA 1U8HA 2E75C 4TQEL 3JTSA 2MIZA 4P05A 2OL3H 3DOSB 1R3IL 5FYKU 2EDFA 2R2EA 4XN9A 1L9OA 2V5SA 1U21A 1EBAA 4UM9D 4NNXA 3CNKA 1Z0NA 2WXRA 4KTDL 4XO9A 1VGKB 5EU3A 4AL8H 2AVGA 5AW9B 2JELH 3QCUH 2WSKA 1EZLA 3GIVA 3HI6H 2EUVA 1OTUD 2EO1A 1NLBH 1R5IA 4A1RA 1T22A 2OMWA 1A21A 1LNUB 4RBPH 3WN5C 2YD1A 2NLJB 3LJ3A 4PJDA 3HE7A 2VN4A 2GHZA 2W65A 3T8VA 4ZNCD 1JWSA 4ZTPH 1TZGH 2NUPB 3EYVA 3I9GL 3UJIL 3DMMA 3H9ZA 3CVBA 2L8AA 2ZWKA 3H3PH 4XO4A 4B53A 1CGVA 1UOKA 2O26U 3OZ9L 3ZYZA 1VB9A 1RZPA 4DP2X 2RMNA 5HYJE 4X0KA 3AU1A 5DXWA 1EVUA 2CLVB 3FQUB 4JO8A 4EIBA 2MNUA 1E7VA 2W0KA 1E8ZA 1KIQB 1ND0B 4OZFB 5HHVH 1KJ2L 2X3BA 5F88B 4ZBJA 5GHWL 2A83B 5KJ7E 3DO7A 1BM3L 3V4VB 3RJQB 1RUQH 3IF1A 2R2BA 2PWFA 4PM1A 2I07A 4LVOB 2Q8BL 4ZW7A 1LP9A 4M6OH 4F9LA 4LVHB 4FXGA 3MRJA 2DIJA 4FCHA 5ERWB 3ULVL 4OGYH 3GSUB 4EJ1C 2BW4A 4YDKH 4EBQL 4JHUA 3RX9A 2FECI 3SPVB 3STLB 1QTSA 2J2ZA 3NZSA 5D93B 2FAUA 4LVOC 1R75A 2R15A 1EAPA 3S48A 1DTUA 5IOPB 4FI8A 1QOKA 1U3NA 1EFXD 3B3IB 3WFZA 3FT0A 4NPYB 2VSMB 4O58L 5ADPH 4CU6A 5FHBL 4YHNA 2E9JA 5MERB 1EANA 3NZHL 1SBBA 5B39B 1JZGA 4NZRH 1Z9SB 3Q05A 3U2JA 1NFIA 4NOFA 5FW6A 4JQXA 3Q6GH 5IB4B 4DVRL 2FL5A 5DJZA 3FF7A 2EIZA 3GJFK 2X0WA 5FYKH 5IWLC 2HMIC 5T3XD 1PTZA 1WFUA 3BIKB 3DBXB 3DPDA 1ZHLB 2X40A 1Y6NR 3NA4A 1I8UA 4GSDL 1YEIH 4R96B 4Y4KA 3NEOA 2WP3O 2XFXB 5IW6A 5FYKD 5FM4A 5AB0A 5T3XH 1BGXH 1P84J 2CO3A 3G5XB 2A0LD 4RH4A 5E0QA 4HKXB 4Y0GA 1NMBH 3OD3A 1EWHA 1G87A 1F97A 1KGCE 1J5HA 4OJCA 3ET9F 2BIMA 4E0RB 4H2AA 1AO7B 3G9VA 3OGCB 4N5EC 5FGBA 3QDJA 2YXMA 1EH9A 1J8RA 1URLA 3ASWA 3HVNA 3T6VA 1G7MB 4WKZA 3QUMB 4PTTA 3FK3A 1M42A 4TNFA 4ZXBA 4JFDB 2F8XC 5JORB 3JV6B 5TJWK 2A9MH 2WIMA 3EDJA 3V0AC 1M71A 5DR5H 2B9AA 4FQXC 2FB4L 2H7WA 3HS0C 3EYQD 3PAZA 3QJXA 1MCPL 2W60A 4ATWA 3DX6A 1MUJA 3DX8B 3EHBC 4JFPB 3P4LA 4EKJA 2GTQA 1BZOA 4PWFA 2ZKXA 1KJVB 4PJCA 4ERSH 1G4RA 3APDA 3DX2A 4CNIB 1YN7B 3KEDA 4JAMA 1E6JH 3CZLA 3PWPB 4L9LB 5CP7A 3X3GH 3AU0A 2A6IB 1A5FL 4J27A 3JVGA 4JY4B 3NSDA 3UGUA 2CNYA 2WLJA 4OV5A 4MXQC 4ODUA 4X6DB 5DRWB 5TE7H 1BF8A 3QDME 3GSQB 4H25A 4OZIA 3AG3B 5JPMA 4DVBB 1AQHA 4K2UL 5F6HI 1HCZA 3S35H 3HS9A 4JPVL 2AK1H 3EJTA 1J05B 3N42F 4TULH 3UBFA 4UV7L 1I4FB 4IRJB 7CGTA 1OK0A 1IAIH 5C0GA 5LG1A 3TN0B 4FLRA 3C6EA 3S36L 1L7TL 2Y36H 4UQBA 1E27B 2R1XB 4KQ4L 3RGBA 3VFPA 1WG3A 1VFBA 4KTEH 4LCIH 4GG6E 2HLFD 2F54E 3MJ7A 3OZLA 3HNSH 5DDHB 3CJJA 2ZCKH 3P3SA 1HSAA 2DI8A 5JIKA 1F4XL 2YD5A 2NMSA 3QZMA 4FG6C 3WEOA 4N8VA 4HKJA 4Z7QB 5E6IA 1JVKA 1HSBB 1C8QA 3B1TA 3EJUA 3IKCB 5J6SA 5TPWL 4N2OA 4DEPB 2HLFC 5H35B 2NNAA 2VZVA 1OCRB 3NDZE 4TVPH 5GJTH 5JDSA 1WPCA 5DMYA 5JPNA 4P5TB 5AUMB 4OZGF 3CTTA 4GBXD 2EUZA 1A6TA 2JCCE 3GSNB 3VU1A 1L9RA 1OE1A 4IJ3C 4XC1H 1A2YA 5C0IA 1ID2A 4XAWL 3QULA 1DQDH 4PCKA 2QTVA 3UTQB 5M94B 2EKSA 5ITBH 3B43A 4JG5A 2CLZB 4LPUA 5J6GB 1MI5D 3O4OC 4CVUA 3APFA 3BVNB 5DZLA 5ISZE 4P5TC 3IJYA 4JFZL 1IM3B 1KPVA 3NTCL 4UQ2A 4Z7AA 1UZ8B 2Y22A 4GOSA 2ILLA 1D3CA 5E4EC 3FCTB 4AVHA 4F7EB 3L95A 3QUXB 1BYOA 2CGZA 4KJQC 3L5WB 4JZOA 5SX5H 1KG0A 2RTTA 3ZE1B 3BSZH 3CZEA 1QVOB 3PL6C 4CBPA 5TDOA 3DSFL 1MCLA 4JFEA 2VW6A 5DD5L 3VXME 1VKXA 3RGVA 5IJVA 4KX8A 5JIHA 2VXVL 4JGMA 4V1DD 2AEPH 1LO3H 1WA0X 4L4JA 1W0YT 1IVLA 3PGFL 2EIZB 4ZO7A 3JYBA 1MH5A 4GKZB 4LCWA 4AGOA 2IOMA 4K0OA 3L4CA 5BMFL 3T0EB 5DS8B 3I50H 5FA4B 5H94B 1BXAA 1N7ML 4C47A 3NEEA 4X99B 1ZLSL 3ZDXE 2E7LA 5IBTH 4DPCX 5HTSA 5BS0E 2VMCA 4KNQA 1R17A 4JE4B 3P54A 4N5ED 2FX7L 3O9WB 1YQ2A 1WT5A 5E7FA 2HJLA 5GS2D 2J2ZB 1I1AA 1LP9F 2G4EA 2W5PA 3Q43A 5DHYA 5GZNC 5LB1A 2WKGA 4AWJC 1PNCA 1KT2A 4KVCH 5DD0H 4DNLA 3GBEA 4LP8A 1LK2A 3C75A 3GTTA 3RVVC 3RWEB 4UQ9A 3WO4B 5A2KH 1IM9D 3EG9A 3GSVA 4JFQB 1T3FA 1JK9A 3P3YA 3RILA 4HLZG 1RL1A 3OX8B 1I8LA 1CCZA 2VJXA 2WXIA 4KKLC 1ILSA 2ZKWA 5EU6B 2K0RA 4XNZB 4QRRA 2R29L 3DWTA 1I85A 2AW2A 3FQUA 3KYMB 5MHSD 4GRLC 2PW1B 4MDIA 5KANI 2B3IA 4PS4L 3FFDB 2VW4A 1TNNA 3QCTL 5L9DH 2BNQE 3A6CH 1RV6X 2XJLA 3RVWD 3ZDXF 1TTAA 3RVUD 3WNMA 2AJSL 3GRGA 2VMJA 3BPLC 4KQ3H 4ZD3H 2OMXA 3VFUA 4UF7C 5T3XE 1CDHA 3DX0A 5KAQG 1UM4H 4N8UA 3VFTA 4QHMA 5E9NA 3I6LD 1USZA 4W9KC 3QHFH 2QVTA 4OCSL 4Q97A 3NIFE 3I6SA 2OTUA 2PCFB 4PRIA 4C58B 1CFQA 2VOTA 4PJ6A 2RBLA 4NP4H 4GMSH 1KIRA 4YX2H 3GM0A 4MCZA 3SJVA 1YEJL 4ELMB 2GHWB 1TIUA 4U3SB 2WQSA 1MWAB 4D0CB 5IQNA 1T80A 4KK6C 5KSVB 4YHPA 4EO5A 5J1AA 1MJ7H 4HZAA 3W82A 5I66A 3CPLA 4KY1H 4NPYA 2ENQA 2FQEA 2LVEA 2FZ3B 2JJTA 5IHZB 1UCBH 1OARH 4MXWL 1A3ZA 5D7LE 1IJNA 2VERN 4FNTA 2PUQT 4G3YH 1YEHL 4PJIE 5I1LA 4ZFQA 1AIFB 1RJYA 1NGZB 3EJZC 1P9MC 1YUHA 2BDNL 2OL3A 5CN2A 1A14L 1X6NA 2GABA 3QC5X 2ZAGA 5EOQH 3UEZA 4BSWA 5C0RH 3AS2A 4LDLB 3UBXB 1WWBX 1P7QB 3OKMA 2M26A 4XCFH 1QSEA 2XBDA 4APXB 5IFJA 4NLAA 5F0MB 3EH5B 1IEBA 4M00A 1PDKB 2FUQA 2WUCH 5TH2A 3PGDA 4DZBA 3KXFA 3S36H 2Y0SA 4OF5A 1DBJL 3IDYB 1N0LA 3UPCA 5L4FA 4WHYG 3AY4A 4HC1H 5C0BD 2BZ7A 4MYPA 4EIGB 5EN2B 2DAVA 5E99H 5B1CA 2NZ9C 2XA8L 4YNYB 2WVSA 1AR1B 2EVJA 1S5IL 4X42A 2VLRB 3FH8A 4LKXB 3TYFA 5I75B 4MXVE 2NYYC 2AJ3A 2CUMA 5GRJH 4S1SL 3QUYB 1PSKH 3KWVA 4FTVE 3K72B 4MA3A 4NIYE 4R4BB 5AZUA 4PGDB 5MENE 4ICWA 4XP1H 3Q3GB 1AZUA 5LBSH 1PG7H 1KCWA 3MRMA 4BBWA 3E9TA 1AD0A 4PJDB 5JIIA 1JHLH 1KIUB 5DO2C 2XWTA 5MEQB 2VDOL 3ZIYA 3CZKA 4M1DL 1RIUL 1ZWIB 1QUNA 3JWNH 4Y16B 5E8NA 5E00B 1F3DJ 1JMXA 4U3CA 2EUXA 4OCYH 5I5JA 2ED6A 1OAXH 4ANKA 4CW1A 4Z7QE 2CO7B 4MNHB 1DJSA 1CFNA 3L9BA 4ZUWA 5LO7A 2ZAIA 4LQ1A 5CJOH 4EZLA 5HHNB 4RFEA 1KXHA 2WUBL 1S5HA 1WV7T 4DPAX 3NAAH 3HE6B 2PMZA 1J8KA 2VRAA 3TO4C 4P23C 5FAAA 3F7RA 1EJOL 4PJ9A 4YDLC 2GK2A 3MBED 5B7EA 3OHXB 1T66D 1T5KA 4PRNA 4TVSa 4L4TA 3X17A 1QYGH 4PJ7B 3WGVB 4A66A 1V54B 3Q3GA 1MJUL 5HI4C 2OMVB 4PPTA 4ZO6A 5F3HB 2XC8A 1DJIA 3V4LA 3ZYIA 2Y06H 1ETA1 4QYOA 3RPIA 3KGSA 5E5MA 3HKZA 3DJ9A 5T3XL 2YD3A 4QY8B 3C6LD 3ARGD 1J10A 3VI4F 4XPGH 4HSCX 3QJZA 2OSYA 4MDIB 1XCQA 1CE6B 3EDFA 1R19A 3HLAB 3Q1SH 1I8MB 1CURA 2QV4A 2XYCA 4WK0B 5D5MB 1KXTB 3QPQD 3QWRD 4D0DB 3PYCA 5DFTA 2WVUA 4NGHL 2OZ4A 4JO3H 1E5ZA 1FL6B 1OSZA 1GGBH 3ARDB 3HCVA 3BCDA 4K5MA 4NQVA 4OZ4B 5I5MA 2VR3A 5C09E 5AKRA 3FQ4A 2BS71 4YHZH 4QT5A 3MYJA 3KLSA 3EG9B 3UJJH 4WO4D 4Z95L 2X88A 4LOUD 4NQTA 2XY2A 1EO8H 4Q9QH 3GDCA 2V9TA 5HHMB 3C09B 5E1GA 5MI0B 1LE9B 2H1PL 3ARUA 1L5GA 2DQFB 2X6VA 1NL0H 2BSTB 5IB5B 1DJXA 3ULVD 4NO2B 2ICEB 2IH1A 1QQDB 3QA3B 5GGQH 2D4DA 2VLKB 2XV2A 4JM2A 1A7NL 2GTZB 3T0BA 1PAZA 2DQDL 1IT9L 3LZPA 4AE1A 2YEQA 5C09A 1IBYA 4QRRD 3SPCA 1OSEA 1ZIAA 3OG4B 3CSYB 3QIWB 1YG9A 2DM7A 4A38A 4BK5C 2XQ0A 2WJ5A 2HFFB 3OAZK 1BZQK 3GO1H 1NWPA 2YKLL 1U2YA 4NN7C 4QCIB 5CJQL 1S9YA 3UAAA 2MRYA 4U1KB 1GY2A 1RJZA 1X9RA 3PL6D 3DI3B 4GAGL 4HVBA 5DS8A 4HPYL 4WI2A 1ZK5A 1MREL 1OCWH 1QNIA 4KJQD 1EEZB 1M2VB 2ROYA 2ZZUT 1YMHA 4YBLB 1LO0H 2EYSB 4IMKC 5I1AA 1OAZH 3UXFA 3L4WA 3MRBA 1HIML 3LZNA 4QRPE 4JFFE 3VNZA 5L2KA 2WLIB 5DQ9B 2Y6SC 3MLVL 5DF0A 1L5GB 5HHQA 4LCIL 1UWEH 2KZBA 3QUKB 4ZOAA 2ZX5A 4JO2H 1ES0B 5I1JH 1PJWA 3F3HA 3HTLX 1XEUA 1DZ0A 3K5RA 3QZNA 4S10A 4U6YA 3ZT5A 1J8HE 4GBXB 5IKCB 3ZTJH 4HS3B 5I1KH 4YHIA 4N0CC 5B8CB 4GRWE 5FV1L 1GC1L 4Y4FA 5J12B 3UAJD 5GRZA 1O9WA 1OP9A 3S34L 4FQCL 2DWYA 1OT4A 4JR9L 4Z3EA 1HJCA 1X5FA 5CEZD 1EGJL 1TTGA 4J4PA 1FNFA 2J20A 5F7UA 1BFOA 2AQ1A 3I9PA 5F7YC 1GYVA 2B8OT 2V17L 3MRIA 1JG9A 4OFYD 5T1JA 5T3ZL 3EJZD 4GW5B 1I1RA 1MW0A 4RZCB 1AZNA 1XBRA 4NUGL 4JRXA 4HK0A 5EOCH 1VEMA 1UWXH 2FJFA 3LX9A 3P0YH 4PLOB 2Z92A 5D2LA 4BUGA 4EZJA 4QTIL 3VQMA 2H32B 1ERNA 2ROXA 3IFOB 2QVIA 4K71C 2Q76A 3E8UL 3OTTA 2Q7YA 1O6TA 3PDDA 5B4MD 5I16B 3RVXC 5JUEL 5FB8B 1Q9KB 1VHPA 2UVEA 2HTKC 3QUMH 4HWZA 3PJLA 5C0EA 4R5TA 4HIXL 4WO4B 5ECGA 3Q5TA 1BQLH 3QJFA 1NDMB 4FOMA 1XL4A 3O6KH 4U2ZA 3WN6A 1QHOA 3IJEA 5J13C 4ODSL 4I5BA 4JJOA 5KBLA 1AO7D 4FHJA 1XCQB 1XZ0A 3ECQA 3S3PA 4TRPH 2X28A 2EXSA 5FUOL 2RJMA 4KZCA 4PSRA 3NP4A 2RD0A 1GHFH 5ILTL 5JO5A 3QFDB 2XNAB 3BN9C 3QEUB 2VISA 4B9IA 5LGJB 2W9EH 4JDZA 2FR4B 2VGLM 3GMLA 3QG6A 4Q6YA 2BHUA 4G7YH 3V2AR 1GCFA 1RP9A 1TMQA 2PKDA 5GPRA 3ARGB 4NQED 1GZPB 3OWEA 5J06A 1DVFC 4U49A 3A6BL 1WICA 3HNVL 3QJHA 3ZO0A 2W60B 1BP3B 4FMKA 5DRNB 4QR7A 4AQ8C 4HX1B 3L7EB 4CC1A 4LHUA 2BDNH 2VXTH 1IRAY 3O0RH 4OSUH 4ZUVB 3QHTC 2MQCA 4QRAA 4AVJA 2KBGA 2EDMA 4ZOEA 4Q4IA 5DQJB 5EN2A 4GJTB 3NP3A 4Y7OC 2YAPA 1WQVT 1BZ7B 1G1CA 3UMTA 4MKTA 1TLMA 2ZCLH 1QNZL 1ZIBA 4GUCA 3IGKA 1AZCA 1TTRA 4GRLA 3NPSC 4YDIH 3T09A 4H1LG 1NC4D 2CJUL 3W0WD 1O7DC 4HPHA 4JRYB 1CQKA 4ANXA 3QK0A 1DSFH 3ZE0B 1OGTA 5HDLA 5JIMA 4P57A 5E8PB 2GJ6E 4H0HB 5TQ0H 1PKQA 4WGKA 4FJZA 2OZNA 3MREA 5KS9F 1TQTA 2P8MA 2XWTB 1H6TA 2P9RA 5I1LB 4F2EA 5D7IF 1VADB 4KNSA 2EDYA 4B96A 3LH9A 2ENJA 1E5AA 3EBGA 4LNRA 3SDYH 5FOBB 1XH3B 4MNHA 3OLIA 2JV6A 1DL7H 2VLME 4O2FA 5I8KH 3IVKB 1NFDE 2DIEA 5GGQL 3QR2A 4TLUA 3B3IA 5C09B 3LKOB 3OJDB 3VG0L 3OR6A 4LCUA 2QV2A 2NW2A 2OJ1A 4XMPH 3VMOA 3LRSB 5EU4B 1ZPLA 3KM1A 4BK5A 1YHPA 3FS9A 3MOAH 5KUMA 2KZ1B 4N1HB 2B2XL 4LSPH 4M1CD 3T1FB 3LIZH 1AE6H 1U92A 2VL5B 1FFQA 3ULVE 3G5YB 4OFKA 1X5JA 1NQBA 4L1HA 5TE6H 1U8HB 4A2HA 2EDOA 3QR1A 1P7KB 5DJAB 3V4UL 1X6LA 5JW5A 2CBQA 2BY1A 3BISA 1BFTA 4R96A 4WWOA 5GIRB 3V52L 4S0HA 1V3LA 4LMQE 2NYKA 4RSVA 5FV2A 5DHMC 4AKOA 4LFHD 5AKSA 4CAGA 1TEFA 3L9EA 3VH8A 2AXWA 3QJTB 4FA6A 3KYNA 3L16A 4KHXL 2NW3B 2XTSA 5GRJL 3VWKA 1G6RB 1WHOA 3HG1E 4BUHA 3QYMA 4WW1B 5FUZL 1SJVA 5A1AA 3CLFL 2KKQA 4ORGA 1JN6B 3WTYA 3Q01A 2YD8A 2NLJA 1J18A 4QRPD 4Y5YC 4BKSC 2NY1D 1U8LA 1UM5L 1NDGB 4MNQD 4MDRA 3ABGA 1OL0A 1B9ZA 4NLHA 2Z8VC 5JYLA 3ECUA 4L3AA 1ONQB 2VDRH 5IB2B 4Z95H 1N4XH 5KG9B 3SE8H 3U9WA 4M6MH 2SODB 5BQDA 4X9HA 1F8TH 4PWIA 4Y5VA 1AZVA 3C5SB 4KGLA 4NUGH 4TPRL 4UNUA 2EQDA 4JFSA 5FKAA 2EC9U 3AC0A 3QT2A 1P4UA 3HZMA 4ENED 3SSGA 4OI7A 2UZIL 3FOLB 2APSA 3IXTA 3ESVF 1YJDL 3FN0L 4IU3B 2NW3A 3WEXB 2IDTA 3PWPE 4BGDA 3C8KB 1JGIA 3C60D 2XT1B 3IT8D 4KY1L 3FU8A 3LIZA 1EDHA 2E8YA 2OL3L 3CGTA 4IJTA 4QOKA 3NIFF 1DO5A 4YHOL 5F96H 3UROR 4G82A 4V33A 2X89A 3KH4A 4JO1L 2VDPB 4IW4C 5K59E 3HE7B 5J5EA 3OB0K 1TZHB 2H2SC 1TJXA 1EXGA 1NEUA 4R7NA 4P3CH 3RHWK 1GY1A 2IXQB 4WW2F 2AAVA 4HUCA 4EI5A 2ZG2A 4D9RE 2ZNXA 4XMVA 2PXYA 2QHRL 1MEXL 2PETA 1V55B 3HE7C 4XPFL 2NNAB 3OLEA 3TJEH 4GXVL 2DWEB 4PJIF 5JPNB 1LO4L 4PJ7A 5EHFA 1YPZF 1IGJA 2VSCA 5HGBA 1WH0A 5ABZA 1HINL 1FFOA 4PW9A 3OR7A 1NA8A 3JUYA 2WVVB 1KN2H 3EOAA 5E2VH 1U8KB 2HJKB 5B38B 3HR6A 3U46B 4K7FB 4TKWA 5J4MA 5DJ8A 1UD3A 4MJ2A 1YECL 1RIHL 1N6UA 4MMXA 1JERA 5JPNC 2ZSVA 5C0CB 3SGEI 3WXWL 3SODB 2IDCA 1UCTA 4O5LL 4CDHA 3AXLB 4PJXA 4D9QE 3NPZB 4RZKA 1NEZG 1BQUA 3LKPB 3NIDB 1MAML 1QEWB