1B00A

Phob receiver domain from escherichia coli
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB
publication title Three-dimensional crystal structure of the transcription factor PhoB receiver domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
total genus 41
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b00A00
4G0PA 2V0NA 3O1IC 4NCBA 5ABPA 1RZRD 1DRJA 2QVGA 2JB9A 3OM1A 4LZLA 4RK0A 2A9RA 1U8TA 3EQZA 1BAPA 4UHKA 4MAAA 1Y1LA 5JNSA 1USIA 3LKVA 4MQFB 4FE7A 4CBVA 3M9WA 4MS3A 4G0QA 2VUIB 3N8IA 1C0EA 4WZZA 5KC8A 5TPZD 1YK1A 2MSWA 2FMHA 3RQIA 4YCSA 3HJFA 3QK7A 4H3KB 1MAVA 4QYMA 1GLGA 1ZH2A 2FMKA 3LMKA 4G0MA 2PL1A 2R4QA 1DBPA 1ZESA 3H75A 2J48A 3GWGA 4KK4A 2Q5CA 3EAFA 1D4ZA 4IMJB 3VNBA 1MVOA 4RY0A 1D5WA 3F6PA 2QR3A 4KZKA 3T95A 5TQJA 1SXHA 4IGAA 2VUHB 1RXIA 3H1GA 5FWXA 3F7NA 2FLKA 3GA5A 2M1ZA 2A9PA 3UK0A 4HNQA 3N75A 2MYUA 3GV0A 1E6KA 3RVNA 5KQPA 3SY8A 1ZITA 3H6HA 3O2JA 4KV7A 4KVFA 2GKGA 3I5AA 5FBKA 4EYQA 4MS4A 3T8YA 4M88A 3OQNA 4KQ9A 3C3KA 3TD9A 1Z16A 3QEMB 1ISSA 2FMFA 4XASA 2E4ZA 3FDFA 4TN5A 4D6XA 1Z18A 2CD7A 5TPWA 3Q7TA 3RVOA 3FMVA 1FFGA 4OATA 1A2OA 5TQ2A 3O1HB 3IP7A 5CNJA 1P6UA 3CG4A 2WB4A 3GBPA 5EWLA 1QO0D 5IUKC 3LUFA 5HM6A 3G85A 1M5UA 4LE0A 4MS3B 3SQNA 1EWTA 4RY8A 2FSPA 1VPWA 1DG9A 3QELA 4MQEA 1JH9A 1QP7A 3A0RB 3JTEA 2WWVD 2IPMA 3HEBA 3RVMA 3DGEC 3HUUA 3QLVA 4XXHA 3CLKA 4N41A 2MSLA 4WT7A 2LPMA 1MB0A 1H9CA 4YGXB 1M2EA 2ZAYA 4EVSA 4LE1A 2WJAA 3FFTA 3OLXA 4L85A 3DGFC 4HNSA 1DP4A 3Q9SA 1JF8A 3LKBA 5FWXB 1U0SY 2GX6A 2RGYA 4JB0A 2PE5A 4GPAA 4JASB 5CHYA 1JFTA 2E4VA 4ETNA 1GCGA 5I4CA 3KLOA 5DLEA 1EAYA 3LUJA 1D1PA 3M9XA 5EWMA 3A3KA 2MSKA 1NXWA 3EJWA 4D74A 1P6QA 2E4UA 4F3TA 1DC8A 1BDHA 2QVCA 4EUKA 3HSYA 4IRXA 4MYRA 2XDYA 1GCAA 4RK4A 1NXXA 2HSGA 1Z26A 4WXEA 5IEBA 3ILYA 1XHFA 1M2FA 4RY9A 2F8SA 3M6MD 1Z25A 1LBHA 3DZDA 4PEVA 2PUGA 1DRKA 2FXIA 4KRFA 2BGGA 5TPWB 1YMVA 3F73A 4IILA 1DBWA 2QZJA 1QP0A 1QPZA 3TMYA 3CHYA 3LUGA 2A9QA 2PUBA 1T34A 1IIBA 1PEAA 1EFAA 2PUDA 4MGEA 3K4HA 4G0YA 3IPCA 3N0WA 4YWHA 3QELB 2R25B 5IULC 4MQEB 3LFTA 1YVUA 3MMNA 5KQMA 1DJMA 2JVJA 4WWHA 1USKA 4NICA 4YV7A 4E7OA 1RZRA 4JAVC 1URPA 3KJXA 2IKSA 5JNTA 4S05A 1QP4A 1JDNA 1PNTA 2JK1A 5C5EA 4ZYLA 1PUXA 3HCWA 3CRNA 1JL3A 1JLKA 4OLBA 1LK0A 8ABPA 5TPZA 4KREA 4Z0NA 2VK2A 2FEKA 2NT3A 2JRLA 3C97A 1APBA 3NBMA 5EWMB 3L6UA 1DCFA 4LX8A 1E6MA 5JS2A 1Z17A 1YTUA 3CTPA 2LUOA 1ABFA 4H3HB 1AB5A 4N0PA 2QW1A 1Z15A 3MQ4A 2PUEA 2FEPA 3DLHA 2AYZA 2YHBA 3DBIA 1ISRA 4RXMA 4PICA 2ZWMA 5KQGA 3HK2A 3CG0A 4RK7A 3OLVA 2FQYA 2RDMA 5EWJA 3SM9A 2M98A 1MB3A 4RV5A 1KGSA 3W9SA 1VKRA 1CEYA 4LDZA 4EY3A 4Z4FA 1RNLA 1S8NA 4XFKA 4G97A 1QNLA 3MM4A 2E4WA 4LDAA 4RXUA 5FBHA 1K68A 5T7BA 1VLZA 4F12A 3R0JA 1ZVVA 2PKXA 3CFYA 2OENG 2L19A 4W5OA 5PNTA 2MYTA 3LUAA 4YLEA 3SNKA 2RJOA 3LUHA 5D2CA 1EHCA 3O75A 1GUBA 4PZ0A 3MIZA 3H1FA 3LUDA 3H5TA 1NXOA 2IDMA 4ML3A 4WUTA 1FFSA 2QSJA 1K66A 3HM9A 4MR7A 3KLNA 1ZGZA 5FWYA 1ZN2A 1J56A 3Q41A 1FQWA 3OLZA 1TLFA 3BREA 3LUCA 1QO0A 1SD5A 3G1WA 1QQAA 2CHEA 3NNNA 3O2SB 1ZHHA 3MA0A 2WY2D 5JS1A 3JPWA 1LJUA 3CS3A 2NZUG 2IPLA 3C3WA 3QLVC 3GYBA 5CNIA 3FGZA 4RZSA 5TE9A 2FTKE 3HO1A 1CYEA 3CU5A 2HPHA 1QQBA 3QEKA 3SAJA 1D2AA 4MR8A 3IP5A 5KC9A 2NZVG 3UUGA 2E4YA 4NCAA 2N9UA 5IEJA 2B1JA 5TQ0A 2JVIA 3KS9A 3URMA 4HNRA 3Q7SA 3T38A 2GWRA 2A9OA 3H5IA 4N0QA 3I09A 3JY6A 3KYJB 5HQJA 1YIOA 3EGCA 1YS6A 2MYNA 1M5TA 2PAFA 5BRAA 4MS1A 4RK1A 3CKMA 4RKRA 4YRZA 4RDCA 3N53A 3EDCA 1RPJA 4ZPJA 4O5AA 5BR1A 3K9CA 1D1QA 2HQRA 2LIVA 2MYPA 3KHTA 3D02A 4GNRA 4N47A 4KFCA 2L18A 1DCKA 3IP9A 5DCLA 3JVIA 4TMYA 5HSGA 2QV0A 4Q7EA 3A0UA 4MS4B 1NXVA 2IOYA 5F64A 3IP6A 3OQMA 1WETA 2B4AA 3O2QB 1HEYA 3H5WA 4DN6A 3OM0A 4H60A 2H3HA 2WJWA 3KCNA 1YK0A 3HUTA 1YS7A 4XLTA 1JWLA 3O1JC 5B3JA 2R47A 5IUJC 3EQ2A 1B00A 5E3JA 3LTEA 3E3MA 1E6LA 1JYEA 3EODA 3S99A 1ZY2A 1BDIA 5TQ2B 4KQCA 3O21A 4P98A 1ZAYA 4B09A 5EWLB 5GOTA 1L5ZA 1W9HA 4IMIB 4Q6BA 2GBPA 4RK6A 4ETMA 4G0ZA 2E4XA 1Z2EA 2CHFA 2JCGA 4Z4IA 1OXKB 4ZMSA 1F51E 1QKKA 3OLWA 2FQXA 1P8AA 4F11A 4MRMA 1ZGGA 3C3MA 1LBIA 1JYFA 2PJUA 5CNKA 1NY5A 3H1EA 3I45A 3GRCA 4RS3A 4OG2A 2FLWA 4KK3A 1PHRA 5TQ0B 1JFVA 1EWKA 2R48A 1AB6A 2JBAA 5GQSA 3OQOA 4LRQA 7ABPA 4DQDA 2I6FA 1BDJA 2GI4A 3KG2A 2FVYA 3QLUA 4N03A 1W25A 2PUAA 1DBQA 2OQRA 1KMIY 2FKAA 3RVSA 4Z4HA 5C5CA 3HVRA 4KPYA 4JA2A 3NNSA 3KTOA 1A04A 5CNMA 4KMRA 4Z9BA 1F4VA 3F6CA 2IPAB 3ROTA 2CWDA 4O1IA 4OLAA 3RVPA 4NQRA 4W5TA 3JS5A 2JVKA 1ABEA 3HDGA 1JHZA 1TVMA 3HDVA 3L49A 4MR9A 3IPAA 5ED4A 3B2NA 5JNRA 4EYKA 4Z4CA 1PEYA 1VRVA 4EVRA 5HKOA 3I42A 2ID9A 5KWSA 4ETIA 6ABPA 4JB2A 4MLCA 2FN9A 3EULA 5KQLA 2IPNA 1DCMA 2LBPA 5IX8A 1FFWA 4FE4A 2KYRA 3BRSA 4RU1A 1Z12A 4XARA 2TMYA 4MRMB 4G86A 4QPJC 1U04A 3RVLA 4EYOA 2ID7A 4QYWA 1DC7A 3DLBA 4EVQA 1Z2DA 4PYRA 2DRIA 1MIHA 2RJNA 2FN8A 2JBAB 2IYNA 5IUNC 4MPTA 1FSPA 1GUDA 1SXIA 3FFWA 3OMWA 3QX9A 4FB4A 4ZMRA 2PLNA 2P9HA 4Z99A 2FEWB 3FFXA 4O1HA 3H5LA 1PNRA 2HQOA 3CZ5A 3P9YA 4RK5A 4N76A 3ILHA 4W5QA 4WXMA 2FQWA 5IBQA 1YMUA 4RXTA 2NT4A 1RXEA 3E61A 5DGCA 3ROFA 2F8TA 2WMYA 1BVHA 2YHAA 4P1ZA 3KSMA 4MR9B 3RVKA 3RVQA 4Z4GA 1CHNA 2H0AA 2L2QA 4Z4EA 1NXPA 1TM2A 5EWJB 4D6YA 2PUFA 1NXTA 4G0XA 3N0RA 4L4UA 1ZDMA 3BBLA 3TO5A 1EWVA 1U2PA 4YP9A 4PE5B 3OO0A 3GT7A 1XWWA 6CHYA 1U2QA 4RWEA 1JDPA 1TMYA 3LOPA 4Z9AA 3HV2A 5B3JC 4Q6WA 3KYIB 1JBEA 3BILA 3H5OA 4NV3A 4F06A 4S04A 4Y9TA 3H6GA 3NNDA 4E7PA 3KKEA 2NUBA 3A10A 5DKFA 2AYXA 3HZHA 4OTZA 3N6VA 2FW0A 1XHEA 1C4WA 3GL9A 3UKJA 1JFSA 4W5RA 2L17A 4TLLB 5BRJA 4EYGA 4MR7B 2QU7A 3RH0A 5FWYB 3OLYA 1L5YA 5DTEA 1Z13A 3N0XA 2PL9A 4YO7A 3SG0A 4KNYA 5JNWA 3BRQA 4MQFA 1ZH4A 2QXYA 2VYCA 4W5NA 1TJYA 1P2FA 2O20A 3JPYA 3LUKA 4JOQA 3TX6A 4OBBA 4EGSA 5JNVA 3RVJA 2FMIA 3MYYA 1KRXA 4HYEA 5KI6A 2PMCA 4TLMB 4MLDA 3OMXA 5BQ3A 5JNUA 1UDRA 1JX6A 1LJLA 1NATA 3Q15C 4JP1A 4RKQA 1A0OA 3NHMA 4MR8B 3C6QA 3JVDA 3QLTA 3HS3A 3QLUC 1R8JA 3Q7RA 3HXMA 5IC5A 1SXGA 1USGA 4DADA 1QMPA 2P4UA 5T3YA 4LE2A 3T6KA 3H5VA 4IF4A 3RVRA 3O74A 4QICA 2WRZA 4RSMA 4YR7A 3OO1A 4MS1B 3MF4A 1OXBB 1BA2A 1NXSA 3QX8A 9ABPA 4G0OA 3CNBA 1DZ3A 3GBVA 3IDOA 2HQBA 1SRRA 3VNAA 4XAQA 2PUCA 3CZCA 4F8JA 4YS6A 3TB6A 3NHZA 1NTRA 2LP4Y 2X7XA 1I3CA 2HJ9A 3QEMA 4UHJA 4ZJPA 2W42A 1E2BA 1KRWA 3D8UA
chains in the Genus database with same CATH superfamily
1THMA 3NBQA 1N6KA 3AJ9A 5EUQB 4BZWA 2PZMA 1BXGB 4QLAA 3SOPA 4D4MA 4D4HA 4RIHA 4P3XA 1OTYA 5JFTA 4BO1A 5BN5B 2E5FA 3A9CA 3PXUA 1NPYA 1N8NA 4KLCA 4MAAA 4BBAA 5C3MA 3KKMA 3JQAD 4HWSA 3STHA 4JU8A 1HC7A 4F3NA 4CTJA 3LKVA 5M2QA 2FG7C 4FD2A 4CLXA 3ROQA 5FR1A 4RW0A 2QTMA 3NONA 4D46A 4EL5A 1E1DA 3JZIA 4I46A 1U94A 1RRMA 3OCUA 1OHHA 1T5LA 4PO9A 1CZKA 1NN3A 1XA4A 1XGKA 4NBRA 1JEQA 3GCGA 2O1EA 1FFBA 2I9PA 2PL1A 3LMKA 3RDPA 3RTGA 3QE4A 1TD1A 3JZDA 3EYWA 3CA8A 1BS1A 1ECGA 1EX7A 3GG9A 3O4FA 4KK4A 4NMLA 4EJMA 2ZANA 4Q9DA 3A2KA 1A5SB 4XIFA 4MVYA 3VNBA 2QTZA 3K0FA 1N4DA 1AUQA 1GTJ1 4KZKA 5MFZA 1ODIA 3LHKA 2BKEA 3QNUA 1JG3A 1RXIA 2IL1A 3AB8A 4XYMA 3N39C 4CQNA 1U1IA 2Z8YM 3FRIA 3VPFA 1KEUA 4RVOA 1FSZA 4ABTA 2A9PA 1U8EA 4NYJQ 3B7GA 1V5IA 3N75A 1Q1NA 2GN1A 4YRMA 2GWHA 4B3FX 5B64A 1PR6A 1EE9A 2Y3IA 3SYKA 5DYIA 4YRNA 2F3UA 5HDBB 5JO0A 4AWBA 4TV9A 2A0WA 1HF3A 4RVNA 2VQFB 3Q3EA 5CDFA 5LWHA 2VTKA 2B78A 4CUJA 4TWBA 2E6UX 4Y9DA 5L7TA 5KNBH 2WHEA 3A3NA 5LC1A 3UOGA 4I81A 4D4KA 1E77A 1MZVA 1YBHA 3CSSA 3VU0A 1PWZA 2IU6A 3IESA 2J3EA 1DTSA 4R6XA 3FG9A 1H2BA 5EFZA 2P5SA 1B16A 3ESXA 3EWNA 4N6NA 1I4DD 2WB4A 4PYOA 3ZW8A 1BQ4A 5BPFA 1PLJA 1XSEA 2JBHA 1TVEA 2Y0BA 3D0QA 1EJ0A 3NS7A 4DLSA 1S5PA 3I1YA 8MHTA 4LJ8A 4PGHA 1GL6A 1D6NA 1I3LA 3IBTA 1YB5A 2LW7A 1Q3HA 3DD1A 4FOSA 4UBOA 3DF7A 4RHEA 3VSBA 1O9GA 4U3JB 1RLJA 2H63A 5EP4A 3WO1A 1GCUA 2NTVA 1QP7A 4X20A 2BM0A 2V6JA 4K28A 3MLBA 1X42A 2VT2A 2WV7A 3ZHSA 2GPBA 3IKLA 3KPJA 2PJRA 3IALA 4BFUA 4YDQA 4QNRA 1XB2A 4IXTA 1CY6A 1UDBA 9GPBA 1LU9A 1WTCA 1MP0A 3V4VB 1EGAA 1YR9A 1ZD4A 2HLDA 3CLVA 3TJMA 2AUNA 5C18A 5AXAA 1T0UA 3A6LA 1RM0A 3DDNA 1YVEI 2E4VA 4GBMA 5SYMA 4BECA 4F2PA 3CB4A 2CT8A 1ZS9A 3RUIA 3OJ0A 2NIPA 1VDMA 3GJ0A 3M0EA 1E18A 2AV6A 3HP7A 1X7WA 3K96A 1SD2A 16PKA 3PFBA 1FF9A 4M6WA 3HJNA 1N0WA 1QIJA 4MXDA 1FQKA 3G5TA 4P3PA 4LOIA 1FRFS 3K0AB 1NYQA 2DU8A 1IQRA 2H54A 3CF6R 4D8YA 1KYTA 2P2CA 2DUWA 3TL6A 3V4OA 5AK0A 1HDIA 1P0FA 2C99A 1P33A 3CVJA 5I7EA 2OMEA 4KQKA 3RSCA 3OM8A 4YHHB 2Q2WA 1GKYA 3A4LA 4J03A 3H83A 1YDHA 1DKPA 5FA6A 4HVTA 4ZRNA 3RAGA 4G5FA 2VDLB 4WLEA 8ADHA 2P9YA 3K4PA 3UIEA 3OIYA 4N9WA 1QO9A 1U1EA 1XZDA 3ZZ0A 5ICGA 1QGZA 3WNDA 1OV6A 2D06A 2AR9A 4AJEA 3M1IA 1L5HA 3IUNA 2PRKA 4C5AA 5JCPA 5EXDA 1G64A 4J91A 1HI9A 4JH0A 1EGHA 3IBSA 5IXSA 3IE1A 1BE0A 3B6EA 4ND3A 4HDNB 4OA8A 4RGVA 1ZMRA 3LPCA 3D64A 4JBHA 1TZJA 2PKWA 1KFBB 4MROA 5CX4A 5E4JA 3VX4A 2YVKA 3BGDA 3K6KA 5DXAA 2FGJA 3WS7A 3BF7A 1FP7A 1CS0A 1KO7A 2QT0A 3B48A 3PRKE 5JCOC 3VH3A 3OZTA 5C7LO 1MLDA 5CGQB 3KLBA 3R3ZA 3W8EA 4CIAA 3WOVA 3ONFA 4G4SO 1G8GA 4PGFA 5EJEA 3F5FA 1KMMA 5IBCA 3TEFA 3BKWA 4IDHA 1M6NA 5AUQA 3A6ZA 1FB5A 4LZZA 1UK7A 3R7AA 1V1RB 2VK2A 3TRFA 1J2JA 1WM1A 5U9CA 4GOLD 1KJ8A 2YYSA 4GMGA 3MINB 4G9EA 4LX8A 4UPDA 1U2DA 4OLBA 4TRJA 2BM9A 4MV3A 1PZXA 2LUOA 3GAFA 3I64A 3MOGA 1AB5A 1FNMA 1THGA 2QW1A 1XQYA 2R5FA 1ODSA 2QJWA 2YDYA 4RUKA 3DBIA 5FNZA 3VR0A 3U0VA 3TOCA 2JDID 4XKJA 3U1BA 4IIDA 5JAOA 5M3BA 2IP1A 1PGOA 1P9LA 3AOEC 2BDEA 3UMRA 1SUDA 3O4HA 1YRYE 3NTRA 4AJJA 3UJNA 2VHWA 2B34A 3AIIA 3CLTC 3HDQA 3C3CA 3WRWA 1P44A 1PSZA 3NIDB 4Y18A 3X1WA 1K7EB 1U0JA 3FWNA 2CXTA 4WW0A 4L9AA 2XSZD 4JCOA 1ISMA 1TCUA 3V9PA 4Z7OB 1J8VA 3R5JA 3AUAA 2RI0A 3LC1O 3K9WA 3FJ1A 4MGZR 3TTSA 3ZJTA 1UEIA 1ZIPA 2NO0A 3D6AA 1NW8A 2PG3A 2CLSA 2GUWA 2RIPA 4RETA 4IW3B 5I8ZA 4CVNA 3U9TA 3U44B 4EG7A 5LFAA 1UZNA 2BFBB 3KR2A 4MR7A 1WOMA 2B2CA 4JSRA 2QV7A 4FGKA 4KODA 4U9HS 5CU7A 3WYFA 1MJFA 2R7LA 1JEJA 1U3VA 3AIOA 5EZYF 3USES 4EPVA 4YUWA 1QQAA 3HSKA 4Q9AA 5CDGA 1EBFA 1MT0A 3K5IA 2OGUA 4FFBA 4FXOA 4M55A 2Y66A 3JPWA 5FI0B 4TM8A 5IDWA 1ADJA 1ILEA 2XCOA 4JFRA 5ERYA 3HKCA 2OO3A 2MJLA 1LZKA 1M76A 2J7KA 3WR5A 4XSGA 2Q4BA 4ENWA 1RKVA 1VCOA 1Z8DA 2WE7A 3RG8A 4A0RA 4K6CA 2OK7A 1TXGA 5EIAA 3R3HA 1IRXA 3EPRA 4IFTA 3JQ8A 1PDWA 3JWIA 5C31A 2IWHA 3B6MA 4ZTZB 1IBLB 3HYTA 3K9GA 1VJGA 3B7PA 1C9MA 3JQ7A 5TGZA 2KPOA 1XQXA 3DV0B 3KS9A 1L8OA 2C61A 2X58A 4YDSA 3P9SA 3QXHA 4QQNA 1N5KA 3GARA 3M5DA 3QEBZ 1HDCA 1R4MB 5D86A 1LX7A 3L7YA 1R9MA 1J23A 2MSEB 1Y1KE 3G2MA 4PHCA 3WB1A 5A3JA 2PAFA 1GV0A 5TIIA 2WSSA 4RD2A 5CITA 1YV9A 3NUGA 4DJ5X 2ORVA 2EX4A 3FCYA 4XPZA 3V6LA 4UXHA 3ELWA 2AVDA 3NAZA 1XPOA 3KZCA 2V8OA 3QVOA 2L18A 3IT1A 5L3RA 5K8UA 1OFHA 1UBTS 2H2IA 5DCLA 4J16C 1FOEB 1M2GA 1XL0A 2PN1A 4M98A 5F73A 3SZUA 4A8TA 1I2MA 4PQGA 5HSGA 4RKYA 1Q11A 4ZTUB 4F2GA 1P17A 2CF5A 5A0VA 2BGRA 2X9NA 5JSYA 1O03A 2RG7A 9LDBA 3IBGA 2OLJA 3URKA 1ZCFA 2O2ZA 2P7HA 5KJFA 4TV9F 2Z1NA 3OPYB 3GJ5A 4OP2A 4UTXA 2ZROA 1PR9A 2ZYVX 2CCKA 3GWZA 3D9QX 4HB3A 4OLFA 2D1FA 1YU9A 3OCCA 4GZMA 5NLLA 3WWZA 4KQCA 3O21A 1S6YA 1OI2A 4IMPA 3DBHA 1NV9A 3ETEA 3GLFB 2D62A 3B3QA 3BL5A 1W9HA 2VQDA 1Q6YA 3E4DA 1M2OB 2PBZA 1G9TA 5JT1A 2AGVA 3NIWA 5BR7A 1US8A 5A9SA 1TYZA 1E9FA 1E7MA 3T61A 4BX8A 1OROA 4EG4A 5JD5A 4AKIA 4N65A 4DM4A 2RHOA 1AIPA 4BKQA 2XNDA 3UGTA 3ILXA 4FILA 5DI3A 1SCIA 2QTFA 1A2QA 4A5SA 1N2IA 1AB6A 2Y1GA 2D6FA 3FBWA 2H07A 4HZGA 2GLUA 5ENZA 1BU8A 2AOWA 4MTLA 5FOWA 2QQGA 5T57A 4BNMA 2CHUA 1YNOA 4DQXA 5HX7A 4ZRMA 2O8NA 5CJ2A 4LJKA 3H99A 2CB9A 3QLUA 1U1FA 3AVPA 4JMLA 2CMFA 4S0XA 5JZOA 4QVKA 2DUUA 1KMIY 1HDYA 1TCCA 5B1HA 3HGQA 4G5YA 5CFNA 4I4TF 5IK2D 3DC7A 5KSZA 3HVRA 3RYCA 2XA9A 4ALIA 4MV4A 4BCBA 3IDAA 2H85A 2I4MA 3JATB 2KE5A 3GDHA 1AF4A 2R8ZA 3HY3A 1Y6JA 3ZX4A 2DLDA 3KBBA 1TIKA 2GJ9A 3B1KA 2XIQA 4PONA 2HZBA 2H1VA 3KOWA 4MDYA 4ANFA 1T4MA 1V3QE 4YPVA 4M53A 4KDFA 2WF8A 1BWSA 3LBNA 4RACA 1LWNA 1NW6A 1TTHA 4UU0A 1FXSA 1RU3A 3B9PA 2PGAA 2X22A 3T7CA 3AL3A 3DZCA 2R1TA 1AU9A 1L5QA 1JXOA 1OILA 2GCOA 4MPDA 5AOBA 5JR3A 2ZM5A 3EYAA 3OT5A 3FKSD 4YR9A 2EFGA 1TM7E 4XA8A 3RROA 1E4YA 2EBHX 2QXTA 3EH1A 3N70A 4JLJA 5TDHA 3ZE6A 1Z39A 3M4ZA 3U7RA 4WNYA 1AKYA 4HC4A 3R77A 4J3FA 2RGEA 2NW6A 1MO4A 4G41A 5LJLA 4YTEA 3TLZA 4H18A 4U5XA 4F5EA 1TF5A 1OA0A 4QVIA 3NWJA 5KTMA 4Z7JA 3SHWA 1IY8A 1FSGA 3VKGA 4U7GA 5J1SB 4OI0A 3BSYA 3UJ7A 2IS6A 5LQNA 2ZRMA 2Q3MA 1DX4A 1N5DA 2I3DA 1QWOA 3DD5A 2ZRCA 1TL7C 4AS3A 2QF7A 1Z4OA 4BMNA 1YU6A 5LNK6 3K8QA 4LWPA 4ROSA 4Z9FA 4DSTA 1GPBA 4AVYA 3S2IA 3PVCA 1NW5A 1RJ9B 1CQWA 4OD0A 1JZQA 2ERYA 4QHSA 3G23A 5FYQA 2APJA 1EJ2A 5DBFA 2IY7A 4G81A 2ZJOA 1P2VA 4D3DA 2XB9A 5FL3A 3P71T 4KTVE 4H27A 5IBQA 3IMKA 2VDWA 4IL5A 3WRYA 4LBYA 2ZPUA 2ADMA 1SR8A 3P1JA 5ER6A 3SZMA 3TQCA 2CFSA 4BP9A 2GN8A 2C7GA 4LJYA 2NXNA 4DZZA 7REQA 1H8HA 3T0IA 3HUFA 2UVPB 1CUWA 1MD9A 1RJGA 2Q27A 3MLEA 4DUZB 5ECGC 3E5RA 3DMYA 2GYYA 1NQTA 1VHJA 4JYPA 3VHXA 3QVSA 2NO4A 2EFCB 1CE8A 2EF1A 1QQ5A 4XVRA 4BC0A 2XRZA 2F17A 1EWVA 3FAZA 2CSXA 1N5MA 2Y76A 5J3JA 1BE8A 1OFUA 1VHWA 3DW1X 3GZ4A 5EE0A 4MNTA 5HQTA 2I4NA 4OKIA 5G0SA 3UHAA 2UYGA 2I1WA 5C3UA 5JJIA 1YA4A 3M4JA 4ESEA 3CGWA 1K4MA 1UT6A 4UXJA 1OZFA 2ODQA 2Q5JA 1W76A 1LLFA 1PP4A 4PGAA 4P0PB 4AJ2A 2AH5A 1Y98A 3T99A 3I9NA 3U17A 5F9HA 4EUFA 4F8YA 3D7NA 3LUBA 4OF4A 4FMCB 4TT8A 5FWNA 3Q9UA 3L05A 5ALFA 1E3SA 3RSGA 3GP8A 2FW0A 2H9IA 1BXGA 1E3IA 4F38A 1KZGB 1Z63A 4GKJB 1MEJA 2L17A 3ADBA 2BKLA 2FE1A 5BN5A 1PTKA 4LI0A 2DR0A 1KOFA 2J4FA 3IDSA 4CT4B 2PL9A 4WKNA 2AD1A 4R3WA 3SG0A 5JNWA 1UP6A 4UNPA 5JXIA 4EUSA 2P6NA 3UUEA 1QU2A 5CUQA 2G9UA 3WIBA 2P5TB 2EG9A 4IYRA 1IY9A 1J8DA 1UEXC 4OQXA 1EWQA 2CHVA 3HN2A 4JOQA 1R4ZA 2WF5A 1U9JA 3R20A 1FUUA 1KRXA 5EJ5A 1XEAA 3KFVA 1PK8A 1SCJA 3EVGA 2ZSBA 4ND8B 3LAWA 1OT3A 4IHAA 5DJ5A 2PT9A 2BVNA 8GPBA 2ZB2A 2NZ8A 2OD9A 3PCTA 1FYWA 5JJBA 3ADCA 3BE6A 2JGDB 1J5EB 3OWOA 1G20E 2DHDA 2J7PD 3OCXA 2HA6A 5FNVB 4KYTA 1GTSA 3N2ZB 3DVAB 1PNOA 3EJ6A 3GDOA 1I2AA 4CM9D 3K0SA 2V7QD 4NG4A 2DWCA 4C2UA 5BSTA 3BGIA 3TLKA 2Q6OA 2PMFA 4CL3A 3BMOB 3O74A 5IZ4A 3QVUA 3ZWAA 4YP0A 3K8YA 2C84A 1Z0SA 2BGUA 2KI5A 4Z8XA 4EI7A 4XIGS 3EXEB 1AKRA 2L82A 3GFQA 5AK4A 4BMPB 1Z4JA 2VSYA 3KYDB 2G88A 4TKUA 1OLXA 3R7WB 4ZDWA 3GBVA 2VBIA 3T41A 3FVTA 5HF6A 4BGVA 3UHOA 2GTIA 2WKQA 2OFWA 3L7LA 3IUPA 3BRCA 4B1FA 1UM8A 4EJ2A 3GLUA 3NUQA 1DHRA 3RV3A 1JSXA 4FR5A 2GCGA 2HIHA 1CJSA 3TCKA 3LA6A 3O83A 2AN9A 2F3RA 4I8DA 3SC4A 3SSNA 2G4CA 2JPDA 2HYDA 1NJ5A 4C6RA 5MGNA 1YE3A 2X8JA 3SBXA 3CUSA 1R6XA 4E07A 2ZSFA 3QF4B 4G2TA 4E14A 1G5TA 1R16A 4KKXB 1X7ZA 4J1TA 2YFHA 1S02A 2CYAA 2DUJA 4Q48A 5LA6A 3SFZA 3N8IA 1OFUX 2J0SA 1U9IA 1YK1A 2FMHA 3MXOA 3PD1A 5K6AA 4U3JA 4E5VA 4A2CA 2WG2A 4XB6B 1XDDA 1J9ZA 3H7AA 2HWWA 3KL2A 1SIUA 1GIAA 2W6ZA 1I14A 5FLEX 1DBPA 3FYUB 4G89A 1WSBA 3V4SA 5FPKA 3GWGA 2X4IA 3EAFA 3H2YA 5L3QA 1FX0B 1R6BX 2FWNA 4QREA 2CEAA 3CCFA 5JDCC 1GZ4A 4JT9A 4KQHA 2H2AA 4B7XA 5CA0F 4I08A 1KMNA 2PKYX 2W6CX 5AHXA 5TJHA 4HNAB 3K70D 5A0TA 2OQIA 3H4MA 3HCAA 3WKBA 1KI7A 3PDHA 3GFPA 1M8KA 1NJGA 7YASA 1E6KA 8AT1A 4XGNA 5L3SA 5EUBA 3SY8A 2CJWB 2N42A 5FOQA 5DLDA 5GP1A 5BR8B 1IL0A 3UJPA 3R7DA 3AF4A 3EVFA 3KOUA 4P92A 1OC4A 3GCXA 1P7VA 4I5DA 4I5EA 2Q4DA 1RPAA 4RA6A 2IQ5A 3T8YA 3VDXA 3DWEX 3OIWA 2GZ2A 1TKCA 1L1QA 3QYFA 1YFKA 2PWZA 4OSOA 1XA3A 4EQZA 5KU7A 1OFGA 4R54A 3K0AA 1E9SA 2JJ8A 3NYRA 4HFRA 1JFFA 2FFAA 3WYEA 2I1QA 3MTEA 4WADA 2JNWA 1XTZA 2FMFA 2EYQA 3DYVA 1XL1A 1KFEB 1Y4ZA 3L1HA 4NE7A 5GM1A 1RRPA 4EWLA 4X62B 1L4GA 1Q0HA 3PJFA 1JI0A 3EC1A 5FR2A 3LW8A 4GX1A 4S2UA 4B6SA 5FI3A 2X76A 1A2OA 1VLJA 1E69A 3N2GA 3IMEA 3E9NA 3CX7A 1HUQA 1E9RA 2ZIWB 3H8WA 9ABPA 4ZXPA 4PF1A 5IUKC 4C04A 4AKGA 1ZFNA 4FFLA 3G85A 4HMPA 4R8MA 4TS3A 1KBQA 4BZZA 1W30A 1MDBA 2M1XA 1TAUA 1SURA 3RJ5A 1QHFA 1V37A 5BWOA 2VHJA 1UBCA 5CT6A 1E5DA 2IPMA 3AG5A 4HDNA 1O6FA 1OAAA 3M33A 4XXHA 1ANKA 5WRFA 5DISB 2VJQA 2B36A 1K9VF 1JKMA 1NBMA 1P7WA 2OCKA 3D5TA 2HHHB 1KVQA 3KSBC 4MLZA 3OZCA 1EFCA 1PT6A 4EHAA 1D6SA 4LBZA 1JP7A 3U26A 2R5WA 4PCUA 3M6LA 2L0XA 2QMEA 2XMQA 3SJZA 3OCVA 1NT4A 3OIGA 2B5WA 3ICPA 3QKIA 4AMBA 1E2NA 1EAYA 1G8KA 1V1RA 2ES4A 3W5CA 3KAQA 1GU0A 1RBYA 3DHVA 2ZDHA 2IXFA 3EJWA 4YJFA 1FFCA 3UC5A 1QG4A 2BKUA 6GPBA 2WUWE 3OFVA 1K3FA 3IP3A 4NG5A 1V4VA 3JYHA 1KEEB 3CKKA 3OY2A 1FDRA 3K0KA 2OV1A 3AR2A 2R4UA 3L4BC 3Q2KA 5ALHA 5G4KA 3DZDA 4JLPA 4RTPA 2P35A 5HEKA 1DWQA 1FRZA 2ZQYA 3Q7PA 4UUMA 5FBVB 3TECE 5TMPA 1JMYA 3RFFA 4M21A 2PO7A 3WO0A 4GVPA 2DFNA 1BGXT 1NR1A 4H7FA 5P8WA 2CXHA 1B6TA 1FY2A 2QAJA 2PUDA 3QPAA 1RPTA 2L42A 3HZOA 3IEUA 4LPKA 2ID8A 3IPCA 5DP2A 4X64B 3DULA 2WG0A 5KYWB 1IONA 1I3KA 2W98A 3HEMA 1X0VA 2E5LB 1KI6B 2GF2A 3IEXA 5HJEA 1UAYA 3WLSA 1FJHA 4YV7A 2VAPA 1P7ZA 3GK3A 4TZ0A 2EFHB 3BTSA 3HCNA 2BFBA 4N8EA 4KG7A 4AO7A 2W2TA 1BMQA 2O4CA 3DNPA 4LOHA 3E5NA 3FZQA 4RNCA 4S05A 2Q5HA 4G5GA 3OECA 5EUMA 4TTAA 3A6FA 4BV2A 2EWMA 1AXEA 3CV3A 3FW1A 4Y2TA 5HR5A 5KNLA 3T5BA 2FRDC 5KTOA 1ZVJA 2VDUE 4DUGD 2A94A 4F3CA 2ZTVA 2QD2A 1D4FA 2AXEA 2P77A 1Q12A 4KPGA 3HMKA 1NQ5A 3RRFA 4CM3A 1TYBE 2PLFA 5BWBA 1ZNXA 1PUIA 2NNWB 2F4NA 2ZIAA 3D3WB 3NZEA 4NOKA 2F4VB 2Y1FA 3EW9A 2R5NA 4XRRA 4ZJZA 2COKA 2Z4TA 1I4OA 3BJIC 3EIQA 1TIBA 2EWVA 3EXG1 5BSUA 4D9GA 1GKLA 2HBZA 2WZCA 2AYZA 4JR2A 3DV0A 4RVUA 3FIUA 4X9XA 5C1DA 5JI2E 2V45A 2QI9F 1R74A 2AC7A 1TYEB 2RHDA 3Q3JB 4GMHA 5DTIA 1R4MA 3MUNA 4HWGA 4HUJA 4MV7A 3EIOA 2R6AA 5E8JA 3OTIA 4F5ZA 5LQKA 1RCTE 2V98A 4E1AA 4CDRA 5ISMA 2JD2A 3ZC3A 4R1PA 1DC3A 1NN5A 3F7MA 3DTTA 3RV4A 4E4RA 4BQFA 1KYQA 4P4LA 2QRGA 3MM4A 1YSCA 3R3YA 5EEGA 4KKVA 2P11A 4U7TB 4EG0A 2PD3A 3V9AA 3SX2A 1SVLA 1J9EA 4Z51A 3RLFA 4E2WA 1DXYA 1Z6XA 1SBHA 2MYTA 4QUIA 1E32A 5B7QA 1LY1A 4MHSA 4PLHA 5DNDA 3SNKA 1LB1B 4WIAA 1Z45A 4KH1A 1W29A 4HEA6 3NTOA 2RBGA 5JG7A 3OP1A 1D0SA 3LF1A 2G1JA 3OPXA 3OTQA 2BZSA 3OPYA 4D92A 3TLGA 3THXB 4AY6A 3HBMA 4FHCA 2AUTA 5L3ZA 3PNSA 4K6OA 2NTEA 4QOIA 2CWWA 5AI8A 5M7EA 3V1NA 2BJVA 3OJFA 3ZS8A 1ZMTA 2HU8A 4IV5A 4ZT6A 4GI3A 4MYSA 3H97A 4QODA 3UCEA 4HH4A 4CT5A 2D2EA 1VJCA 3LFHA 3LECA 1M2OA 4N6OA 4ZDJA 4YMLA 2Q3CA 4IDGA 1Z62A 5ALYA 4AZWA 1P4HA 2AF3C 1KHTA 2HPHA 5LB4A 1DRUA 3ORHA 1XRPA 5HMMA 2X4LA 3KQQA 1OAOC 1WJGA 3MT8A 2VDNB 3IUBA 2AOUA 4H0FA 1UDXA 1QR2A 2B1JA 5LA6F 2UUAB 2QL5A 4UTZA 1D2HA 1LQUA 2IOFK 3EFOB 4PYJA 5K09A 2EQAA 2O7SA 5ETJA 2LZ0A 3EEBA 3TLAA 4D79A 3MTBA 3I09A 3KYJB 4MOWA 4ACAA 2H2GA 5FFNA 4CU2A 2O2SA 3D4OA 1NQOA 1GUZA 4LXYA 4CYMA 1MHTA 2YWBA 1TDJA 3L6CA 4RK1A 3HXKA 3VR5A 4PNEA 5AUNB 4ZPJA 5A6SA 2XZTA 3FX2A 2VF4X 3NIBA 1MH9A 3HJHA 4JB8A 3W90A 5AK6A 3IP9A 2G4LA 5DM0A 4AJPA 4KXVA 3S70A 2GLTA 3JATA 1U2EA 2JRCA 4COKA 9ATCA 3QKRB 5KDOA 4BNVA 1O95A 2GJ8A 5FEMA 4QRDA 2OPHA 4AY2A 2HCRA 3QLJA 1AG9A 1M1YB 2C31A 4TYWA 1RAHA 1GADO 2I5PO 3KLPX 1GFWA 1SBZA 4X8OA 2JAWA 1CBUA 1B2RA 3R3VA 3WAGA 4WCFB 3IBCA 2QN1A 4O2AF 1DOZA 4UFNA 2EKZA 3QKSB 3PR1A 3IR6A 1XTSA 1KAEA 4BASA 4AUKA 1GGNA 1UKAA 4JI2B 1T5BA 1XMSA 5CTJA 2H31A 3QXCA 2OEPA 4FS8A 2LRHA 3RFTA 5HTKA 1L3BA 3K1YA 4HH3C 3H16A 3VU9B 1UPXA 1JVNA 1VBNA 4OJTA 1IDN1 4FGLA 2CNWA 3E6AA 2O14A 3I45A 5ALDA 2ACWA 2NO6A 3DNFA 2J07A 2YC2C 3OOWA 4AUMA 2NQ2C 1XRSB 3MVEA 4MB2A 1JECA 2LCFA 1EWYA 5F52A 3K94A 4AS2A 2RBEA 4A3SA 2XOXA 4HQRA 2IEGA 4AKEA 4OBXA 4ALLA 1L5MA 3S1SA 1T5TA 2NWQA 4TV8B 1XPRA 5L7WA 5JH7F 4O2RA 3C48A 4Z1MD 2YN4A 2FWBA 3CN9A 3RT7A 1JLSA 2A0FA 3CM0A 4KBYA 2J0QA 3RRJA 1SC9A 3EFBA 2ONCA 5DHUA 2B30A 1DE0A 2C0QA 2HIGA 4DT1B 4DBVO 4MWDA 4GI7A 1BG6A 3PC4A 1J0EA 1MPXA 1RJ9A 2ZSEA 2X9QA 3EZYA 4KSBA 3KTOA 4MDHA 3ZWXA 2H1WA 4DQLA 1RKBA 2H7CA 2ZVJA 2OHVA 5E0KB 2XE8A 2GM4A 1H3FA 3B12A 2C94A 3QI2A 1P0QA 1C0PA 4IDCA 1ISFA 1Z8NA 4MI6A 3EWAA 3PEUA 1A1VA 3GCWA 3I39X 4DV1B 3VM6A 3W8FA 3EZ9A 1RFLA 2DQYA 3RSQA 4AP5A 5IDXA 3KUDA 4Z3OA 3UBMA 3HDVA 3ILSA 4WEOA 4HT3B 3E7PA 2J3IA 2UVPA 1JKJB 3TYXA 1ORDA 5HGJA 2XZLA 2CNDA 2IEZA 2PVPA 3B2NA 5DTMA 2ZZMA 3T7EA 3V8VA 1RTKA 1DDIA 1PEYA 4I6EA 2ZXFA 4GPBA 3GEDA 4MKHA 1U7ZA 3PDCA 1PT5A 7ADHA 3TEJA 1V6SA 3BN3A 1HEIA 1I2BA 3ASVA 5T8KC 5KTNA 3GLIE 1Y8ZA 1M0TA 3VOSA 4LXHA 1Q15A 1ZU4A 2IA5A 2IXBA 4WK6A 5ENVA 5H3HA 5LB2A 5AVQA 3V8QA 1TZMA 4KR9A 4M0DA 2VDVE 2C07A 2O3QA 2ZBQA 4C78A 3B85A 1SOAA 4QOHA 4OOEA 1H1DA 5IMSA 5EZYB 2WUGA 4A1FA 1AK1A 3GHHA 1KDOA 4IS2A 3QU9A 4J0IA 3F9IA 2N46A 4MRPA 1SC6A 4KMSA 2I6UA 4J90A 4MA5A 4IOMA 5JAMA 1F8XA 4OHRA 3UMYA 2HBYA 1X1DA 4DKJA 4MW0A 4ZAFA 4XD7D 2R6DA 1XTIA 1VSQA 1T6XA 1H2RS 4YP7A 4KE9A 4HYQA 1XG5A 4MUBA 1A9XA 1U28C 1SOMA 2FPIB 3ESDA 2BKXA 3TINA 5BOSB 1CEXA 2NZJA 3EGDB 4TL8A 5AHOA 4KRYA 3A1WA 3IV7A 4ND8A 4MO2A 5KX5B 4MUJA 3IGFA 5EJGA 3FF1A 3L6BA 4MQMA 1DT3A 3ZWDA 3F8WA 1XYVA 3HGMA 1PN3A 3ME5A 3MGGA 4MVJH 4P0TA 3TK1A 1V0JA 2PO5A 3V46A 1NV8A 2JGDA 3VGJA 4PG8A 4MEAA 2REOA 4EB8A 1E1KA 5KMGB 5JASA 4WXPA 4BNDA 1NVTA 3KPVA 3O4IA 3E27A 3DVAA 3W3AH 2AMYA 4LF8B 4YRBA 3HBAA 3VPXA 1X1CA 2I7CA 3U2QA 3WYAA 2L2QA 4O5OA 3IXQA 3IL2A 3I2JA 2PUFA 5CCDA 1XCJA 2B94A 3BMOA 3O7MA 2Q1WA 4FMDB 4MVJM 3EIUA 4OV6B 2O6HA 4B6RA 3MT0A 3GELA 2XQVA 1E0KA 2NUAB 4HEHA 4R3NA 1V9LA 3U3KA 1YTLA 3EXEA 4E3WA 3WA7A 2DLNA 3UG6A 1PFYA 2OMKA 3KYDA 1F5SA 4PV7A 4KHZA 4X8LA 4F6RB 5TVKA 2E0IA 3BWYA 3DFMA 2JH3A 2DJ5A 3KXLA 4G1EB 4Q6WA 1VIVA 2HADA 3AR8A 5AVKA 1HLDA 1U2ZA 2SCUA 3RNOA 2UYCA 5JO9A 2GF0A 3TAHA 2Z1DA 3B3FA 4KXFB 4Q24A 2Q41A 4ON9A 4MH0R 5JD6A 2GDJA 3IS3A 2OXFA 1UBNA 3IT3A 2FN4A 1HL7A 1L5YA 2TECE 3QF4A 1U3WA 3MLAA 3V97A 1AMOA 4HS9A 4JR1A 1NX9A 1CUFA 1J2TA 3TXAA 2GM5A 1L9XA 2XIJA 3I53A 2XRMA 2Q1YA 4K9NA 3A1FA 4KIJA 4OHWA 5DGTA 5FOVA 4KI0A 1AQJA 2IYYA 1OU0A 1CLEA 2VCEA 5C4GB 4UTPA 4CLEA 2BH2A 1JHDA 2C20A 4TLMB 4CFYA 5E4FA 3IO5A 1R37A 3F7TA 3ID6C 4G5HA 4BNFA 3ZYCA 1QHNA 1LJLA 1CTQA 2JEZA 2OBLA 3FYUA 3NUZA 5G0TA 5IW8A 1TEZA 1PS9A 2FK7A 3NTLA 4D99A 3RGWS 3TJZA 3MT7A 2DFDA 3FXAA 4DKXA 2Q0SA 1SXGA 3GRFA 2YN2A 1D2EA 4IH9A 1FSSA 2KBEA 2OESA 2ZJ4A 4HNAA 3PT9A 5K0CA 1SC1A 5CVUA 4YRKA 4HQNA 3MD0A 1Q0RA 1NJ2A 3TZQA 1I4LD 1W4AA 2CJWA 3ZGXA 1OXBB 1FRQA 4YT4A 3IEIA 4M7PA 1NYLA 3L02A 3GMIA 4CMJA 4G0OA 1TEHA 1UBFA 3H18A 3WHPA 1IZYA 1M1NA 2XNSA 3VSAA 5HVNA 1BWRA 3ZWCA 4E2FA 2O1XA 3MWGA 1J7KA 4JELA 4IQ8A 4YCAA 2PPLA 1I3CA 3LQQA 3LUPA 4WX2B 2F3SA 5AI9A 1E2BA 4G0PA 4MCJA 3O6VA 1L1RA 3R5HA 2ORWA 4ZCPA 3OY7A 3WKCA 5IFKA 2PGIA 4IDFA 1L5LA 3MWEB 1E0SA 2EGUA 3T3OA 4E2ZA 2HT6A 3RUDA 4BVLA 4B3RB 3L0DA 3LHIA 4N3AA 4P4TA 2AZTA 1HE3A 3KXKA 4QPPA 1COZA 2Z43A 3SBDA 4ZK2A 1T10A 4NEQA 3SSMA 3HG7A 2NAFA 4CCSA 4IDDA 1C0EA 1M7GA 3IMFA 1W5SA 4DLUA 4PFSA 1HNXB 4DJAA 3E03A 4YJ3B 3W7BA 4DCPA 2IBMA 5JD3A 1UKZA 2QN8A 2WJ6A 1DQNA 1NVXQ 3JAKB 2ZTUA 5IJ9A 3DM5A 4Y6SA 3P7MA 1WNFA 4WZAE 4FYIA 1P4GA 3FCCA 3WJAA 3WAKA 2ZZNA 2X8WA 3KQHA 4EAAA 4QXQA 4BTLA 1NF8A 1V3VA 1XKQA 2H2DA 4NU0A 4YBZA 2J9FA 2BGNA 1KSHA 1WPGA 5TQJA 3A70A 1G5IA 2E87A 2ZYAA 2Y2UA 4C6HA 4F6LA 5EJ8A 1Q1AA 2Y71A 3OJWA 1BO6A 1OB2A 5KQPA 3A7EA 2VH2A 1OWOA 1PU2A 3P9KA 4LECA 4K9SA 3LGXA 5A2QA 1DC6A 4AO8A 3QE9Y 4UTRA 1GT91 1W581 3PUXA 4KQJA 3ZWBA 5FOUA 1R9GA 3S5JA 4TYMA 1JU9A 1U6JA 2UZIR 3KKZA 4KQ9A 3G5UA 1ORTA 1FSFA 2UZ1B 3G9TA 3NYWA 1XEXB 4GS5A 3EZNA 4PFKA 1FNSA 1Z16A 2HU7A 2R96A 1B6GA 2V74B 4LQCA 1OZ0A 4V02A 2VPZA 1L7PA 2RFLA 3WMGA 5DM70 3UVEA 3FDFA 3H17A 1E2PA 1WSWA 1E2UA 2QTVB 4HDRA 3UYKA 1CSEE 1M6HA 3F67A 1SEVA 3HCRA 3SE7A 3B1ZA 1P6UA 2LVBA 3CG4A 3FN4A 1C7RA 2CSUA 3DV9A 4L2IB 2G9VA 5KZMB 4Q05A 2C5AA 3EEQA 3PL5A 3RK1A 4DQUA 5DNCA 2PUTA 5CLFA 2I7VA 3KIPA 3OZWA 5T3UA 2WAYA 4BLQA 1T5DX 3QX7A 3TB4A 4GE0A 2GKOA 4GPEA 1QZ3A 4NBVA 3JAWA 2XR1A 3D8SA 1KI6A 2Y1WA 3L7IA 3O4VA 1FPQA 3RO7A 3KM0A 3OX1A 3AJ8A 3CUKA 4WT7A 4FB5A 1HZZA 3ADOA 2VJYA 3ZDBA 3TXXA 4B46A 3TUZC 2BHSA 3OZEA 4A23A 1Y6FA 2WYOA 2QMYA 3R6WA 1L4NA 2J41A 1KZ7B 3OJOA 4OEHA 3AY3A 4N7JA 5CG2A 5FWXB 1U98A 2H2HA 3H4IA 3RSZA 5JY6A 1DAPA 3DM9B 3TCNA 3WRXC 4C4TA 4KAJA 4M1MA 3REQB 2EP5A 3AY6A 3T1TA 2GZDA 1GZ3A 1O5OA 2D8MA 4KJZA 3SXJA 2D7JA 1N8TA 1QS0A 3BS4A 1SOWA 4UVIA 3RHSA 4RF4A 4B3SB 1WNTA 4HFNA 3BXXA 2WKWA 3NRBA 1XU9A 3A37A 3PHBE 4MYRA 4EUKA 5IASA 5LR6A 1QFXA 3COJA 4QXRA 3VMMA 3X44A 2W6ID 1NXXA 4IAOA 3O4RA 1KFJB 1W73A 2CJXA 2CXRA 2CK3A 1I9GA 2JFWA 3WBFA 3EVZA 5HRCA 2CW5A 2EZTA 2R00C 1QE3A 2AW5A 2IYOA 5ALQA 2QRZA 4ZHQA 4ZOCA 1KQOA 1NJ8A 3ZH9B 1OD6A 2GAJA 2JA2A 1Q7EA 4OXKA 5C5IA 2X2FA 4W5WA 5LU9A 4DMCA 3AHHA 1J2YA 2B3TA 3KQTA 1QPZA 4BXOB 5F1PA 1QV7A 3RS4A 1IZ0A 1S2GA 2PZEA 1P3Y1 1OXTA 4K9MA 2FI1A 4KMOA 2BSQA 3I9MA 3PFHA 1AN9A 4ZANA 5IULC 4OYYA 4NMHA 4WY8A 4Y2VA 5DOZA 1K63A 3N8KA 4D4IA 3WXMA 1S3GA 3ZCQA 4DWWA 4JHXA 3X1DA 3L01A 3FVQA 4CM7A 4M1SA 2EXXA 1Z38A 3BQMB 2OHHA 2ZIFA 3H2JA 4GMDA 2IKSA 4JUAA 2W00A 3KTFA 4L8FA 4KO1S 1Y3CE 3ZWPA 1KEKA 4GM1A 3K0EA 1OLSA 2F90A 1S0UA 4IH1A 1XRMA 5DM1A 5KNBA 1KY3A 2AR7A 4MKXA 5K03A 2GRUA 2Y67A 3AXSA 1GAQA 1LJ8A 2P2SA 3QXGA 5EQJB 1NLUA 3TTYA 4YAKA 4GOKA 5DHQA 5JIBA 2J6BA 3MWKA 3B6JA 4PQYA 4WL0A 1EXVA 4H1UA 2ACEA 3PL1A 3WYGA 1WULS 3M6UA 5JS2A 3WBJA 2FEMA 2ZOSA 5CA0B 1GZ7A 3IAXA 1U2GA 4ESOA 3D0KA 2EL9A 4J2HA 1KR5A 3K09C 4H2DA 1N0IA 2F43B 2VG8A 4MYDA 4BJ3A 3B82A 2ECKA 2P90A 3EFOA 3G9QA 5GJCA 4D3SA 1ISIA 3LC2O 4LK2A 5C52B 3RFCA 4TQUS 1WBJB 3ZLTA 5EJ7A 4GC5A 4IIGA 3VJMA 2FKNA 1YAJA 3V2HA 5JXHA 4UTNA 2JL1A 5B4UA 1KJYA 4OA5A 4XFKA 2XBLA 3P9QA 2CMHA 3UJ8A 1WUYA 1WMSA 2DCMA 2O4UX 4B3JA 1X1EA 3VDQA 4WHMA 4JROA 1DUVG 3A4TA 1LRJA 2E7ZA 1KO8A 4RXUA 5DFAA 5EIHA 2NU9B 4XDGA 3GEPA 3HYRA 1E4EB 1LDGA 2NSYA 3COYA 2OBMA 4NSNA 5CVTA 1UPUA 2OGWA 5CBKA 1QZUA 3UAXA 1K6EA 5KCZA 1DJPA 3KWFA 5EJFA 1ONSA 4M0KA 3UWDA 2YNMD 3LLSA 4JY7A 4D98A 1I7SB 5BY2A 4GQIA 1K9SA 4RCZA 3RHZA 1ZN2A 5K01A 1XWFA 4FR0A 2C04A 3ISVA 4R16A 4WCFA 4XGKA 5THKA 4I3HA 1YNSA 3SHFA 3GJ3A 4UASA 3QKSA 1JU3A 4AKHA 4JV5B 2DT8A 3FNIA 3MA0A 4N01A 1Q92A 5DGHA 3AX6A 1Y1SA 3SSAA 5FLXA 3CS3A 3GYBA 4CDMA 3PC2A 2AYYA 3RU3A 4DIDA 3FNBA 1V6AA 2HPZA 3AW9A 4K9DA 5JLAA 4RNDB 3TOVA 3VU9A 4BJ1A 5F7XA 4TZ6A 2C4KA 3EQ7A 3R7LA 4B34A 5KHLB 2GAOA 1AKEA 3KXDA 3RYTC 3DMPA 2I67A 4OFZA 1GRRA 2OM2A 4Y2XA 3ABQB 2YYYA 3FNFA 4HBZA 5G3ZA 3PNMA 4DLVA 3D8HA 2OV2A 1SCDA 1QLHA 4WN9B 5LZ5A 5TS2A 2XCSB 2QUAA 2PS0A 3I0ZA 5ESWA 3T9CA 3G7SA 4OU4A 4TV8A 2O2YA 5H68A 5HQJA 1MX5A 4HUQB 3MD9A 3EC7A 1UBSB 2YINC 4B3XA 5I9TA 1XN1A 1EGMB 2JZOA 3HYSA 5FXMA 4O5AA 2W2MA 3ZHXA 3N58A 4JOSA 4XX0B 1WXDA 2NZXA 3FZYA 5ALPA 3E2IA 5BQFA 3S8YA 4RJLA 3SKVA 4FLFA 4TMZA 1CLUA 2M32A 5AO9A 4DM3A 1SJ9A 4UCFA 2CHGA 2X5JO 2ZYDA 3UHPA 3X1KA 2WTUA 2FUKA 1VZ3A 3FNHA 1WV0A 1K08A 3PGLA 3PXCX 1JSRA 3JRWA 2B1RA 3WL6A 3RE1A 1F1BA 1I13A 4AN1A 5DYWA 1KYYA 1MG5A 1A8UA 3LOQA 3LBFA 1FS6A 1SG0A 5B3JA 3U4DA 1I7PA 3DE5X 4E3ZA 3O9ZA 1LDBA 2JARA 3DBRA 4BIMA 1KQ3A 4UMVA 5BXQC 4EEKA 1CEEA 3U62A 3O0DA 3KT6A 3KFLA 3TSAA 4B4OA 3F9RA 1XAJA 2F3TA 2JGEA 3UUFA 3VYVA 2Q45A 3EXIB 1VFNA 3IKJA 5EMJA 4ZQIA 3ZQJA 4IMIB 5DULA 4EZBA 1JHMA 3DEHA 1EVYA 2JLQA 2JHPA 3Q8MA 3P2JA 5AVUA 4X8HA 4CLRB 5HRUA 2WR8A 1UADA 2ZJ6A 2ZWIA 1DIRA 1HYEA 3R5TA 3H9CA 1LF0A 2V7XA 3SLRA 1DJNA 1IBCA 1XVIA 1U5AA 5H81A 3D0RA 4B35A 1Z2AA 3H13A 2QYOA 4UZEA 4TZTA 4D97A 3A11A 4QBTA 1ZM3A 3RRNA 2FSVA 3A36A 2J67A 1T2AA 5D7NA 1GNQA 1T26A 4IDPA 5JNLA 4MWBA 1Y6GA 4HRYA 3WADA 5CH8A 1PBTA 1W75A 5GPBA 1Y1RA 3FMGA 2J5QA 4AROA 4II7A 2Y1DA 4ENVA 2HA3A 4GIBA 3JR3A 3F73A 4NABA 2QSYA 2FPIA 2EATA 3VFDA 2GJAA 5FOSA 3LWZA 3FUUA 3AMVA 4TYYA 4EH1A 4UULA 5KX5A 1BE1A 3PGXA 2EBWA 5FUXA 2W6PA 1RWPA 1E7SA 2CWDA 4WZAA 2BOVA 3DTVB 1WZCA 1FVFA 5KKCA 4IR7A 1NVEA 5KMGA 1GVHA 1ABEA 4YV1A 5DBGA 4A2QA 3FDXA 2NU6B 4HB4A 1HE2A 3BMCB 4MB0A 3H8VA 4EW6A 3U4HA 4ZHSA 2AOVA 2OQVA 4PAOA 4YUAA 5JW6A 1N1EA 2FN3A 3BMQB 3FTEA 1SVOA 2PRZA 1LLCA 1HNNA 1Z08A 3AWIA 3ITKA 4PU0A 1I3OA 2AA3A 3O95A 1PEKE 2YVLA 4Q7KA 2C9CA 4FE4A 3OU2A 2QJFA 4YP1A 4F6RA 4V1CI 2WFZA 3R41A 4YCNA 3WQQA 3ROPA 3PHLA 3ADDA 1CUVA 4NYIR 4ZHQF 2QMOA 4CM4B 2WWYA 3WL8A 3S2YA 2J3JA 2JIMA 2QRQA 1QHHA 3PUZA 3K0CA 1U04A 1E62A 2ECFA 4I5IA 4JBXA 1JNYA 4UU7A 4YX9A 4OHZA 2QORA 1GPLA 2DPGA 3RIMA 4QYWA 1DC7A 1GTVA 4MINA 4LY3A 4V3CA 1UZAA 3PFGA 4H7DA 3NPAA 1OI4A 4GBGA 3K30A 4KYUA 5LOVF 3KSUA 4CKWA 3OCWA 1CRWG 5BRNA 5C1OA 3KQYA 3G2IA 5BUSA 2HPAA 4GXQA 1I6KA 1BX0A 4UAUA 3WLFA 4DYHA 4FB4A 5KYNA 3NHFA 3U48A 1QCYA 2HMUA 1X3SA 3PE3A 3QYAA 4X92A 5EUCA 2A78A 1NUAA 2Q3HA 3L0YA 2IV3A 3CWQA 3ML1A 2D5IA 1CNFA 4AURA 1FC0A 2TMGA 1M72A 2QSZA 2R8EA 3CLTD 4M9UA 1RMQA 1CIPA 2IZ0A 4ZVTA 4PVCA 1Z74A 4Q3LA 4RXTA 4DY6A 1QC5A 3OOYA 3I9LA 2VRCD 1YGYA 3M82A 4YA6A 5EVCA 4BNXA 5DTRA 4DCCA 1DC5A 1KYIA 4QKQA 1CHNA 3I1FA 3BSWA 3OX2A 3VSDA 1TM2A 1E7RA 3OWHA 3CPJB 4DDWA 3SEFA 3HJGA 5FRDA 3E8SA 3V2UA 3BBLA 3UWOA 4LHWA 1GGFA 1NUTA 3FFAA 3AHFA 4WTOA 5BXYA 4W8HA 1C9KA 3MSXA 4CWAA 1MX1A 1LLDA 5A03A 3CT4A 2WQ7A 5D87A 3JVUA 5KTRA 1SKUA 1H6CA 3BWMA 1EK2A 1N0UA 4DLYA 2YJNA 4CQLB 3O8RA 4N7BA 1LC3A 4FQ5A 2ZJ7A 4KEAA 2GASA 2HCBA 3PNKA 5FPYA 4C2AA 4G67A 4CKZA 5JQGB 5F4ZA 1DWOA 4L6IA 4C7VA 4UZSA 2BWJA 2YV4A 3HL4A 1R3DA 3UAWA 3KZOA 5J2TB 3E0QA 4LDPA 2AJLI 5IABA 1T8WA 3DFKA 1XVUA 3ENWA 2ALJA 3W6ZA 1O9HA 3DAPA 2X9LA 4CF4A 1CRLA 1V4NA 2Q5LA 3QVJA 1CIJA 4ASUA 1RYBA 2ACVA 2AS0A 2PZ8A 3WIDA 2OTCA 2BCGY 2G1UA 2UUOA 1W2GA 3EY9A 3QUCA 4UTOA 3UO8B 3LRXA 2VPTA 3W9UA 2C3OA 2B98A 2CJYA 3T1OA 2IU4A 4EY5A 4YJ3A 4JD5A 4P4SA 3TX2A 1DKQA 4P81A 2JZCA 4GXNA 2ZAGA 4YCMA 1JYSA 4IIJF 3RAPR 2CNNA 4HMQA 3T1VA 1PV1A 3C3EA 3PVSA 4JU9A 2GQ0A 5EKDA 1QIIA 1MQSA 3IE2A 221PA 5JH7B 1WDWB 3NWPA 4QASA 3UM9A 4J4HA 1LW6E 4R7GA 3S81A 1X74A 2JCXA 5E1BA 3ZPXA 1A27A 3LLCA 4HX9A 4OREX 4UEJA 5JYDA 2NACA 3LJKA 4RESA 3AETB 1BEEA 3F3KA 2A9VA 3H5VA 3ORFA 4HR7A 5AI5A 3TMKA 3EVEA 5U4XA 5J2UF 1GRVA 2LCIA 2ZJZA 5K0NA 1PJAA 2WRZA 2NYVA 2I4RA 2VK1A 4UMFA 4YR7A 2FR8A 2GEJA 4ZI7F 4HDQB 3VHLB 1C7IA 2IHBA 1XJ5A 3BB1A 4G1MB 2JZNA 1B8VA 1QZTA 1GQFA 3HCPA 3KYBA 3QA9A 4ZVSA 4A7PA 2UYOA 1FFDA 2EGGA 4LHYA 2O3UA 4NAVA 5FI5A 2O54A 4XR4A 2ZBVA 3ZDZB 5EFOA 4W9NA 1OR8A 1TEXA 1CFJA 1XEXA 3KZ1E 4J3JA 4TMVA 2CUNA 1NTRA 2FZGA 4K2HA 2NV0A 2WIJA 3GU3A 3CLUC 4KACA 4KRXA 4LW8A 3EARA 2X3YA 4IIBA 1RZRD 3B6KA 2QTVA 1AC5A 1H66A 2C8KA 1HQCA 1FFXA 5T67A 3UMBA 5AJHA 3HBNA 1A5BB 2QVZX 3GEHA 4X24A 3RSLA 1JDVA 1CZOA 3MFYA 4NIMA 2ECQA 3AEKB 5H0IA 4QJ5A 1XCBA 3RSSA 3W5IA 1I2ZA 3CVYA 1TQ4A 1Q1ZA 3R9KA 3VH4A 3NMUF 1KHHA 2O1SA 5TPZD 2XCQA 5GGYA 1CUAA 1FRVA 1BRMA 3LIPA 4E51A 4J0QA 4N6GA 4HN9A 3ZY6A 4PO1A 4K9RA 1QYRA 5E9AA 5IAGA 1E7QA 4F3RA 5JAHA 2ICAA 3WGZA 1YUBA 1ZESA 2XUPA 1D3AA 1TTPB 1WOYA 2H16A 2CE7A 3REFA 3HJTA 4ENTA 4G8JA 1E5TA 1WCIA 2W2VA 4GWKA 1K88A 2ZJ0A 5C51B 4IDQA 1CETA 4MCAA 1B6SA 4I2VA 2VTBB 4D82A 3K5PA 3ANNA 3U7QA 5IXJA 4G25A 1UFKA 2OCLA 2OK8A 4MGIR 5FWXA 2Q7XA 3GB9A 2FLKA 2QY6A 4QU5A 2P5UA 4REOA 4F2DA 1SHJA 5F1KA 2QOEA 3JX9A 3REQA 5J23A 4HGQA 4GT1A 1UFQA 2K5UA 4P7GA 3O8NA 1WCV1 2R6ZA 2QB5A 4CMHA 1O96A 3TGPA 5ERXA 2JLYA 3U49A 4KW7A 2QPAA 3FOBA 1TCAA 3B3AA 2YKGA 3AR3A 4Q4AB 3B1XA 3AH8A 3KX2A 4RFVA 3WP0A 5IC4A 1ABBA 4BZPA 3K92A 4TTRA 1W5TA 3HI6A 3KWMA 3D4IA 2CHQA 5KBYA 4WECA 4O3MA 4R0NA 4MW9A 4P36A 5IZCA 1HQYE 1DTEA 3LY5A 3MGCA 4UE2A 3UPDA 4D6XA 3IMGA 3P0JA 3QVMA 1J0DA 4NS1A 4C08A 2H18A 2QMHA 2P9TA 5CNJA 1X8JA 1RC0A 2HLPA 1NSFA 2W2LA 2YRXA 1L8AA 4O4JF 3ADKA 2YWEA 4KVAA 4BXOA 4M4SA 1YQGA 4MUAA 2ZTSA 1EWTA 2VDOB 1ODLA 1ST2A 1ND5A 1I80A 2RGXA 1ZD3A 5LBTA 2FZEA 3TFQA 1VI5A 4URUR 5FADA 3HDJA 2PA3A 3LBAA 1XJ0A 1JH9A 3A0RB 1VIYA 2VEOA 2OV6A 2ZJAA 1OYWA 1VA4A 1K06A 3ZGYA 3AEUB 3MJVA 3RLIA 5FUBA 1YZNA 2FMXA 4LWOA 1Y1TA 4NFHA 3CRZA 4OJQA 1YZKA 3P9RA 4GOXA 4YXWA 1D2NA 2H8GA 4PG4A 2W43A 5LP1A 4NAHA 2QAIA 5I6DA 5LMZA 3SPXA 5CHYA 2FW1A 4BFWA 1UBRS 3LCRA 4KN6A 4ARZB 1EVKA 3N28A 1B42A 3WLOA 2VP3A 1EZ4A 4F9TA 2QRVA 3HJCA 3NVMB 1II0A 4AJ4A 1PLKA 2C8JA 2HF8A 1XP8A 3PKZA 4LOAA 2OLEA 1E0DA 1T1GA 1Y8RB 3M6FA 5H3CA 4L0DA 3ZHUA 5FAKA 1CUJA 2WP8J 2IZZA 2Z8XA 2XKKA 2G3YA 4IRXA 5TGTA 4LJAA 2W6JA 4C0SA 4HN2A 3OFJA 2F43A 2OO5C 1O7JA 4KNWA 4WXEA 3SN6A 3UICA 4G8BA 4WK0B 3WYBA 1MIOA 4B33A 4C0BA 3QWIA 1FNDA 1NFQA 3EGIA 2WFMA 1LBHA 3HNRA 3ETJA 3T5CA 2W2OA 1XAIA 1DINA 1Q84A 4QXOA 3OD5A 3EG5A 5FWDA 2BEVB 4M83A 5BV0A 3ONDA 3HRHA 4M9XA 3WMXA 1KWGA 2IIBA 4AXXA 4DA9A 2WE8A 4IILA 4Q4JA 2R97A 2YY7A 1LF5A 4BFVA 1YWGO 1QUEA 2NU9A 2HO4A 2BP7B 3PXBA 4MGKR 5I4BA 3FUTA 4IJQA 3CKYA 1NVMB 2VLIA 4GKBA 4DXDA 3IQDB 1L1EA 4OBEA 2SKEA 5FBRB 4BDSA 2HIAA 3W2IA 4WK4B 3IYLW 1EX6A 4YYZA 2VP6A 4MP8A 1XTPA 1XXHB 4WLVA 3W04A 2DBQA 4GW3A 3IOMA 3ETGA 5CDSA 3TG2A 3G8CA 2BF4A 4PQEA 1IFXA 4AY3A 4CODB 4I1UA 3EZLA 2PGXA 1WHSA 2R65A 4LHXA 3VC2A 3CW9A 1Q14A 1JLKA 3VVCA 4A73A 5CB4F 2W0SA 2CLFB 3TW0A 3VDNB 5GZ1A 1KTIA 4DWVA 1LRKA 2VP0A 1H94A 2B8TA 2C2XA 2VA9A 1FLNA 1P18A 2NT3A 2WAAA 3H1PA 3NETA 5F12A 3O73A 3FUCA 1YMQA 1PDOA 1A4RA 5KSYA 4A0HA 1QRSA 2PM8A 3TD2A 3CEMA 2PUEA 1TFRA 2ZR8A 2JLWA 2JJ2A 4AD8A 1PV2A 4R71A 1N0HA 1U0FA 1XTQA 3QU4A 4D0SA 2IFTA 4PICA 1QYCA 3OLQA 1G8FA 3BIXA 1A7AA 2BHLA 1IN4A 1ITZA 2WFLB 4KVZA 4PBSA 4F9FA 4HUQA 2BE7A 5HZMA 2PX6A 1C1XB 1OWNA 4RV5A 1VLHA 4CN8A 1RDFA 4J29A 4JYBA 4NR0A 5HZHA 3T7AA 2QD4A 2Z8ZA 3CRW1 1KZ1A 2GXSA 4AS1A 2VVTA 3R3WA 3KR0A 1LPMA 3P9NA 2I80A 3WX0A 1XNRB 4XX0A 1G63A 4G4IA 2O06A 5KNCH 1U1CA 5KOHA 4UUAA 2HJRA 4JX8A 1XU7A 3R0JA 5K45A 1ZNYA 3HABA 1AE1A 3L06A 4UE6A 4BNIA 4DPMA 1CPYA 2NU7B 5PNTA 1SCUB 4YLEA 3CRVA 3TRIA 4EB0A 5JS8A 2JASA 2ZAIA 4NARA 3HCEA 4YJ2F 5H83A 3RYFB 3FPEA 1NNUA 4DWOA 2QSJA 3C5WP 3T3HA 4B5LA 2RAFA 3OWXA 5BPHA 4UDOA 1V11B 1UOEA 2X77A 1POWA 2P9EA 1U8CB 1BFDA 3LLVA 1U90A 3OLZA 2ZRIA 3C1OA 5FT9A 3R74A 2A14A 1SD5A 1QIGA 3G1WA 3G89A 3KHSA 4WKCA 5HZGA 3EXIA 1ZNZA 4DC0A 1ZC4A 2ZXEA 2NGRA 4TS1A 1OLUB 4UNQA 1ECFA 3NCHA 3FGZA 2H4ZA 3IAHA 3UW1A 2IS4A 3L7BA 5BV8A 1B0PA 4YASA 5B58T 2R7AA 4D3YA 3PNOA 3V8EA 3IKTA 4TMKA 3DDHA 2OXRA 3IP5A 2VYQA 5JV5A 3P0RA 3N8DA 2IF2A 1UK6A 4B6JA 5IFLA 2VF7A 4JUIA 3URMA 2E21A 1EHIA 2A57A 4HNRA 3KR1A 3T38A 3W8DA 5HF8A 5AP9A 3KSAC 2JFUA 2EZ8A 4FIDA 5C81A 3C3JA 3OEHA 1M5TA 3KR9A 3KT8A 1SOUA 2Z9BA 2XYHA 3GOQA 1FE8A 5DLPA 3RF6A 1IQPA 1T5OA 4R1MA 2IK8A 3B8HA 3B6ZA 3WL4A 4BLTA 2J9GA 2BTQA 4V0SA 1ZR2A 4G09A 4CI9A 2R0QC 1Z36A 2RG1A 3EQ9A 3OEYA 5AXCA 4XIYA 1Z5GA 2HW8A 3LPNA 2VPQA 3DTVA 4GP6A 4OBWA 4TSFD 1CY8A 5GMOA 1EX9A 4LBVA 2XMSA 2ZWVA 4J0CA 4Q1FA 2VWHA 4ZCMA 5A6VA 2NU6A 1RTTA 3QMWA 1LPAB 3BMCA 4WKPA 2WP0A 1QLWA 3O1JC 2VJNA 4F5WA 1H5UA 1IE3A 1ORWA 2ZTHA 2DBVO 2R47A 4CMKA 3ITDA 2WPDA 3RWMB 4JJKA 2YMPA 1J5PA 1JYEA 4I66A 1FUYB 1P61B 3BMQA 4C30A 1DX6A 1V8FA 2JK0A 2Q8PA 3UV7A 3ZDFA 4AUNA 2PZLA 3HZRA 3X43A 4PRLA 3OKAA 1ZAYA 1BXKA 4LFCB 3EWSA 1L4UA 1VYTA 2BH9A 2DBYA 2ZB3A 5G02A 3DO5A 1SXJE 2ZITA 1ECJA 2A67A 1LLQA 2A6PA 4HDMB 1ODTC 3UENA 1MTOA 1PYDA 4TYPA 4BMOB 1EWRA 2C2BA 5T5QA 3S2FA 4OP3A 1XTRA 1Y0BA 2Y1KA 3C5VA 1WXXA 3QNWA 4PLPA 5NULA 3EMDA 3AUKA 4QNNA 4NX2A 1E8DA 3BHMA 4OYRA 2R48A 4LVOA 1ZUD1 5IJZA 2QHXA 4KB5A 2R6FA 5JARA 2XOEA 4JJFA 4EECA 1RRGA 1IDOA 2Z5VA 7ABPA 1BOOA 1FYFA 5DBHX 1ETHA 2GI4A 4PANA 1U2DC 4EKNB 3VDMA 2WTMA 5B6JA 1TCBA 2VPPA 4PZ9A 5E9WA 4RWZA 1V5FA 4MRAA 2WJVA 3RD5A 3A06A 4QYIB 4AP6A 4NJMB 2DCUA 3ETHA 3H6KA 1J5XA 4XFDA 4Z9BA 4KE8A 2IITA 4DRZA 1W59A 4ND4A 3V33A 2EJWA 1G3MA 3EZXA 1CQIB 3THRA 1EFHA 1EP9A 1H9AA 4R0MA 2CJFA 1YO6A 1BU5A 2AW3A 2X19A 2ZKLA 3EDOA 3KAPA 4NCXA 2BFPA 1EUYA 1GTRA 4RVCA 2HRBA 1JQBA 3LNCA 5JMTA 5BMOA 3F5QA 3TIIA 5HOQA 3HU2A 1BC5A 4WY2A 2IWRA 1RAEA 2AX3A 3IUQA 4BFXA 1F14A 1WVMA 3TVTA 1RLUA 4OB8A 1UH5A 5D1NA 5EMKA 5FTWA 2PH5A 4XQCA 3UK7A 2I3BA 1BQ3A 2NADA 5IP5A 4ENPA 3BZWA 3NHYA 3K6RA 3MWFA 1CK4A 2WJHA 2Z4RA 3BJRA 3C6BA 4LZWA 1CUSA 1ENZA 4DSUA 1Z0ZA 2VZ8A 4R40A 3L8MA 4GLLA 4TL7A 3R9WA 1Z06A 4Q1BA 1W1UA 1YE5A 3OKPA 4OAPA 1S2NA 5ALGA 1O87A 3PQ2A 1OTHA 2G71A 1LBQA 1DC4A 5J2TA 1N25A 3MBOA 4PYRA 2PGJA 4K6GA 3ET5A 1BSVA 1IAQA 1U5BB 1R5NA 3H19A 4ZEWA 4JUBA 2R1ZA 2OWDA 1OVGA 3G3EA 1J1IA 3LO5A 2B35A 3C15C 4O8ZA 2AFVA 1BMFD 3IQEA 4ACBA 1GG9A 1KAOA 1REQB 1G5HA 2W71A 3QX9A 1FCJA 4JVMA 4ZEXA 5J9FA 4AIIA 1C9JA 3CCBA 3UWPA 3BTOA 3A1DA 3VO2A 3THWB 2GYUA 4ZPXA 3OF2A 3PIDA 4KNVA 1HR0B 2V1XA 2VUUA 4IIVA 3RJMA 2UUCB 4TVOA 2QRNA 2AT1A 5IHPA 4V1CB 3G1UA 4DA8A 3AF2A 4IKOA 4ABYA 1MX3A 1O0SA 1V3UA 3HN7A 1UPBA 3KK0A 3X2SA 2XA1A 3PPWA 1EB8A 2R86A 3ZU3A 3RWBA 3L8FA 3I2GA 3DDUA 3R8XA 4OCZA 3AETA 5JCJD 3KOMA 4G0XA 1E98A 2Z2YA 4BNLA 4KO8A 3A14A 1POXA 1FMJA 1PJ3A 1XZPA 3BB3A 3CJRA 3NV7A 3VX3A 3K70B 2I03A 1U2PA 1YH3A 1PYGA 5IDQA 3P94A 4X91A 4IDOA 4INAA 2P0EA 4FHDA 1Y5RA 2NO7A 4A8JB 1HETA 2VT3A 2IYPA 2RKOA 3FYCA 4F7DA 3AVXA 1XQ9A 2Y6VA 4H0CA 4FKMA 5E4YA 1M67A 3H5OA 3RC1A 1NI5A 3ZQKA 2F7SA 2JAHA 4E7PA 3KKEA 2FSFA 2GHQA 2JJYA 5JADA 4XZ3A 1SU6A 2NSLA 3S27A 4CW7A 1QVAA 4BMSA 4CEIB 4XD2A 4PSUA 5CVJA 5BVGA 1J1UA 1T0JB 2GFHA 4LFBB 3AINA 3D1LA 1X92A 3TSWA 4X1KA 4NDZA 3W2TA 1AMNA 3OJEA 1VBMA 3MMXA 2H1HA 1OXXK 3H2HA 2XXAB 3LC0A 1Y89A 3RHTA 3AEKA 4NZYA 3SHTA 4RQBA 4EHNA 3LUKA 2A7QA 3EXFB 4N5NA 4DB2A 2YY5A 2J5KA 1F0KA 3TZBA 3U7EB 1XUOA 1FP2A 3MTJA 1RVDA 4JIGA 2FZLA 4JL8A 4LX0A 3TNFA 4MLDA 4EY8A 5BQ3A 1HG0A 2Q46A 3PUKA 2XQIA 4Y2GA 1Y48E 4MR8B 5CA1A 1A9SA 4W1RA 1PFGA 3QLUC 1C50A 1WX1A 4BATA 4WFJA 3HXMA 3L6EA 1A4XA 4JNCA 2XITA 5BWLA 2VTBA 2UYHA 3ZVNA 1XCMA 2GN6A 4DL9A 2Y6UA 3U39A 1RAGA 4D80A 3C2QA 2CBXA 2CUZA 5B1SA 5KYXA 1FLVA 2WNIA 1E8MA 1VLVA 4RHXA 2A5LA 1E4VA 2JIRA 2SICE 3A28A 5CLHA 1Y33E 4KQFA 2Z3VA 5D84A 2OAGA 1CY0A 3KO8A 4BPRA 4HH1A 1AMUA 1CQJB 1WQ3A 4XOIA 1R0BA 1U9ZA 5ALZA 1Y5NA 3QSYA 1OWLA 1RYDA 1RXVA 3CNBA 3KE8A 1KU0A 1PW7A 4J1QA 4Q4AA 1H4TA 1UFRA 2D54A 1D9XA 3IQIX 1KDYA 2HJHA 3T06B 1KK1A 3EG9A 1IXZA 4D9FA 5LQCA 2KW5A 2W42A 3I2YX 4O33A 4DLTA 3QHAA 4L74A 2D2XA 3KYCA 4P4UA 3LG2A 4CMGA 3QHPA 1P7PA 4EQ6B 1GXSB 3G2NA 1T8RA 4OLHA 4WACA 4BQNA 4ZYUA 2NP6A 4G0UA 1ST3A 1HY3A 2NM0A 4ZAWA 5CM2Z 1RQ7A 2YRWA 4MVJA 1VGVA 4FNAA 3WWOA 4HDSB 1JU4A 3E3OA 3U4QB 1G8PA 1E5XA 1QLJA 3QE2A 3DZBA 3CW2A 3ZV7A 4UM9D 4E2XA 1U7HA 4KVGA 1Y3FE 3W3AA 5JAZA 3PGJA 2VEDA 5BQ5A 1J97A 2VUIB 4I1IA 5IAAA 1BWPA 1SZCA 1WZEA 4GYYA 1GKUB 3D1VA 4X93A 4ZOAA 1Q20A 3RQIA 4FZ3A 4YCSA 3TBFA 4FR2A 3R6TA 3HFJA 1GLGA 4RDXA 3SD7A 2FW9A 3ZYZA 3IQGX 3KB2A 4RAQA 1TQ8A 1TRKA 3ORSA 1R50A 1R6AA 2OECA 3LT5A 2AN5A 4GSYA 2G8LA 1CDZA 1JIKA 2H00A 2I7XA 4MK4A 3QWFA 1YZHA 1Y9ZA 5C8YB 5JTUA 3K2QA 1USUA 4PWYA 1IG3A 2WIKA 2RK4A 3DMTC 5LYJB 3Q8LA 1IUNA 4O2BB 3WRYC 3UATA 4ARZA 4P84A 2CMDA 3UK0A 4EELA 2MYUA 4BRUA 4RKFA 4HTFB 4M1OA 1J0BA 5DGIA 3H6HA 1IXKA 2HBQA 3E1SA 3O2JA 3K9HA 3FTNA 4CV0A 1ZWKA 4YJGB 5F9FA 1YB1A 2D2IA 4EW3A 1RYMA 3I5AA 3COSA 4ZA2A 2PQMA 3OU7A 2FZ4A 2YWXA 1EIZA 2C0PA 5G0VA 3G2KA 1JHXA 3AHEA 3U3JA 3NT5A 3HFGA 1RHJA 4GLBA 3U1VA 4ZEVA 4EFNA 1AVTA 1YOVA 1TT5B 5IKMA 1IN1A 3GT3A 4UD2A 1RJDA 4PLTA 2E4ZA 2WHPA 1CNMA 1XK7A 4H15A 1L7OA 2P1ZA 4TN5A 1MQAA 4IGEA 4WLNA 2H1CA 4A03A 4BQRA 3Q7TA 4TRRA 3RVOA 4DCOA 5B58C 2ZI4A 2BEVA 2ZSJA 2G5PA 1SXQA 4HWPA 4BTVA 3GJ7A 3JZMA 5EWLA 4IJVA 4A27A 4Q1CA 2GPWA 1LLUA 4ITRC 1Z88A 2BP7A 2I65A 2IYVA 4ZT4A 3SQNA 2C5FA 4A0SA 4F85A 3C70A 2ENUA 4IIFA 4ZWNA 3AR5A 4OMCA 1YB2A 2CMKA 1AZLA 3A9UA 1EDBA 5FOTA 1R0XA 3B1VA 3QLVA 3DE0X 1Y6QA 4QU9A 4YRAA 1GZSA 1KYXA 2PRSA 1WUJS 1T2CA 1XXHA 2RHRA 4X61A 5JZSA 1QKJA 1KNQA 1IMJA 4CL8A 5K2OA 1GA6A 1VI2A 4J1SA 3VPDA 1Z6YA 3LKBA 1VXOA 3DL2A 1M6YA 5DYTA 2PWYA 3DAGA 4JASB 3LV8A 1SXJA 4JBNA 1WP9A 1GPNA 2OCGA 2OAP1 3WK6A 2JHFA 3PHJA 5H5JA 4GO1A 2CEKA 5HIMA 1MW9X 3GLGB 5AJTA 2XNHA 3F74A 1HURA 2AI2A 2KLBA 4KUGA 5HWSA 2PR2A 4JI4B 2VUSA 1F2TB 1PD1A 1V41E 1MJ5A 1OU4A 3E2MA 3E9EA 3MJTA 3N8HA 1E1RD 1WEHA 2VHVA 3DLPX 4GM0A 4RHCA 4DIEA 1M2VB 3ILYA 1P60A 1T9DA 5HJ7A 5K8TA 1XMXA 2VJMB 1JLHA 1K5GA 4LXUA 1R9NA 4ZI7B 3M5WA 5JXWA 4CRWB 2BGGA 5F1OA 2G40A 4P7JA 3BWVA 1SN7A 3CZQA 3ZBPA 1OFTA 3E53A 4K05A 3QITA 5H59A 1YUMA 4IIEA 4TLAA 4WZBB 4XDZA 4IGKA 5AYVA 1G38A 3HB1A 4GI5A 3WLRA 4EPRA 1E9CA 5BN4B 1WPXA 4WJKB 2OG2A 1M2KA 3GJ4A 3PDUA 3UNXA 2IUSA 2NVWA 2IOFA 3GRVA 1SCUA 1VYHA 3KHUA 2D3WA 4DV4B 1HOXA 3G5LA 3SJUA 3NO4A 4NZZA 2P41A 4QBIA 4D96A 4K88A 5KQMA 3NHSA 3HU1A 3JYLA 4D9CA 4IVNA 1K1EA 3OPNA 3IVGA 1A71A 3V55A 2Q4RA 5CLJA 3IV9A 4K3VA 4M2LA 5CXQA 2DFVA 4UHCA 5J47A 1U9IC 2IP2A 4DZRA 3HXOA 3OKFA 5IHXA 2JK1A 1RQPA 3I23A 2WD7B 3JV7A 3ELUA 4G6ZA 4PZYA 2D2VA 5FTNA 3TQSA 2LWIA 3EASA 5E9JA 1OLUA 2WWRA 4KGVA 1ONPA 1W48A 1SG6A 2P3LA 4IDBA 5ENDA 3UH1A 4UEQA 4P3KA 3SZOA 4MVJP 1C7JA 2WJGA 4JC4A 1YRLA 1CJBA 2DHQA 4BO5A 4QM7A 4GGPA 1IOZA 5JRDS 1YTUA 2QQ5A 2WUEA 2WDPA 2ZJ3A 3OPMA 4YLGA 2GD1O 1X7GA 5EAIA 1OFVA 2XAUA 3LQ1A 3HK2A 3MCAA 5IANA 4NULA 1SUWA 3IIJA 4QWMA 4UUQA 4YV2A 1KIFA 1WMDA 3CG0A 3AJRA 3QVWA 4KGDA 3SM9A 5CR9A 5C5CA 4N3BA 3OE1A 1AGXA 1H2ZA 1K6IA 1KO4A 2JBWA 5CLQA 2R2GA 1CEYA 1RP7A 1UJ5A 3B53X 4BC1A 2HFKA 3AR7A 1ML3A 3WGNA 3NCTA 5K4HA 1GLVA 3LYHA 4OI2A 1QNLA 1G3QA 3SFTA 3KELA 3VBCA 5A7FA 5CA1F 3G2QA 2I22A 1N8KA 3D6JA 4D0RA 3SGLA 1JDUA 5DHFA 3X2EA 1ESDA 1WABA 2G1PA 2QAGB 4DLBA 1PLLA 2D5LA 3GRAA 4FFVA 1W36B 2G0TA 2P65A 4GHWA 2WVAA 3IE0A 4OHFA 3BWEA 4HUTA 1SH7A 2J9YB 3H1FA 2ZYRA 1L7MA 3HBJA 4R3UC 3CF4A 1MO5A 4Y98A 3ZIAD 3D3KA 2LD4A 4G4GA 1FRNA 1R10A 5E0OA 4YRTA 1P1FA 4BMYA 2L69A 4OMFG 2QTLA 1QGAA 3U16A 1X80B 1TJ4A 3VVBA 2P62A 2BAGA 3OZGA 1T1IA 4N49A 1T13A 3FM9A 1FXWF 1RXCA