1B00A

Phob receiver domain from escherichia coli
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
122
structure length
122
Chain Sequence
ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional crystal structure of the transcription factor PhoB receiver domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB
total genus 41
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b00A00
4TLLB 4KVFA 5FWXA 4YR7A 2LUOA 3LMKA 1M2FA 3LUCA 2PUBA 2BGGA 1JDNA 3IP6A 4G0QA 2QVGA 3N0RA 3JPYA 3EQ2A 4IMJB 1FFGA 4RSMA 5TQ2A 3H5LA 2QVCA 3HUTA 5CNIA 1CEYA 1RXIA 2FVYA 3DZDA 3O2SB 1NXWA 1Z25A 5JNVA 1JL3A 2FLWA 4H60A 1LBHA 5IEJA 3HO1A 2E4YA 1GUBA 3A3KA 4UHKA 4RK5A 3Q7TA 3KYJB 4RZSA 3H6GA 5IC5A 4KREA 4TN5A 3I5AA 1LJLA 1NTRA 5GQSA 1TVMA 3OQNA 5PNTA 3KLOA 4F3TA 1C4WA 1P2FA 1YK1A 4Z4HA 4JB0A 2PAFA 4LE0A 2VYCA 2MSKA 4XASA 1SRRA 2HPHA 1YMVA 4ZMSA 4MR7A 2FQXA 4XLTA 5CNKA 2PL9A 4RXMA 3O2QB 4YWHA 3OLVA 2NZVG 3JTEA 2V0NA 2JVKA 3D8UA 5DGCA 4QPJC 1MB0A 1USKA 3LUKA 3P9YA 5TQ0B 1VRVA 1P6UA 3O21A 4OTZA 1U0SY 1F4VA 3CKMA 3M9XA 4OATA 4YLEA 3LKBA 5KC9A 3CZCA 3NHZA 3H5OA 2QXYA 2HQRA 3CNBA 4ZJPA 1ZH4A 3FFXA 2FEWB 4NCBA 3H5IA 3DBIA 3K4HA 1BDHA 1ABEA 2QZJA 1HEYA 1JDPA 1MIHA 3RVSA 4MR8A 1FFSA 3KG2A 3QEMA 4N47A 4P98A 1QO0A 2E4UA 1SXIA 3SQNA 1L5ZA 2E4ZA 3OLZA 1U2QA 3QLTA 5EWLA 5ED4A 3OQOA 5DKFA 3Q7SA 4YO7A 3RVRA 1E2BA 2LPMA 2H0AA 3EQZA 3LKVA 5IULC 5KQMA 1JYFA 4MYRA 2M1ZA 3HSYA 4YS6A 2HQOA 2E4XA 3ROTA 3H1EA 3KJXA 3QEMB 4N0PA 3EULA 4KFCA 5E3JA 4YRZA 4EVSA 4Z9AA 2P4UA 2MSLA 3MF4A 3IP7A 3LUFA 3KHTA 3N53A 3Q41A 1QP7A 1XHEA 2HSGA 4WWHA 5HKOA 2LP4Y 3GA5A 2PUFA 4LX8A 5HM6A 4MAAA 3SAJA 3JPWA 3KCNA 3BREA 4G0YA 4EYKA 5FBKA 3BRQA 3GBVA 1NXTA 1XHFA 5B3JC 2QR3A 2RGYA 5IUKC 4F11A 5FBHA 3I42A 3HV2A 1ISRA 4LE1A 3H5VA 2WRZA 1ZVVA 1Z15A 4IF4A 4HNRA 3GL9A 2A9QA 3SG0A 4EVQA 5IEBA 2GI4A 1Z2DA 3QELA 2R25B 2E4WA 2Q5CA 5TQJA 4MR7B 3I09A 3LUDA 4G0ZA 2JBAB 2IKSA 5TE9A 3QLUC 3ILHA 3RQIA 2ID9A 4RK6A 6CHYA 1CYEA 1RZRA 3JY6A 3VNBA 1YIOA 3T38A 1JHZA 3SNKA 4O5AA 3JVDA 3FFTA 1YS7A 2E4VA 2FXIA 1OXKB 3KTOA 4KQ9A 1VLZA 5EWLB 5IUNC 5JNRA 4NCAA 4NV3A 3RVLA 1Z12A 3OLYA 1YS6A 4OLAA 1JBEA 1P8AA 4KPYA 1ZHHA 3R0JA 4RY9A 1OXBB 2FEKA 1EWKA 1W9HA 3OLWA 3RVPA 5KQLA 4QICA 3GT7A 3HXMA 2QSJA 1D2AA 4EVRA 1BDIA 3CHYA 3DLBA 1JF8A 4Z0NA 3JVIA 1RXEA 4DN6A 4Q6WA 2IPLA 2QV0A 1D5WA 3TD9A 3IPCA 3NNSA 3H75A 4WT7A 4F12A 5JS2A 4G86A 2PUDA 4MS3B 1NXOA 1TMYA 4XAQA 3NHMA 1XWWA 5KQPA 5D2CA 3LUAA 4ZPJA 2RDMA 5EWJA 3FDFA 2VUHB 1LJUA 3TMYA 3B2NA 1IIBA 4F8JA 3LOPA 4FB4A 3EDCA 4G0MA 4M88A 4MLCA 3TO5A 4YV7A 4LDZA 3O1JC 3KYIB 1KRWA 2NT3A 3Q7RA 4HNQA 3HUUA 1SXGA 4RXUA 4JB2A 1DP4A 3LFTA 2NZUG 3E61A 3EGCA 4L85A 4ZYLA 1A0OA 2CD7A 1URPA 1RPJA 1UDRA 3HDGA 3H1FA 1TJYA 4ML3A 5JNUA 1JH9A 1PUXA 4MS1B 2O20A 3MM4A 2GBPA 2GKGA 4MQFB 4EY3A 5TPWA 1DJMA 4RS3A 4D74A 3GYBA 2WMYA 1QNLA 2ZWMA 3GV0A 3ILYA 3KSMA 1NY5A 2JB9A 1JYEA 5I4CA 1GCAA 2PE5A 2FMKA 2WJWA 1MVOA 4IMIB 3HCWA 1B00A 4RU1A 3W9SA 4EYGA 3OMWA 4W5OA 8ABPA 2B4AA 1ABFA 4WZZA 4PICA 1USGA 3C97A 4KK3A 3G85A 3A0UA 3MMNA 3LUGA 3N8IA 1BVHA 1WETA 2PLNA 4MS3A 3H5WA 2IPAB 3MIZA 2PUEA 2FQWA 1Z13A 4RXTA 2JBAA 2FKAA 2FSPA 3EODA 2L19A 3GRCA 4NICA 4RV5A 2JRLA 3K9CA 2MYNA 3Q9SA 3FGZA 4L4UA 1F51E 1QO0D 4W5TA 2NUBA 1DG9A 3N0XA 3C3KA 1PNRA 1CHNA 4P1ZA 4Y9TA 1GLGA 2CHFA 4LRQA 2PJUA 2A9RA 2RJOA 2F8SA 1JFVA 4WXEA 4Z4CA 4GPAA 2IOYA 4IGAA 4RDCA 5TQ2B 2FMHA 3Q15C 1I3CA 1MB3A 1Z2EA 2GWRA 3QLVA 4MGEA 5T3YA 3T6KA 2OENG 3URMA 3CS3A 2XDYA 1MAVA 4TLMB 3IPAA 4MPTA 2ZAYA 1S8NA 3N75A 1EWTA 3F6PA 5TQ0A 5TPWB 4RWEA 4N41A 3FFWA 2YHAA 2PMCA 3OMXA 4MS4A 4MS1A 1E6KA 1ZGGA 1JFTA 2PL1A 3FMVA 4ETIA 4YCSA 3GBPA 2YHBA 3RVKA 1H9CA 5KC8A 1R8JA 3DGFC 1Z26A 4E7PA 3N0WA 2PUCA 1Z17A 1E6MA 3HJFA 1USIA 1M5UA 2IPNA 3QLUA 4H3KB 4Z4EA 2PUAA 3HZHA 2WWVD 5HQJA 4MR8B 3RVMA 4H3HB 3L6UA 5KQGA 1Y1LA 2PUGA 3ROFA 3CU5A 3O74A 1LK0A 1ZDMA 3QK7A 2L2QA 2VK2A 4CBVA 2W42A 1BAPA 5T7BA 2L18A 4MRMA 6ABPA 5IUJC 1PEAA 3I45A 1JFSA 2CHEA 2L17A 3TB6A 5DTEA 4JASB 3RVNA 2OQRA 3KS9A 4ETMA 3EJWA 3F6CA 1A2OA 3KLNA 4XARA 3CRNA 1DCFA 4N76A 1DZ3A 4S04A 1QP0A 4MLDA 4HYEA 1BDJA 3LUHA 2B1JA 4W5RA 5JNWA 2VUIB 1DBQA 4KRFA 4MQEA 3OM1A 2A9OA 4ZMRA 2FEPA 4RY8A 1KRXA 2N9UA 3O1IC 4MR9A 2GX6A 2TMYA 4XFKA 4D6XA 1EFAA 4MS4B 2LIVA 3HS3A 3OM0A 3A10A 5JS1A 5TPZD 4WUTA 5FWYB 4LZLA 4D6YA 4B09A 4Z4FA 3N6VA 3A0RB 2MSWA 3IP5A 4RKQA 4JOQA 3HDVA 1ZY2A 3CZ5A 3OLXA 3TX6A 1RZRD 4FE4A 4W5NA 3IDOA 4Z4GA 4WXMA 1P6QA 3OO0A 1U8TA 2I6FA 5BQ3A 1AB6A 2NT4A 2HQBA 2PKXA 5KI6A 4ETNA 4RKRA 3E3MA 4NQRA 5CHYA 1TM2A 3MQ4A 4KK4A 1YTUA 1PHRA 1JLKA 3F73A 1SD5A 2FN8A 2R4QA 3CG0A 5HSGA 3H5TA 1M2EA 3BRSA 5DLEA 4RK4A 4Q6BA 2ID7A 3O1HB 3OQMA 4DADA 3QLVC 1W25A 4RK0A 4Z99A 4Z9BA 4EYQA 4EYOA 1NATA 4MQEB 1APBA 4S05A 1DRJA 7ABPA 1C0EA 1DBPA 4PE5B 2F8TA 1T34A 3JS5A 3BBLA 3SM9A 5BR1A 2FMIA 4MR9B 2RJNA 1VPWA 4PZ0A 1LBIA 2WB4A 1GUDA 2LBPA 1EAYA 1AB5A 2R47A 1JX6A 9ABPA 5C5EA 4RK7A 1DC8A 2P9HA 1J56A 1M5TA 2M98A 3QX9A 3HK2A 4N03A 3MYYA 3C6QA 4QYWA 5KWSA 3T95A 2R48A 2WY2D 3MA0A 5FWYA 4G0XA 4DQDA 1QQBA 4MRMB 2MYTA 2DRIA 5BRAA 1YMUA 1ZAYA 5BRJA 5C5CA 4OLBA 2QW1A 3NBMA 1TLFA 3O2JA 4W5QA 2FLKA 3CG4A 1BA2A 1QKKA 1DC7A 1Z18A 3RVQA 3SY8A 5IX8A 4O1IA 4TMYA 2X7XA 2A9PA 3D02A 3QELB 4G0PA 1NXPA 4KV7A 2AYZA 3NNNA 4RK1A 3T8YA 1D1PA 1DCMA 4UHJA 2FMFA 1EWVA 2HJ9A 2H3HA 3M6MD 4RY0A 2J48A 1PEYA 1K68A 3LTEA 1ZN2A 3S99A 1VKRA 3C3WA 1FQWA 3O75A 1YK0A 4G0OA 1QP4A 1JWLA 3HVRA 3QX8A 2IDMA 3DGEC 3C3MA 4JAVC 5JNTA 3L49A 4G97A 3OO1A 1QQAA 4PYRA 3RH0A 1DRKA 4N0QA 2JVJA 1ZGZA 3VNAA 1ZESA 2MYUA 5F64A 1GCGA 1NXXA 4MQFA 4O1HA 5IBQA 1QPZA 3RVJA 4YP9A 1RNLA 2CWDA 4HNSA 1NXSA 3RVOA 3CLKA 1L5YA 4Z4IA 4IILA 3H6HA 3HEBA 4GNRA 3QEKA 4KQCA 5GOTA 1YVUA 3EAFA 2AYXA 4QYMA 1DBWA 2IPMA 4KZKA 3HM9A 1EHCA 1DCKA 5EWJB 2MYPA 1NXVA 2JVIA 1FSPA 5ABPA 2KYRA 2JK1A 5B3JA 1ISSA 3UKJA 4LE2A 5CNJA 4OG2A 5EWMB 1D1QA 5DCLA 2FW0A 1U2PA 1U04A 2QU7A 4FE7A 4LDAA 3F7NA 4Q7EA 2WJAA 4E7OA 4XXHA 1A04A 1ZH2A 3UK0A 4JP1A 1K66A 4KMRA 3BILA 1Z16A 3LUJA 1PNTA 5JNSA 3GWGA 4IRXA 4JA2A 5CNMA 1KGSA 3DLHA 4KNYA 3G1WA 4EUKA 3IP9A 4YGXB 1KMIY 3CFYA 4EGSA 5FWXB 3UUGA 5EWMA 4PEVA 1QMPA 3KKEA 2FN9A 1FFWA 1D4ZA 2FTKE 4F06A 1SXHA 2IYNA 2JCGA 5TPZA 2FQYA 3H1GA 1E6LA 3NNDA 1ZITA 3CTPA 3M9WA 4OBBA
chains in the Genus database with same CATH superfamily
2ZRKA 4D97A 4FDVA 5IHXA 4BE9A 2PUBA 1JHOA 1YZYA 4OY3A 4KXMA 1JMVA 4YB8A 5TJ9A 4LF9B 1FFGA 3EH2A 5TQ2A 3A3OA 3V4OA 2YV2A 3B9QA 4URFA 4AY2A 1RXIA 4Y7CA 1QSGA 1QFJA 1XJWA 3NAGA 2Q99A 4IH9A 2W2TA 1FA9A 4RQAA 3UGQA 1TXGA 4FU0A 2OGWA 4B5KA 1D6MA 1CUHA 2WU4A 2R85A 4NU6A 5G0VA 2OYCA 3IOMA 4P36A 3RUDA 2EYUA 3C6YA 1U0NA 2CXXA 2ZIVB 3LP5A 3DKIA 4NBKA 1NFQA 4BFXA 1FXUA 2XZDA 1RI2A 3Q72A 3HKCA 3QVXA 1NX6A 4X24A 5EZ6B 4ZTUB 3TLGB 1PN3A 3TQQA 3U3ZA 1C1HA 2QK4A 1J2EA 1XPJA 5JAQA 1E7WA 3KKKA 3RD5A 2N46A 3V4FA 2JCXA 1HYHA 5DX0A 2HPHA 3ST7A 1SUEA 5I5EA 3TFOA 1ZJZA 3NH9A 3GZNB 1R37A 5IABA 2ZSEA 2A5FA 2HBRA 3PD0A 1P2VA 2E49A 2D59A 2P91A 3U7JA 1BYUA 1RD4A 3TKLA 5EJMA 5LDGA 2IHTA 4WOPA 5DGCA 4ZI7A 4AZVA 3E05A 1R0KA 1ETHA 2AHOA 4ID3A 2VHQA 3G5MA 3JYOA 3TZHA 421PA 4H2DA 5FYQA 2YYZA 1G38A 4JHXA 1T25A 3NHZA 3NWBA 4JGIA 2GRUA 4HGPA 2ZVPX 3AG6A 1Q1BA 1R12A 4DM4A 2CMGA 1E5QA 1R0BA 1M2OB 4QREA 4WAUA 1TVKB 3D43A 2QSYA 1WPGA 1YUMA 3CLRC 5AJWA 4X66B 4FZ3A 4G1EB 4Q3LA 4B3JA 3RANA 1F0NA 4UDYX 5ESRA 4DREA 2DQSA 1IG3A 1PT8A 4R7TA 3IXLA 4TVSA 3E35A 3HCPA 4I2VA 1WE2A 1P7VA 3LXXA 4LOJA 3BK7A 1XCPA 4LY9A 3OQOA 2BI7A 4RBNA 2DWPA 1FMTA 1SC3A 2VHXA 4MYRA 4A23A 1VMIA 3E9QA 3NUZA 1T15A 4BO1A 2QUJA 3PVSA 4RS4A 3WKDA 4ARSA 1GTVA 3L7NA 3ZY5A 1GNSA 3AJRA 4HWPA 1IJKA 2QUAA 4RTJA 1H22A 3AFIA 4ICIA 2AZTA 4FYJA 1IWOA 1MC5A 3F6YA 1L7OA 4IGKA 4UBIA 2YMLA 5HKOA 3ITKA 4HDSA 4YJKA 4YMIA 3MXOA 1WXWA 1KI6A 4RTMA 3SAJA 4MUEA 4P34A 1GAJA 2EJVA 4TM8A 1MPTA 3X1WA 2QENA 1OI7A 1KEKA 1H2XA 2IP2A 1K7YA 1Y3CE 3EBPA 1H1LB 1Y98A 3BTUA 1NRJB 2ZIEA 4Q9JA 2QGZA 5ERYA 1AQJA 4D6PA 3NT5A 1R9MA 4O29A 2FW8A 3DD1A 1F5NA 1VE3A 3HYRA 4JSRA 5EKXA 3O8OB 2DE0X 2IQ5A 4YCNA 4KMOA 2PQMA 3WIVA 1CYDA 3TLZA 2YWBA 5HK9A 5TE9A 3QLUC 3TL3A 3ABQB 5B1EA 3PQEA 4LYGA 2D13A 1A27A 2J07A 3GJ4A 4FGUA 4EY8A 4GT1A 1YVDA 4GBED 4P7BA 1FQKA 1IHYA 4NOJA 1NLZA 2PBZA 3MCVA 2DT5A 1KZ1A 1Z33A 1NX9A 3OLYA 2GZ1A 1B14A 1Z29A 2C2BA 3C43A 2PZBA 4Z7OB 2H7YA 1G2IA 1MH1A 1U7HA 2D1YA 3NT4A 3STVA 1J21A 5L8VA 2VP4A 3GD5A 3GT7A 1GNTA 2QZSA 3K1JA 3NJ4A 5ALGA 4D99A 2EL7A 4DQLA 3GIWA 2XHZA 5CVDA 2I8CA 4KIFA 4GXRA 1B2LA 2JW5A 4TMZA 2VBGA 4TVBA 3NC0C 2J33A 4DMRA 3K0AA 4N5NA 1T3HA 4N5MA 2ONKA 4EO4A 2GZSA 1KDTA 3ED5A 5ENVA 3REOA 1XWWA 3CMMA 5K8LA 2BIFA 1GR0A 2W11A 3ZPXA 1FMLA 2R3SA 2RDMA 5GM1A 1M8FA 1ZNZA 4DA7A 2VDUE 1KY2A 2O54A 3FDFA 1EGMB 3NS7A 3DMDA 3QE3A 5IVPA 3O8QB 1XD2B 3Q1KA 4PE5B 5T8KC 1F2VA 4DAOA 1GPH1 3WOHA 4HP8A 4YXFA 3GCWA 2HRBA 2VJQA 4MLZA 5JVDF 1R10A 4G2NA 2JGKA 4PYLA 5HUQA 2DR2A 1YDMA 4CYMA 4TKVB 2ZM5A 4IGFA 4U2BA 1TZJA 2BC9A 1MO4A 4B43A 1B93A 2YWXA 1YD7A 5BSWA 1URPA 4ZVNA 2EFJA 1UMDA 3DCYA 1AGPA 3HDGA 3V4PB 1GN9A 2V9ZA 1Q74A 4GR5A 2HM7A 5CHEA 2FPKA 4NCIA 4Y0VA 3SEQA 3CLTD 3DMNA 3WS7A 3H1AA 4M8SA 4NABA 1R4MA 3KE8A 4O08A 3HVJA 2IEAA 1W76A 3A4LA 3L0IB 2W6CX 1RQRA 4FFRA 5FR1A 1TT5A 4ND5A 2HPZA 5D1NA 3GLHB 5EIAA 4NL4H 3RC3A 5IJWA 5IU6A 4ENQA 5JSYA 1Z82A 2WDZA 2V3CC 3N2IA 1ZINA 1X80A 2W6IA 3U7QB 4JVOA 2HJRA 2MDTA 3NHPA 4F86A 3SHWA 1CR4A 3U1BA 2PN1A 4RU1A 2CNOA 2BE9A 4OU4A 2W90A 1UZNA 4UHEA 1U8ZA 2A59A 2CLEB 4ZVPA 5BT9A 4JC4A 4OL9A 3TSAA 3VU3A 3NXSA 2PWZA 4MVJA 4TXNA 2P2GA 1BGVA 2W2QA 4R40A 2NPOA 5G3ZA 3V4VB 2PUEA 3FHTA 4PU0A 2BH9A 1AHNA 4ZZ0A 2WW8A 2HA5A 5SYAA 2KWIA 1UWLA 2FQ1A 2ZRQA 3VKUA 1JHAA 1JIIA 2HJSA 3GD7A 3DB1A 3LQFA 3NHFA 3OX3A 1B7GO 3OWOA 2EW8A 4GGPA 4J16A 4MIOA 4XUEA 1CIJA 1R4NA 4ZXFA 4YROA 1CNEA 4BEVA 4IDFA 4IUCS 1QQ6A 1RMTA 1DC4A 1NR7A 2EX1A 2PJUA 2BMJA 2XYQA 1HPLA 2Z9CA 4PCAA 3T94A 2NX2A 4I5GA 2JANA 4RDCA 1YRQA 2BW0A 1JVSA 1CIPA 1Z8HA 2BHTA 1MTOA 1D0VA 2C4WA 3D8NA 1DKOA 3HXTA 3FJOA 1KFKB 5HFNA 2ZU0C 3URMA 3ZCTA 3TOVA 1YJCA 4EHBA 2AG8A 3WAJA 3BGVA 3D4NA 4L28A 5U4XA 1PBTA 1XMJA 4D57A 3DQZA 2F3SA 5IYZA 1SN7A 4DXDA 3B51X 1T5TA 2GM9A 1XZ8A 2X0JA 4RWEA 5ARDA 3SJZA 3KJHA 1CERA 1XTTA 2HMSA 2PL1A 3O3NB 3JVUA 3OZIA 2XOKD 2P9BA 3BAZA 4PHTA 5DHTA 4J29A 2OUIA 4Y7DA 2HPAA 1YACA 2GD2A 2DQZA 1ZXBA 3GLHA 1Z17A 4NIMA 2YNMD 4O4LB 5FJIA 4URUR 2DMRA 2V7GA 3QMPA 2PUAA 4YAEA 1G6OA 1PL0A 5HE8A 4RNCA 4Q24A 4JNCA 1IONA 1ZKMA 3R7AA 1LK0A 3H0CA 2ARKA 3QHAA 2L2QA 4W63A 3DDUA 2XXBA 2OQIA 3TLGA 4JBHA 1BRMA 4L75A 1BXGB 1IYZA 3TM4A 4BMPB 1CIVA 1Y9EA 4P86A 2Q5FA 3DWEX 3CH5A 2Z04A 3WWPA 2GBCA 4GBJA 1K6XA 4I5EA 4GI2A 4M0FA 3H2SA 5JU6A 3AXSA 2WG2A 4JODA 1S89A 4TT3A 2ZS9A 5KYGA 2RI1A 5F7XA 5KINB 2C3MA 2I3BA 4YRSA 2D1RA 2Y1GA 1E1YA 3RSFA 2IHZA 2VIIA 4BZWA 2JJMA 4E2WA 1Z08A 1CZLA 3U3DA 5CCEA 4GR9A 1OYWA 5TGZA 4BZQA 3WMGA 4UNPA 3UJAA 1QRTA 6Q21A 1Z7GA 1FP4A 4MW1A 5DGTA 4OI4A 2P0YA 3WGOA 3HLTA 1ZH0A 2JFXA 3RNLA 1E7QA 4DBZA 2OOSA 3OCVA 3RTAA 3IMKA 2PRSA 2OBFA 5JS1A 3B8EA 2ZUUA 2REQB 1SQ5A 5AIBA 1PS8A 3NHLA 3SICE 4FWBA 4AJHA 3RKUA 4HEA1 2NSDA 1L7BA 2AUMA 2HB6A 4HYTA 4L5JA 2C07A 1Y5RA 2YIMA 4JOQA 2OWEA 1AK1A 2OBLA 1GDTA 3GLGB 2BCJQ 1LBEA 4KSYA 4B80A 1LCIA 5DLYA 5JNLA 5DBGA 5AOAA 4R0VA 3FY4A 3JWIA 4G5QA 5FLEX 5HTKA 3ROPA 2WNSA 5B57C 5JZ9A 4DLYA 2IL1A 1QCYA 2C9YA 5I4IA 1Z36A 4INJA 2WWYA 4MRAA 4P38A 3OTGA 1W44A 3K70C 1UKEA 1ZCZA 2FW1A 5DOVA 1AS2A 1LX6A 1K7CA 1VPVA 2FN8A 4IHQA 1TRKA 2BELA 4L95C 4MGYR 4CG0A 2CLOB 4V1CA 1UJBA 1WVGA 3E9EA 2GERA 2I5PO 2EWMA 1LTHR 3FDXA 2VAVA 3BCUA 4JLOA 1KVTA 4WCFB 4MXDA 2CJPA 5ER6A 1AQYA 3NHSA 4Z0TA 3VSDA 4RK0A 2OYRA 4DS3A 3DE3X 4BTVA 1DQZA 3LPNA 3MWFA 1D2NA 1QYRA 3KQVA 4COKA 1A4RA 1WPRA 4BMVA 3ERCA 1APBA 1KJ9A 2GVDC 2IWRA 5A4JA 2QT9A 3AP2A 3D4OA 4PYMA 1XV5A 2X1MA 2F3UA 4YRCA 2R8PA 4A5SA 3JS5A 3NIFB 5CXXA 4DVGA 4Q3KA 3KB2A 4UBLA 2LBPA 3ONNA 3CWZA 1TCBA 3H19A 1PJ4A 3L8CA 2GETA 3GELA 5D5HA 5KNLA 1WU7A 3QTLA 1E0JA 3O1LA 4G36A 2BM1A 4JBYA 1QQBA 2DRIA 2RHBA 3KSBC 3TTXA 4PONA 4LQ4A 4HGOA 5A62A 2ZGVA 5JARA 4PPFA 4ABYA 4BNVA 3K32A 5F2KA 1M83A 2PMEA 4CLRB 3NGMA 3UAYA 2HDHA 4TUYA 1AT1A 1S8FA 2HWXA 5I9LA 3D02A 1BX1A 4QLBA 3L7LA 3KAQA 4Q01A 1XTSA 4RLFA 4GZLA 4M9RA 3L6DA 5DCYA 4Z9XA 5B1SA 2Y77A 3LYLA 2J48A 1IZZA 2AJCA 4PLFA 5EINA 1LA2A 1RDFA 1ADYA 1G2QA 3UA3A 5KKCA 4JI7B 2OLKA 1UP6A 4BWGA 1VL6A 1JHYA 1O87A 3TRJA 1ZICA 1E63A 3DDWA 3I9MA 5T67A 4TKVA 1JWLA 3H04A 2IDMA 2ZAGA 1GIAA 2AUNA 1IM8A 4BLWA 5IF3A 1SU7A 1XTJA 3UXMA 4ZYUA 3DLTA 3M6WA 5BY2A 1IVSA 4OHVA 3EK2A 3KXPA 1WB9A 1LQ2A 1NVGA 3D3EA 4O1HA 1QPZA 4HZGA 3GFOA 2J09A 3WK9A 1ZM3A 4C3ZA 4DCOA 2O19A 4OGLA 4A8JC 1R6AA 2L42A 2SICE 5EKSA 1XRQA 4CLDA 1KOGA 1HG1A 4G9BA 4JP2A 5BWMA 4Q15A 2CUNA 4KQCA 1B6GA 1RCFA 2Y76A 4OHOA 4TYPA 1RLOA 3TLBA 1POWA 3NATA 1TO1E 1U0GA 5LZ5A 5DM60 1QF9A 4J2OA 2HQ1A 2EGHA 1W88B 2MOKA 2VCYA 5I5GA 3OKFA 3B1VA 1K27A 1VBKA 2I78A 5EMKA 1KOLA 3ZG6A 4LE2A 4I2NA 3ZK8A 2WUWE 5DCLA 3N39C 1CQJB 2XZOA 2C61A 3P4YA 4YAKA 1PKXA 3DV0B 4KQJA 4ZV9A 2XLBA 1QLHA 4O2AA 1GU7A 1L6RA 3ZV5A 3PQ2A 4TLCA 3K8ZA 1CEQA 3MTGA 3PHJA 4KNYA 4L4ZA 2P9TA 2O3SA 2PWBA 2E18A 2KE5A 3E81A 4TROA 1P2GA 1WXIA 1YS2X 3CFYA 5EFOA 3RRYA 4MO9A 4UHFA 2CEKA 3DONA 1HYQA 3FD8A 1BQ3A 3G88A 4OJNA 4X9XA 4C6TA 4GX0A 4JKIA 3STTA 1U4OA 3DEYX 1JTEA 2I2CA 4GGOA 1KK2A 3D31A 5BQOA 1A9RA 4A0RA 1QRAA 4R0MA 3T9FA 4DV1B 3N87A 3CBQA 4ATNA 4CCAA 3AUXA 1G9XA 2FOLA 2FUCA 2VEOA 3CVJA 3UWSA 4AROA 2HHHB 2OHXA 3JQ7B 3GQBA 4RVCA 1RVDA 4TL9A 5HIMA 1WA5A 1VP3A 2Q2QA 2X1VA 2RHGB 1CR6A 3E7XA 3LMKA 5DSTA 1YSCA 4FEAA 2B92A 3LF2A 4M1MA 1WD7A 1E1DA 5EXSA 3RRBA 3AJ9A 2R84A 1IXYA 3ZNQA 3OE4A 6LDHA 1P1CA 1YKSA 2A0FA 2FZGA 3FNRA 1N1MA 4Y2RA 3PL1A 3X1XA 3CGWA 3H4TA 3KP1A 1SXJB 4CMIB 2IYSA 2NAPA 3CJTA 2NTJA 2F1JA 3NQ41 4D81A 2Z3VA 1ABBA 5DNDA 5EIBC 2OPBA 3MRVA 4QWWA 1A4UA 4Q3CA 4WKNA 3HJBA 4XD7D 3U3XA 3ZE6A 3Q8MA 2OA0A 3ZGOA 1DXOA 3NP7A 2H4YA 3C2QA 3C3CA 3BMOB 1G19A 3N2LA 4B4WA 1X13A 4AN1A 5ISMA 1HQDA 3WIOA 3NXKA 4KIWA 1M8GA 5K4GA 3BGOS 2ZS8A 1W48A 3OHMA 3B2EA 1HDYA 2ZT5A 3TCXB 3JTMA 2WSIA 4QDOA 4ZHSA 1LPOA 4QM6A 1KP9A 1DVRA 4UAJA 3W7BA 1JHMA 4XD7A 1J0DA 5IJ0A 3JQBA 1D8AA 2FR8A 3ESRA 3ZYCA 3VJRA 4M60A 1OMOA 2J46A 4IDBA 3CPJB 1QKJA 2O2CA 3LRTA 4RKFA 3EOBI 4A26A 1LU9A 4EF4A 3V7FA 3PFHA 3HG7A 5HIIA 3M9XA 5AJHA 1VJ1A 4BMYA 1M8JA 2DLNA 3CZCA 3EEFA 4RTLA 2BGWA 4D56A 4GWKA 1Q0LA 4KOAA 3EDOA 4BO6A 1ODJA 1X14A 3IIEA 1U1CA 1OUMA 2VYQA 1ZJJA 2BN4A 3C3DA 3CLTC 4O3FA 4HYYA 4DSUA 4PC6A 5DM1A 1LSUA 4HGYA 5JS7A 3UK7A 5FPYA 3JARA 3KQSA 1AJEA 1RJDA 3U81A 3KAJA 4V24A 2WOJA 4PSKA 1MW9X 4KQFA 4M1TA 3U3MA 5FRDA 3GA7A 3S81A 1V96A 3S28A 3SQNA 1FRQA 1LI5A 1SFRA 1KYZA 3CCBA 1KDYA 2R6FA 2HK9A 5ED4A 3UEOA 5KOHB 4YUYA 2EKDA 3WKAA 3EVTA 1Y9AA 1QRRA 3EHDA 3KUUA 5K0FA 3D3WA 1XKXA 3DE6X 1S4QA 1OI2A 1VIVA 1T9ZA 3PKIA 3MIIA 1HH4A 1Z4MA 1W0JD 4I46A 4QYIA 1FFXA 3AIIA 3DUFA 2XF2A 2GO7A 2G9QA 3UWMA 3G7UA 3MT8A 2AR7A 3F3YA 3FOAA 4G1BA 3WYCA 2FI1A 3MBKA 4PTZA 4PXSA 4ZEWA 2M6KA 3V00A 2IU0A 2OC4A 3S2SA 4BATA 3W2GA 1LFAA 3KXKA 1EFLA 1VPEA 5K2MA 2PUFA 4RIFA 5I7FA 4G4IA 4A0GA 4Z54A 3CW2A 3PNMA 2H1OA 3WI7A 4N0MA 2QAGC 3OOSA 1X9HA 3L46A 1KWKA 5FBHA 1VI2A 3D59A 2EDCA 2A84A 1E5VA 3H5VA 5HZMA 1ZBDA 4QELA 5HKBA 3RYCB 4LTNA 5FF9A 3LX8A 2Y66A 2V5UA 3QY0A 1ODFA 1OU4A 4MKRA 4WCFA 2DCMA 1J8QA 3H9CA 5TQJA 4DEYA 4ILKA 5AI0A 5ALMA 2F59A 2XZPA 4C4RA 4IQ8A 4JJEA 1BHO1 4UEOA 2ZVDA 3RK0A 3CINA 3SXUB 2J32A 4ZREA 1YU9A 4DEVA 4HS9A 5EN4A 4H6PA 2IX3A 4O2BF 2H11A 3KQKA 3NKVA 2H4ZA 4HUJA 2IOFK 3I04A 1WULS 4IEIA 3IKMB 4RSGA 4WHMA 2ZYWX 5HMMA 3IE2A 2VAXA 1S01A 5EEGA 5FH9A 1U7ZA 1YOBA 2QRJA 1E2JA 2RIPA 2WTNA 9LDBA 1UDBA 4AP9A 5ALRA 4E2XA 4LNUB 3TQCA 1GKLA 2ZAIA 3TUJC 2PJDA 1LI7A 3EJ6A 1KBQA 4A92A 1JA1A 1RADA 2HLDD 4MINA 3K9QO 3TPFA 1O89A 5CB8A 4MTLA 3NNSA 2PG3A 4G2TA 1O2DA 3IB3A 1IOWA 3LY5A 2CL6X 2UZ1B 1F5SA 3LL4A 2ZWPA 4YACA 5JS2A 1EUDA 2IHJA 3DL2A 2UKDA 2XVMA 1PGNA 1VFPA 4ZHQA 1JEQB 3MWYW 1MV5A 2PX4A 1R1DA 1YB7A 1JSCA 2P6OA 3PRJA 1RAHA 4GYJA 1LVGA 3OQPA 4C30A 2C7QA 3WYDA 3AVTA 4Q3EA 1HDXA 2BZGA 1KARA 4OK6A 3DZ8A 4HWOA 3K70B 4QE3A 4MTCA 5BWLA 1UT5A 3RBXA 4Q1BA 4ZA2A 1N0HA 3HUUA 1J8VA 4A8TA 1A5BB 4XI9A 1SKMA 1KVQA 3GLFE 3NGXA 2YHIB 1AGRA 1Q15A 2JD0A 2GM4A 3PGVA 3WO0A 1HDIA 4EJSA 4ZANA 2JGMA 2QM8A 5FTNA 2F90A 2W83A 3OT1B 4R2KA 1KZ4A 1SQSA 1W87A 1E9RA 3FCYA 3MCUA 3OCZA 4FCWA 4YQYA 3R7WA 1N6OA 4D43A 5A4AA 5JLAA 5JFOA 3QITA 3ZWKA 4G8BA 4I55F 4PNZA 1QCCA 3JWEA 4P81A 1DJMA 2NV2B 1WDLA 2DWUA 4WERA 3ZYZA 3J81k 3Q8LA 4ZU1X 2XYPA 2XAAA 1K9SA 1M1YE 1ZK1A 2VLIA 3AHHA 5H1YA 4PG8A 3CM0A 2BFAA 3CVOA 5ULLA 1VXRA 3QBTA 1ZNQO 3KIPA 1EIZA 2J5KA 2AD5A 2G36A 5AVTA 4BUZA 3I2KA 4XQ0A 2ZIUB 3ZBQA 2YWEA 4G26A 4NOLA 2PKWA 3O8CA 1F4LA 4XGQA 1H2AS 2FZVA 5CTAA 2LIPA 4RCZA 2W2MA 4LJAA 1USGA 3C7CB 4X20A 4C4XA 3CLUD 3LUGA 4NBSA 1Y3FE 4J90A 3DWGA 3D6NB 2HGSA 2Q3BA 2P68A 3W78A 1TQ6A 4EI2A 4AL4A 1GPDG 5G0WA 1GADO 3G5TA 4OOFA 3AB7A 1BU5A 3RBVA 1POXA 4L4UA 8ADHA 5K0CA 3PHHA 3IKTA 3CUSA 4HBGA 1SHTX 1YI0A 1PNRA 2NP7A 3ZD6A 2E2WA 2FP3A 2BLLA 3GJXC 2DTDA 1JFVA 3PJDA 4UUNA 1KVSA 1C8BA 3MILA 4QUHA 3C41J 3PRYA 3JZAA 1C7IA 3HCOA 2JD1A 4ENPA 4XDYA 4HNVA 2E1PA 4LQCA 4F7DA 2OOKA 4H77A 1EWTA 2VDKB 2EAUA 1QFXA 5JCJA 3F6PA 4FILA 3B38A 4QA9A 1NR1A 5BW6B 1KPIA 3B1JA 3OIUA 3N2YA 2ZJFA 1PWYE 5E6RA 2IYXA 1SCDA 4DQ0A 1JFTA 2XRFA 2QTCA 1PG5A 3IHLA 4YCSA 4FNOA 4DARA 2NVWA 3MMZA 3N2GA 5FEMA 3SSAA 1NNEA 2GJKA 1T6BY 3UXYA 4PQFA 4YRGA 4D3SA 1NP7A 3TR0A 3OFND 3U9LA 3UWPA 1SWVA 1G9TA 2GCIA 2GD1O 3RV4A 2V03A 4D4KA 4DCJA 4ZYWA 2B4TO 2YYAA 3RHFA 2YRWA 3BBPA 5CA0B 1RP7A 3B5EA 1B0AA 3H9BA 4JMPA 1PT9A 3IXMA 4LKOA 5H16A 3TSYA 3UFXA 1OD6A 5BSHA 5C1IA 1F0PA 1YDWA 3ANXA 5DYTA 1SVOA 4MGIR 4C4ZA 4TL7A 1M10A 2C7RA 2C8VA 5BW4A 3P27A 1DX6A 3QMMA 2Z0MA 3DZJA 1RXSA 1DBSA 2ZYRA 4V0ME 2O8DA 1H6BA 1C2YA 4AQ7A 1T9HA 3P52A 1WSWA 2G08A 1FP7A 2O0JA 1BVYF 5F2OA 2A14A 1SHUX 4KTVE 3RTBA 1OWPA 3T3IA 4HDMB 2ZG6A 2R6CA 4FKBA 4CE6A 1P61B 2OBXA 3RIGA 4ZIRA 1B43A 1UKBA 3QHPA 2XDQA 4Z1MD 1L8OA 4ZKEA 1MO3A 1JAHA 3QBEA 2ZSBA 5IN4A 4QUIA 1I9GA 1KHHA 3PHLA 5AKIA 4CF7A 1FYFA 1DQRA 2RGXA 4J1TC 3UV6A 5JFGA 4US2R 1A98A 4HZIA 5AKEA 2X0RA 4CKEA 1GTZA 1KJYA 3UCFA 4KVAA 3ZW7A 1W8DA 2BFDA 3ZLJA 2CXOA 4RE5A 4ZDKA 3SWWA 3GRVA 4RWZA 1RIFA 1E3DA 1P91A 2DFNA 2LIVA 2Q45A 4YAUA 1GWNA 3QKRA 1R4NB 4HDKB 4AZ3B 1SVNA 4CHGA 1Y1TA 1T3LA 4LZLA 3DKVA 4J4TA 3L4BA 3G9UA 3QPUA 2BMDA 2HLNA 4LXUA 2X4DA 4IIJB 2OHOA 4NPAA 2IXTA 7REQB 4RHYA 3DMRA 5BOSB 3ZU3A 4GQIA 4GEGA 2GPYA 2Q2VA 1OHHA 4PFKA 2DEUA 3ICPA 4ZYXA 3PUZA 1QAMA 5CJJA 1JAIA 3K1YA 2IF2A 1N6LA 4O4HA 4MW0A 4MW9A 2WF5A 1Z88A 1HQCA 4OP2A 5BN3A 2AMJA 4AG6A 1CVRA 2WZBA 1YZTA 3I62A 4KK4A 3GOQA 1ELOA 1ESDA 5EUBA 5KCZA 2ZBGA 3TW6A 2ZDHA 3JW8A 4LYEA 4I08A 1E6WA 1PWXA 3B3QA 3IUYA 4EIWA 4R1SA 1RLMA 1ODLA 3AXTA 5H80A 5LB2A 3SKVA 3WFIA 3MNFA 1N9KA 1EAMA 1Z4OA 4F4UA 1ZVQA 2DOKA 3HABA 2X40A 2C1XA 1U4SA 3ITNA 3SPXA 4RKYA 5JHGB 2M2IA 3RNOA 2CFSA 2J0SA 2GZAA 3K6SA 4N9WA 3VTFA 1SIUA 3A26A 3A6HA 3WWZA 5CT4A 3EFOB 3CF4G 4JENA 5KNCA 4OQDA 3KPVA 5TGTA 1JEQA 4EEKA 1MC4A 2OCXA 3BWCA 3G2KA 3T7DA 1DAKA 4PZ0A 2F2TA 3RF7A 4MQ5A 5J4LA 3PYXA 1KFCB 1Y8QB 2OCKA 1C2TA 4P4NA 1KY3A 2I3ZA 2AJ8A 1UK6A 5ENDA 1UWKA 2BGNA 4MROA 1W0KA 4EHLA 3KYDA 1HMPA 1OX4B 3H99A 4H7HA 1ZZEA 2C00A 5DI3A 4EEXA 3MYYA 5EKTA 3L8HA 1ULUA 3CMCO 5I7WA 2HK7A 2X86A 2IXBA 4NZNA 4W4TA 4EENA 5BMVB 4N7RA 4E3WA 4CLOA 2PPLA 4B48A 5LQRA 2W6QA 3IB6A 5CFRA 3STYA 1U63A 3AVXA 5F2NA 5ILGA 3PUVA 5E9QA 3I9LA 2GPAA 3REFA 2I1QA 3RVQA 3BULA 4ENWA 2UZAA 4J6FA 3ICOA 5JRZA 1BE6A 1WHSB 2X7XA 2OTCA 5T4FA 3UAZA 3K31A 3OOJA 3VR0A 1SBCA 5LKRA 3OIFA 2VC2B 3L05A 3UOGA 4BFVA 1ECLA 2P5SA 3FNBA 3OQJA 3NONA 4G1VA 1RPZA 2LVBA 1IIRA 2NADA 2WQZA 4NZPA 1VL0A 2JI7A 1N7JA 1YHZA 2VDOB 1ZOPA 2KBEA 3C6MA 4FN4A 4IVQA 2O2DA 3M1IA 1CJKC 4I1SA 5HVNA 5CLHA 1E2EA 1ZGJA 3C48A 3ZGYA 3N2NA 1G8JA 3OJWA 5HS6A 3MCWA 2Z9DA 4EFDA 4HRXA 1DV2A 1RT9A 1XDBA 5BOVA 3NEYA 4RSHA 1FDUA 3C3MA 4UU7A 1DQSA 3RI3A 5HCUA 1ECCA 5FPHA 3FYCA 3S6JA 1CUSA 3DEFA 1PV4A 3WC4A 4HG2A 4QJ4A 5B4TA 5BVGA 2Z6UA 4OXYA 3KSAC 5LQJA 1ZGZA 2WMDA 1U90A 4OAQA 4CCSA 5REQB 2OVFA 1NPYA 2Q28A 1MDBA 3GAFA 4IIUA 3W8RA 4JI3B 2X8BA 3COPA 4RIHA 4ZRNA 4XVUA 3CLKA 4KRXA 5JAMA 4MV0A 1EUQA 3FNGA 3VNRA 4EJSB 5KVVA 4ITUA 5M3BA 3R7WB 4YWJA 3R9KA 1J7JA 1KKLA 1K3UB 4WPGA 5CIWA 1DCKA 4B3DA 4BU1A 4CPDA 1Z62A 3HCBA 4POOA 2A7QA 4BC0A 4FFWA 1JHVA 4HMPA 3BCSA 3GC6A 2DPXA 3DG9A 5KZMB 5IVHA 2DWOA 4DUZB 3D1JA 4RH1A 4LRXA 2XEDA 4ZT2A 3SLKA 3T34A 3UHJA 3UMRA 1PJSA 4EHKA 4QJIA 4ZC8A 2JFPA 3KLBA 5CK5A 5ALYA 1CF9A 3HLYA 1XTKA 3LZDA 3U44A 4N5DA 4DUGD 4BFTA 2O8NA 3EBLA 2ZI3A 2PT6A 2ORWA 1Y7TA 2NPIA 4QPNA 4YGXB 1COWD 4B3CA 5FWXB 5KSZA 2MR6A 5LUAA 1SD1A 3LVFO 1L5SA 2XV1A 3IR7A 4F06A 2JGNA 3LHSA 3R4VA 1D4AA 3D8TA 4MRPA 1TA0A 4IGEA 1RRKA 5A05A 8MHTA 2AE2A 1OLSA 2HHAA 3QUSA 4G6ZA 1U1EA 1PT5A 2VRCD 4FGJA 3E22B 3SS7X 3D64A 4KFSA 5D51S 5EHIA 1RLUA 2LUOA 4EEZA 4GLOA 3BMNB 1FTNA 1KP2A 1II0A 1MOSA 3OSZA 2GKSA 3B70A 2NXEA 3CZQA 1SUBA 2QRNA 3HP7A 3IP6A 2WUVA 1C3EA 4GG1A 5EE3A 4LWZA 4TTTS 2QVCA 2AZMA 1N2BA 3BTVA 3CNOA 1V4BA 3DZDA 3P94A 4JYZA 1ZUD1 1DG1G 4MVYA 1AKUA 1DO2A 1LBHA 4UCFA 4YT5A 1KL7A 1JJBA 1FSZA 1L4MA 5DP2A 2P41A 4RX1A 1YRAA 5CA1F 4GM0A 1VL8A 2FN4A 5AW0A 2MIIA 4TV8F 5LBIA 2H1IA 1K98A 4QDUA 3LK7A 4YRMA 2G3YA 4LHYA 3PFWO 5KYNA 4NZMA 2TS1A 3LIPA 4PHCA 5AI9A 1E9AA 1ORIA 3L3BA 3HM2A 4CLOB 2OO3A 4YRAA 4JZKA 2WZCA 3OE7D 1SRRA 2IHUA 1F17A 4PN7A 3LTNC 2LTAA 1YV9A 3C7AA 2GYYA 2JBHA 3RASA 1NQUA 4YUZA 4XLTA 4ZI5A 2E3JA 2XA9A 2QRHA 4ND7A 3L0YA 3O2QB 2NZVG 4EMTA 3MBOA 2QAGB 4QPJC 1MB0A 2PX2A 3GMIA 2IU3A 2K2WA 4NPHA 3AF0A 3LDHA 3WLOA 3BA6A 2EBFX 5B58C 2IX9A 4JC8A 1X2BA 2DHQA 2J45A 2FPIB 4I1UA 4K3VA 1QIFA 3W8FA 4AJPA 4BGUA 2XMQA 4E5UA 1Z4IA 3WBBA 3OT5A 4MI3A 4BFWA 3OPXA 3WL7A 4C6HA 3LOUA 5BN1A 3DBIA 4IO1A 3DJYA 2RB4A 3K4HA 1R3UA 1UBJS 3DT9A 3QG5A 3BK1A 1G8SA 5DMHA 3PI6A 1X8XA 3VH2A 5BV8A 1DINA 2BKLA 2GCGA 3U60B 2IY8A 4P98A 4MVJM 3U7FB 2XQGA 3EQ6A 2R5NA 3O2NA 1R4AA 4PLYA 3M70A 2MU1A 1DUSA 2WYVA 4QZVA 5I9TA 2HCFA 5DKFA 5I4KA 1E2BA 2QTHA 3AVUA 3K0KA 1NONA 1PFWA 2CCKA 3FMFA 4TYQA 1UAGA 1XP5A 2Y67A 5IZCA 3EFHA 3A1FA 3ROTA 5ECGC 3OQBA 3KQQA 2YHSA 4IUDS 3BS4A 1DAOA 1K7SN 1P7CA 2PD4A 1E4EA 2NQTA 5E3JA 5JY1A 1TO6A 2OCLA 1B15A 2ODEA 4IIJA 2PBFA 1PQ4A 3AF6A 3IMCA 1CUYA 3R5XA 4AULA 2VHTA 3AUYA 5KYVA 1GQQA 1XAHA 2G6TA 3C3AA 1ZC3A 3EIOA 3NBAA 4TRRA 4U00A 4BQRA 4XSGA 4IIGA 1SU8A 3A1SA 4MP3A 1UEXC 2JLZA 5IBRA 2FHSA 1I1NA 1XHFA 3IKJA 1H2HA 3GGPA 3K0CC 3BMOA 4TQGA 5TT1A 4U2DA 1FU4A 4UM5A 4YMSA 5AHWA 1KEEB 1W4RA 2GF0A 2WRZA 1WP4A 3FR8A 3NH6A 3UHFA 4EVQA 3L06A 2OAP1 4U2FA 4TLBA 1H0KA 3D2BA 3I9JA 4DRXB 4BGEA 3O26A 1U0LA 4FFPA 1Z0UA 3QF4B 2OXFA 3IAM6 5SZHB 5EIEA 3ILHA 2OHVA 1I80A 1L7NA 2FK8A 3QH4A 5KJ6A 3D7RA 3FSRA 3ILVA 3VNBA 2OO5C 3GPCA 3HKCB 4AN4A 5F98A 1UPTA 3SNKA 3I6ZA 4P0TA 3W6NA 1UBKS 4TYWA 2E89A 1OXKB 4OM8A 4B73A 4G4SP 5KTOA 4BP1A 2PFGA 3WGTA 1GPAA 2BMEA 2F62A 2H9IA 1RHQA 4MI9A 1E2NA 2ZJ4A 3MOIA 1DRWA 1ENYA 2WAMA 1N5MA 3AUUA 4GC9A 4RMHA 4DKXA 1OXBB 1WHTA 1IHDA 2VPPA 1ZONA 1UBHS 5KB3A 4PSVA 3DLBA 5BR8B 1GILA 2AEFA 3KUCA 2MR5A 2WD7B 721PA 1RFGE 2H63A 5B7NA 3DOOA 5C37A 1D5WA 1IK6A 2VDPB 4LJ4A 1FLAA 2HA6A 3FCAA 4JV5B 1RHRA 3AKCA 2XVZA 3D0RA 1D4FA 3KZCA 1QCZA 4L8YA 1B42A 1I2MA 4NYJQ 3FIJA 2ACEA 2NIPA 2ZIFA 5E4JA 5EIBD 5H83A 3AVVA 3H8WA 3FJYA 3HKBA 4KWEA 4ZPJA 4EHDA 5EWJA 3MELA 1IAVA 3D2LA 4TXMA 1G5RA 4PG7A 3ZDQA 1TOAA 5EJ2A 3HCRA 3DFMA 2QZZA 4PN3A 1J07A 1R5OA 2O8BB 2WNIA 4HX2A 4OXXA 2FFHA 5E3IA 4Z51A 3FTEA 5GP1A 4N40A 2JF0A 2GD6A 3NTXA 2NT3A 4BBPA 3OFKA 5E2IA 2XUGA 4EA9A 3FNQA 4OYLA 4TL6A 3RB8A 5LPNA 3ZHRA 4BCDA 4AKEA 3B78A 3ORYA 4M1KA 2DTEA 5JMPA 4XM0A 3P5SA 2K6GA 4HFJA 1X3LA 2OXEA 1TE2A 3LS2A 4KMMA 3VA7A 1JH8A 1MH9A 1K86A 4MICA 1DEHA 4KW7A 1SKYB 4HUQB 3OQIB 3N5CA 2D62A 4ZGWA 3E9RA 5F51A 2X4IA 1R0LA 3BDIA 4NZYA 3MS4A 4JJZA 5HE9A 1KJWA 5CK4A 1HT3A 1OAOA 1XZEA 1MHTA 2RGNC 2WMYA 2ZSUA 2GASA 2XMDA 3GV0A 1EFPA 1L9KA 3MTQA 3ILYA 4GAEA 1TQDA 5CYPA 2D54A 3VJKA 3IURA 5KWVA 2UUCB 2O2EA 4FNMA 5FB3A 2WM2A 3UPDA 1Z6YA 3EZ2A 3HADA 1FU7A 4FDMA 2VNSA 1QHHB 2QLTA 3CW8X 3D7MA 4HMOA 4NCJA 4RVDA 2VN8A 4CKBA 4AWAA 4D9HA 4PQYA 3IE1A 5IC4A 3AR4A 3EUWA 1CG6A 3TBHA 2BFCB 1WUTA 1OIVA 5JWHA 1SXJA 4FW8A 4CMIA 3WLNA 3QPBA 2XR1A 3MMNA 2O3JA 3BT7A 1QU3A 3O8OA 3K5PA 1JLSA 1NVWQ 1A2KC 4V2IA 3UMCA 3UWOA 4I6JA 1SKUA 1QGZA 1TJ5A 1JU4A 2BISA 2FSPA 2PUHA 1Q5PA 2PPVA 4IWYA 2C2KA 2J3IA 2QQGA 2SKCA 3F1LA 3GRCA 1U7DA 1VMEA 3PBKA 4LHSA 3ZS8A 4C0SA 3FZEA 4W99A 4F5YA 4FR2A 4FYKA 4W8OA 1F51E 4GLFA 3LLMA 2IYUA 5HQ3B 2OCAA 2P2LA 1RYDA 5IAJA 4CWAA 1Z5PA 4A15A 2AEEA 3KM0A 4ZTZB 2O6LA 2VJPA 1KOJA 3HY4A 3QLVA 4E5DA 1MB3A 4DEXA 2XQIA 1MB2A 3KEFA 1FNDA 1MQAA 3IP1A 1ZXLA 3W77A 5FO0A 1SC6A 2BGLA 4YJ3B 3R7NA 3TE7A 4MWSA 2Y0DA 3N75A 4LDNA 2GK4A 4XSVA 4DZZA 4J0IA 5TQ0A 2ZJOA 3VR3D 4C6RA 1V11B 1ZQ1A 4D4GA 2E85A 2JPDA 3P0HA 4G0UA 4OEHA 3H2GA 3W3AH 1VE9A 4YMVA 3PGJA 1EUDB 3LDFA 2C5SA 2BJWA 2ILVA 4GICA 3BH0A 4TTSA 4BGVA 2B6HA 1Y8ZA 2H5LA 4B8YA 4Q9HA 3M8KA 2ECKA 4U7GA 1T0JB 3BB4A 4A2CA 3AR5A 1NJSA 1ECJA 3IT2A 5BXYA 4CW7A 2Z4TA 3K9BA 3OUZA 4RMNA 3CBGA 1HSZA 4LYDA 3O8QA 3PHBE 4IYJA 4TT3D 3HZHA 2IHVA 5HQJA 1KSGA 3VUFA 1NLYA 3ZHUA 4AZTA 2R9VA 1XZAA 4U2CA 3S2FA 2YVKA 3CU5A 3O74A 3QVGB 2FSHA 5A2QA 3V2IA 1SB8A 2I80A 2GT1A 3FPFA 3I92A 4L5IA 4BNFA 2QL5A 3N7UA 1DELA 2CFOA 3GO4A 3I72A 4QXQA 3DCNA 3DTTA 4IH1A 2C59A 2WI8A 2G7MC 3ZU5A 2P30A 5JYDA 4C88A 5FX2A 2O0LA 2VWQA 1ML3A 3MMSA 1VJTA 1MN6A 3MG9A 3AIOA 4JASB 4K28A 5BVHA 4O5OA 1JKJB 1GO2A 3E7DA 4XVQA 2HIGA 2WILA 3HKBB 1SIOA 3PEYA 1GSIA 1TD9A 3QPDA 2P9GA 4HK4A 4KR2A 2J9FA 2PLFA 1FFDA 1BDJA 3IMFA 2NU9A 3DOEA 4V02A 4Z5XA 2VUIB 4JFRA 4D25A 2PX6A 2RGWA 2JFBA 4BO3A 2BMWA 4AWXA 3LQ4A 4GMHA 4I1IA 3LA6A 3RTCA 4Q02A 4XYGA 3M3DA 3DQPA 2ZYGA 4ZQBA 4LXIA 4ZMRA 4R3NA 3QKSA 3KJGA 5BV0A 1EFAA 1DKRA 3OEHA 2EKZA 4MS4B 2JFQA 1SKBA 4L0MA 5FNVF 3VDNB 1GD1O 1NSYA 1HE4A 1Y5IA 2CUZA 1A5AB 1HQKA 2Z3WA 2H1WA 4P3XA 4PPGA 3E15A 4UM9D 3VOTA 4JIMA 4RULA 1A9YA 3OCUA 4FFMA 1EWQA 3LO5A 1J24A 3R44A 3DFZA 3N6VA 4LJ6A 3DZCA 3IJ5A 4NEGA 4RKQA 4G5FA 3UMFA 3UKDA 4K8OA 4MEBA 2FW6A 1E0SA 2QV7A 5FPQA 3SVLA 2FPOA 5KNDD 1R6VA 1CUUA 1K4MA 1L4GA 1SQFA 1FFAA 2CDNA 3LAWA 2IYPA 3HR4A 1Q7EA 4WCVA 4BNWA 5ES4B 4U7WA 5K8VA 2CNDA 2DKOA 2ZSFA 3NHRA 3QVTA 4RFLA 3R7SA 5HUHA 1GGKA 1NQAO 2X76A 3RO7A 3COZA 2D06A 1AURA 4IHJA 1LFDB 4YHBA 5LJLA 2Y0PA 1WG8A 1YR8A 3EMDA 1K5HA 2Q4TA 3PU6A 4GOKA 2QTLA 1OC4A 4HAVA 2WC1A 4ND8B 2ZE8A 4GS5A 4HAYA 1GJRA 1Q0SA 3S7ZA 2H2DA 3NOOA 4HNAB 1IRXA 3KTAA 3ASUA 2QYHA 3INYA 1R18A 5JVDB 4O4HB 4EG7A 1W25A 3VSCA 4B74A 2CYCA 1I3KA 5EJ8A 2WP8J 4I4CA 3KU4A 4Y2VA 2QD2A 2WT8A 2XWPA 4BOYA 4DLTA 2NU9B 3D54D 3L43A 3M0EA 1QGAA 1RQGA 3DBRB 1DXHA 3AERB 2IZ7A 3KJZA 3H1TA 2C94A 1K8XB 2W4IA 3G2QA 2DUUA 3LW7A 4NC9A 4RGBA 1P17A 1XQXA 4WFJA 5DXJA 1O0SA 3IC5A 3RSHA 5JJKA 5LIPA 4N7BA 5F1YA 4Z0PA 3PDIB 1NKSA 1REQA 3IOYA 5I7RA 1QYXA 3DR5A 2OECA 4AKTA 5C7YA 1XRLA 3DYVA 2N1MA 1EDZA 4NJMB 1XFDA 4I99A 4EUSA 1TQ2A 2EJBA 4EY5A 4ZOAA 1M5TA 2NV0A 2V4UA 1GTMA 3P32A 3QIVA 3HK2A 1TGVA 2X8JA 1A2QA 3OZWA 4NBTA 2W0SA 4IDGA 1RKUA 3OY7A 4XUGB 3ZEAA 3EUEA 2H1LA 1UM9A 1ZJ5A 1E3WB 2A0YA 4XWAA 4MUAA 5DM0A 3T3NA 2MYTA 3AYXB 3L8ZA 5BRJA 3LBFA 2CUTA 2PBRA 4PX3A 1F2DA 1UT8A 2JEOA 3AFHA 5KJ1A 1F3OA 1TIPA 5AO9A 5EIOA 3SS8A 5FNZA 1XLTC 4LF5B 2CT8A 1VG9B 1ZNXA 2QWXA 2HI0A 3QELB 4NS4A 1T0IA 3ZDXB 2V45A 5CT5A 4WOCA 4ZIRB 1AZTA 2ZR8A 3ZHBA 3K0EA 2GZDA 5ALXA 1X3SA 2CLIB 4E5SA 5A4FS 4CKCB 2V7EA 1KHTA 1IJEA 2QB5A 3TLKA 2YZGA 4GOND 1RAFA 3RBAA 3NYQA 1TEHA 1X77A 5IMBA 4ZYYA 3U19A 3SYNA 4YMLA 1PYGA 3L4EA 2W2NA 2W6ID 5GY7A 2UZ4A 3KUDA 3LLUA 1HNXB 2OQ2A 3K96A 4NXNB 1QWSA 4P4UA 5A5DA 4P4GA 3V2HA 3R2JA 3U17A 4PNHA 1BWQA 3QX8A 2Q6OA 3UC5A 4G9GA 2Z4SA 1IRIA 4L5BA 4V38A 5JECA 4BJHB 2Z2IA 3T7RA 5FHQA 2K7FA 2E7ZA 1LF0A 2G8LA 3SDBA 3L6OO 1G6HA 4L07A 2JVJA 2I2AA 5H8WA 3AUSA 2CK3A 1WPQA 2XD9A 4FUQA 1EFVA 1SPXA 2HCTA 1SRQA 5LYJA 1OBCA 1NP6A 1WLSA 2DAPA 3GFVA 3O4IA 3OTWA 3ZW9A 4DDVA 1LDEA 3U3OA 1NVEA 4OJTA 1SOVA 2C0QA 4C6SA 5JQGB 5A4KA 4NVRA 1NE2A 1OYOA 2AFIE 2AOWA 3KEMA 4II3A 5AHKA 4RH3A 1V2HE 4ZOLB 4AJOA 1C80A 4H6VA 2YJTD 1YB1A 3ZQ4A 4FT2A 2ODTX 4BMXA 3AB8A 2P5TB 2KYRA 4NU0A 3EZGA 3AINA 1O0CA 4KXXA 1VOTA 3TSOA 5EWMB 1QO9A 4C7OB 2HQSA 1U2PA 2Q4BA 3BEOA 4JDPA 1O6GA 2IBTA 3KT3A 4O8CA 2IOFA 3A58B 1SUSA 3DJFA 4RPCA 3EXIA 4H4CA 2QX9A 1KQFA 1T0BA 3VUEA 5C53B 1YH3A 3BILA 1WR8A 3F5FA 5SYMA 2DUNA 4D0NA 4WCFC 3WJ7A 1AZWA 4FOPA 1GG9A 4V0MA 5LD2B 1P1FA 4I36A 4J49A 4BQFA 4KJXA 4V1CI 2WHRA 1SQ0A 3DV2A 2PL5A 4GQBA 3FJ1A 1QMPA 4PWZA 5AXBA 3U7RA 4YPOA 5ED0A 1NPDA 1GPYA 1D4ZA 1QV7A 2FCAA 3HGTA 3A6EA 2IV7A 3ZNNA 2E4AA 4GYYA 1N3YA 1WUYA 1Y4SA 3O8NA 4ODIA 3T3HA 1LPPA 5J1SB 3ZHYA 1FDRA 2RC6A 3KZOA 4HFNA 4E21A 1BE0A 2YJ6A 1DUVG 2JLUA 2EP5A 3KSUA 5MHTA 5DRYA 3E4CA 4IQ4A 5HJ7A 1GZUA 3THYB 1P80A 3R23A 1FTSA 1XN4A 1IBLB 1JDNA 5TS3A 4DM3A 3EXG2 1H85A 4Q9NA 1L1QA 6REQA 3T7TA 2GJAA 3GFFA 5AJUA 1PZXA 2X2PA 2GPBA 2VWPA 3PXAA 4F3NA 1E2DA 4N01A 5KNDA 1NG9A 5JNVA 4PZEA 2F1KA 2E4YA 2YJNA 3A3KA 5FOVA 4FIZA 4RK5A 3Q7TA 4BLSA 3N74A 1K7XB 1FFCA 3DPIA 2AC4A 4RADA 4R68A 1CWUA 1G3UA 1SCKA 4P5PA 3EC2A 1TVMA 1OCEA 3KYDB 4WZ6A 5JW6A 1OWOA 4TV9F 2R60A 4R1MA 4EI8A 4WACA 5KVCA 5TEVA 4IXNA 3L8EA 2VYCA 2UYQA 1IJFA 1QUEA 4O59O 1T9CA 1VMDA 3ACBA 2H1FA 3RVBA 3RRFA 5AM2A 1T6YA 1JPJA 1FTYA 4R1LA 4WCDA 2JJ1A 5CNKA 1FX0A 4G8CA 2JLAA 4XB6B 3PCTA 1DIBA 1XEXB 5BSRA 2QRGA 2VK4A 5C8YB 4WL0A 3MINA 4C6TB 1DQPA 1LLQA 1M1ZA 1GG5A 4GI3A 4F9FA 1C4XA 3LUKA 4QIHA 1ORTA 1G4AE 4H9GA 2O3UA 4KYVA 7REQA 2G1KA 2REOA 3ODPA 4WECA 3HA3A 2BCEA 5F9HA 2WJGA 2II6A 3GJ0A 3RHSA 4JYAB 4TKZA 1RJFA 4RGVA 3JQFA 4QO8A 5G02A 1KK0A 3CNBA 2J5XA 4HB2A 2HRDA 5AKLA 3TL6A 2LDBA 2OFXA 4GKAA 5IBCA 1ICIA 1MR3F 3NFYA 2D5AA 1JHPA 2VQ6A 3M6VA 1E3LA 4E33A 5F5LA 5CXSA 3R6DA 5KVAA 3RAFC 4MA4A 1IXKA 3ZEIA 3Q11A 5JO0A 2X0KA 4MCHA 4J0GA 1Y6JA 2ZBFA 3I2FA 3C5HA 1VJCA 3EIUA 3PNOA 2PA0A 4GI1A 2IFTA 2WAAA 4X6UA 4A7PA 5C32A 4GPEA 1Z68A 3DOHA 1J9GA 1W59A 2XGSA 3QBJA 5JQGF 4GPZA 2VXCA 1MV8A 5J47A 2LPMA 3V8EA 3HBNA 4RTSA 4AFNA 1VG1A 4RPLA 1ECBA 5IKMA 5B5SA 2R44A 4AICA 4RJTA 5A71A 4HAIA 4S1TA 1YDGA 3ZJVA 3AERA 1JIKA 1X7ZB 2OD2A 3OIWA 4XGNA 4QJBA 1ZWKA 5D7NA 2VDMB 2DC1A 3HRKA 1WXFA 3JQDA 4YAOA 3RSQA 3KAPA 2R8XA 4C0QC 5KNBD 2JKYA 4P31A 1JR3A 3NMUF 4DL9A 4I5FA 1DBVO 3DXFA 3AFNA 2PO7A 2W4QA 3PYMA 1OR8A 1S1CA 3C6XA 2LP4Y 4QULA 3DEJA 2TMDA 3LGSA 4RHCA 3NHUA 4GGMX 1Q6YA 2WJHA 4RVUA 1L4BA 5JVDA 1ATIA 1G3QA 1WKBA 2Z8XA 4BN4A 4EYKA 3GBVA 4C4YA 1BYIA 4IOKA 5E4TA 2I33A 3A25A 4X1IB 1UP7A 3HV2A 5E9JA 4R0NA 1MZPA 2LCFA 3E70C 1CW2B 1J6UA 1ZUIA 3I28A 3CVWA 1N9GA 3HJAA 5EESA 1ZVVA 2NUTA 1P6XA 2CF5A 4AMYA 3I6IA 3SBOA 1EX7A 1HC7A 3ZDEA 4CG1A 2E87A 3JAWB 4PO3X 4F96A 1U1IA 2H8GA 2JBAB 3G8AA 4IRMA 2NTYC 3TJZA 3F4KA 1GGMA 1HLGA 1P5JA 3H11B 5EIHA 1MRSA 4IXDA 5AK0A 4A82A 2AFRA 5CEJA 1AIPA 3PLNA 4LY6A 2NU7A 4TL8A 1QBGA 2XI4A 1R4MB 2GJ9A 1DNPA 5AXAA 4U2KA 3ZE9A 4F91B 1T3GA 3OOWA 3PFKA 2XB8A 4DHWA 1IHXA 3GLFB 1X92A 4FKZA 5A4IS 1KNQA 4CM7A 3ZWMA 3LHIA 1BDMA 2CXRA 2W2PA 1P18A 2G5TA 1RXCA 1HYEA 1MJ5A 3HJCA 2QTFA 3K9GA 3PKZA 4R9RA 3UHOA 2Q6TA 4F56A 5IK2A 5F5NA 4H35A 1KSFX 1YQDA 2D1TA 5BW5A 2UUAB 2GJSA 1Y6RA 2HA0A 1NUSA 3R3UA 2OCIA 4XGIA 3RC1A 3OQVA 3AF4A 5AVYA 3TNFA 4PBTA 3SSOA 1T3ZA 1ORVA 3DFIA 1YCGA 2QPAA 4LGCA 1PX2A 4RQBA 5DNWA 1JR3E 3DMPA 3AR9A 3T9EA 3UQYS 1F6DA 4QBHA 1DCTA 1FC0A 4ZOLA 8OHMA 2OXTA 5D2CA 4I3HA 2DH6A 3IMGA 1ISGA 1RVV1 3O83A 2EV9A 4W5WA 2JGEA 4YJ2B 4DVJA 4S2UA 3EVNA 1SCIA 3TMYA 3W6PA 1NBMA 1BMQA 1P5HA 2PS9A 1W94A 2XTAA 1Q1NA 2CJXA 2ZJZA 3P2IA 2FF7A 3KYIB 4H31A 1LLCA 1J8YF 2DHDA 4DPLA 4RD0A 4NCKA 4B3SB 2MHCA 2NG1A 1KEEA 1FS4A 3NBXX 4L0QA 3L6EA 4WY2A 1WIWA 3P7MA 1TAGA 5HF8A 3TTUA 3EXHB 1WPXA 3DFFA 2H1CA 4QDKA 5JPCA 2IHBA 3FROA 1WM1A 4N3BA 4MAFA 4FW9A 4UMDA 3S27A 2RH5A 1DHTA 1R5JA 4FMCB 3GP5A 1GCUA 4RD1A 4JUDX 4BB6A 3A9CA 4NWIA 5CP8A 4MQFB 2FUG6 2GKGA 2R6AA 1CQIA 2VSOA 2ZRDA 4JS0A 4U39A 5IZCC 3GNLA 4WV3A 5FI1B 3V2UA 5EZYF 2Y0EA 2ENUA 2ZWMA 1O5IA 3TRIA 1G41A 3E4DA 3IELA 5F1OA 3R9IA 1DWOA 1EVLA 1TQ8A 3V1UA 4ENVA 4YMUA 3VZSA 4CIYA 1XALA 1UXGA 1X0XA 2X14A 2IE0A 2K4MA 4CN8A 2G1PA 2R1VA 3SXJA 1N5RA 1MQSA 9ATCA 3E23A 4F4DA 2DXIA 4P7JA 1YBVA 5B64A 3TAXA 4V3CA 2WE7A 3CSUA 3OMWA 1ETUA 2ODAA 3PFCA 4WTOA 5TR9A 4R8RA 4CV1A 2CYBA 1KYIA 1A7UA 2AD1A 2RGDA 5DNAA 1MC1A 1UJ6A 3UFXB 3UGKA 4OHZA 4ZO7A 4BGIA 3GY0A 3SR4A 2EGUA 1EP3B 4QNMA 2EZ4A 5JEEA 3CRQA 3PNBA 1HZZA 3SI7A 4A0QA 2P9JA 3HGQA 4FDTA 4C4AA 1QRSA 4X3CA 4I66A 1H3NA 4JY7A 1NDHA 1M72A 1RRGA 2P27A 2Q7DA 3TW0A 2YYYA 1K7FB 4P83A 2RHHA 4DBVO 3IILA 3PNKA 3RSCA 3CR8A 2HTFA 3EGWA 2QGFA 2ZIAA 1PSDA 2A58A 4X1KB 2Y3IA 2B94A 4EPRA 1X87A 2F8SA 3M89A 1ADBA 1PLKA 1B73A 2PK3A 2BF4A 2PSHA 4DTCA 2J0QA 1PFKA 4E0BA 1II9A 1JR6A 2ZI9A 3HN6A 2C2ZA 3QP9A 3TIXB 3ZHXA 4FMDB 1XPUA 1J0CA 1H66A 1KMHB 2R7KA 1NN5A 3GVPA 2R6ZA 4O4LA 2ATEA 3O5AA 5AI4A 3VV3A 3HVUA 3RABA 4CM4A 4ZDJA 4KE9A 1PD0A 2AOTB 3M4NA 4M1EA 4MZXA 1CJVC 4QPPA 5FTJA 3WYEA 3IEKA 2PMCA 1MFPA 4KAJA 3IOBA 4CEIA 4ZO8A 2R68A 3C3XA 3GFPA 1MGPA 3KXLA 3OICA 2HHLA 2VS1A 1A8QA 4E7PA 1JN0A 2R8RA 2GFQA 3ETGA 3ABSB 3GLFA 5C1BA 2KHZA 4V39A 1YQTA 2V7WA 2W2KB 3PXUA 4FP9A 4PX9A 5K7SA 4AECA 2OB2A 2BFEB 3KOOA 3GU3A 3SHQA 2BGJA 1H4VB 1CT9A 1L1RA 3CZ4A 4IZOA 2Q9BA 1EE2A 3QK7A 4I55B 4GWLA 5GONB 5IASA 5C4MA 1JXAA 1QNFA 2JS7A 1R9JA 1KMNA 3DLIA 3MPUA 4YO8A 1GZ3A 5AK6A 3RW9A 2O8CB 4LPKA 1U9IA 4CTNA 1ORDA 5AJXA 2D2FA 3HPRA 4Y1RA 2WG1A 3KB1A 1FVHA 2J3LA 3P2YA 2D4HA 1OB2A 3KS9A 3JWPA 1FYWA 3R5JA 3M1AA 4XARA 4PC2A 5AM1A 1DZ3A 3H2IA 5A0FA 3SXPA 4S04A 1QIJA 3R1IA 5BQXA 5HPYB 1L6IA 1NLUA 1VGVA 3IBTA 4BBZA 5G4LA 3I58A 2PM8A 4I8XA 1KMCA 1KI1A 1MABB 3MUOA 2XNSA 5JY6A 5JJCA 2QSUA 4J0QA 5AVVA 1AUVA 1AUOA 1T1JA 2W6ZA 4LV8B 2K87A 1W30A 4UREA 3TMAA 3VNQA 1K0UA 2PMDA 2WKSA 1IY0A 4QBKA 4DMFA 3R7BA 1AZLA 3I9V1 3MTEA 4HEQA 4W6ZA 1P1IA 4HEA6 4Y2YA 3A10A 3BIWA 3ASVA 1Q1AA 1IZ0A 5E4YA 4B3IA 2GTIA 4LSMA 2GOYA 4B8ZA 3KX2A 1RRMA 2B5OA 4CDNA 1GNLA 3AETB 1GDHA 1Y9JA 3QVVA 5L4LA 5LQSA 5A0TA 2VL7A 3IVCA 1I9CA 1JSXA 4RSRA 1RTTA 5AXDA 4NCNA 4EGJA 5G41A 2X42A 3W7AA 2XRYA 4QQKA 1BE8A 2Q5IA 3A32A 1FQOA 3ZJ4A 4QUBA 3KV1A 2OORA 4RJJA 1RYNA 1OI4A 5KI6A 2XSZD 1TQHA 3RWOA 3G89A 1TM2A 3VDMA 4E22A 1PHRA 2AOUA 2CE2X 1AU9A 1WV0A 2VH2A 2WM9B 2VWHA 3EXG1 4CQMD 4LPSA 1HFWA 3HDHA 1ZVKA 4YDRA 2HLDA 3NAZA 4FK8A 2AW5A 4KXQA 4Q6BA 5FUYA 2EJWA 4MWDA 4UJ5A 1RRFA 2FDCA 1NI3A 4JT9A 1XPRA 1H93A 2YFHA 3D81A 1HSOA 1GGJA 1L7EA 4ZVTA 1UBFA 3BD9A 4L8WB 4P9NA 2FSUA 3HCAA 3FDIA 1OROA 2YXEA 4CR7A 4C78A 4G07A 2GNOA 2O5CA 1QIIA 2FMIA 2VSXA 2YIJA 3F7TA 5DBFA 1L4EA 4JBLA 3RFFA 2YX1A 1E20A 2HBYA 2P9YA 4HTFB 4JUBA 1PZMA 1IFXA 1VSTA 1BMTA 4DF3A 4QEKA 1GUDA 1Q92A 5K01A 2VJBA 3MOSA 1ONNA 2GAAA 3HNPA 5BNTA 2CVHA 4KDRA 3WYFA 2FCRA 1DTSA 1ZZGA 3AESA 3HL4A 3K05A 3KLMX 1YB5A 2QD5A 2FRVA 3OFJA 1XKTA 2WU1A 4QYWA 4P5DA 3RUEA 3V6LA 3LBIA 3WNZA 5FXMA 2G4CA 4HXEB 4PIPA 3COYA 2AK3A 3HJNA 1TF7A 3VBCA 5AUNB 2YV5A 3G9QA 5F76A 3I05A 3B9PA 2GPJA 4LGYA 4ZRDA 4OI1A 4ER6A 1JS1X 2ZJ1A 3PPWA 5HMLA 4EGQA 3H6KA 1JU9A 4RE6A 4IQGA 4QKQA 1W0KD 2ZTVA 1LNQA 4G0PA 1OX4A 4RPGA 1QG2A 1TEZA 1HNZB 2ZT7A 4QGSA 3GFGA 4NK4A 3K9WA 3KAKA 4BEWA 1E69A 4F6RA 4D42A 3H4VA 1DKLA 3SZGA 3E03A 5DVZA 4F4IA 1IK4A 3L4JA 3LTEA 5AM4A 1ZMRA 1WS6A 2LWIA 1NULA 4FLMA 1VKRA 1XUOA 3C3WA 7MDHA 1XJCA 1YONA 4G0OA 3WGQA 1AKWA 4GLJA 4R9SA 2EQBA 5EMJA 4FGWA 1HFKA 2DP4E 3R0IA 3K35A 4K0RA 5J2TF 2MT9A 5FWNA 1E77A 1WCV1 3UGJA 1NMYA 1TDJA 1S2DA 1ZMBA 4UDNA 1MG0A 3ET4A 4HGQA 3GFSA 3SJCA 4P0QB 1TVCA 1SBZA 3EZ7A 1EQ2A 4PYRA 1P19A 5B6PA 2YCBA 3FOBA 5H82A 1C1DA 1EX9A 3AJDA 4HEHA 3VDQA 1XJ5A 5B12A 2PSSA 3WRXA 3OFNA 5FTKA 3PCRB 1NOIA 1SMKA 3VTZA 4FMCF 1T5BA 4LJKA 4OHUA 4GNRA 1AK2A 2GXQA 3T9AA 1E9VA 3NT2A 4DPMA 3INGA 2G71A 2UZ0A 3ZUGA 2P62A 3VMMA 2VUTA 5L7TA 2O0HA 5TB5A 1U3CA 1AKVA 2X77A 5FI0B 2R6DA 4OBEA 2QN8A 1XTPA 1FSPA 3EPRA 1L5KA 1EBBA 4RHTA 3UXEA 1MDFA 3A05A 3K0CA 5CNJA 2XJ4A 3EXHC 2HJWA 3AY7A 1BOOA 4NZ9A 4B76A 4E7OA 2I34A 4KGVA 4KDFA 1N1GA 2I2WA 3GRUA 4G5RA 4XIJA 1KIMA 2VT2A 1XU4A 4UU1A 3UJNA 1E0DA 4MMZB 2O1WA 3OLQA 5AH0A 4QTZA 2NVUB 3OPNA 1HFJA 3QWHA 1CY7A 4PSCA 4AAYA 5DI3B 2R4TA 3FWZA 2O0KA 4MJLA 5SZJA 4DR4B 4KN9S 3WAGA 4LG1A 2P7IA 1KI8A 1NNLA 2ES4A 3PWZA 4YJHB 2P2YA 1I24A 4GX2A 4ALIA 5FTLA 3ZN2A 3S2YA 3AR8A 4JEMA 5GVRA 1UCFA 4I3GA 4XDHA 1AQ6A 1QRUA 2CFTA 3VR4A 1U5BB 5BMVF 2QMYA 1LSSA 2D2XA 4GBGA 1BEEA 4EG5A 5ALOA 1F38A 2AN4A 4UU0A 4P82A 5K6AC 3CTPA 5CA0F 5HZKA 1IMOA 5FAXA 2BPOA 3PLAE 4IKPA 2C9CA 4OHCA 1CRPA 3NVAA 4G5XA 3G2JA 2W6JD 1C9MA 4N4AA 1EFVB 1OXTA 2C3OA 3AW9A 4MJ7A 5HUJA 1KR2A 4KNVA 6ADHA 3FKSA 1NXWA 2QRLA 2DY0A 2B2CA 2E6KA 3NHBA 3OKAA 4FD2A 1RWOA 1FEZA 1VSBA 2ZR0A 4LNAA 2GNAA 4C4TA 1GPJA 4UHKA 3SYMA 3OSUA 3BHNA 4D8YA 1EFDN 3AK4A 2C2OA 2HCJB 3UQZA 3ZE2B 2C9MA 4M49A 2O1EA 4BVFA 4DJDC 2IW3A 2JGIA 3HZRA 1J1IA 4KLNA 1CR0A 3LBHA 2C2HA 4PGFA 2JHAA 2C1EA 4RF5A 2Z2JA 5PNTA 4AUEA 4DNFA 1SJ9A 1P2FA 2A8YA 4LJ8A 1Y7LA 3G59A 4QEZA 4UZSA 1SU6A 2XTMA 3S2IA 2JIMA 2Z30A 3NO4A 2O2JA 1Z6GA 4M9UA 4QNRA 1HLFA 2MSKA 2DHRA 1V41E 3B53X 1AG9A 3B1KA 3DD5A 4HDAA 4LK2A 3ER8A 2VDLB 3BG5A 4KLAA 1NIPA 3BSFA 4EA7A 3OC0A 4HLUA 3K8QA 2PT9A 2HXSA 5CT9A 3L77A 4L57A 3TVTA 1TM5E 3TXAA 1C7QA 1SZCA 1XD2A 1XHLA 1ZWLA 4OGFA 3LT1A 4QPCA 5GJWC 4F1KA 2XEXA 3UT0A 1NF8A 3TQFA 5EVCA 4KYUA 2A30A 3DVAB 4OQMA 2PD6A 4KGXA 4X63A 4ZI7F 3V8NA 3K94A 1U0SY 1BD4A 1PZFA 4JL6A 5TLSA 3IRUA 1W36B 1MRNA 1RJ9B 1YDFA 4W1RA 1KO7A 1M34A 3QEBZ 2A5GA 2XJ9A 3O4JA 3PEVA 3LZ6A 3KHSA 4YV2A 4L9SA 1QH8A 2XUAA 1GZ7A 3G0OA 4JQCA 3QWBA 4GI5A 2JLBA 2V4ZA 5LSAA 3EMVA 1DLJA 4PGGA 2I7VA 4QSMA 5AVRA 1JVNA 1JDPA 2O23A 4G8JA 1I4DD 2BCGY 1HWYA 3B20A 4DDKA 3EWAA 4K86A 4ZVUA 4EHIA 5A5VA 5BUCA 5IXJA 2F8TA 1IPFA 3VR2A 1C7EA 4DNOA 1SVLA 3F90A 1CJSA 1X7GA 3OP1A 4DY6A 5A9SA 1JHXA 1WLYA 5AW2A 3KQUA 1WZUA 1SXJC 1TFUA 1ZCJA 3ISJA 4A8HA 5ALLA 3PXDA 4ZQGA 1WL8A 4HAWA 4A6XA 2H0AA 4RVSA 4YDSA 4B2YA 2B3DA 3PT9A 1DBIA 3HSYA 4LZAA 1XAJA 5AHRA 5LL6P 5EPUA 4U2GA 4AQDA 4LYAA 2W48A 2X13A 1C14A 3HU5A 4AT1A 1JFFB 3PQCA 1LI4A 3AHJA 4FZVA 4M9QA 4XIYA 4R6XA 3HUFA 1BXZA 1RJGA 4LN1A 2XKKA 2G82A 5CTJA 1E61A 1W85B 3MF4A 4HRYA 4S1VA 4UC0A 4DV0B 1ODIA 1AV6A 1BXKA 5IH7A 1PUJA 1MMFB 4K05A 3D5QA 5AOBA 4ACAA 3LFHA 5HR5A 1EA7A 3QENA 2FEOA 4JR1A 1BCSA 4RABA 3ZDCA 4G0YA 3ZV4A 2PMFA 1IN7A 2J6BA 1UR5A 1C9YA 3FGOA 3LU1A 1E1NA 1J39A 2G67A 2W2LD 3DVAA 4NBUA 4N3NA 4FSXA 1KJZA 3W90A 1THTA 4DDMA 2QMEA 3OFSA 3HKDA 4BQSA 4IF4A 3AWIA 3M81A 4FINA 2JI9A 2GI4A 5EE0A 2C3UA 4CKWA 3DAPA 3DFUA 4MRRA 1VBNA 3O73A 1VI5A 2FFAA 4P32A 3L9XA 4FEEA 3TIGA 5KYWB 3RQIA 3R77A 3ZOKA 2UXBB 1DWPA 1EH5A 4JEHA 2ADMA 5IVDA 2XQKA 3EG9B 3GPIA 2QLMA 3JY6A 1NZFA 4RFSA 3T38A 4OSPA 4Q48A 2R7LA 1P7ZA 4HTAA 4ES6A 1O08A 3G5UA 1PJ8A 3PCXA 5IUNC 3ENKA 1JEDA 3QJ5A 1JNXX 4DT1A 1PTJC 1ZD8A 2UVQA 4QGGA 3RS8A 2X15A 3C14C 1ZJYA 1JAYA 4YXWA 1P8AA 4BUCA 2CV0A 2V98A 4V1CB 4REOA 1WX1A 1MOPA 1JJIA 4CCYA 3B13B 3KR2A 1C50A 2ZBPA 4JJ7A 1TTPB 3C4JA 3AR7A 1GL7A 3F78A 4G5SA 4HLCA 4P7FA 1SCUA 4Q6WA 5A9RA 1YJ5A 2NSYA 1JAXA 3TAHA 1H2BA 3WLHA 2X8WA 5FDFA 2X9VA 3CZRA 4V0KA 3S1AA 1U0FA 4GL2A 2VTEA 4Q7MB 3U3KA 2D0PB 4NV1A 2B25A 1M6VB 2B8NA 2PQ0A 2JH9A 1GGHA 2VDJA 3AVPA 1NSFA 4KBGA 1SBNE 1X8JA 3IDSA 3UWKA 1CS4C 1X2EA 2QVXX 4TWBA 2VUHB 4FYHA 1XU7A 3GI1A 1DQYA 4W1PA 2AX3A 4BKQA 1ACJA 3GH1A 2CXPA 5DI9A 1P1JA 4MLCA 2YW2A 4BTLA 1H3EA 1K8YB 2X6RA 4ONEA 2FN7A 1KA9H 1H1LA 2ODQA 1S8OA 2Q8PA 1VHDA 1O0BA 4YQFA 1SUIA 1SXGA 2GNPA 2IDJA 2WAXA 5H5JA 3RROA 4B2LA 3BZWA 2ODBA 3EWNA 4MPJA 4DLXA 1K3FA 1S2OA 3AM5A 3HHPA 2NVUA 1HBJA 2J5BA 1RP1A 2QGNA 3CH6A 3VR4H 4LA4A 3EN0A 2IZ6A 1YZGA 3B7PA 2DJ5A 5JJ5A 1MQ9A 1W0JA 1JGTA 1QH8B 1SC9A 4B32A 4HWTA 1JG6A 1O95D 3MWGA 4ML3A 4QO7A 1U11A 3ZD9A 2B0CA 2ZYUX 5DM2A 2GJ8A 3AFOA 3V33A 1NMZA 1EVJA 2PO5A 1JB1A 1YBHA 4BQOA 1Y4DE 4RS3A 1P5RA 2VRCA 2VP3A 1IY8A 1V5WA 4PZDA 2XMPA 4L4YA 3GEPA 4MKGA 2YV4A 3U2QA 1XZCA 1RZUA 2Z3ZA 4C9BA 2C57A 1YR3A 4IJQA 4IJ6A 2JZCA 4GOJA 5JZOA 2XCRB 1Y63A 4BJ6A 4U7HA 2PE5A 2VT3A 2G5CA 1OLOA 1WB4A 1XDDA 2Z5FA 4UXIA 5C7IO 4R2LA 5C7OO 4JVNA 4XD2A 3ZXXA 2J41A 3UMVA 4M8IA 3F6RA 4CODB 2VG8A 3A0UA 5MN6A 4HNTA 3ICVA 4KX5A 1TEXA 4NJOA 4S1PA 3EE6A 1V47A 1GXSA 5A02A 1CUBA 2VSYA 4RXTA 4DDTA 5EJ4A 2YV3A 3KUXA 3V9AA 2ZJ3A 4EUHA 5BSMA 5IXYA 3CW9A 2XCUA 3P0JA 4UPDA 3QFCA 3W4JA 1N5DA 4BLRA 3TSWA 2JIRA 3C4VA 1PFVA 2CBGA 5BSUA 2E1RA 2W2OA 3WGJA 4HN9A 3ISTA 4JFAA 1Z2EA 4WRRA 3HMQA 3SSNA 4FONA 2CY0A 4BV3A 4CTJA 4AJNA 3VO1A 5JXHA 1J0AA 3BXFA 5I9IA 3AG5A 1H05A 5LMUB 3K0HA 2ZUBA 1XNHA 3N8DA 4YFYA 5I01A 3D6TB 1U2EA 2G6BA 1EP2B 1WZNA 2C2MA 4YUXA 5HQ3A 2YHAA 4EJ0A 5DNYB 3V7UA 4RLQA 3VSEA 4D02A 2GF2A 5EXXA 2Z5LA 1LQTA 2PXHA 2EW2A 1FY2A 1OFVA 2FW7A 3LQRA 5COBA