1B06A

Superoxide dismutase from sulfolobus acidocaldarius
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
208
structure length
208
Chain Sequence
VIQLKRYEFPQLPYKVDALEPYISKDIIDVHYNGHHKGYVNGANSLLDRLEKLIKGDLPQGQYDLQGILRGLTFNINGHKLHAIYWNNMAPAGKGGGKPGGALADLIDKQYGSFDRFKQVFSESANSLPGSGWTVLYYDNESGNLQIMTVENHFMNHIAELPVILIVDEFEHAYYLQYKNKRGDYLNAWWNVVNWDDAEKRLQKYLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SUPEROXIDE DISMUTASE)
publication title Refined crystal structure of a superoxide dismutase from the hyperthermophilic archaeon Sulfolobus acidocaldarius at 2.2 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 74
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1b06A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1b06A02
3OT7A 2P4KA 1AVMA 2RCVA 1EN5A 1BT8A 1MA1A 1MNGA 3DC6A 1EN4A 1BS3A 1EM1A 3KKYA 2ADQB 1XDCA 2QKAA 1B06A 2GDSA 1IDSA 3BFRA 1GN4A 4BR6A 1GN6A 3EVKA 1JR9A 1WB8A 1D5NA 1BSMA 3DC5A 4YIOA 4GUNA 1AR4A 1GN3A 4JYYA 1JA8A 2AW9A 2CE4A 1I08A 1P7GA 3IC9A 3TJTA 1Y67A 1ZUQA 3MDSA 1MMMA 1IX9A 3LSUA 1I0HA 1LUWA 3AK1A 1PM9A 1ZLZA 4F6EA 1LUVA 3K9SA 3CEIA 2ADPA 1N0NA 5AG2A 3AK2A 3RN4A 4C7UA 1AR5A 1GN2A 1XILA 3QVNA 4FFKA 1QNMA 5A9GA 1XUQA 1PL4A 1ZSPA 4JZGA 4JZ2A 1KKCA 1VARA 1XREA 4E4EA 1VEWA 1ZTEA 1EN6A 1IXBA 3C3SA 1MSDA 3C3TA 2QKCA 2CDYA 1WB7A 1AP5A 1AP6A 3AK3A 1N0JA 4X9QA 1SZXA 4YIPA
chains in the Genus database with same CATH superfamily
4B3TB 1VF7A 2KG7A 2X0LA 3OR7C 4BAYA 2UUBB 1BT8A 4GZRB 1BE3H 2B1IA 1VQKV 4RAIA 3WG7B 1EM1A 4J42A 2F43G 1YJWV 2Q7GA 4GYCB 4JAVA 5D5PA 3H1LH 3JATB 1F7YA 3ZRVA 1SQQH 2UXDB 3CRAA 3G6BA 1YITV 1HNZB 4I7ZB 1I5XA 4EB6B 5KHIA 1PNKA 3F7YC 3SYQA 3JD4A 2P90A 2YIAA 4YXWG 2JS3A 4DYLA 2UXCB 2UXXA 2LFSA 4B3MO 1JCHA 4JI3O 1VQMV 1KUQA 4CS4A 5HFMA 3MHSC 5HFLA 1JNBA 4FK5C 2Y69C 1SQBH 3W7WA 4XBFA 2NR5A 3LDDA 1F4MA 5B1AC 2CGOA 1AJQA 4J7ZA 1KYOF 4Q6GA 1J5EO 3BA9A 5KLVH 3RN4A 2VQFO 5KX5B 1N33O 5IY5C 3ETQA 4U3JA 2W6IG 5EYPB 1E1RG 2HG5C 2ZQMA 5H9CA 2BTQB 4DR1O 4PDLA 1B6QA 1PNLA 1RM1B 3CRQA 1ZSPA 1K97A 2WLKA 4LF9B 4JF3A 2DYRC 2OWOA 1ZX3A 1IURA 1WJZA 1L8DA 1FJGO 4H37A 4UVBA 1Y6XA 2V1DA 1NTZH 4DW0A 3H9VA 4WFBV 4WFHA 2ZE5A 2HR3A 4FVMA 3JCUZ 3T2MA 2XOKG 3IFXA 3K04A 2ZE6A 4OPHA 2XTAA 4JI5O 2EZPA 4MTXA 1I94O 1BMFG 5LXTB 2ILMA 1B04A 3I55V 5LHIA 4X64O 1DF5A 3PJSK 1MSWD 4NXMB 5L3CA 1Q86W 2ADQB 3RVYA 4J7JA 2YXYA 2JS5A 3S3WA 2YI8A 3AG2C 2WLNA 3Q4HA 4PELA 1MABG 2XAHA 1R73A 3OEEG 5BMVB 2QEXV 1QR8A 1SF9A 1VQ4V 5H5NA 3K03A 2EBOA 4DR4O 5LGNA 1QVFU 2A79B 1ZUQA 3K58A 4X20B 2LGWA 3ZEDA 2HFEC 1NI8A 4ZOLA 5CBGA 4HZ3A 1JPXA 3OTFA 3ZRSA 2DWDC 2V4DA 3K9SA 1VQ9V 5DEDA 4GT1A 1M57C 1AJNA 4B3RB 3ASNB 1S5JA 2EZOA 3VOUA 4YJ3B 4X62B 4L87A 5IWAB 3FKSG 1H5WA 4DV6O 2YICA 4JI2O 4WBNA 1SQFA 3FB8C 3STZC 1XI1A 5FPRA 4IIJB 4NKGB 4U7NA 2WLIA 3T4DA 2OTJV 2EIMB 3N2GB 2G38A 5B1NA 1TAEA 3ZCCA 1N4CA 4LFAB 3AG3C 3ZN1A 4LH6A 3CCVV 1DF4A 3L70H 4BIUA 4X9QA 5CA3A 3OT7A 5C8YA 3IGAC 4MVQA 5FPOA 3M7MX 5GW7A 2KG7B 2ZT9B 1R3IC 2YXLA 1QLNA 2R72A 1ZWIC 2YS8A 4MVOA 2WSSG 2GV9A 1Z2GA 2DQ3A 3RW0A 3K0DA 1SQGA 5LA6A 3CC2V 2KSDA 4OPAA 3OD4A 4F4LA 1Q82W 3OM3B 3ZRXA 3VQYA 4QPJA 4DV7O 3ZMZA 1BSMA 3SDLA 4X1IA 1IBLO 3JAMN 5H2FZ 5B3SB 2E74B 2ZDIA 4DV0O 1VQ5V 1YZBA 3K5NA 3CWBH 4B3MB 3TETA 4JI3B 4UCVA 3FB5C 5KA5A 2OYQA 1QQCA 2QSAA 1N0NA 3ZHRA 2ZIMA 2XT9A 1FYJA 3CXCU 3CSXA 2Y4UA 1AI5A 3OMNB 4U3JB 4FLWA 3CCJV 1J5EB 5TISZ 2VQFB 1N33B 1SZTA 4YY3O 5FNVA 1US6A 2IJJA 5A9GA 4DR1B 2OCCC 2AZ2A 5LP6C 3SPCA 3X2QB 2N05A 5D5QA 3A0HZ 2FYUH 1BGYH 4R8CA 1JJOA 1Y66A 2UXBO 4UB6Z 2K1EA 2XAQA 2IJKA 3CJHA 4GX2A 1FJGB 5CA1A 4I4TA 2R9IA 3ABLB 3TK1A 1Q6IA 1R3JC 2N74A 4DR6O 4IHJA 5J2UA 1K7DA 1XHXA 2E5LO 1R6NA 3UKMA 1M93A 4EFBA 4JI5B 4NR1A 1I94B 3MD0A 3CPWU 4X64B 1U96A 4B3SO 1FS0G 5B1BB 4AILC 2EIKB 4PI2A 5KHKA 1KC8W 3APOA 3B8MA 3RYHA 3BFRA 1ENVA 4MVRA 5J9PC 2QGNA 2P5OA 1ZL8A 1Q81W 3K9AA 3Q4HB 1GH6A 3T1HO 1QU7A 4Z1VA 1OCRB 4I55A 4D6TH 2HEPA 4DV2O 3BABA 1I08A 5GONA 2FMLA 4O4HA 4UVCA 4HNAA 4DR4B 2QWNB 3A8TA 2HJDA 3ETEA 4ZOLB 2RN9A 1LUVA 3O9OA 4I9WA 4I50A 1WP7A 4JAAA 2F23A 3F5WC 5GTHZ 1DTOA 4PDRA 1G6UA 4CC5A 2AHYA 3SYOA 4WBNB 4DV6B 2L6LA 1S76D 1GKFA 2X6BA 1FXKA 3RYFA 2WLIB 3JD1A 5C93A 3G67A 2P22C 2Y0IA 4FLVA 1YCIA 4IYIA 5E1AC 3OTOO 2FB5A 4P9OA 3E2EA 5BR8O 4QE7A 4YIPA 3D8CA 1MZEA 1K34A 1A32A 3GB7C 1AVMA 3HPLC 3RYIA 5C8YB 1QHTA 1W59A 4JTDB 1QCEA 5LGTA 4XDLA 2F1MA 2JK5C 3W7XA 4PHZA 2R70A 5IYZA 1R6KA 2F93B 3KKYA 4HBNA 5LA6B 3NXSA 3F7VC 4MTOA 4TV9A 3UT5A 4P9PA 3CXHF 4NVPA 3U0ZA 4MVZA 1MG1A 3OGIB 4JI8O 3QF7A 4A5UB 1KKDA 3ASNC 1WB8A 2D2CB 3BVOA 2N04A 1BHAA 4JI4O 4JI1O 1M56B 1COWG 4TSFG 4X1IB 2A7WA 2JEUA 4N21A 4UV9A 3T1CA 3RVZA 1IBLB 4JAUA 4X89A 1CEZA 3CC7V 2EIMC 2YEVA 2JJ1G 1SRYA 1SS3A 4CBCA 3SJQC 4DV0B 2OT5A 3K0GA 2Y4TA 1XL6A 2XHBA 4NTWA 2UU9O 1ZLZA 4EFEA 2EILC 5LOVA 1NVPB 2QM7A 2QTSA 1TUBA 3FX7A 4E2LA 4NXNO 5FNVB 2A9HA 1S3JA 4NYKA 4ZIBA 1NZ6A 4AI8A 4WFFA 4YY3B 4UCRA 2QWOB 5FLXN 3C90A 3OAAG 2EJRA 2UXBB 3CJHB 4DO2A 2NN4A 1HW7A 5B3SC 5CA1B 2DOSA 4I4TB 3CCMV 4U3FH 4LWSA 4IHJB 5J2UB 1KECA 2YI9A 4DR6B 4O2BA 4O2AA 3EFFK 2E5LB 2GTAA 1WA8A 3CCQV 2IJIA 2OCHA 1XDCA 3E8FA 4GLXA 4B3SB 2QWRB 3N27A 4U7OA 4TWKA 3RYHB 3CRRA 1JR9A 3GWKC 1ZL8B 2HVKC 2BE3A 4X66O 4FIPC 1Y74A 2YIBA 4DR2O 4I55B 3T1HB 1PNMA 3O65A 4PJ0Z 3X2QC 4DV2B 5GONB 4XDJA 2CTRA 2UUAO 4F6RA 4O4HB 3TJTA 2Q69A 2AZ0A 3CB2A 4HNAB 1SETA 3BCCH 4FLYA 4OGQB 1QLEC 1HNWO 1KMIZ 2WA3A 3JD3A 4PV1B 3H1JH 3JALA 4LF4O 4DW1A 4BIZA 5IYDO 5EZYA 1JFFA 1IZ3A 2DMXA 3ABLC 1VQ6V 4I50B 3AG4B 1DK1A 3SYAA 1R3LC 5JJEB 1VQLV 2XUMA 3JD0A 5JCOA 5CA0A 2CTQA 3J80N 1N32O 2EIKC 2BOCC 1SQVH 2KQXA 3A0BZ 3BPZA 1VEWA 1KD1W 1N36O 1OV9A 1FXKB 3RYFB 1H2SB 2LGQA 2WAMA 3RBZA 2RDCA 3D3IA 4TV8A 5B5EZ 4UCOA 1HR0B 1AP5A 2ZD9A 3E22A 3AK3A 4JI0O 2ITDC 2RMKB 1AI4A 1SERA 2LFRA 2X6AA 3OTOB 3K5MA 4DV1O 1H38A 1IBMO 3RYIB 5BR8B 4LF7O 4DR7O 4FZ0A 3BA8A 4I5SA 2FL4A 1AROP 2ZIOA 2ZXWB 3T4ZA 3ZIAG 5IYZB 4FMTA 2BOBC 1WAZA 3CRCA 4H44B 4FJCC 1Z5VA 2O57A 3L71H 4GCZA 4TV9B 3UT5B 1GN4A 2V7QG 1V9PA 4DR5O 3B8NA 1BQ0A 1V54C 3RT3C 5KMGA 4UFZA 5A2QN 4JI8B 3W7SA 1T5EA 3DTUB 4GUNA 2P7TC 1XMOO 1KQSU 4JI4B 4JI1B 2KB1A 2Q6AA 1EFRG 3WFVA 2XAJA 1OCZB 1SQXH 3ABKB 1IX9A 2YEVB 3ZHQA 2EIJB 4KP4A 3NR7A 3ABMC 4NTYA 3AG1B 4ABMA 4RO2A 1NBMG 5KAFZ 2P67A 3E8BA 2UU9B 5AG2A 4D7TA 4FM1A 5LOVB 4JI6O 1V55B 4C7UA 4LF5O 1OCCB 1TUBB 5LMUO 1WPXA 4DUYO 3P3NA 2IU3A 2Z3YA 1Q43A 3IJ4A 4AHCA 1AI6A 4B7KA 4UXNA 3MHHC 4TQDA 1PKXA 4O4IA 4NXNB 1KKCA 3JCZA 4E4EA 4JPRA 3JAKA 1Q6UA 3CCSV 2E3CA 1VQ8V 1SC5B 4J7KA 2CTPA 1S0VA 3DXRA 3CE2A 3E86A 4KXRA 2Q67A 2DWEC 4IYHA 1M56C 1K92A 3FB6C 4QNHB 2XASA 3S3XA 2Q0AA 4MVUA 1EN5A 5BXZA 2R9RB 3DSQA 4R6ZA 3A2FA 4LWSB 5KUKA 2ZDIC 4H13B 5IE9A 4B08A 5J2TA 4LH7A 1NJIW 4O2BB 4O2AB 2WA4A 1WA8B 1IJGA 3HKDA 1LR1A 4AQYO 2GDSA 5DN6G 1G1XB 1VF5B 2HVJC 2ODMA 2ZKOA 1CXZB 2IH1C 1L0NH 1CPYA 1RP3B 2ZINA 4IT5A 4UCSA 1AR4A 2QM8A 2OTLV 1Y74B 4X66B 2E75B 2JGDA 1Q7YW 3GVMA 3SJCC 3UCSC 2Z0AA 4DR2B 1XMQO 3U10A 1Y67A 4F6RB 1W0JG 2P6JA 4J9ZB 1XOUA 2UUAB 1AR1B 2VQEO 4JGSA 1H2KA 4CS3A 1Q6HA 1TA8A 5L3GA 3D36C 5CB4A 2QA4V 3ZJZA 3JALB 4UCUA 4J10A 5EZYB 1JFFB 1YSCA 2GHYA 4LF4B 4K8ZA 4YHHO 1NH2B 3FYEB 3CCUV 3THOA 1WPBA 4WFGA 4CH6A 3JAWA 2WLHA 4CH5A 5KUMA 3OMAB 1PL4A 5CA0B 2NLJC 4JZ2A 1L1FA 5IDJA 3SJBC 1I7FA 1IXBA 4D7SA 1NVPD 3HKEA 1N32B 1S72V 1QBZA 1N36B 5EC1C 2QKCA 4TV8B 1NKDA 4PA3A 1AB3A 2JIZG 3E22B 2QWQB 5CBFA 1SZXA 3STLC 1F4NA 3LNNA 4JI0B 1XNRO 1VF6C 2RCVA 3WG7C 3HB3B 4KFMA 3B2EE 3RFRA 3B09A 5L3DA 4DV1B 1IBMB 4LF7B 4UB8Z 3LSQA 3SPHA 4LP8A 5IT9N 4DR7B 2ATKC 1ORQC 1BS3A 3APQA 2UXNA 1YIJV 3OR6C 1NS1A 1NTMH 2HHHO 4FZ1A 1F23A 1GN6A 1GM8A 4GKJO 3KCXA 2CK3G 3B77A 2WLJA 4DR5B 5KMGB 1IBKO 1HP8A 1QR9A 3U11A 1K73W 2WLMA 4JYYA 4CC6A 1JA8A 2CE4A 1J95A 2Q5ZA 5EIBC 1YTFD 4QPKA 3OUFA 1FD9A 1U97A 5F2VO 4FLTA 1HWYA 1KBHA 3LSUA 3ASOB 2WLLA 4TUYA 1UPGA 4RQEA 2ADPA 5KHHA 5E79Z 1M5IA 4DRXA 1PD3A 2Z5UA 1JX9A 1RM1C 1X59A 3E8HA 4WF9V 2ZNIA 4LF5B 1GN2A 5LMUB 2ZE8A 4DUYB 4DK1A 4NTXA 3SJAC 5JQGA 4O4IB 1TGOA 4UVAA 3JAKB 3B4SA 2WPDG 5LP6A 1S5HC 3DXRB 1Q3EA 4RWUA 1NR1A 3E89A 4JYAO 4FLZA 1BCCH 4UV8A 2Q9LA 2Q7HA 3T1YO 3PN1A 2K9PA 4JTAB 2NNUA 5EIBD 4JI2B 2GTSA 3BEHA 3FYIB 1RPRA 2GBOA 2IJHA 2BTOA 1LNQA 2QDOA 3EXAA 4OXSA 5K1PA 4I0XA 4ICGA 3AEIA 4ZHQA 4FLUA 3HKDB 1YVWA 4BR6A 5L3BA 2H94A 1E79G 4AQYB 1V55C 3QG5A 3CRMA 1FXHA 3K5OA 3AG2B 2L35A 1YF2A 2JGDB 3HKBA 2RNBA 1K8AW 2YXHA 2EINB 1IVSA 3OGCC 3ZMTA 3MDSA 4BW9A 1D2DA 1VP7A 1XEQA 2ZR2A 1ZAUA 1SA0A 1XMQB 1LUWA 3FD9A 2LW1A 1G4YB 2VQEB 3M8AA 4DV7B 3SGIA 5CB4B 1M90W 3W7TA 4X65O 3I5DA 1P49A 4JYCA 4YHHB 1M57B 3QVNA 2F4VO 3AG7A 3RYCA 3JAWB 3SPJA 1H2MA 5LYJA 3ICXA 4ZI7A 4TOIA 4B7EA 5LGUA 1VMGA 2W0XA 4K3AA 4R50A 2CAZC 2YC0A 5LL6Y 3OFNG 3HKEB 4CS2A 4CH3A 5DM6V 3WB1A 2CH7A 2PY5A 3QO5A 3ZMSA 4Z1MG 4X1YA 2EULA 2DN9A 3UM7A 4W4KA 5ITZA 4LF8O 2DQ0A 5KHGA 2X7RB 1Q8IA 5LHGA 2MK3A 1MA1A 1XNRB 1NR7A 4Q20A 4KL1A 1BQZA 4H33A 4NB5A 4CH4A 3QTCA 3G6EV 1BHBA 4KUMA 5CN0A 4OX9O 3H1KH 3H1HH 4QGPA 1WN7A 2QKAA 3R65A 1B06A 1URFA 3E8GA 3WB0A 1XBLA 2YDEA 4P30A 2HHHB 3D3QA 1G8MA 1S77D 3CD6V 4GKJB 1R1BA 1XNQO 4JASA 5IYBO 5BZBA 2PI4A 3JARA 4JV5O 4O4LA 1B3QA 1IBKB 1S5LZ 5JCOC 1YI2V 1XL4A 4LC1A 1PPJH 4LFCO 3KCYA 4I9QA 1FFTB 3OE7G 1QVGU 5IJ0A 2IM9A 4PD4F 4BWAA 1DGSA 4MT8A 2OIEA 1K4CC 2BSKA 1XQ8A 2WLLB 4P2ZA 4TUYB 2YIBD 4G2KA 3CCRV 4LNUA 2DE0X 1H2NA 2Y48A 1NU1H 4DRXB 4LF6O 1I5YA 1MZFA 3LDEA 2AHZA 1XILA 2EX3A 4QE9A 3CHXA 3VQVA 1M4UA 3OEHG 4DXWA 5JQGB 1FOUA 1YDXA 1FXVA 4WFEA 3BAAA 2OCCB 2B5UA 1Y76A 1GTOA 5LP6B 1VQOV 1NH2D 4BIOA 2IBZH 3ZS8C 3ZMVA 1NT2B 3W7UA 5JVDA 2Q8VA 2QWPB 3HR0A 2ITCC 3ZX6A 4JYAB 2ZM6O 5B1BC 3T1YB 2DJVA 5KAIZ 3K3WA 4DV5O 4EKWA 5IJ9A 3DC6A 3SPIA 4J80A 5LMNO 1H2LA 1M9NA 1SESA 4YJ2A 3ASOC 1MOFA 4BW5A 4I0XB 3TXSA 2PF4E 3HKCA 4ZHQB 2P06A 2YSUB 5JH7A 4TT3G 1OCRC 2QR4A 4PDMA 4ZBMA 4R7CA 1FPOA 3G71V 2Q0OC 4GX1A 4J41A 2LQTA 3ABTA 2E76B 1P7GA 2HP8A 3HKBB 4L8JA 3ZBHA 3LDCA 1SA0B 1I0HA 2LP7A 4QJFB 3AK1A 4F6EA 3L75H 4JI7O 4QIWF 2A06H 1XHZA 3A0RA 4GKKO 3CX5F 4PA7A 1AR5A 4X65B 1KP3A 1AJPA 3FAVA 2ZR3A 1FFXA 3SPGA 3RYCB 4X1KA 4K8XA 5LYJB 2F4VB 1OHHG 3JSLA 4ZI7B 1P7BA 1ZTEA 1EN6A 1K4DC 3UO3A 5EBMC 3J7AU 3C3SA 1VQNV 3C3TA 4LBEC 5IYCO 1M1KW 2XNDG 2CH7B 5JJJB 2JJ2G 2IU0A 4X1YB 4DUZO 2PGGA 5ITZB 3K57A 5K1XA 2UUCO 3RWRD 1D5AA 4MTGA 4LF8B 2EINC 2CGNA 2YUAA 4TQFA 2HLDG 4DV4O 2DW4A 1EN4A 4DV3O 5EBWC 2GUZA 3I56V 1EZVH 4OX9B 5LHHA 2JRIA 2JVDA 3G4SV 2PZSA 1D5NA 1HNXO 3DC5A 1GRJA 3VQWA 4YIOA 2AXTZ 3OUSA 1GN3A 3JARB 4KHPO 4O4LB 2F66C 4PI0A 1P4RA 1XNQB 4IL6Z 2X6CA 5H6RA 3IC7A 4JV5B 4J9YB 1JOYA 2GSMB 3JSNA 3CMAV 1HDJA 1AILA 1Q90D 4DK0A 4LFCB 5IJ0B 2QTOA 3BY6A 1JVMA 2BSKB 2W6JG 2XAGA 3N2KA 4O4JA 1GM9A 4LNUB 4IGGA 2HKOA 2QKSA 4EEQA 1NQTA 1VQPV 2ZNJA 2YIDA 2MW2B 4LF6B 2EILB 2Q68A 5EK0A 3K08A 1JMKC 4MSWC 1P84F 4JZGA 2PI5A 1VARA 1RSOA 1H8EG 3SYCA 2DYSB 2EJ7A 2Q73A 1HNWB 1OCOB 3JASA 1Y76B 1F51A 3H01A 5JVDB 4HYOA 5JWPA 1YXBA 3L73H 3LSSA 4LFBO 2B9ZA 1FAFA 4MVSA 3EHBB 2ZM6B 3VBBA 3ZHVA 5IJ9B 2PYJA 1SKVA 3CMEV 4DV5B 2ARHA 3E35A 2A3QA 3P3PA 4YJ2B 1Q5OA 5LMNB 1UJWB 4MW3A 1N34O 2M6YA 5B1OA 2LW7A 3HKCB 1AI7A 1IDSA 5JH7B 1R6TA 1JQ0A 3SYPA 1RPOA 1TVKA 2JDIG 3BHPA 2JGUA 3MAQA 4XDKA 1UFIA 2AW9A 2RQ6A 1L0LH 5EBLC 3IC9A 4GX5A 3B40A 1KB9F 3J81N 4PA6A 1VQ7V 1WNSA 1GMGA 2XAFA 4G27B 1O9GA 3AG4C 2LJ2A 3CEIA 2BCCH 1X4TA 4LCUC 2Q4PA 4FFBA 4RUEA 4JI7B 1QLEB 1XMOB 5EC2C 3D36A 5CMUA 2ETNA 4CZZA 1PP9H 3CCEV 3OW2U 2H8PC 1FXKC 4GKKB 1IXMA 3CCLV 2PTMA 2QE7G 3FAVB 4K0KO 1FFXB 1K3EA 1K9MW 4X1KB 5DECA 3ZRWA 3ZN0A 4PA4A 2FKXA 4DR3O 2VRZA 1R3KC 1MSDA 2D3OW 2C2AA 2Y69B 3WU2Z 5BY1A 2ZE7A 1WB7A 4B3TO 1GO3F 1N0JA 2P4VA 3CS5A 5B1AB 1N8RW 1NTKH 1O9HA 4JI6B 5GTIZ 2UUBO 3LUTB 3DGEA 4JYBA 2ZXWC 3L74H 3BRCA 1Z5WA 1WP8A 5KA6A 4DUZB 3QO7A 4FM2A 5IY5B 1JJ2U 3SR2C 3OMIB 3ZHTA 1K5SA 4ASUG 2UUCB 3K5LA 1VF6A 1W2BU 5B66Z 3ETGA 4DV4B 2GUZB 4DV3B 2UXDO 3JATA 4X8AA 2DYRB 2PYLA 1YEWA 1HNZO 1E1QG 3EVKA 3TXQA 5CBHA 4N23A 5H6QA 3E83A 3IAYA 3JYCA 2UXCO 1VIBA 2ZCEA 4EB6A 1OCZC 3TGUH 1HNXB 1SQPH 1K33A 3ABKC 4RQFA 1V54B 2EIJC 2A0LA 3TCUA 2B1GA 5J2TB 4K35A 4H0LB 2CTWA 4KHPB 2LO1A 3CP1A 2QM4A 4MVMA 3ZHUA 3P30A 3AG1C 5KHJA 3KG2A 4G28B 3H1IH 3L72H 1OCCC 1KP2A 2FTKA 1PM9A 3G80A 1HR0O 4WFAV 4UCTA 3N2KB 4J11A 4O4JB 2M7WA 4MTFA 3LNMB 3AK2A 5KX5A 1W0KG 5EYPA 1K5QA 3ABMB 2BTQA 2KKWA 4W4LA 2IH3C 2VS0A 1BL8A 1KU9A 4HAMA 1TUEB 1QNMA 4JTCB 2QJ1A 1XUQA 4LR3A 4LF9O 1GM7A 3R66A 1RSOB 1ROPA 1THZA 3FB7C 3CC4V 4RUFA 5LBQA 3UQ8A 1FKAO 3JD2A 3ETDA 3JASB 1AP6A 3GWOA 3WB2A 2CUGA 2VWKA 2PUSA 2AGAA 1WLEA 2W0FC 3FFQA 2OIGA 1OZ0A 2P4KA 3RGBA 5LXTA 1BZKA 1GAXA 1MNGA 4NXMO 5JJNB 4LFBB 4MW8A 4Z2WA 2Q7EA 1YJNV 4WCEV 2JEXA 2Y0PA 4ZKIA 3K06A 4PA9A 4FM0A 3QNEA 3L9DA 1N34B 3CYOA 3AG3B 1GK9A 3M99B 1TVKB 5BMVA 3QO8A 3ZMUA 3VQXA 3ZHSA 5L3FA 3K59A 1PV0A 3UO2A 4X20A 2DYSC 1MMMA 2VWJA 3F5TA 1OCOC 2RJZA 5FL7G 4FLXA 4PDVA 1EZJA 1EBOA 5L3EA 3KDRA 4B3RO 4X88A 4X62O 1Y4MA 5IWAO 1YHQV 4FPPA 3K79A 4FFBB 4YJ3A 1YJ9V 3P32A 1DLBA 2HJFC 1RFYA 2R9AA 4FFKA 4IIJA 2H3OA 2F95B 2WWWA 1XREA 4K0KB 3N2GA 1PL0A 4LFAO 3ML0A 3ZRWB 3ABUA 4UUJC 4DR3B 2CDYA 2IW5A 4GX0A 1H8HG 1H2GA 1OJHA 1CP9A 1YTFB 3KZIZ 4MS2A
chains in the Genus database with same CATH topology
3OT7A 2P4KA 1AVMA 2RCVA 1EN5A 1BT8A 1MA1A 1MNGA 3DC6A 1EN4A 1BS3A 1EM1A 3KKYA 2ADQB 1XDCA 2QKAA 1B06A 2GDSA 1IDSA 3BFRA 1GN4A 4BR6A 1GN6A 3EVKA 1JR9A 1WB8A 1D5NA 1BSMA 3DC5A 4YIOA 4GUNA 1AR4A 1GN3A 4JYYA 1JA8A 2AW9A 2CE4A 1I08A 1P7GA 3IC9A 3TJTA 1Y67A 1ZUQA 3MDSA 1MMMA 1IX9A 3LSUA 1I0HA 1LUWA 3AK1A 1PM9A 3KDRA 1ZLZA 4F6EA 1LUVA 3K9SA 3CEIA 2ADPA 1N0NA 5AG2A 3AK2A 3RN4A 4C7UA 1AR5A 1GN2A 1XILA 3QVNA 4FFKA 1QNMA 5A9GA 1XUQA 1PL4A 1ZSPA 4JZGA 4JZ2A 1KKCA 1VARA 1XREA 4E4EA 1VEWA 1ZTEA 1EN6A 1IXBA 3C3SA 1MSDA 3C3TA 2QKCA 2CDYA 1WB7A 1AP5A 1AP6A 3AK3A 1N0JA 4X9QA 1SZXA 4YIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT7 A;  2P4K A;  1AVM A;  2RCV A;  1EN5 A;  1BT8 A;  1MA1 A;  1MNG A;  3DC6 A;  1EN4 A;  1BS3 A;  1EM1 A;  3KKY A;  2ADQ B;  1XDC A;  2QKA A;  1B06 A;  2GDS A;  1IDS A;  3BFR A;  1GN4 A;  4BR6 A;  1GN6 A;  3EVK A;  1JR9 A;  1WB8 A;  1D5N A;  1BSM A;  3DC5 A;  4YIO A;  4GUN A;  1AR4 A;  1GN3 A;  4JYY A;  1JA8 A;  2AW9 A;  2CE4 A;  1I08 A;  1P7G A;  3IC9 A;  3TJT A;  1Y67 A;  1ZUQ A;  3MDS A;  1MMM A;  1IX9 A;  3LSU A;  1I0H A;  1LUW A;  3AK1 A;  1PM9 A;  1ZLZ A;  4F6E A;  1LUV A;  3K9S A;  3CEI A;  2ADP A;  1N0N A;  5AG2 A;  3AK2 A;  3RN4 A;  4C7U A;  1AR5 A;  1GN2 A;  1XIL A;  3QVN A;  4FFK A;  1QNM A;  5A9G A;  1XUQ A;  1PL4 A;  1ZSP A;  4JZG A;  4JZ2 A;  1KKC A;  1VAR A;  1XRE A;  4E4E A;  1VEW A;  1ZTE A;  1EN6 A;  1IXB A;  3C3S A;  1MSD A;  3C3T A;  2QKC A;  2CDY A;  1WB7 A;  1AP5 A;  1AP6 A;  3AK3 A;  1N0J A;  4X9Q A;  1SZX A;  4YIP A; 
#chains in the Genus database with same CATH topology
 4B3T B;  1VF7 A;  2KG7 A;  2X0L A;  3OR7 C;  4BAY A;  2UUB B;  1BT8 A;  4GZR B;  1BE3 H;  2B1I A;  1VQK V;  4RAI A;  3WG7 B;  1EM1 A;  4J42 A;  2F43 G;  1YJW V;  2Q7G A;  4GYC B;  4JAV A;  5D5P A;  3H1L H;  3JAT B;  1F7Y A;  3ZRV A;  1SQQ H;  2UXD B;  3CRA A;  3G6B A;  1YIT V;  1HNZ B;  4I7Z B;  1I5X A;  4EB6 B;  5KHI A;  1PNK A;  3F7Y C;  3SYQ A;  3JD4 A;  2P90 A;  2YIA A;  4YXW G;  2JS3 A;  4DYL A;  2UXC B;  2UXX A;  2LFS A;  4B3M O;  1JCH A;  4JI3 O;  1VQM V;  1KUQ A;  4CS4 A;  5HFM A;  3MHS C;  5HFL A;  1JNB A;  4FK5 C;  2Y69 C;  1SQB H;  3W7W A;  4XBF A;  2NR5 A;  3LDD A;  1F4M A;  5B1A C;  2CGO A;  1AJQ A;  4J7Z A;  1KYO F;  4Q6G A;  1J5E O;  3BA9 A;  5KLV H;  3RN4 A;  2VQF O;  5KX5 B;  1N33 O;  5IY5 C;  3ETQ A;  4U3J A;  2W6I G;  5EYP B;  1E1R G;  2HG5 C;  2ZQM A;  5H9C A;  2BTQ B;  4DR1 O;  4PDL A;  1B6Q A;  1PNL A;  1RM1 B;  3CRQ A;  1ZSP A;  1K97 A;  2WLK A;  4LF9 B;  4JF3 A;  2DYR C;  2OWO A;  1ZX3 A;  1IUR A;  1WJZ A;  1L8D A;  1FJG O;  4H37 A;  4UVB A;  1Y6X A;  2V1D A;  1NTZ H;  4DW0 A;  3H9V A;  4WFB V;  4WFH A;  2ZE5 A;  2HR3 A;  4FVM A;  3JCU Z;  3T2M A;  2XOK G;  3IFX A;  3K04 A;  2ZE6 A;  4OPH A;  2XTA A;  4JI5 O;  2EZP A;  4MTX A;  1I94 O;  1BMF G;  5LXT B;  2ILM A;  1B04 A;  3I55 V;  5LHI A;  4X64 O;  1DF5 A;  3PJS K;  1MSW D;  4NXM B;  5L3C A;  1Q86 W;  2ADQ B;  3RVY A;  4J7J A;  2YXY A;  2JS5 A;  3S3W A;  2YI8 A;  3AG2 C;  2WLN A;  3Q4H A;  4PEL A;  1MAB G;  2XAH A;  1R73 A;  3OEE G;  5BMV B;  2QEX V;  1QR8 A;  1SF9 A;  1VQ4 V;  5H5N A;  3K03 A;  2EBO A;  4DR4 O;  5LGN A;  1QVF U;  2A79 B;  1ZUQ A;  3K58 A;  4X20 B;  2LGW A;  3ZED A;  2HFE C;  1NI8 A;  4ZOL A;  5CBG A;  4HZ3 A;  1JPX A;  3OTF A;  3ZRS A;  2DWD C;  2V4D A;  3K9S A;  1VQ9 V;  5DED A;  4GT1 A;  1M57 C;  1AJN A;  4B3R B;  3ASN B;  1S5J A;  2EZO A;  3VOU A;  4YJ3 B;  4X62 B;  4L87 A;  5IWA B;  3FKS G;  1H5W A;  4DV6 O;  2YIC A;  4JI2 O;  4WBN A;  1SQF A;  3FB8 C;  3STZ C;  1XI1 A;  5FPR A;  4IIJ B;  4NKG B;  4U7N A;  2WLI A;  3T4D A;  2OTJ V;  2EIM B;  3N2G B;  2G38 A;  5B1N A;  1TAE A;  3ZCC A;  1N4C A;  4LFA B;  3AG3 C;  3ZN1 A;  4LH6 A;  3CCV V;  1DF4 A;  3L70 H;  4BIU A;  4X9Q A;  5CA3 A;  3OT7 A;  5C8Y A;  3IGA C;  4MVQ A;  5FPO A;  3M7M X;  5GW7 A;  2KG7 B;  2ZT9 B;  1R3I C;  2YXL A;  1QLN A;  2R72 A;  1ZWI C;  2YS8 A;  4MVO A;  2WSS G;  2GV9 A;  1Z2G A;  2DQ3 A;  3RW0 A;  3K0D A;  1SQG A;  5LA6 A;  3CC2 V;  2KSD A;  4OPA A;  3OD4 A;  4F4L A;  1Q82 W;  3OM3 B;  3ZRX A;  3VQY A;  4QPJ A;  4DV7 O;  3ZMZ A;  1BSM A;  3SDL A;  4X1I A;  1IBL O;  3JAM N;  5H2F Z;  5B3S B;  2E74 B;  2ZDI A;  4DV0 O;  1VQ5 V;  1YZB A;  3K5N A;  3CWB H;  4B3M B;  3TET A;  4JI3 B;  4UCV A;  3FB5 C;  5KA5 A;  2OYQ A;  1QQC A;  2QSA A;  1N0N A;  3ZHR A;  2ZIM A;  2XT9 A;  1FYJ A;  3CXC U;  3CSX A;  2Y4U A;  1AI5 A;  3OMN B;  4U3J B;  4FLW A;  3CCJ V;  1J5E B;  5TIS Z;  2VQF B;  1N33 B;  1SZT A;  4YY3 O;  5FNV A;  1US6 A;  2IJJ A;  5A9G A;  4DR1 B;  2OCC C;  2AZ2 A;  5LP6 C;  3SPC A;  3X2Q B;  2N05 A;  5D5Q A;  3A0H Z;  2FYU H;  1BGY H;  4R8C A;  1JJO A;  1Y66 A;  2UXB O;  4UB6 Z;  2K1E A;  2XAQ A;  2IJK A;  3CJH A;  4GX2 A;  1FJG B;  5CA1 A;  4I4T A;  2R9I A;  3ABL B;  3TK1 A;  1Q6I A;  1R3J C;  2N74 A;  4DR6 O;  4IHJ A;  5J2U A;  1K7D A;  1XHX A;  2E5L O;  1R6N A;  3UKM A;  1M93 A;  4EFB A;  4JI5 B;  4NR1 A;  1I94 B;  3MD0 A;  3CPW U;  4X64 B;  1U96 A;  4B3S O;  1FS0 G;  5B1B B;  4AIL C;  2EIK B;  4PI2 A;  5KHK A;  1KC8 W;  3APO A;  3B8M A;  3RYH A;  3BFR A;  1ENV A;  4MVR A;  5J9P C;  2QGN A;  2P5O A;  1ZL8 A;  1Q81 W;  3K9A A;  3Q4H B;  1GH6 A;  3T1H O;  1QU7 A;  4Z1V A;  1OCR B;  4I55 A;  4D6T H;  2HEP A;  4DV2 O;  3BAB A;  1I08 A;  5GON A;  2FML A;  4O4H A;  4UVC A;  4HNA A;  4DR4 B;  2QWN B;  3A8T A;  2HJD A;  3ETE A;  4ZOL B;  2RN9 A;  1LUV A;  3O9O A;  4I9W A;  4I50 A;  1WP7 A;  4JAA A;  2F23 A;  3F5W C;  5GTH Z;  1DTO A;  4PDR A;  1G6U A;  4CC5 A;  2AHY A;  3SYO A;  4WBN B;  4DV6 B;  2L6L A;  1S76 D;  1GKF A;  2X6B A;  1FXK A;  3RYF A;  2WLI B;  3JD1 A;  5C93 A;  3G67 A;  2P22 C;  2Y0I A;  4FLV A;  1YCI A;  4IYI A;  5E1A C;  3OTO O;  2FB5 A;  4P9O A;  3E2E A;  5BR8 O;  4QE7 A;  4YIP A;  3D8C A;  1MZE A;  1K34 A;  1A32 A;  3GB7 C;  1AVM A;  3HPL C;  3RYI A;  5C8Y B;  1QHT A;  1W59 A;  4JTD B;  1QCE A;  5LGT A;  4XDL A;  2F1M A;  2JK5 C;  3W7X A;  4PHZ A;  2R70 A;  5IYZ A;  1R6K A;  2F93 B;  3KKY A;  4HBN A;  5LA6 B;  3NXS A;  3F7V C;  4MTO A;  4TV9 A;  3UT5 A;  4P9P A;  3CXH F;  4NVP A;  3U0Z A;  4MVZ A;  1MG1 A;  3OGI B;  4JI8 O;  3QF7 A;  4A5U B;  1KKD A;  3ASN C;  1WB8 A;  2D2C B;  3BVO A;  2N04 A;  1BHA A;  4JI4 O;  4JI1 O;  1M56 B;  1COW G;  4TSF G;  4X1I B;  2A7W A;  2JEU A;  4N21 A;  4UV9 A;  3T1C A;  3RVZ A;  1IBL B;  4JAU A;  4X89 A;  1CEZ A;  3CC7 V;  2EIM C;  2YEV A;  2JJ1 G;  1SRY A;  1SS3 A;  4CBC A;  3SJQ C;  4DV0 B;  2OT5 A;  3K0G A;  2Y4T A;  1XL6 A;  2XHB A;  4NTW A;  2UU9 O;  1ZLZ A;  4EFE A;  2EIL C;  5LOV A;  1NVP B;  2QM7 A;  2QTS A;  1TUB A;  3FX7 A;  4E2L A;  4NXN O;  5FNV B;  2A9H A;  1S3J A;  4NYK A;  4ZIB A;  1NZ6 A;  4AI8 A;  4WFF A;  4YY3 B;  4UCR A;  2QWO B;  5FLX N;  3C90 A;  3OAA G;  2EJR A;  2UXB B;  3CJH B;  4DO2 A;  2NN4 A;  1HW7 A;  5B3S C;  5CA1 B;  2DOS A;  4I4T B;  3CCM V;  4U3F H;  4LWS A;  4IHJ B;  5J2U B;  1KEC A;  2YI9 A;  4DR6 B;  4O2B A;  4O2A A;  3EFF K;  2E5L B;  2GTA A;  1WA8 A;  3CCQ V;  2IJI A;  2OCH A;  1XDC A;  3E8F A;  4GLX A;  4B3S B;  2QWR B;  3N27 A;  4U7O A;  4TWK A;  3RYH B;  3CRR A;  1JR9 A;  3GWK C;  1ZL8 B;  2HVK C;  2BE3 A;  4X66 O;  4FIP C;  1Y74 A;  2YIB A;  4DR2 O;  4I55 B;  3T1H B;  1PNM A;  3O65 A;  4PJ0 Z;  3X2Q C;  4DV2 B;  5GON B;  4XDJ A;  2CTR A;  2UUA O;  4F6R A;  4O4H B;  3TJT A;  2Q69 A;  2AZ0 A;  3CB2 A;  4HNA B;  1SET A;  3BCC H;  4FLY A;  4OGQ B;  1QLE C;  1HNW O;  1KMI Z;  2WA3 A;  3JD3 A;  4PV1 B;  3H1J H;  3JAL A;  4LF4 O;  4DW1 A;  4BIZ A;  5IYD O;  5EZY A;  1JFF A;  1IZ3 A;  2DMX A;  3ABL C;  1VQ6 V;  4I50 B;  3AG4 B;  1DK1 A;  3SYA A;  1R3L C;  5JJE B;  1VQL V;  2XUM A;  3JD0 A;  5JCO A;  5CA0 A;  2CTQ A;  3J80 N;  1N32 O;  2EIK C;  2BOC C;  1SQV H;  2KQX A;  3A0B Z;  3BPZ A;  1VEW A;  1KD1 W;  1N36 O;  1OV9 A;  1FXK B;  3RYF B;  1H2S B;  2LGQ A;  2WAM A;  3RBZ A;  2RDC A;  3D3I A;  4TV8 A;  5B5E Z;  4UCO A;  1HR0 B;  1AP5 A;  2ZD9 A;  3E22 A;  3AK3 A;  4JI0 O;  2ITD C;  2RMK B;  1AI4 A;  1SER A;  2LFR A;  2X6A A;  3OTO B;  3K5M A;  4DV1 O;  1H38 A;  1IBM O;  3RYI B;  5BR8 B;  4LF7 O;  4DR7 O;  4FZ0 A;  3BA8 A;  4I5S A;  2FL4 A;  1ARO P;  2ZIO A;  2ZXW B;  3T4Z A;  3ZIA G;  5IYZ B;  4FMT A;  2BOB C;  1WAZ A;  3CRC A;  4H44 B;  4FJC C;  1Z5V A;  2O57 A;  3L71 H;  4GCZ A;  4TV9 B;  3UT5 B;  1GN4 A;  2V7Q G;  1V9P A;  4DR5 O;  3B8N A;  1BQ0 A;  1V54 C;  3RT3 C;  5KMG A;  4UFZ A;  5A2Q N;  4JI8 B;  3W7S A;  1T5E A;  3DTU B;  4GUN A;  2P7T C;  1XMO O;  1KQS U;  4JI4 B;  4JI1 B;  2KB1 A;  2Q6A A;  1EFR G;  3WFV A;  2XAJ A;  1OCZ B;  1SQX H;  3ABK B;  1IX9 A;  2YEV B;  3ZHQ A;  2EIJ B;  4KP4 A;  3NR7 A;  3ABM C;  4NTY A;  3AG1 B;  4ABM A;  4RO2 A;  1NBM G;  5KAF Z;  2P67 A;  3E8B A;  2UU9 B;  5AG2 A;  4D7T A;  4FM1 A;  5LOV B;  4JI6 O;  1V55 B;  4C7U A;  4LF5 O;  1OCC B;  1TUB B;  5LMU O;  1WPX A;  4DUY O;  3P3N A;  2IU3 A;  2Z3Y A;  1Q43 A;  3IJ4 A;  4AHC A;  1AI6 A;  4B7K A;  4UXN A;  3MHH C;  4TQD A;  1PKX A;  4O4I A;  4NXN B;  1KKC A;  3JCZ A;  4E4E A;  4JPR A;  3JAK A;  1Q6U A;  3CCS V;  2E3C A;  1VQ8 V;  1SC5 B;  4J7K A;  2CTP A;  1S0V A;  3DXR A;  3CE2 A;  3E86 A;  4KXR A;  2Q67 A;  2DWE C;  4IYH A;  1M56 C;  1K92 A;  3FB6 C;  4QNH B;  2XAS A;  3S3X A;  2Q0A A;  4MVU A;  1EN5 A;  5BXZ A;  2R9R B;  3DSQ A;  4R6Z A;  3A2F A;  4LWS B;  5KUK A;  2ZDI C;  4H13 B;  5IE9 A;  4B08 A;  5J2T A;  4LH7 A;  1NJI W;  4O2B B;  4O2A B;  2WA4 A;  1WA8 B;  1IJG A;  3HKD A;  1LR1 A;  4AQY O;  2GDS A;  5DN6 G;  1G1X B;  1VF5 B;  2HVJ C;  2ODM A;  2ZKO A;  1CXZ B;  2IH1 C;  1L0N H;  1CPY A;  1RP3 B;  2ZIN A;  4IT5 A;  4UCS A;  1AR4 A;  2QM8 A;  2OTL V;  1Y74 B;  4X66 B;  2E75 B;  2JGD A;  1Q7Y W;  3GVM A;  3SJC C;  3UCS C;  2Z0A A;  4DR2 B;  1XMQ O;  3U10 A;  1Y67 A;  4F6R B;  1W0J G;  2P6J A;  4J9Z B;  1XOU A;  2UUA B;  1AR1 B;  2VQE O;  4JGS A;  1H2K A;  4CS3 A;  1Q6H A;  1TA8 A;  5L3G A;  3D36 C;  5CB4 A;  2QA4 V;  3ZJZ A;  3JAL B;  4UCU A;  4J10 A;  5EZY B;  1JFF B;  1YSC A;  2GHY A;  4LF4 B;  4K8Z A;  4YHH O;  1NH2 B;  3FYE B;  3CCU V;  3THO A;  1WPB A;  4WFG A;  4CH6 A;  3JAW A;  2WLH A;  4CH5 A;  5KUM A;  3OMA B;  1PL4 A;  5CA0 B;  2NLJ C;  4JZ2 A;  1L1F A;  5IDJ A;  3SJB C;  1I7F A;  1IXB A;  4D7S A;  1NVP D;  3HKE A;  1N32 B;  1S72 V;  1QBZ A;  1N36 B;  5EC1 C;  2QKC A;  4TV8 B;  1NKD A;  4PA3 A;  1AB3 A;  2JIZ G;  3E22 B;  2QWQ B;  5CBF A;  1SZX A;  3STL C;  1F4N A;  3LNN A;  4JI0 B;  1XNR O;  1VF6 C;  2RCV A;  3WG7 C;  3HB3 B;  4KFM A;  3B2E E;  3RFR A;  3B09 A;  5L3D A;  4DV1 B;  1IBM B;  4LF7 B;  4UB8 Z;  3LSQ A;  3SPH A;  4LP8 A;  5IT9 N;  4DR7 B;  2ATK C;  1ORQ C;  1BS3 A;  3APQ A;  2UXN A;  1YIJ V;  3OR6 C;  1NS1 A;  1NTM H;  2HHH O;  4FZ1 A;  1F23 A;  1GN6 A;  1GM8 A;  4GKJ O;  3KCX A;  2CK3 G;  3B77 A;  2WLJ A;  4DR5 B;  5KMG B;  1IBK O;  1HP8 A;  1QR9 A;  3U11 A;  1K73 W;  2WLM A;  4JYY A;  4CC6 A;  1JA8 A;  2CE4 A;  1J95 A;  2Q5Z A;  5EIB C;  1YTF D;  4QPK A;  3OUF A;  1FD9 A;  1U97 A;  5F2V O;  4FLT A;  1HWY A;  1KBH A;  3LSU A;  3ASO B;  2WLL A;  4TUY A;  1UPG A;  4RQE A;  2ADP A;  5KHH A;  5E79 Z;  1M5I A;  4DRX A;  1PD3 A;  2Z5U A;  1JX9 A;  1RM1 C;  1X59 A;  3E8H A;  4WF9 V;  2ZNI A;  4LF5 B;  1GN2 A;  5LMU B;  2ZE8 A;  4DUY B;  4DK1 A;  4NTX A;  3SJA C;  5JQG A;  4O4I B;  1TGO A;  4UVA A;  3JAK B;  3B4S A;  2WPD G;  5LP6 A;  1S5H C;  3DXR B;  1Q3E A;  4RWU A;  1NR1 A;  3E89 A;  4JYA O;  4FLZ A;  1BCC H;  4UV8 A;  2Q9L A;  2Q7H A;  3T1Y O;  3PN1 A;  2K9P A;  4JTA B;  2NNU A;  5EIB D;  4JI2 B;  2GTS A;  3BEH A;  3FYI B;  1RPR A;  2GBO A;  2IJH A;  2BTO A;  1LNQ A;  2QDO A;  3EXA A;  4OXS A;  5K1P A;  4I0X A;  4ICG A;  3AEI A;  4ZHQ A;  4FLU A;  3HKD B;  1YVW A;  4BR6 A;  5L3B A;  2H94 A;  1E79 G;  4AQY B;  1V55 C;  3QG5 A;  3CRM A;  1FXH A;  3K5O A;  3AG2 B;  2L35 A;  1YF2 A;  2JGD B;  3HKB A;  2RNB A;  1K8A W;  2YXH A;  2EIN B;  1IVS A;  3OGC C;  3ZMT A;  3MDS A;  4BW9 A;  1D2D A;  1VP7 A;  1XEQ A;  2ZR2 A;  1ZAU A;  1SA0 A;  1XMQ B;  1LUW A;  3FD9 A;  2LW1 A;  1G4Y B;  2VQE B;  3M8A A;  4DV7 B;  3SGI A;  5CB4 B;  1M90 W;  3W7T A;  4X65 O;  3I5D A;  1P49 A;  4JYC A;  4YHH B;  1M57 B;  3QVN A;  2F4V O;  3AG7 A;  3RYC A;  3JAW B;  3SPJ A;  1H2M A;  5LYJ A;  3ICX A;  4ZI7 A;  4TOI A;  4B7E A;  5LGU A;  1VMG A;  2W0X A;  4K3A A;  4R50 A;  2CAZ C;  2YC0 A;  5LL6 Y;  3OFN G;  3HKE B;  4CS2 A;  4CH3 A;  5DM6 V;  3WB1 A;  2CH7 A;  2PY5 A;  3QO5 A;  3ZMS A;  4Z1M G;  4X1Y A;  2EUL A;  2DN9 A;  3UM7 A;  4W4K A;  5ITZ A;  4LF8 O;  2DQ0 A;  5KHG A;  2X7R B;  1Q8I A;  5LHG A;  2MK3 A;  1MA1 A;  1XNR B;  1NR7 A;  4Q20 A;  4KL1 A;  1BQZ A;  4H33 A;  4NB5 A;  4CH4 A;  3QTC A;  3G6E V;  1BHB A;  4KUM A;  5CN0 A;  4OX9 O;  3H1K H;  3H1H H;  4QGP A;  1WN7 A;  2QKA A;  3R65 A;  1B06 A;  1URF A;  3E8G A;  3WB0 A;  1XBL A;  2YDE A;  4P30 A;  2HHH B;  3D3Q A;  1G8M A;  1S77 D;  3CD6 V;  4GKJ B;  1R1B A;  1XNQ O;  4JAS A;  5IYB O;  5BZB A;  2PI4 A;  3JAR A;  4JV5 O;  4O4L A;  1B3Q A;  1IBK B;  1S5L Z;  5JCO C;  1YI2 V;  1XL4 A;  4LC1 A;  1PPJ H;  4LFC O;  3KCY A;  4I9Q A;  1FFT B;  3OE7 G;  1QVG U;  5IJ0 A;  2IM9 A;  4PD4 F;  4BWA A;  1DGS A;  4MT8 A;  2OIE A;  1K4C C;  2BSK A;  1XQ8 A;  2WLL B;  4P2Z A;  4TUY B;  2YIB D;  4G2K A;  3CCR V;  4LNU A;  2DE0 X;  1H2N A;  2Y48 A;  1NU1 H;  4DRX B;  4LF6 O;  1I5Y A;  1MZF A;  3LDE A;  2AHZ A;  1XIL A;  2EX3 A;  4QE9 A;  3CHX A;  3VQV A;  1M4U A;  3OEH G;  4DXW A;  5JQG B;  1FOU A;  1YDX A;  1FXV A;  4WFE A;  3BAA A;  2OCC B;  2B5U A;  1Y76 A;  1GTO A;  5LP6 B;  1VQO V;  1NH2 D;  4BIO A;  2IBZ H;  3ZS8 C;  3ZMV A;  1NT2 B;  3W7U A;  5JVD A;  2Q8V A;  2QWP B;  3HR0 A;  2ITC C;  3ZX6 A;  4JYA B;  2ZM6 O;  5B1B C;  3T1Y B;  2DJV A;  5KAI Z;  3K3W A;  4DV5 O;  4EKW A;  5IJ9 A;  3DC6 A;  3SPI A;  4J80 A;  5LMN O;  1H2L A;  1M9N A;  1SES A;  4YJ2 A;  3ASO C;  1MOF A;  4BW5 A;  4I0X B;  3TXS A;  2PF4 E;  3HKC A;  4ZHQ B;  2P06 A;  2YSU B;  5JH7 A;  4TT3 G;  1OCR C;  2QR4 A;  4PDM A;  4ZBM A;  4R7C A;  1FPO A;  3G71 V;  2Q0O C;  4GX1 A;  4J41 A;  2LQT A;  3ABT A;  2E76 B;  1P7G A;  2HP8 A;  3HKB B;  4L8J A;  3ZBH A;  3LDC A;  1SA0 B;  1I0H A;  2LP7 A;  4QJF B;  3AK1 A;  4F6E A;  3L75 H;  4JI7 O;  4QIW F;  2A06 H;  1XHZ A;  3A0R A;  4GKK O;  3CX5 F;  4PA7 A;  1AR5 A;  4X65 B;  1KP3 A;  1AJP A;  3FAV A;  2ZR3 A;  1FFX A;  3SPG A;  3RYC B;  4X1K A;  4K8X A;  5LYJ B;  2F4V B;  1OHH G;  3JSL A;  4ZI7 B;  1P7B A;  1ZTE A;  1EN6 A;  1K4D C;  3UO3 A;  5EBM C;  3J7A U;  3C3S A;  1VQN V;  3C3T A;  4LBE C;  5IYC O;  1M1K W;  2XND G;  2CH7 B;  5JJJ B;  2JJ2 G;  2IU0 A;  4X1Y B;  4DUZ O;  2PGG A;  5ITZ B;  3K57 A;  5K1X A;  2UUC O;  3RWR D;  1D5A A;  4MTG A;  4LF8 B;  2EIN C;  2CGN A;  2YUA A;  4TQF A;  2HLD G;  4DV4 O;  2DW4 A;  1EN4 A;  4DV3 O;  5EBW C;  2GUZ A;  3I56 V;  1EZV H;  4OX9 B;  5LHH A;  2JRI A;  2JVD A;  3G4S V;  2PZS A;  1D5N A;  1HNX O;  3DC5 A;  1GRJ A;  3VQW A;  4YIO A;  2AXT Z;  3OUS A;  1GN3 A;  3JAR B;  4KHP O;  4O4L B;  2F66 C;  4PI0 A;  1P4R A;  1XNQ B;  4IL6 Z;  2X6C A;  5H6R A;  3IC7 A;  4JV5 B;  4J9Y B;  1JOY A;  2GSM B;  3JSN A;  3CMA V;  1HDJ A;  1AIL A;  1Q90 D;  4DK0 A;  4LFC B;  5IJ0 B;  2QTO A;  3BY6 A;  1JVM A;  2BSK B;  2W6J G;  2XAG A;  3N2K A;  4O4J A;  1GM9 A;  4LNU B;  4IGG A;  2HKO A;  2QKS A;  4EEQ A;  1NQT A;  1VQP V;  2ZNJ A;  2YID A;  2MW2 B;  4LF6 B;  2EIL B;  2Q68 A;  5EK0 A;  3K08 A;  1JMK C;  4MSW C;  1P84 F;  4JZG A;  2PI5 A;  1VAR A;  1RSO A;  1H8E G;  3SYC A;  2DYS B;  2EJ7 A;  2Q73 A;  1HNW B;  1OCO B;  3JAS A;  1Y76 B;  1F51 A;  3H01 A;  5JVD B;  4HYO A;  5JWP A;  1YXB A;  3L73 H;  3LSS A;  4LFB O;  2B9Z A;  1FAF A;  4MVS A;  3EHB B;  2ZM6 B;  3VBB A;  3ZHV A;  5IJ9 B;  2PYJ A;  1SKV A;  3CME V;  4DV5 B;  2ARH A;  3E35 A;  2A3Q A;  3P3P A;  4YJ2 B;  1Q5O A;  5LMN B;  1UJW B;  4MW3 A;  1N34 O;  2M6Y A;  5B1O A;  2LW7 A;  3HKC B;  1AI7 A;  1IDS A;  5JH7 B;  1R6T A;  1JQ0 A;  3SYP A;  1RPO A;  1TVK A;  2JDI G;  3BHP A;  2JGU A;  3MAQ A;  4XDK A;  1UFI A;  2AW9 A;  2RQ6 A;  1L0L H;  5EBL C;  3IC9 A;  4GX5 A;  3B40 A;  1KB9 F;  3J81 N;  4PA6 A;  1VQ7 V;  1WNS A;  1GMG A;  2XAF A;  4G27 B;  1O9G A;  3AG4 C;  2LJ2 A;  3CEI A;  2BCC H;  1X4T A;  4LCU C;  2Q4P A;  4FFB A;  4RUE A;  4JI7 B;  1QLE B;  1XMO B;  5EC2 C;  3D36 A;  5CMU A;  2ETN A;  4CZZ A;  1PP9 H;  3CCE V;  3OW2 U;  2H8P C;  1FXK C;  4GKK B;  1IXM A;  3CCL V;  2PTM A;  2QE7 G;  3FAV B;  4K0K O;  1FFX B;  1K3E A;  1K9M W;  4X1K B;  5DEC A;  3ZRW A;  3ZN0 A;  4PA4 A;  2FKX A;  4DR3 O;  2VRZ A;  1R3K C;  1MSD A;  2D3O W;  2C2A A;  2Y69 B;  3WU2 Z;  5BY1 A;  2ZE7 A;  1WB7 A;  4B3T O;  1GO3 F;  1N0J A;  2P4V A;  3CS5 A;  5B1A B;  1N8R W;  1NTK H;  1O9H A;  4JI6 B;  5GTI Z;  2UUB O;  3LUT B;  3DGE A;  4JYB A;  2ZXW C;  3L74 H;  3BRC A;  1Z5W A;  1WP8 A;  5KA6 A;  4DUZ B;  3QO7 A;  4FM2 A;  5IY5 B;  1JJ2 U;  3SR2 C;  3OMI B;  3ZHT A;  1K5S A;  4ASU G;  2UUC B;  3K5L A;  1VF6 A;  1W2B U;  5B66 Z;  3ETG A;  4DV4 B;  2GUZ B;  4DV3 B;  2UXD O;  3JAT A;  4X8A A;  2DYR B;  2PYL A;  1YEW A;  1HNZ O;  1E1Q G;  3EVK A;  3TXQ A;  5CBH A;  4N23 A;  5H6Q A;  3E83 A;  3IAY A;  3JYC A;  2UXC O;  1VIB A;  2ZCE A;  4EB6 A;  1OCZ C;  3TGU H;  1HNX B;  1SQP H;  1K33 A;  3ABK C;  4RQF A;  1V54 B;  2EIJ C;  2A0L A;  3TCU A;  2B1G A;  5J2T B;  4K35 A;  4H0L B;  2CTW A;  4KHP B;  2LO1 A;  3CP1 A;  2QM4 A;  4MVM A;  3ZHU A;  3P30 A;  3AG1 C;  5KHJ A;  3KG2 A;  4G28 B;  3H1I H;  3L72 H;  1OCC C;  1KP2 A;  2FTK A;  1PM9 A;  3G80 A;  1HR0 O;  4WFA V;  4UCT A;  3N2K B;  4J11 A;  4O4J B;  2M7W A;  4MTF A;  3LNM B;  3AK2 A;  5KX5 A;  1W0K G;  5EYP A;  1K5Q A;  3ABM B;  2BTQ A;  2KKW A;  4W4L A;  2IH3 C;  2VS0 A;  1BL8 A;  1KU9 A;  4HAM A;  1TUE B;  1QNM A;  4JTC B;  2QJ1 A;  1XUQ A;  4LR3 A;  4LF9 O;  1GM7 A;  3R66 A;  1RSO B;  1ROP A;  1THZ A;  3FB7 C;  3CC4 V;  4RUF A;  5LBQ A;  3UQ8 A;  1FKA O;  3JD2 A;  3ETD A;  3JAS B;  1AP6 A;  3GWO A;  3WB2 A;  2CUG A;  2VWK A;  2PUS A;  2AGA A;  1WLE A;  2W0F C;  3FFQ A;  2OIG A;  1OZ0 A;  2P4K A;  3RGB A;  5LXT A;  1BZK A;  1GAX A;  1MNG A;  4NXM O;  5JJN B;  4LFB B;  4MW8 A;  4Z2W A;  2Q7E A;  1YJN V;  4WCE V;  2JEX A;  2Y0P A;  4ZKI A;  3K06 A;  4PA9 A;  4FM0 A;  3QNE A;  3L9D A;  1N34 B;  3CYO A;  3AG3 B;  1GK9 A;  3M99 B;  1TVK B;  5BMV A;  3QO8 A;  3ZMU A;  3VQX A;  3ZHS A;  5L3F A;  3K59 A;  1PV0 A;  3UO2 A;  4X20 A;  2DYS C;  1MMM A;  2VWJ A;  3F5T A;  1OCO C;  2RJZ A;  5FL7 G;  4FLX A;  4PDV A;  1EZJ A;  1EBO A;  5L3E A;  3KDR A;  4B3R O;  4X88 A;  4X62 O;  1Y4M A;  5IWA O;  1YHQ V;  4FPP A;  3K79 A;  4FFB B;  4YJ3 A;  1YJ9 V;  3P32 A;  1DLB A;  2HJF C;  1RFY A;  2R9A A;  4FFK A;  4IIJ A;  2H3O A;  2F95 B;  2WWW A;  1XRE A;  4K0K B;  3N2G A;  1PL0 A;  4LFA O;  3ML0 A;  3ZRW B;  3ABU A;  4UUJ C;  4DR3 B;  2CDY A;  2IW5 A;  4GX0 A;  1H8H G;  1H2G A;  1OJH A;  1CP9 A;  1YTF B;  3KZI Z;  4MS2 A; 
#chains in the Genus database with same CATH homology
 3OT7 A;  2P4K A;  1AVM A;  2RCV A;  1EN5 A;  1BT8 A;  1MA1 A;  1MNG A;  3DC6 A;  1EN4 A;  1BS3 A;  1EM1 A;  3KKY A;  2ADQ B;  1XDC A;  2QKA A;  1B06 A;  2GDS A;  1IDS A;  3BFR A;  1GN4 A;  4BR6 A;  1GN6 A;  3EVK A;  1JR9 A;  1WB8 A;  1D5N A;  1BSM A;  3DC5 A;  4YIO A;  4GUN A;  1AR4 A;  1GN3 A;  4JYY A;  1JA8 A;  2AW9 A;  2CE4 A;  1I08 A;  1P7G A;  3IC9 A;  3TJT A;  1Y67 A;  1ZUQ A;  3MDS A;  1MMM A;  1IX9 A;  3LSU A;  1I0H A;  1LUW A;  3AK1 A;  1PM9 A;  3KDR A;  1ZLZ A;  4F6E A;  1LUV A;  3K9S A;  3CEI A;  2ADP A;  1N0N A;  5AG2 A;  3AK2 A;  3RN4 A;  4C7U A;  1AR5 A;  1GN2 A;  1XIL A;  3QVN A;  4FFK A;  1QNM A;  5A9G A;  1XUQ A;  1PL4 A;  1ZSP A;  4JZG A;  4JZ2 A;  1KKC A;  1VAR A;  1XRE A;  4E4E A;  1VEW A;  1ZTE A;  1EN6 A;  1IXB A;  3C3S A;  1MSD A;  3C3T A;  2QKC A;  2CDY A;  1WB7 A;  1AP5 A;  1AP6 A;  3AK3 A;  1N0J A;  4X9Q A;  1SZX A;  4YIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...