1B06A

Superoxide dismutase from sulfolobus acidocaldarius
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
208
structure length
208
Chain Sequence
VIQLKRYEFPQLPYKVDALEPYISKDIIDVHYNGHHKGYVNGANSLLDRLEKLIKGDLPQGQYDLQGILRGLTFNINGHKLHAIYWNNMAPAGKGGGKPGGALADLIDKQYGSFDRFKQVFSESANSLPGSGWTVLYYDNESGNLQIMTVENHFMNHIAELPVILIVDEFEHAYYLQYKNKRGDYLNAWWNVVNWDDAEKRLQKYLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of a superoxide dismutase from the hyperthermophilic archaeon Sulfolobus acidocaldarius at 2.2 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (SUPEROXIDE DISMUTASE)
total genus 74
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1b06A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1b06A02
1EN5A 3AK1A 4FFKA 1I08A 1LUVA 1GN4A 3KKYA 3RN4A 3AK3A 1XILA 4JYYA 1N0JA 1AP5A 1AVMA 1AP6A 1B06A 1EN4A 1EN6A 3MDSA 4GUNA 3DC6A 2CDYA 1MA1A 1I0HA 4C7UA 1SZXA 4JZ2A 4F6EA 4BR6A 1ZTEA 1BT8A 3IC9A 3TJTA 2CE4A 1ZSPA 1P7GA 2QKAA 1AR4A 1N0NA 1IDSA 2P4KA 1WB7A 1XDCA 1JA8A 1KKCA 1Y67A 3OT7A 1GN2A 1XREA 5A9GA 1AR5A 1MSDA 4YIPA 1VARA 1WB8A 1ZLZA 3QVNA 3K9SA 1BS3A 2QKCA 2GDSA 1MMMA 1VEWA 1GN3A 3CEIA 3C3SA 2ADQB 1QNMA 1ZUQA 1LUWA 1IX9A 3DC5A 1PL4A 2ADPA 1IXBA 1JR9A 5AG2A 1D5NA 3LSUA 1EM1A 3AK2A 1PM9A 4YIOA 1MNGA 1BSMA 1GN6A 3EVKA 4E4EA 2RCVA 1XUQA 4X9QA 2AW9A 3BFRA 4JZGA 3C3TA
chains in the Genus database with same CATH superfamily
1YSCA 1XMOB 4I4TA 5H9CA 4EKWA 3ETGA 1SQVH 1JVMA 4TV9B 2QGNA 3SJQC 2Q0AA 2Q68A 1BL8A 2JEXA 3AG2B 2Y48A 4PA3A 3T2MA 1ZAUA 4CC6A 4WF9V 2ZR2A 5BXZA 4DK0A 2ZXWB 1KUQA 4YJ2A 1RFYA 4J9ZB 2FTKA 3OFNG 3Q4HB 4MS2A 1BE3H 1Y4MA 4CS2A 3H1JH 3SPJA 1NH2B 1IBMB 4I5SA 1IBKO 3E2EA 1Q5OA 2PYJA 1NR7A 2M7WA 1ZSPA 4I4TB 4OGQB 1Q3EA 2OWOA 2A06H 3FX7A 4JI5B 4A5UB 4B3TB 4FFBA 5TISZ 1L0LH 4RQEA 1P4RA 3JD2A 4X1YA 1K97A 1OCZC 5HFLA 3KG2A 2BTQA 1AJNA 2ZM6B 4NXNB 1GMGA 2W0XA 3T1HB 4AQYB 3M8AA 3K9SA 4IHJA 1IVSA 2FMLA 4G28B 4ICGA 2G38A 1M56C 2PY5A 1TUBA 3CCSV 2Q73A 3TETA 4DV2B 1LUWA 4JI2B 3B8NA 2Z5UA 4RAIA 2Y69C 1SS3A 4QJFB 1D5NA 3LSUA 4PJ0Z 5B66Z 2Q6AA 1Q6IA 4I9QA 2QKSA 2XAHA 4NYKA 3AG4C 5KA5A 3W7SA 3RYHB 5JVDB 3ZHQA 5CA1A 2JS5A 4LF9O 2YIDA 4YJ2B 1MZFA 4FLXA 4TQDA 3W7UA 3LSQA 3IC7A 2B1IA 3VQWA 3KCXA 3MHHC 3S3XA 4XDJA 3ETDA 1EFRG 1FXHA 4MTOA 4R7CA 1XNRO 1NT2B 1QHTA 1J5EO 1HP8A 3FYEB 1QU7A 2OCHA 3E22A 5DEDA 3N2GA 3I5DA 3VQVA 1HNWO 1MA1A 3HKBA 1YIJV 1Z2GA 2KG7B 1PNKA 1ZTEA 1DGSA 1TA8A 1NBMG 4K0KB 1W2BU 2VWKA 1QR8A 5L3FA 3CSXA 4JI4O 4U7NA 3D3QA 5HFMA 2ZQMA 1N0NA 3WG7B 1NKDA 2CAZC 4JTCB 2X6BA 2A3QA 4GCZA 4FM1A 2PF4E 3I55V 4JI3O 5BY1A 1IBLB 2PI5A 3SYPA 1M90W 1GRJA 2QM7A 1B3QA 3I56V 3RYCB 4O4LB 1RSOB 4K8ZA 1JFFA 3QVNA 3ABUA 1ZL8A 4DV3O 3F7YC 4DR3O 2LGWA 3B4SA 3C3SA 5ITZB 3ABKB 1ZUQA 3BABA 3ETEA 3DC5A 1V54B 4XBFA 2ZE7A 2BSKB 2WA4A 4MTGA 1GN6A 3ETQA 4DV1O 4E4EA 2VRZA 1E79G 3AEIA 4B3SB 4IIJB 3MAQA 2UXNA 1EZVH 5D5QA 3FKSG 1B04A 1S72V 4X1YB 3WG7C 3CRAA 1P7BA 1QQCA 1CPYA 1MOFA 5CA0A 3VOUA 5KMGA 1SQFA 4RQFA 3AG2C 4R8CA 4DUYB 2GSMB 4GKKO 4I0XB 3DSQA 5KUKA 1XMQB 2YICA 1FOUA 1PD3A 1BHAA 2HJFC 2DQ0A 4DV7B 2N05A 3MHSC 3OGCC 5KLVH 2CGNA 4UV8A 4MVOA 2RMKB 4Z2WA 2ZXWC 1E1RG 1QLEC 3R65A 1FFTB 3L70H 1GM8A 1V54C 3ZMVA 1V9PA 1JMKC 2F95B 4UXNA 1QR9A 2WLNA 2CGOA 2DYRB 4LCUC 3J81N 2B9ZA 2Q4PA 5EC1C 1NS1A 3E83A 4LF8O 3TXSA 4JAAA 2A7WA 2PTMA 1Y74A 4I55A 1K34A 1GK9A 3SJAC 4K8XA 3D36C 5L3BA 1AI6A 1PPJH 4TV8A 1MMMA 3P3NA 1P84F 4FLWA 1A32A 2HLDG 4LNUA 1DK1A 4KHPO 3T4ZA 4FLUA 1URFA 2F4VO 3CCEV 3HB3B 1M56B 4DR1B 2XHBA 3B77A 1DF4A 3HKEA 3WFVA 2Y69B 1I7FA 1DLBA 2Y4UA 2E3CA 3ZRWA 1Q82W 4JI7B 3L74H 4B08A 5LHIA 4X66O 4J80A 2X6CA 3OR7C 3ZHRA 2EIMB 3H9VA 2FL4A 1KP2A 3RVYA 4IIJA 4JGSA 1WLEA 2HG5C 3F5WC 4FMTA 1K73W 1PL0A 3RGBA 4FJCC 4ZHQB 4I50B 2ITDC 4XDKA 1RPRA 2LP7A 4MVSA 4JPRA 2F43G 4TSFG 5B1BB 4J7ZA 5JQGA 5GONA 2VQFB 4PELA 4D6TH 5LA6B 3JAWB 3JAKB 5KUMA 4X8AA 2UXCB 2YSUB 5EC2C 3KDRA 3K08A 2F1MA 4JYCA 1PNLA 2YEVB 4MTFA 3STLC 1R3JC 1G8MA 1M4UA 2ZNJA 4ZI7A 2ZKOA 4H0LB 2ITCC 2Q67A 1XREA 1L8DA 2Z0AA 5EK0A 3CMAV 5H2FZ 2BCCH 1VARA 1ZLZA 3A0HZ 2UUCB 4JTDB 5LMUB 3KZIZ 2GDSA 2Y4TA 2IJKA 5B3SB 1VQ4V 4N21A 3ABMC 3OEHG 1GN3A 4JI1B 2ADQB 1JJOA 4F4LA 1QVFU 2Q8VA 2WLKA 3F7VC 1PL4A 1GM9A 5LGNA 1HNWB 1K5QA 3LDDA 3GVMA 4J42A 5EIBD 3ZHUA 2F66C 3K04A 1AILA 2IU3A 2CTWA 4RO2A 1XQ8A 3OAAG 1WP7A 4UCTA 1KB9F 2HHHB 2AHYA 2JGUA 3U10A 1DTOA 1FYJA 2QEXV 3CC2V 1KU9A 1HNXB 2QTOA 2IJIA 2P6JA 3DXRA 4X1KA 1P49A 2JVDA 2AZ2A 3BHPA 4PA4A 2N74A 4GZRB 4JI6O 2LW7A 5L3DA 1YCIA 5FL7G 3CXCU 1H2NA 1K8AW 3CMEV 1BMFG 3SYAA 4X65O 3QF7A 5EIBC 1NVPB 1W0KG 4LF4B 1I0HA 1N4CA 3CRQA 5KHHA 3E8FA 2CTPA 2HHHO 1I5XA 3ZBHA 4TUYB 1AI4A 3T1HO 3TGUH 2CE4A 3JD0A 3K0GA 2IU0A 2DW4A 3CCQV 1QVGU 1VF6C 4Z1VA 1KC8W 1WB7A 5LYJA 2JGDA 4QNHB 2V7QG 5LXTB 2QWPB 4WFAV 5KHGA 1XI1A 3G71V 1YZBA 2UUAB 4UCOA 2XUMA 1X4TA 5JH7B 2QKCA 1PV0A 1SQXH 3RBZA 4DRXB 4DR2O 3SJBC 5EBWC 3CEIA 3ZIAG 5JQGB 3BVOA 3H1IH 2VWJA 1SC5B 4UFZA 1H8HG 4F6RA 1IXBA 3K5OA 2W6JG 4JAUA 1FFXA 1K7DA 1MNGA 3CRRA 1XUQA 3SPGA 5LP6C 1ZX3A 2NLJC 1F4NA 4U3FH 3SPCA 3JD1A 3E8GA 4PD4F 3RT3C 4W4LA 5LP6A 3U11A 2JEUA 3C90A 5KX5B 4B3TO 2ZD9A 1M93A 4PHZA 3RYIA 2DE0X 1HW7A 3HPLC 4WFFA 5J9PC 3X2QB 2MW2B 2P06A 3E8HA 3CE2A 1Z5VA 3THOA 4GX0A 4WFGA 2M6YA 2OCCC 5E79Z 2R70A 3Q4HA 5IJ0A 4FLZA 4HBNA 4JI7O 1CEZA 4B3MO 4ZBMA 1THZA 2ZNIA 3OW2U 4DV5B 4U7OA 4YJ3A 1N34B 4PV1B 4DR6B 3LSSA 4UCRA 1NTZH 1Y74B 4I55B 4EFBA 4UVCA 2C2AA 2LO1A 2E75B 2JJ1G 1O9HA 1FXKA 2ZR3A 4KL1A 3VQYA 4FM2A 3K9AA 1XMOO 4EFEA 4PDRA 3CB2A 4AI8A 1AR5A 2UU9O 3UO2A 1O9GA 5B3SC 1FFXB 1JFFB 1RSOA 3ABMB 3CPWU 2HJDA 4R50A 2AGAA 4KFMA 1GO3F 5CA1B 2UXCO 4YHHB 1QLEB 1QNMA 1YJNV 2WLIB 2V4DA 2L35A 1FXVA 3CC7V 5KHJA 4TT3G 3JSLA 4B7KA 1IBMO 2JIZG 3P32A 4UB8Z 3K0DA 4I9WA 2R9AA 4JYAO 5FNVA 1RM1C 3VBBA 1SA0A 1OJHA 4WFBV 3CRMA 4ZHQA 4TOIA 3JCZA 3ASNB 3CCVV 4IYHA 2IW5A 4GX5A 4PA6A 1IZ3A 1DF5A 4MW8A 2UUBO 5EZYA 4FK5C 1IBLO 2Q0OC 4TUYA 4DV1B 2NR5A 2EIKC 2H3OA 3ML0A 2HVJC 4CZZA 4B3SO 2WLHA 4O4JA 3IFXA 5CB4B 4O2AA 1N36B 4NVPA 1KQSU 1EN4A 3H01A 3O65A 3A2FA 4DR3B 1IJGA 1NU1H 3ABLB 3RYHA 4K3AA 3NXSA 2BTOA 3CS5A 3DXRB 1U96A 3JATB 1R6KA 3OMNB 1OZ0A 3FB6C 4CH5A 1MG1A 1RM1B 5B5EZ 1YXBA 1TAEA 2CH7A 2HP8A 4DV2O 4JI2O 3JATA 3OT7A 3JD4A 2E5LO 3CC4V 4BAYA 1Q6UA 3CJHA 1M5IA 5CBFA 3ZRSA 1S5JA 3A8TA 3K57A 3SPIA 4NKGB 4O4HA 5IE9A 5IWAO 4CC5A 4QE7A 4MVUA 4JYAB 1BGYH 1FKAO 2XT9A 4FLYA 5IY5B 3LNMB 4X1IA 5EYPA 1XBLA 4D7TA 1BZKA 5C8YB 1RPOA 2EINB 1ROPA 4K0KO 1YJWV 3UT5B 3ZS8C 2RCVA 3T1YO 2EIJB 4DV4B 3KCYA 2X6AA 2BOCC 4FIPC 1NJIW 4X64B 4O2BA 1S76D 1RP3B 3JAMN 3M99B 3RN4A 1COWG 3X2QC 3S3WA 2GUZA 4JYYA 4NXMB 4DO2A 5LGUA 1AROP 2JRIA 1K33A 3UKMA 2P5OA 4JTAB 1NR1A 3N2KA 3K5MA 5LOVA 1B6QA 2XNDG 3E35A 2OIGA 5L3CA 4YY3B 4EB6B 4H37A 4IL6Z 4ZI7B 2CK3G 1KKCA 3WB0A 2EX3A 3K79A 4PI0A 1VQOV 1Y67A 1HNXO 1F23A 1FXKC 2ZINA 4LF7O 4UCSA 3OEEG 4LBEC 1HDJA 5K1PA 5KAIZ 1XMQO 1SKVA 4P9OA 1YTFD 3U0ZA 3ZMZA 3JAWA 2EZPA 5LA6A 2UXBB 3DGEA 1D2DA 2W6IG 3OTFA 4LFCB 3W7WA 1R1BA 2Q9LA 4L8JA 1EM1A 3UM7A 3AK2A 2R9RB 1VIBA 1JX9A 4MVMA 1YJ9V 1VQ6V 3ASNC 4UV9A 1YVWA 2AW9A 5B1AB 2E76B 2W0FC 1F51A 3ZMTA 4MW3A 3RW0A 4B7EA 4LF4O 4DR4O 1I08A 4R6ZA 3FFQA 4LWSB 1LUVA 1IXMA 4LH6A 2RJZA 4DR2B 2OTLV 3ZCCA 2ETNA 1AP5A 1K5SA 5J2TB 1N32B 5J2TA 4JI1O 3MDSA 1AJQA 4OXSA 4GT1A 1WA8B 1J5EB 4C7UA 3ABLC 4JI0O 2Q7HA 1TUBB 2A79B 1AR1B 2Q69A 4P2ZA 3STZC 2DQ3A 1UJWB 2RQ6A 3BA9A 3SDLA 4QPKA 3AG7A 1UPGA 3N2GB 4KHPB 2ZDIA 5LOVB 3A0RA 3B8MA 1GN2A 1GKFA 4DR1O 3D36A 2KG7A 4DV3B 4DV0B 3RWRD 5B1AC 2AXTZ 3T1CA 2HR3A 3UQ8A 1N33O 2P4VA 4E2LA 2LFRA 2PYLA 1JCHA 5LL6Y 2ZE6A 2WWWA 4WBNB 3VQXA 4BW9A 4X20A 3M7MX 4UUJC 2QM4A 4J11A 1WPXA 4OX9B 4UB6Z 4WCEV 4WFEA 2XAGA 4TV8B 5H6RA 5JVDA 2EIJC 4BW5A 3AG4B 5FPOA 3ZMUA 3RYFB 1Q86W 3ASOC 3ZN0A 5KX5A 2WLIA 4TWKA 2ATKC 2X7RB 5C93A 5EYPB 2UUCO 2GTAA 1MZEA 2OYQA 4GKJO 1KKDA 1SF9A 1K3EA 4ABMA 4B3RO 5H5NA 3N27A 3T1YB 4DUZB 1N34O 3OUSA 5DECA 1BQZA 1N8RW 1S5LZ 3IJ4A 4YHHO 5IYCO 3GWKC 1SQBH 1AVMA 5ITZA 1TVKA 5DN6G 5KHIA 4PDLA 1BQ0A 4MVQA 1S5HC 4GUNA 2WSSG 3ZHTA 4FM0A 3BAAA 1R3KC 2OCCB 5L3EA 1LR1A 2WLLB 3HR0A 1SQGA 3J80N 4FPPA 3CX5F 2YI8A 4I0XA 3UO3A 2AZ0A 5KAFZ 4LP8A 2JJ2G 4DV4O 2Q5ZA 1XOUA 1H8EG 4AILC 2GUZB 3OTOO 5GTHZ 1VQLV 4NB5A 4B3RB 3BRCA 1HNZB 1GH6A 1H5WA 1Y76A 1Y76B 4LR3A 2VQEO 4PDVA 5CBHA 3B40A 1KBHA 1Q43A 3JSNA 5CMUA 4JI6B 4DR5B 4YY3O 4JASA 1KD1W 2KQXA 5CB4A 4PA7A 3A0BZ 3H1HH 5CBGA 4HNAA 1AJPA 4DR7B 2OIEA 3B09A 1YEWA 4NXMO 2OTJV 1YHQV 1M1KW 2UU9B 1T5EA 3OE7G 2NNUA 2LFSA 4H44B 2Q7GA 2ZDIC 4LH7A 1K92A 3OTOB 4X88A 2UUBB 3LDEA 4NTWA 4YIOA 1SERA 5KHKA 2PZSA 3HKCA 3D8CA 4DR6O 4GKJB 2QR4A 2CTQA 4HYOA 3L73H 4FFBB 1I94B 3JYCA 3C3TA 2QWNB 5FLXN 4HZ3A 4KXRA 3BY6A 1ZL8B 2YXHA 3PN1A 4OPAA 4FFKA 3RYFA 1OV9A 2PGGA 1FJGO 1ZWIC 4LFCO 5LMNB 2EJRA 2Z3YA 5JJEB 2D3OW 2EJ7A 1TUEB 2HEPA 1HWYA 1OHHG 4ZKIA 3JALB 1AP6A 3EHBB 2UXDO 2LW1A 3CXHF 2CDYA 2ZIMA 3W7XA 4EB6A 2WLLA 2ZE5A 3LDCA 4BR6A 2LQTA 4IT5A 1BT8A 1G4YB 2KB1A 3TJTA 2FKXA 3SYCA 2DYRC 3K06A 3H1LH 1VMGA 2B5UA 5KA6A 3ZEDA 4X1IB 3GWOA 3K59A 1JOYA 2QTSA 3CCLV 2ZE8A 2P4KA 1UFIA 1F7YA 4HNAB 1N36O 1XDCA 2EULA 5JWPA 1VQPV 4GKKB 2F93B 3CD6V 1MSWD 4ZIBA 5A9GA 5IYBO 5IYZB 2DYSB 3MD0A 3APOA 2YIBD 3LUTB 3K03A 4X62B 2B1GA 2CTRA 4O2BB 1L1FA 3JAKA 4NR1A 2DN9A 3JALA 3FAVA 3G6EV 1Z5WA 4PI2A 1VF5B 4LFAB 1WA8A 2DJVA 5AG2A 5KMGB 2YS8A 3QNEA 4JYBA 3PJSK 4CH6A 1NQTA 3G67A 4AHCA 4MVRA 4ZOLA 1WJZA 2XAQA 1FXKB 4LWSA 1XHZA 3WB1A 2Y0IA 2EILB 4D7SA 2EIMC 5J2UB 4IYIA 3J7AU 3BA8A 5IJ9A 2F4VB 3KKYA 5GTIZ 1WPBA 2IM9A 3SR2C 1YDXA 3ABKC 4LFBO 3HKEB 5IT9N 3DTUB 2K1EA 3CYOA 1NH2D 2CH7B 3SGIA 2WA3A 2WAMA 3DC6A 1H2MA 1NTKH 1SA0B 3IAYA 1SRYA 3RYCA 3K58A 3ZHSA 5JJJB 2IJHA 2WPDG 2JGDB 3HKDA 2QA4V 4JI8O 2YXLA 2XTAA 4X20B 3JASA 1P7GA 2UUAO 4FLVA 5LP6B 5BMVB 3JARB 3CWBH 3QO7A 1XNRB 2O57A 1H38A 2QE7G 4XDLA 2WLMA 4YIPA 3B2EE 5LHGA 1S77D 5J2UA 4NTXA 2EILC 3ZHVA 1VQMV 1OCOC 3TCUA 1D5AA 1OCRB 4CH4A 3E86A 4QE9A 1YI2V 2GHYA 4RUFA 1OCCC 2K9PA 5BZBA 4O4IB 2DOSA 1WAZA 2ZCEA 2XAJA 4X1KB 1CXZB 1PP9H 1L0NH 2YIAA 2FB5A 5K1XA 1WP8A 2RN9A 3P3PA 4N23A 1BSMA 4J9YB 2BOBC 2DMXA 4J10A 1QLNA 2IH1C 3NR7A 1EBOA 3CCMV 2LGQA 3QG5A 4GX1A 1I5YA 1H2LA 5BR8B 4GLXA 5CA0B 1XEQA 1SZTA 4JZGA 2IBZH 2N04A 1VQ9V 5B1OA 2QJ1A 4DV0O 1GAXA 5JCOA 1S3JA 1N33B 2PI4A 4JI0B 5LXTA 1R6NA 3JCUZ 5FPRA 1VP7A 4B3MB 1J95A 1SQPH 2PUSA 2QM8A 1R3LC 1K4CC 2OT5A 4LF6O 1R3IC 1EN6A 1OCCB 3BCCH 4OX9O 1F4MA 2RNBA 1U97A 3FD9A 5DM6V 1VQNV 1JNBA 2NN4A 3K5NA 3IC9A 2MK3A 2YDEA 4F6RB 3G6BA 3EXAA 4Z1MG 1AB3A 3K5LA 4DV5O 3IGAC 5LMNO 4P9PA 3G4SV 3APQA 4PDMA 1IURA 4O4LA 2L6LA 4DR4B 1BS3A 4JV5B 3FB7C 4DUYO 1M57B 3L75H 4U3JB 3QO8A 2AHZA 3TK1A 3OUFA 3UCSC 4BIZA 4LF9B 1YTFB 2YIBA 1IX9A 1FS0G 1WN7A 1G6UA 2P7TC 2ADPA 1NZ6A 1Q81W 4FZ1A 3WB2A 3BEHA 4TV9A 4AQYO 4JI4B 5L3GA 1X59A 4DUZO 1JPXA 5F2VO 2XASA 1W59A 4UCVA 2ZIOA 2JK5C 1GM7A 4JI5O 3ZN1A 1EN5A 5D5PA 1US6A 4PA9A 4DRXA 4ZOLB 1OCZB 3GB7C 2A0LA 3QTCA 4GYCB 4J41A 5JH7A 3HKDB 4YJ3B 1K4DC 1GN4A 4LF7B 3FB8C 3AG3B 3AK3A 3O9OA 4DR7O 2D2CB 3CCUV 1M57C 1N0JA 4DV6B 1B06A 2YXYA 3G80A 5LYJB 2X0LA 4CH3A 3T4DA 4ASUG 1W0JG 5LHHA 4MTXA 1FD9A 2IH3C 2VQEB 3SPHA 4IHJB 2EINC 4DXWA 4BWAA 1XNQO 3RFRA 4OPHA 3E89A 4O2AB 1IDSA 2Y0PA 3AG1B 4FZ0A 4G27B 1JA8A 1E1QG 3D3IA 4NTYA 4JV5O 4RWUA 3ZRXA 4I7ZB 2WLJA 3CCJV 3ZMSA 4BIOA 3L9DA 3E22B 1FJGB 1PNMA 4JF3A 5IDJA 4JI8B 1AI7A 1SETA 4QIWF 2DWDC 1K9MW 2EZOA 5LGTA 3AG3C 4JI3B 3OMIB 4U3JA 3F5TA 2VQFO 5IYDO 1VQ7V 3ZJZA 3EVKA 1XHXA 4KUMA 2QSAA 3UT5A 4X64O 1V55C 2V1DA 3SYOA 3OD4A 4GX2A 5IYZA 1VF7A 4LC1A 4W4KA 4X9QA 4J7JA 1N32O 4X89A 3L72H 2DYSC 1HNZO 3P30A 1GTOA 1VQKV 4FLTA 4G2KA 5A2QN 4I50A 1G1XB 3W7TA 3CP1A 2ARHA 2EIKB 1OCOB 5GW7A 2RDCA 1OCRC 1JQ0A 4QPJA 4NXNO 3N2KB 3FB5C 1S0VA 2H94A 2LJ2A 1EZJA 1I94O 3E8BA 4RUEA 1NTMH 2QWQB 4CS4A 4TQFA 3SJCC 2GV9A 5IJ0B 4HAMA 4Q6GA 5H6QA 1YF2A 2QKAA 5B1NA 1AI5A 3WU2Z 1V55B 4IGGA 4WBNA 4QGPA 3CHXA 1HR0B 1PKXA 2R9IA 1JJ2U 3CRCA 1MSDA 1BHBA 2Q7EA 1SQQH 1ORQC 1M9NA 2BSKA 2JS3A 4YXWG 4WFHA 1VEWA 2R72A 3FYIB 5EZYB 2YI9A 2ZT9B 1VQ5V 2XAFA 5EBMC 1QCEA 2EBOA 1VF6A 1TGOA 2JDIG 4JAVA 1R6TA 1KYOF 2QWOB 4P30A 4O4JB 1KP3A 5IY5C 2UXBO 4UVBA 2GBOA 4MT8A 1Q90D 4UVAA 2A9HA 4O4HB 2E5LB 1NI8A 2QWRB 3CJHB 3ZX6A 3RVZA 3JARA 4BIUA 3L71H 1R73A 2QDOA 4LFAO 3JASB 3H1KH 2FYUH 3AK1A 2YEVA 1FAFA 4UCUA 4Q20A 2H8PC 2ODMA 5JCOC 2HKOA 1KMIZ 4DR5O 4MVZA 3FAVB 2IJJA 1BCCH 1NVPD 2ILMA 2HFEC 1XILA 5B1BC 4X62O 2F23A 4DYLA 2XOKG 2KKWA 2HVKC 1Y66A 1Q8IA 3OM3B 4J7KA 4H13B 5EBLC 3CCRV 3EFFK 1SZXA 3BPZA 4JZ2A 4DK1A 4F6EA 5IJ9B 3ZRVA 5LMUO 1XL4A 5BR8O 3R66A 5CN0A 1QBZA 3ZRWB 4L87A 4LF5O 4FVMA 1AR4A 4DW0A 2BE3A 3JD3A 4MSWC 5BMVA 4X66B 3ICXA 3K3WA 2P90A 1IBKB 3AG1C 3OMAB 4DW1A 3ASOB 4KP4A 1H2GA 1WB8A 1ENVA 3OR6C 4CS3A 1Y6XA 4DV6O 2YC0A 5CA3A 4CBCA 2VS0A 2E74B 5GONB 5FNVB 1HR0O 1KECA 4DV7O 1MABG 2CUGA 4LF6B 5E1AC 2ZM6O 4LFBB 3QO5A 4X65B 2GTSA 5LBQA 2P67A 3TXQA 1FPOA 4K35A 1Q6HA 4LF5B 4H33A 1LNQA 1H2SB 1JR9A 1WNSA 2YUAA 5C8YA 4LNUB 3ABTA 5IWAB 4O4IA 1PM9A 2UXDB 2UXXA 1TVKB 1YITV 3OGIB 4EEQA 1H2KA 2BTQB 3RYIB 1VQ8V 3HKBB 3LNNA 1CP9A 2DWEC 1XNQB 1XL6A 5JJNB 1Q7YW 2KSDA 2P22C 3BFRA 4LF8B 3HKCB 1SESA 3SYQA
chains in the Genus database with same CATH topology
1EN5A 3AK1A 4FFKA 1I08A 1LUVA 1GN4A 3KKYA 3RN4A 3AK3A 1XILA 4JYYA 1N0JA 1AP5A 1AVMA 1AP6A 1B06A 1EN4A 1EN6A 3MDSA 4GUNA 3DC6A 2CDYA 1MA1A 1I0HA 4C7UA 1SZXA 4JZ2A 4F6EA 4BR6A 1ZTEA 3KDRA 1BT8A 3IC9A 3TJTA 2CE4A 1ZSPA 1P7GA 2QKAA 1AR4A 1N0NA 1IDSA 2P4KA 1WB7A 1XDCA 1JA8A 1KKCA 1Y67A 3OT7A 1GN2A 1XREA 5A9GA 1AR5A 1MSDA 4YIPA 1VARA 1WB8A 1ZLZA 3QVNA 3K9SA 1BS3A 2QKCA 2GDSA 1MMMA 1VEWA 1GN3A 3CEIA 3C3SA 2ADQB 1QNMA 1ZUQA 1LUWA 1IX9A 3DC5A 1PL4A 2ADPA 1IXBA 1JR9A 5AG2A 1D5NA 3LSUA 1EM1A 3AK2A 1PM9A 4YIOA 1MNGA 1BSMA 1GN6A 3EVKA 4E4EA 2RCVA 1XUQA 4X9QA 2AW9A 3BFRA 4JZGA 3C3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN5 A;  3AK1 A;  4FFK A;  1I08 A;  1LUV A;  1GN4 A;  3KKY A;  3RN4 A;  3AK3 A;  1XIL A;  4JYY A;  1N0J A;  1AP5 A;  1AVM A;  1AP6 A;  1B06 A;  1EN4 A;  1EN6 A;  3MDS A;  4GUN A;  3DC6 A;  2CDY A;  1MA1 A;  1I0H A;  4C7U A;  1SZX A;  4JZ2 A;  4F6E A;  4BR6 A;  1ZTE A;  1BT8 A;  3IC9 A;  3TJT A;  2CE4 A;  1ZSP A;  1P7G A;  2QKA A;  1AR4 A;  1N0N A;  1IDS A;  2P4K A;  1WB7 A;  1XDC A;  1JA8 A;  1KKC A;  1Y67 A;  3OT7 A;  1GN2 A;  1XRE A;  5A9G A;  1AR5 A;  1MSD A;  4YIP A;  1VAR A;  1WB8 A;  1ZLZ A;  3QVN A;  3K9S A;  1BS3 A;  2QKC A;  2GDS A;  1MMM A;  1VEW A;  1GN3 A;  3CEI A;  3C3S A;  2ADQ B;  1QNM A;  1ZUQ A;  1LUW A;  1IX9 A;  3DC5 A;  1PL4 A;  2ADP A;  1IXB A;  1JR9 A;  5AG2 A;  1D5N A;  3LSU A;  1EM1 A;  3AK2 A;  1PM9 A;  4YIO A;  1MNG A;  1BSM A;  1GN6 A;  3EVK A;  4E4E A;  2RCV A;  1XUQ A;  4X9Q A;  2AW9 A;  3BFR A;  4JZG A;  3C3T A; 
#chains in the Genus database with same CATH topology
 1YSC A;  1XMO B;  4I4T A;  5H9C A;  4EKW A;  3ETG A;  1SQV H;  1JVM A;  4TV9 B;  2QGN A;  3SJQ C;  2Q0A A;  2Q68 A;  1BL8 A;  2JEX A;  3AG2 B;  2Y48 A;  4PA3 A;  3T2M A;  1ZAU A;  4CC6 A;  4WF9 V;  2ZR2 A;  5BXZ A;  4DK0 A;  2ZXW B;  1KUQ A;  4YJ2 A;  1RFY A;  4J9Z B;  2FTK A;  3OFN G;  3Q4H B;  4MS2 A;  1BE3 H;  1Y4M A;  4CS2 A;  3H1J H;  3SPJ A;  1NH2 B;  1IBM B;  4I5S A;  1IBK O;  3E2E A;  1Q5O A;  2PYJ A;  1NR7 A;  2M7W A;  1ZSP A;  4I4T B;  4OGQ B;  1Q3E A;  2OWO A;  2A06 H;  3FX7 A;  4JI5 B;  4A5U B;  4B3T B;  4FFB A;  5TIS Z;  1L0L H;  4RQE A;  1P4R A;  3JD2 A;  4X1Y A;  1K97 A;  1OCZ C;  5HFL A;  3KG2 A;  2BTQ A;  1AJN A;  2ZM6 B;  4NXN B;  1GMG A;  2W0X A;  3T1H B;  4AQY B;  3M8A A;  3K9S A;  4IHJ A;  1IVS A;  2FML A;  4G28 B;  4ICG A;  2G38 A;  1M56 C;  2PY5 A;  1TUB A;  3CCS V;  2Q73 A;  3TET A;  4DV2 B;  1LUW A;  4JI2 B;  3B8N A;  2Z5U A;  4RAI A;  2Y69 C;  1SS3 A;  4QJF B;  1D5N A;  3LSU A;  4PJ0 Z;  5B66 Z;  2Q6A A;  1Q6I A;  4I9Q A;  2QKS A;  2XAH A;  4NYK A;  3AG4 C;  5KA5 A;  3W7S A;  3RYH B;  5JVD B;  3ZHQ A;  5CA1 A;  2JS5 A;  4LF9 O;  2YID A;  4YJ2 B;  1MZF A;  4FLX A;  4TQD A;  3W7U A;  3LSQ A;  3IC7 A;  2B1I A;  3VQW A;  3KCX A;  3MHH C;  3S3X A;  4XDJ A;  3ETD A;  1EFR G;  1FXH A;  4MTO A;  4R7C A;  1XNR O;  1NT2 B;  1QHT A;  1J5E O;  1HP8 A;  3FYE B;  1QU7 A;  2OCH A;  3E22 A;  5DED A;  3N2G A;  3I5D A;  3VQV A;  1HNW O;  1MA1 A;  3HKB A;  1YIJ V;  1Z2G A;  2KG7 B;  1PNK A;  1ZTE A;  1DGS A;  1TA8 A;  1NBM G;  4K0K B;  1W2B U;  2VWK A;  1QR8 A;  5L3F A;  3CSX A;  4JI4 O;  4U7N A;  3D3Q A;  5HFM A;  2ZQM A;  1N0N A;  3WG7 B;  1NKD A;  2CAZ C;  4JTC B;  2X6B A;  2A3Q A;  4GCZ A;  4FM1 A;  2PF4 E;  3I55 V;  4JI3 O;  5BY1 A;  1IBL B;  2PI5 A;  3SYP A;  1M90 W;  1GRJ A;  2QM7 A;  1B3Q A;  3I56 V;  3RYC B;  4O4L B;  1RSO B;  4K8Z A;  1JFF A;  3QVN A;  3ABU A;  1ZL8 A;  4DV3 O;  3F7Y C;  4DR3 O;  2LGW A;  3B4S A;  3C3S A;  5ITZ B;  3ABK B;  1ZUQ A;  3BAB A;  3ETE A;  3DC5 A;  1V54 B;  4XBF A;  2ZE7 A;  2BSK B;  2WA4 A;  4MTG A;  1GN6 A;  3ETQ A;  4DV1 O;  4E4E A;  2VRZ A;  1E79 G;  3AEI A;  4B3S B;  4IIJ B;  3MAQ A;  2UXN A;  1EZV H;  5D5Q A;  3FKS G;  1B04 A;  1S72 V;  4X1Y B;  3WG7 C;  3CRA A;  1P7B A;  1QQC A;  1CPY A;  1MOF A;  5CA0 A;  3VOU A;  5KMG A;  1SQF A;  4RQF A;  3AG2 C;  4R8C A;  4DUY B;  2GSM B;  4GKK O;  4I0X B;  3DSQ A;  5KUK A;  1XMQ B;  2YIC A;  1FOU A;  1PD3 A;  1BHA A;  2HJF C;  2DQ0 A;  4DV7 B;  2N05 A;  3MHS C;  3OGC C;  5KLV H;  2CGN A;  4UV8 A;  4MVO A;  2RMK B;  4Z2W A;  2ZXW C;  1E1R G;  1QLE C;  3R65 A;  1FFT B;  3L70 H;  1GM8 A;  1V54 C;  3ZMV A;  1V9P A;  1JMK C;  2F95 B;  4UXN A;  1QR9 A;  2WLN A;  2CGO A;  2DYR B;  4LCU C;  3J81 N;  2B9Z A;  2Q4P A;  5EC1 C;  1NS1 A;  3E83 A;  4LF8 O;  3TXS A;  4JAA A;  2A7W A;  2PTM A;  1Y74 A;  4I55 A;  1K34 A;  1GK9 A;  3SJA C;  4K8X A;  3D36 C;  5L3B A;  1AI6 A;  1PPJ H;  4TV8 A;  1MMM A;  3P3N A;  1P84 F;  4FLW A;  1A32 A;  2HLD G;  4LNU A;  1DK1 A;  4KHP O;  3T4Z A;  4FLU A;  1URF A;  2F4V O;  3CCE V;  3HB3 B;  1M56 B;  4DR1 B;  2XHB A;  3B77 A;  1DF4 A;  3HKE A;  3WFV A;  2Y69 B;  1I7F A;  1DLB A;  2Y4U A;  2E3C A;  3ZRW A;  1Q82 W;  4JI7 B;  3L74 H;  4B08 A;  5LHI A;  4X66 O;  4J80 A;  2X6C A;  3OR7 C;  3ZHR A;  2EIM B;  3H9V A;  2FL4 A;  1KP2 A;  3RVY A;  4IIJ A;  4JGS A;  1WLE A;  2HG5 C;  3F5W C;  4FMT A;  1K73 W;  1PL0 A;  3RGB A;  4FJC C;  4ZHQ B;  4I50 B;  2ITD C;  4XDK A;  1RPR A;  2LP7 A;  4MVS A;  4JPR A;  2F43 G;  4TSF G;  5B1B B;  4J7Z A;  5JQG A;  5GON A;  2VQF B;  4PEL A;  4D6T H;  5LA6 B;  3JAW B;  3JAK B;  5KUM A;  4X8A A;  2UXC B;  2YSU B;  5EC2 C;  3KDR A;  3K08 A;  2F1M A;  4JYC A;  1PNL A;  2YEV B;  4MTF A;  3STL C;  1R3J C;  1G8M A;  1M4U A;  2ZNJ A;  4ZI7 A;  2ZKO A;  4H0L B;  2ITC C;  2Q67 A;  1XRE A;  1L8D A;  2Z0A A;  5EK0 A;  3CMA V;  5H2F Z;  2BCC H;  1VAR A;  1ZLZ A;  3A0H Z;  2UUC B;  4JTD B;  5LMU B;  3KZI Z;  2GDS A;  2Y4T A;  2IJK A;  5B3S B;  1VQ4 V;  4N21 A;  3ABM C;  3OEH G;  1GN3 A;  4JI1 B;  2ADQ B;  1JJO A;  4F4L A;  1QVF U;  2Q8V A;  2WLK A;  3F7V C;  1PL4 A;  1GM9 A;  5LGN A;  1HNW B;  1K5Q A;  3LDD A;  3GVM A;  4J42 A;  5EIB D;  3ZHU A;  2F66 C;  3K04 A;  1AIL A;  2IU3 A;  2CTW A;  4RO2 A;  1XQ8 A;  3OAA G;  1WP7 A;  4UCT A;  1KB9 F;  2HHH B;  2AHY A;  2JGU A;  3U10 A;  1DTO A;  1FYJ A;  2QEX V;  3CC2 V;  1KU9 A;  1HNX B;  2QTO A;  2IJI A;  2P6J A;  3DXR A;  4X1K A;  1P49 A;  2JVD A;  2AZ2 A;  3BHP A;  4PA4 A;  2N74 A;  4GZR B;  4JI6 O;  2LW7 A;  5L3D A;  1YCI A;  5FL7 G;  3CXC U;  1H2N A;  1K8A W;  3CME V;  1BMF G;  3SYA A;  4X65 O;  3QF7 A;  5EIB C;  1NVP B;  1W0K G;  4LF4 B;  1I0H A;  1N4C A;  3CRQ A;  5KHH A;  3E8F A;  2CTP A;  2HHH O;  1I5X A;  3ZBH A;  4TUY B;  1AI4 A;  3T1H O;  3TGU H;  2CE4 A;  3JD0 A;  3K0G A;  2IU0 A;  2DW4 A;  3CCQ V;  1QVG U;  1VF6 C;  4Z1V A;  1KC8 W;  1WB7 A;  5LYJ A;  2JGD A;  4QNH B;  2V7Q G;  5LXT B;  2QWP B;  4WFA V;  5KHG A;  1XI1 A;  3G71 V;  1YZB A;  2UUA B;  4UCO A;  2XUM A;  1X4T A;  5JH7 B;  2QKC A;  1PV0 A;  1SQX H;  3RBZ A;  4DRX B;  4DR2 O;  3SJB C;  5EBW C;  3CEI A;  3ZIA G;  5JQG B;  3BVO A;  3H1I H;  2VWJ A;  1SC5 B;  4UFZ A;  1H8H G;  4F6R A;  1IXB A;  3K5O A;  2W6J G;  4JAU A;  1FFX A;  1K7D A;  1MNG A;  3CRR A;  1XUQ A;  3SPG A;  5LP6 C;  1ZX3 A;  2NLJ C;  1F4N A;  4U3F H;  3SPC A;  3JD1 A;  3E8G A;  4PD4 F;  3RT3 C;  4W4L A;  5LP6 A;  3U11 A;  2JEU A;  3C90 A;  5KX5 B;  4B3T O;  2ZD9 A;  1M93 A;  4PHZ A;  3RYI A;  2DE0 X;  1HW7 A;  3HPL C;  4WFF A;  5J9P C;  3X2Q B;  2MW2 B;  2P06 A;  3E8H A;  3CE2 A;  1Z5V A;  3THO A;  4GX0 A;  4WFG A;  2M6Y A;  2OCC C;  5E79 Z;  2R70 A;  3Q4H A;  5IJ0 A;  4FLZ A;  4HBN A;  4JI7 O;  1CEZ A;  4B3M O;  4ZBM A;  1THZ A;  2ZNI A;  3OW2 U;  4DV5 B;  4U7O A;  4YJ3 A;  1N34 B;  4PV1 B;  4DR6 B;  3LSS A;  4UCR A;  1NTZ H;  1Y74 B;  4I55 B;  4EFB A;  4UVC A;  2C2A A;  2LO1 A;  2E75 B;  2JJ1 G;  1O9H A;  1FXK A;  2ZR3 A;  4KL1 A;  3VQY A;  4FM2 A;  3K9A A;  1XMO O;  4EFE A;  4PDR A;  3CB2 A;  4AI8 A;  1AR5 A;  2UU9 O;  3UO2 A;  1O9G A;  5B3S C;  1FFX B;  1JFF B;  1RSO A;  3ABM B;  3CPW U;  2HJD A;  4R50 A;  2AGA A;  4KFM A;  1GO3 F;  5CA1 B;  2UXC O;  4YHH B;  1QLE B;  1QNM A;  1YJN V;  2WLI B;  2V4D A;  2L35 A;  1FXV A;  3CC7 V;  5KHJ A;  4TT3 G;  3JSL A;  4B7K A;  1IBM O;  2JIZ G;  3P32 A;  4UB8 Z;  3K0D A;  4I9W A;  2R9A A;  4JYA O;  5FNV A;  1RM1 C;  3VBB A;  1SA0 A;  1OJH A;  4WFB V;  3CRM A;  4ZHQ A;  4TOI A;  3JCZ A;  3ASN B;  3CCV V;  4IYH A;  2IW5 A;  4GX5 A;  4PA6 A;  1IZ3 A;  1DF5 A;  4MW8 A;  2UUB O;  5EZY A;  4FK5 C;  1IBL O;  2Q0O C;  4TUY A;  4DV1 B;  2NR5 A;  2EIK C;  2H3O A;  3ML0 A;  2HVJ C;  4CZZ A;  4B3S O;  2WLH A;  4O4J A;  3IFX A;  5CB4 B;  4O2A A;  1N36 B;  4NVP A;  1KQS U;  1EN4 A;  3H01 A;  3O65 A;  3A2F A;  4DR3 B;  1IJG A;  1NU1 H;  3ABL B;  3RYH A;  4K3A A;  3NXS A;  2BTO A;  3CS5 A;  3DXR B;  1U96 A;  3JAT B;  1R6K A;  3OMN B;  1OZ0 A;  3FB6 C;  4CH5 A;  1MG1 A;  1RM1 B;  5B5E Z;  1YXB A;  1TAE A;  2CH7 A;  2HP8 A;  4DV2 O;  4JI2 O;  3JAT A;  3OT7 A;  3JD4 A;  2E5L O;  3CC4 V;  4BAY A;  1Q6U A;  3CJH A;  1M5I A;  5CBF A;  3ZRS A;  1S5J A;  3A8T A;  3K57 A;  3SPI A;  4NKG B;  4O4H A;  5IE9 A;  5IWA O;  4CC5 A;  4QE7 A;  4MVU A;  4JYA B;  1BGY H;  1FKA O;  2XT9 A;  4FLY A;  5IY5 B;  3LNM B;  4X1I A;  5EYP A;  1XBL A;  4D7T A;  1BZK A;  5C8Y B;  1RPO A;  2EIN B;  1ROP A;  4K0K O;  1YJW V;  3UT5 B;  3ZS8 C;  2RCV A;  3T1Y O;  2EIJ B;  4DV4 B;  3KCY A;  2X6A A;  2BOC C;  4FIP C;  1NJI W;  4X64 B;  4O2B A;  1S76 D;  1RP3 B;  3JAM N;  3M99 B;  3RN4 A;  1COW G;  3X2Q C;  3S3W A;  2GUZ A;  4JYY A;  4NXM B;  4DO2 A;  5LGU A;  1ARO P;  2JRI A;  1K33 A;  3UKM A;  2P5O A;  4JTA B;  1NR1 A;  3N2K A;  3K5M A;  5LOV A;  1B6Q A;  2XND G;  3E35 A;  2OIG A;  5L3C A;  4YY3 B;  4EB6 B;  4H37 A;  4IL6 Z;  4ZI7 B;  2CK3 G;  1KKC A;  3WB0 A;  2EX3 A;  3K79 A;  4PI0 A;  1VQO V;  1Y67 A;  1HNX O;  1F23 A;  1FXK C;  2ZIN A;  4LF7 O;  4UCS A;  3OEE G;  4LBE C;  1HDJ A;  5K1P A;  5KAI Z;  1XMQ O;  1SKV A;  4P9O A;  1YTF D;  3U0Z A;  3ZMZ A;  3JAW A;  2EZP A;  5LA6 A;  2UXB B;  3DGE A;  1D2D A;  2W6I G;  3OTF A;  4LFC B;  3W7W A;  1R1B A;  2Q9L A;  4L8J A;  1EM1 A;  3UM7 A;  3AK2 A;  2R9R B;  1VIB A;  1JX9 A;  4MVM A;  1YJ9 V;  1VQ6 V;  3ASN C;  4UV9 A;  1YVW A;  2AW9 A;  5B1A B;  2E76 B;  2W0F C;  1F51 A;  3ZMT A;  4MW3 A;  3RW0 A;  4B7E A;  4LF4 O;  4DR4 O;  1I08 A;  4R6Z A;  3FFQ A;  4LWS B;  1LUV A;  1IXM A;  4LH6 A;  2RJZ A;  4DR2 B;  2OTL V;  3ZCC A;  2ETN A;  1AP5 A;  1K5S A;  5J2T B;  1N32 B;  5J2T A;  4JI1 O;  3MDS A;  1AJQ A;  4OXS A;  4GT1 A;  1WA8 B;  1J5E B;  4C7U A;  3ABL C;  4JI0 O;  2Q7H A;  1TUB B;  2A79 B;  1AR1 B;  2Q69 A;  4P2Z A;  3STZ C;  2DQ3 A;  1UJW B;  2RQ6 A;  3BA9 A;  3SDL A;  4QPK A;  3AG7 A;  1UPG A;  3N2G B;  4KHP B;  2ZDI A;  5LOV B;  3A0R A;  3B8M A;  1GN2 A;  1GKF A;  4DR1 O;  3D36 A;  2KG7 A;  4DV3 B;  4DV0 B;  3RWR D;  5B1A C;  2AXT Z;  3T1C A;  2HR3 A;  3UQ8 A;  1N33 O;  2P4V A;  4E2L A;  2LFR A;  2PYL A;  1JCH A;  5LL6 Y;  2ZE6 A;  2WWW A;  4WBN B;  3VQX A;  4BW9 A;  4X20 A;  3M7M X;  4UUJ C;  2QM4 A;  4J11 A;  1WPX A;  4OX9 B;  4UB6 Z;  4WCE V;  4WFE A;  2XAG A;  4TV8 B;  5H6R A;  5JVD A;  2EIJ C;  4BW5 A;  3AG4 B;  5FPO A;  3ZMU A;  3RYF B;  1Q86 W;  3ASO C;  3ZN0 A;  5KX5 A;  2WLI A;  4TWK A;  2ATK C;  2X7R B;  5C93 A;  5EYP B;  2UUC O;  2GTA A;  1MZE A;  2OYQ A;  4GKJ O;  1KKD A;  1SF9 A;  1K3E A;  4ABM A;  4B3R O;  5H5N A;  3N27 A;  3T1Y B;  4DUZ B;  1N34 O;  3OUS A;  5DEC A;  1BQZ A;  1N8R W;  1S5L Z;  3IJ4 A;  4YHH O;  5IYC O;  3GWK C;  1SQB H;  1AVM A;  5ITZ A;  1TVK A;  5DN6 G;  5KHI A;  4PDL A;  1BQ0 A;  4MVQ A;  1S5H C;  4GUN A;  2WSS G;  3ZHT A;  4FM0 A;  3BAA A;  1R3K C;  2OCC B;  5L3E A;  1LR1 A;  2WLL B;  3HR0 A;  1SQG A;  3J80 N;  4FPP A;  3CX5 F;  2YI8 A;  4I0X A;  3UO3 A;  2AZ0 A;  5KAF Z;  4LP8 A;  2JJ2 G;  4DV4 O;  2Q5Z A;  1XOU A;  1H8E G;  4AIL C;  2GUZ B;  3OTO O;  5GTH Z;  1VQL V;  4NB5 A;  4B3R B;  3BRC A;  1HNZ B;  1GH6 A;  1H5W A;  1Y76 A;  1Y76 B;  4LR3 A;  2VQE O;  4PDV A;  5CBH A;  3B40 A;  1KBH A;  1Q43 A;  3JSN A;  5CMU A;  4JI6 B;  4DR5 B;  4YY3 O;  4JAS A;  1KD1 W;  2KQX A;  5CB4 A;  4PA7 A;  3A0B Z;  3H1H H;  5CBG A;  4HNA A;  1AJP A;  4DR7 B;  2OIE A;  3B09 A;  1YEW A;  4NXM O;  2OTJ V;  1YHQ V;  1M1K W;  2UU9 B;  1T5E A;  3OE7 G;  2NNU A;  2LFS A;  4H44 B;  2Q7G A;  2ZDI C;  4LH7 A;  1K92 A;  3OTO B;  4X88 A;  2UUB B;  3LDE A;  4NTW A;  4YIO A;  1SER A;  5KHK A;  2PZS A;  3HKC A;  3D8C A;  4DR6 O;  4GKJ B;  2QR4 A;  2CTQ A;  4HYO A;  3L73 H;  4FFB B;  1I94 B;  3JYC A;  3C3T A;  2QWN B;  5FLX N;  4HZ3 A;  4KXR A;  3BY6 A;  1ZL8 B;  2YXH A;  3PN1 A;  4OPA A;  4FFK A;  3RYF A;  1OV9 A;  2PGG A;  1FJG O;  1ZWI C;  4LFC O;  5LMN B;  2EJR A;  2Z3Y A;  5JJE B;  2D3O W;  2EJ7 A;  1TUE B;  2HEP A;  1HWY A;  1OHH G;  4ZKI A;  3JAL B;  1AP6 A;  3EHB B;  2UXD O;  2LW1 A;  3CXH F;  2CDY A;  2ZIM A;  3W7X A;  4EB6 A;  2WLL A;  2ZE5 A;  3LDC A;  4BR6 A;  2LQT A;  4IT5 A;  1BT8 A;  1G4Y B;  2KB1 A;  3TJT A;  2FKX A;  3SYC A;  2DYR C;  3K06 A;  3H1L H;  1VMG A;  2B5U A;  5KA6 A;  3ZED A;  4X1I B;  3GWO A;  3K59 A;  1JOY A;  2QTS A;  3CCL V;  2ZE8 A;  2P4K A;  1UFI A;  1F7Y A;  4HNA B;  1N36 O;  1XDC A;  2EUL A;  5JWP A;  1VQP V;  4GKK B;  2F93 B;  3CD6 V;  1MSW D;  4ZIB A;  5A9G A;  5IYB O;  5IYZ B;  2DYS B;  3MD0 A;  3APO A;  2YIB D;  3LUT B;  3K03 A;  4X62 B;  2B1G A;  2CTR A;  4O2B B;  1L1F A;  3JAK A;  4NR1 A;  2DN9 A;  3JAL A;  3FAV A;  3G6E V;  1Z5W A;  4PI2 A;  1VF5 B;  4LFA B;  1WA8 A;  2DJV A;  5AG2 A;  5KMG B;  2YS8 A;  3QNE A;  4JYB A;  3PJS K;  4CH6 A;  1NQT A;  3G67 A;  4AHC A;  4MVR A;  4ZOL A;  1WJZ A;  2XAQ A;  1FXK B;  4LWS A;  1XHZ A;  3WB1 A;  2Y0I A;  2EIL B;  4D7S A;  2EIM C;  5J2U B;  4IYI A;  3J7A U;  3BA8 A;  5IJ9 A;  2F4V B;  3KKY A;  5GTI Z;  1WPB A;  2IM9 A;  3SR2 C;  1YDX A;  3ABK C;  4LFB O;  3HKE B;  5IT9 N;  3DTU B;  2K1E A;  3CYO A;  1NH2 D;  2CH7 B;  3SGI A;  2WA3 A;  2WAM A;  3DC6 A;  1H2M A;  1NTK H;  1SA0 B;  3IAY A;  1SRY A;  3RYC A;  3K58 A;  3ZHS A;  5JJJ B;  2IJH A;  2WPD G;  2JGD B;  3HKD A;  2QA4 V;  4JI8 O;  2YXL A;  2XTA A;  4X20 B;  3JAS A;  1P7G A;  2UUA O;  4FLV A;  5LP6 B;  5BMV B;  3JAR B;  3CWB H;  3QO7 A;  1XNR B;  2O57 A;  1H38 A;  2QE7 G;  4XDL A;  2WLM A;  4YIP A;  3B2E E;  5LHG A;  1S77 D;  5J2U A;  4NTX A;  2EIL C;  3ZHV A;  1VQM V;  1OCO C;  3TCU A;  1D5A A;  1OCR B;  4CH4 A;  3E86 A;  4QE9 A;  1YI2 V;  2GHY A;  4RUF A;  1OCC C;  2K9P A;  5BZB A;  4O4I B;  2DOS A;  1WAZ A;  2ZCE A;  2XAJ A;  4X1K B;  1CXZ B;  1PP9 H;  1L0N H;  2YIA A;  2FB5 A;  5K1X A;  1WP8 A;  2RN9 A;  3P3P A;  4N23 A;  1BSM A;  4J9Y B;  2BOB C;  2DMX A;  4J10 A;  1QLN A;  2IH1 C;  3NR7 A;  1EBO A;  3CCM V;  2LGQ A;  3QG5 A;  4GX1 A;  1I5Y A;  1H2L A;  5BR8 B;  4GLX A;  5CA0 B;  1XEQ A;  1SZT A;  4JZG A;  2IBZ H;  2N04 A;  1VQ9 V;  5B1O A;  2QJ1 A;  4DV0 O;  1GAX A;  5JCO A;  1S3J A;  1N33 B;  2PI4 A;  4JI0 B;  5LXT A;  1R6N A;  3JCU Z;  5FPR A;  1VP7 A;  4B3M B;  1J95 A;  1SQP H;  2PUS A;  2QM8 A;  1R3L C;  1K4C C;  2OT5 A;  4LF6 O;  1R3I C;  1EN6 A;  1OCC B;  3BCC H;  4OX9 O;  1F4M A;  2RNB A;  1U97 A;  3FD9 A;  5DM6 V;  1VQN V;  1JNB A;  2NN4 A;  3K5N A;  3IC9 A;  2MK3 A;  2YDE A;  4F6R B;  3G6B A;  3EXA A;  4Z1M G;  1AB3 A;  3K5L A;  4DV5 O;  3IGA C;  5LMN O;  4P9P A;  3G4S V;  3APQ A;  4PDM A;  1IUR A;  4O4L A;  2L6L A;  4DR4 B;  1BS3 A;  4JV5 B;  3FB7 C;  4DUY O;  1M57 B;  3L75 H;  4U3J B;  3QO8 A;  2AHZ A;  3TK1 A;  3OUF A;  3UCS C;  4BIZ A;  4LF9 B;  1YTF B;  2YIB A;  1IX9 A;  1FS0 G;  1WN7 A;  1G6U A;  2P7T C;  2ADP A;  1NZ6 A;  1Q81 W;  4FZ1 A;  3WB2 A;  3BEH A;  4TV9 A;  4AQY O;  4JI4 B;  5L3G A;  1X59 A;  4DUZ O;  1JPX A;  5F2V O;  2XAS A;  1W59 A;  4UCV A;  2ZIO A;  2JK5 C;  1GM7 A;  4JI5 O;  3ZN1 A;  1EN5 A;  5D5P A;  1US6 A;  4PA9 A;  4DRX A;  4ZOL B;  1OCZ B;  3GB7 C;  2A0L A;  3QTC A;  4GYC B;  4J41 A;  5JH7 A;  3HKD B;  4YJ3 B;  1K4D C;  1GN4 A;  4LF7 B;  3FB8 C;  3AG3 B;  3AK3 A;  3O9O A;  4DR7 O;  2D2C B;  3CCU V;  1M57 C;  1N0J A;  4DV6 B;  1B06 A;  2YXY A;  3G80 A;  5LYJ B;  2X0L A;  4CH3 A;  3T4D A;  4ASU G;  1W0J G;  5LHH A;  4MTX A;  1FD9 A;  2IH3 C;  2VQE B;  3SPH A;  4IHJ B;  2EIN C;  4DXW A;  4BWA A;  1XNQ O;  3RFR A;  4OPH A;  3E89 A;  4O2A B;  1IDS A;  2Y0P A;  3AG1 B;  4FZ0 A;  4G27 B;  1JA8 A;  1E1Q G;  3D3I A;  4NTY A;  4JV5 O;  4RWU A;  3ZRX A;  4I7Z B;  2WLJ A;  3CCJ V;  3ZMS A;  4BIO A;  3L9D A;  3E22 B;  1FJG B;  1PNM A;  4JF3 A;  5IDJ A;  4JI8 B;  1AI7 A;  1SET A;  4QIW F;  2DWD C;  1K9M W;  2EZO A;  5LGT A;  3AG3 C;  4JI3 B;  3OMI B;  4U3J A;  3F5T A;  2VQF O;  5IYD O;  1VQ7 V;  3ZJZ A;  3EVK A;  1XHX A;  4KUM A;  2QSA A;  3UT5 A;  4X64 O;  1V55 C;  2V1D A;  3SYO A;  3OD4 A;  4GX2 A;  5IYZ A;  1VF7 A;  4LC1 A;  4W4K A;  4X9Q A;  4J7J A;  1N32 O;  4X89 A;  3L72 H;  2DYS C;  1HNZ O;  3P30 A;  1GTO A;  1VQK V;  4FLT A;  4G2K A;  5A2Q N;  4I50 A;  1G1X B;  3W7T A;  3CP1 A;  2ARH A;  2EIK B;  1OCO B;  5GW7 A;  2RDC A;  1OCR C;  1JQ0 A;  4QPJ A;  4NXN O;  3N2K B;  3FB5 C;  1S0V A;  2H94 A;  2LJ2 A;  1EZJ A;  1I94 O;  3E8B A;  4RUE A;  1NTM H;  2QWQ B;  4CS4 A;  4TQF A;  3SJC C;  2GV9 A;  5IJ0 B;  4HAM A;  4Q6G A;  5H6Q A;  1YF2 A;  2QKA A;  5B1N A;  1AI5 A;  3WU2 Z;  1V55 B;  4IGG A;  4WBN A;  4QGP A;  3CHX A;  1HR0 B;  1PKX A;  2R9I A;  1JJ2 U;  3CRC A;  1MSD A;  1BHB A;  2Q7E A;  1SQQ H;  1ORQ C;  1M9N A;  2BSK A;  2JS3 A;  4YXW G;  4WFH A;  1VEW A;  2R72 A;  3FYI B;  5EZY B;  2YI9 A;  2ZT9 B;  1VQ5 V;  2XAF A;  5EBM C;  1QCE A;  2EBO A;  1VF6 A;  1TGO A;  2JDI G;  4JAV A;  1R6T A;  1KYO F;  2QWO B;  4P30 A;  4O4J B;  1KP3 A;  5IY5 C;  2UXB O;  4UVB A;  2GBO A;  4MT8 A;  1Q90 D;  4UVA A;  2A9H A;  4O4H B;  2E5L B;  1NI8 A;  2QWR B;  3CJH B;  3ZX6 A;  3RVZ A;  3JAR A;  4BIU A;  3L71 H;  1R73 A;  2QDO A;  4LFA O;  3JAS B;  3H1K H;  2FYU H;  3AK1 A;  2YEV A;  1FAF A;  4UCU A;  4Q20 A;  2H8P C;  2ODM A;  5JCO C;  2HKO A;  1KMI Z;  4DR5 O;  4MVZ A;  3FAV B;  2IJJ A;  1BCC H;  1NVP D;  2ILM A;  2HFE C;  1XIL A;  5B1B C;  4X62 O;  2F23 A;  4DYL A;  2XOK G;  2KKW A;  2HVK C;  1Y66 A;  1Q8I A;  3OM3 B;  4J7K A;  4H13 B;  5EBL C;  3CCR V;  3EFF K;  1SZX A;  3BPZ A;  4JZ2 A;  4DK1 A;  4F6E A;  5IJ9 B;  3ZRV A;  5LMU O;  1XL4 A;  5BR8 O;  3R66 A;  5CN0 A;  1QBZ A;  3ZRW B;  4L87 A;  4LF5 O;  4FVM A;  1AR4 A;  4DW0 A;  2BE3 A;  3JD3 A;  4MSW C;  5BMV A;  4X66 B;  3ICX A;  3K3W A;  2P90 A;  1IBK B;  3AG1 C;  3OMA B;  4DW1 A;  3ASO B;  4KP4 A;  1H2G A;  1WB8 A;  1ENV A;  3OR6 C;  4CS3 A;  1Y6X A;  4DV6 O;  2YC0 A;  5CA3 A;  4CBC A;  2VS0 A;  2E74 B;  5GON B;  5FNV B;  1HR0 O;  1KEC A;  4DV7 O;  1MAB G;  2CUG A;  4LF6 B;  5E1A C;  2ZM6 O;  4LFB B;  3QO5 A;  4X65 B;  2GTS A;  5LBQ A;  2P67 A;  3TXQ A;  1FPO A;  4K35 A;  1Q6H A;  4LF5 B;  4H33 A;  1LNQ A;  1H2S B;  1JR9 A;  1WNS A;  2YUA A;  5C8Y A;  4LNU B;  3ABT A;  5IWA B;  4O4I A;  1PM9 A;  2UXD B;  2UXX A;  1TVK B;  1YIT V;  3OGI B;  4EEQ A;  1H2K A;  2BTQ B;  3RYI B;  1VQ8 V;  3HKB B;  3LNN A;  1CP9 A;  2DWE C;  1XNQ B;  1XL6 A;  5JJN B;  1Q7Y W;  2KSD A;  2P22 C;  3BFR A;  4LF8 B;  3HKC B;  1SES A;  3SYQ A; 
#chains in the Genus database with same CATH homology
 1EN5 A;  3AK1 A;  4FFK A;  1I08 A;  1LUV A;  1GN4 A;  3KKY A;  3RN4 A;  3AK3 A;  1XIL A;  4JYY A;  1N0J A;  1AP5 A;  1AVM A;  1AP6 A;  1B06 A;  1EN4 A;  1EN6 A;  3MDS A;  4GUN A;  3DC6 A;  2CDY A;  1MA1 A;  1I0H A;  4C7U A;  1SZX A;  4JZ2 A;  4F6E A;  4BR6 A;  1ZTE A;  3KDR A;  1BT8 A;  3IC9 A;  3TJT A;  2CE4 A;  1ZSP A;  1P7G A;  2QKA A;  1AR4 A;  1N0N A;  1IDS A;  2P4K A;  1WB7 A;  1XDC A;  1JA8 A;  1KKC A;  1Y67 A;  3OT7 A;  1GN2 A;  1XRE A;  5A9G A;  1AR5 A;  1MSD A;  4YIP A;  1VAR A;  1WB8 A;  1ZLZ A;  3QVN A;  3K9S A;  1BS3 A;  2QKC A;  2GDS A;  1MMM A;  1VEW A;  1GN3 A;  3CEI A;  3C3S A;  2ADQ B;  1QNM A;  1ZUQ A;  1LUW A;  1IX9 A;  3DC5 A;  1PL4 A;  2ADP A;  1IXB A;  1JR9 A;  5AG2 A;  1D5N A;  3LSU A;  1EM1 A;  3AK2 A;  1PM9 A;  4YIO A;  1MNG A;  1BSM A;  1GN6 A;  3EVK A;  4E4E A;  2RCV A;  1XUQ A;  4X9Q A;  2AW9 A;  3BFR A;  4JZG A;  3C3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...