1B06A

Superoxide dismutase from sulfolobus acidocaldarius
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
208
structure length
208
Chain Sequence
VIQLKRYEFPQLPYKVDALEPYISKDIIDVHYNGHHKGYVNGANSLLDRLEKLIKGDLPQGQYDLQGILRGLTFNINGHKLHAIYWNNMAPAGKGGGKPGGALADLIDKQYGSFDRFKQVFSESANSLPGSGWTVLYYDNESGNLQIMTVENHFMNHIAELPVILIVDEFEHAYYLQYKNKRGDYLNAWWNVVNWDDAEKRLQKYLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of a superoxide dismutase from the hyperthermophilic archaeon Sulfolobus acidocaldarius at 2.2 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (SUPEROXIDE DISMUTASE)
total genus 74
structure length 208
sequence length 208
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1b06A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1b06A02
1MMMA 1MA1A 4FFKA 5AG2A 1N0JA 4C7UA 3CEIA 1AR5A 1SZXA 1N0NA 1XDCA 1GN4A 2RCVA 1QNMA 1EN6A 3BFRA 1LUWA 1I0HA 1B06A 1WB8A 1EN5A 3AK2A 1JA8A 1VEWA 4YIOA 3QVNA 2ADPA 3DC6A 5A9GA 1XILA 1IDSA 1BS3A 1AP6A 3AK1A 4F6EA 1EM1A 1XREA 2GDSA 3K9SA 1BSMA 3MDSA 3LSUA 3DC5A 1IXBA 3IC9A 2ADQB 3AK3A 4JYYA 3C3TA 1Y67A 1AP5A 1GN6A 4GUNA 2AW9A 4JZGA 3KKYA 1PM9A 3OT7A 3RN4A 1EN4A 4YIPA 4E4EA 1PL4A 2P4KA 3TJTA 3C3SA 4BR6A 1KKCA 2QKAA 1LUVA 1VARA 3EVKA 1XUQA 1ZTEA 1GN2A 2CDYA 1AR4A 1ZUQA 1GN3A 1BT8A 1I08A 1ZSPA 1JR9A 1AVMA 4JZ2A 1MSDA 1IX9A 2CE4A 1P7GA 2QKCA 1MNGA 1ZLZA 1D5NA 1WB7A 4X9QA
chains in the Genus database with same CATH superfamily
1MMMA 3B2EE 4HNAB 3UQ8A 1G8MA 4C7UA 1JNBA 2EX3A 3CB2A 2WAMA 5LYJA 1S3JA 3ASOB 1DF5A 1JJOA 4I50A 1NQTA 1I5XA 5H6QA 5D5PA 2WLLB 3OUSA 1QU7A 5JWPA 3RYHA 2Y69B 3FX7A 3WU2Z 1H2MA 4J7KA 4U3FH 5LMUB 4IYHA 4YIOA 1JCHA 1IBKB 3FD9A 4QE7A 1Q90D 1OCZC 3SPGA 3T1HB 1QLEC 1BSMA 3JATB 1H8EG 2YEVB 4JYYA 3T4ZA 4X1IB 2ITCC 1Y74A 3P3PA 1MG1A 1EZVH 3A8TA 2E3CA 5JJNB 3BEHA 2CUGA 1Z5VA 4JYBA 3ZRSA 1SETA 3N2KB 3CRRA 4DV1O 4K8XA 1EZJA 4ZI7A 4NVPA 3OMNB 5KHJA 4BR6A 1VQ6V 3RVZA 4FVMA 4Z1VA 4B08A 1BCCH 2Q6AA 4BIOA 3ZHQA 1K4CC 3OEEG 4IYIA 1AI4A 1PNKA 2HHHO 4TV9A 4DR1O 5B1BB 1ZSPA 4IL6Z 2BOCC 3JYCA 3I56V 3HKDB 4OXSA 2OIEA 5LGTA 4UCOA 4PA3A 3BA9A 1XL6A 1NI8A 1VQ5V 4NKGB 4B3TO 4Z2WA 3F5TA 2EILC 1IBLB 4XDKA 4OPHA 3IFXA 2JK5C 2JGUA 4HYOA 4U3JB 4DK1A 3ZMVA 4AQYB 4FLXA 4DV4B 5KAIZ 5CA3A 2H3OA 3G67A 1FJGB 1X59A 4LF4B 2OWOA 3CCVV 3N27A 5LXTB 4O4LB 3B4SA 1K73W 1XMOB 1U97A 2KQXA 4GLXA 2HKOA 2K9PA 3QO5A 3A0RA 2WLKA 3JALB 4F4LA 3MHSC 2PGGA 2DN9A 4IT5A 4WCEV 3K5NA 3SPJA 1XMQO 5KHIA 3BABA 2LW7A 1SKVA 2ZE5A 3T1YB 4LF6B 4XBFA 1RPOA 3L73H 3U0ZA 4L8JA 4MVOA 1SERA 1O9GA 2CTRA 1NVPD 5GTIZ 1OZ0A 2F95B 4JI6O 4MT8A 3AG1B 1G6UA 4O4JB 4JI2O 3ABMC 2C2AA 4X64O 3QG5A 3TXQA 1V54B 4DV3O 4KHPB 1AJNA 1BZKA 2YC0A 5JCOA 3STZC 1XUQA 1ZTEA 3K57A 5CB4B 2XOKG 4FLYA 3AG7A 2VQEB 2YSUB 2K1EA 1IX9A 3HPLC 2VS0A 1JFFA 1ZLZA 4PA7A 3WFVA 3TXSA 2P7TC 5JQGA 4K0KO 3L74H 2E5LB 1YXBA 3X2QC 3DSQA 5GW7A 3ABUA 4QNHB 4EB6A 2L6LA 1BHAA 3SPIA 1YJWV 3SDLA 3K59A 1Q86W 3CEIA 2WSSG 5ITZB 4PJ0Z 1Z5WA 3JD2A 5KHGA 4AQYO 1YJ9V 3CRMA 2YIBA 1NU1H 3RFRA 2Q67A 4UCVA 3LDCA 3ZJZA 3SYAA 2QM7A 4QPJA 1FXKC 4J7JA 1VQPV 4JI0O 1PPJH 1N33B 1VQLV 4CS4A 3OM3B 3JARB 1SQVH 3AK1A 2UXDO 4F6EA 1EM1A 3SPHA 2QWOB 1CPYA 5B1AB 3L9DA 1IXBA 2EINB 1NR1A 4WFAV 1HW7A 5B66Z 4LP8A 3N2GA 4JZGA 4O2BA 2A06H 2Q68A 2AGAA 1EN4A 2E5LO 1OCRC 3LDEA 2XAJA 4IGGA 1NTKH 4QE9A 5FNVA 4DV7B 5EBLC 3BRCA 4GT1A 1OCCC 1WN7A 3C3SA 3E89A 5KHHA 3HKEB 2ZE6A 1HNWO 5IY5C 4LF5B 3L71H 3FB6C 2IJJA 1M1KW 3KG2A 1EBOA 1TUBB 3T4DA 2XT9A 1DGSA 1F4MA 1QVFU 1D5NA 1CXZB 5B3SB 1IXMA 2OT5A 4MTXA 4NTXA 2GTSA 1QQCA 1K8AW 2EIMB 4BIUA 2EIKB 5KLVH 1KUQA 4H33A 1P49A 4HBNA 3P30A 1QLNA 1SRYA 2OIGA 1ZAUA 1HP8A 1RSOB 1AB3A 2YS8A 3STLC 5IJ0B 3ASNB 1ROPA 2D2CB 3BCCH 1M93A 4QIWF 1R6KA 3W7WA 2P90A 3HKBB 4CH3A 4AILC 2IU0A 3BAAA 3K9SA 1MZFA 5KUMA 3RYCB 3LSUA 1X4TA 4JAVA 2QJ1A 4PDLA 3LNNA 2XAFA 3C3TA 2QEXV 4DUYB 2V4DA 4TT3G 4QPKA 2YDEA 1KD1W 3F5WC 3HKEA 4JV5B 2N74A 1BQZA 3M7MX 3ZN1A 1OV9A 4LF9B 2RQ6A 1JX9A 1Q43A 1PM9A 4DV5O 5IDJA 2UXDB 1I5YA 4E4EA 1VQ9V 4UXNA 3ZMZA 2P22C 1UFIA 3TJTA 4DW1A 3AG2B 4FMTA 4GKKB 2UUBB 2QKAA 2Z0AA 4LNUB 4FPPA 5IWAB 5D5QA 1BL8A 2ZDIA 3O9OA 2FL4A 2HEPA 3EVKA 5BMVA 3PN1A 5KMGA 2PY5A 4B7EA 3U10A 3SYOA 4BW9A 3HR0A 1QVGU 3FB7C 1KC8W 2XHBA 3QNEA 2IH1C 2JGDB 4DK0A 4ZIBA 2AHYA 3JCZA 1B04A 1N34B 4WF9V 1TGOA 1XNRO 1VMGA 1XOUA 1M5IA 4F6RB 4PELA 4YXWG 1K9MW 1YIJV 2EBOA 1SF9A 4BIZA 4RWUA 2RDCA 1SQFA 2MK3A 4DV2B 1G4YB 5IE9A 4OGQB 3CRAA 4UUJC 5LP6C 5GTHZ 4UV8A 3JAWB 1YCIA 4UVCA 2EILB 2QM8A 2W6JG 4TUYB 1S0VA 1PKXA 4GX2A 1TAEA 3T1YO 1IVSA 1R3IC 5ITZA 3CCSV 1FXHA 1AJPA 4Q6GA 2GDSA 3UO2A 2EJ7A 1YF2A 3MDSA 1IBKO 1AI6A 2R9IA 5LMNO 1J5EB 1XBLA 4GKJO 1EFRG 2RMKB 2YIAA 4O4IB 4TSFG 2Y0PA 4TWKA 2DE0X 2RNBA 1VQ8V 5FL7G 1W0JG 4P2ZA 2F23A 1H38A 2A79B 1FAFA 1KKCA 3H1LH 2ZD9A 5IYBO 3H1IH 3WG7C 5HFLA 1AR4A 3ZHSA 4FLUA 2Q0OC 2E75B 3ABTA 4BW5A 2GTAA 3MHHC 2A0LA 4JPRA 4JZ2A 4GX1A 4NXNO 4KUMA 5CA1B 2YI8A 4J9YB 3KDRA 3H1KH 2P4VA 1YSCA 3DGEA 5J2UA 1QR9A 2ODMA 1NS1A 3B77A 3RYIA 1VF7A 1TUEB 5IYDO 2F93B 4DRXA 4ZOLA 2X6BA 3OEHG 2XUMA 1W0KG 4ZHQB 4DR6O 4UCTA 2FTKA 2M7WA 1SA0B 3R66A 5KMGB 5KAFZ 1YTFD 2L35A 1XDCA 1GN4A 2EJRA 2ZXWC 2A3QA 2Z5UA 1WP8A 3ZRXA 1FKAO 1NTZH 3G80A 4DV1B 3JARA 2WA3A 2QWPB 4X20B 3JAKB 1B06A 4G2KA 3JD3A 2PUSA 4FFBA 4ZBMA 3CMEV 1IJGA 2DW4A 3CCUV 2UU9B 4MVMA 2LFRA 5L3GA 2ADPA 3DC6A 1D5AA 1BS3A 2YI9A 1HNZB 1AP6A 2VQFO 3OD4A 2AHZA 4B3MO 2IW5A 4RQFA 3DC5A 3WB2A 2GHYA 3CCJV 4NB5A 1IBMO 1Y66A 4TOIA 2EULA 1F4NA 1GN6A 2YXLA 2WA4A 5IYCO 1S72V 4OPAA 3LDDA 3VOUA 2IJKA 4G27B 4EFEA 2QDOA 3B8NA 4CS2A 4LFAO 1NZ6A 5H2FZ 5B1AC 3RW0A 1RFYA 1JFFB 3H1HH 2ZDIC 4JTDB 3HB3B 4UVAA 4DXWA 4J9ZB 2VWKA 4XDLA 2CDYA 2OYQA 2E76B 2VQEO 4LH7A 1N34O 2Q7HA 3GWOA 1BT8A 2DQ0A 3D3IA 3UT5A 1HNWB 1K34A 1P7GA 4TUYA 2KB1A 1FFXA 4X62B 1J95A 1WB7A 4X64B 3ZCCA 2OTLV 3K0DA 1L0LH 2DOSA 3BA8A 4X65O 2W0FC 2R72A 4W4LA 4LF7B 2Y4UA 3CXHF 5IY5B 3A2FA 2PI5A 1RM1B 1YEWA 1YDXA 2XAGA 1US6A 4DV7O 1KMIZ 4UB6Z 1E1RG 4GX5A 3J7AU 1WAZA 4I0XB 4RUFA 3ZN0A 2XAQA 2YICA 3LUTB 1NH2B 1HWYA 4JYAO 5EK0A 2R9AA 1LUWA 2JDIG 1K4DC 2JEXA 1R3LC 4P9OA 3FAVB 2Q7EA 4ZHQA 1AROP 4FZ0A 2JGDA 5E79Z 1SA0A 4GYCB 3RBZA 2WLMA 1F7YA 5IJ9B 3BHPA 4QGPA 2UXXA 3OR6C 4DRXB 3BY6A 4CH5A 2AZ0A 3U11A 1IBMB 2O57A 1NJIW 5CBHA 3SJAC 2P6JA 3ZHVA 2ADQB 3AK3A 3J81N 3H9VA 2ZIOA 1FYJA 1Y76A 3F7YC 2BTOA 3ASNC 3IJ4A 3W7SA 3I55V 2AW9A 4FIPC 1DK1A 4FK5C 3CC7V 3CC2V 5EZYA 4RQEA 4CC6A 1ZWIC 4ICGA 5FPRA 5KX5B 1LNQA 2RN9A 3ETDA 1L8DA 1H2KA 2P4KA 3GB7C 3G6BA 4MTOA 3ZX6A 4DR1B 2ZNIA 4PA4A 1G1XB 4PV1B 5LOVB 4R7CA 2JIZG 2P67A 2WLIB 4JASA 2KKWA 3G71V 4TV9B 4LFCO 5EC1C 1RSOA 2BTQA 4O4IA 2ILMA 4FJCC 1HNZO 1YVWA 3APOA 3C90A 2ETNA 3QTCA 4AHCA 3I5DA 3T2MA 3OTOB 1SQQH 3L72H 3ZEDA 3CJHB 3AG2C 4UCRA 2EIJB 4I55B 1R3JC 2RJZA 4MVSA 3ABLB 2Q4PA 4JI3B 2YIDA 5EZYB 1FJGO 5J2TA 4LR3A 3BPZA 4DV2O 4PDMA 1K92A 4F6RA 1FD9A 5CN0A 1F23A 4FLVA 4H13B 4JI4B 3AG3C 3E8BA 4J10A 4CH4A 2DYSB 3K06A 1PL0A 3B40A 3OAAG 1WB8A 2ZT9B 5LHIA 1NH2D 1OHHG 4JI4O 4CZZA 4DO2A 4JI7O 3E2EA 2YXHA 2GV9A 1OCOB 1R73A 1XILA 4WBNB 3K3WA 1PNLA 4X1YA 1O9HA 1RP3B 1Q5OA 5JVDB 3JASB 2UUCO 4K35A 2WWWA 3N2GB 2IH3C 4I5SA 3K0GA 2QGNA 4WBNA 2Q8VA 1BMFG 2LP7A 1JMKC 1XNRB 1Q3EA 5K1PA 4YIPA 1KB9F 3CCQV 2Q69A 3JD1A 1JOYA 1T5EA 2BOBC 1H2LA 1GKFA 1L1FA 2NR5A 2DJVA 3VBBA 4K8ZA 3ZBHA 3LSSA 4RUEA 2GUZB 4PA6A 4YJ2B 1S77D 5CA0B 2UUAB 1MOFA 2M6YA 3CYOA 5CBFA 2CK3G 3UT5B 2QKCA 1VF6C 4NXMO 2DMXA 3O65A 2Y48A 1AJQA 5DN6G 5BXZA 5J9PC 1MA1A 1XMQB 1XNQB 1YTFB 3ZHTA 3FYIB 4FZ1A 3SYQA 1NR7A 4TQDA 2UUCB 5KA5A 5K1XA 2RCVA 4B3TB 4DR2O 2FMLA 3EHBB 3HKCB 3JCUZ 4CH6A 1KKDA 1K97A 4JF3A 3CRCA 4JI3O 4X88A 2AZ2A 1OCZB 3ASOC 4NXNB 5IT9N 2PF4E 4MVQA 4B3MB 5LGUA 2OCCC 2WPDG 4D7TA 5A9GA 1M4UA 5LHGA 3OMIB 2ZXWB 1VIBA 1MZEA 4DW0A 2X7RB 1FPOA 2MW2B 2ZCEA 2UXCB 2F43G 2YIBD 2LO1A 3VQXA 4DV0B 4IHJB 1VQKV 3T1CA 1V9PA 2LJ2A 3RWRD 1QLEB 1GTOA 1CP9A 1COWG 3OFNG 1S5JA 4PI2A 1LR1A 3NR7A 1KYOF 4LF6O 3G4SV 2D3OW 2Q73A 1M57C 4CS3A 4DV4O 4WFFA 5B5EZ 5FPOA 3K03A 1MABG 1QCEA 5JH7A 3JSLA 1P84F 3OTFA 2HLDG 4O4LA 1H2NA 3OGIB 4EFBA 3JAMN 1VQOV 4JI8B 1Y4MA 2A9HA 4RAIA 1Z2GA 5EYPB 5KA6A 1OJHA 2PZSA 2ATKC 4J42A 1GO3F 4H37A 3CCEV 2PYJA 1KU9A 2CH7B 5E1AC 3K5LA 4JI0B 3MAQA 3RGBA 1A32A 4NYKA 3ETEA 1VF6A 4L87A 3L70H 1SQPH 3ZRWA 4FFKA 3CWBH 5LP6A 4D7SA 4JTAB 3SJCC 2KG7B 4DR3O 1YITV 4GCZA 3D36A 3IGAC 1CEZA 1HNXB 4UFZA 1Q7YW 2Y0IA 3CCMV 4NTWA 5H9CA 1HNXO 4I55A 1PNMA 1VEWA 4N21A 3THOA 5LHHA 1SC5B 3HKDA 4JI1O 3RVYA 2HVKC 3TGUH 2QTSA 4U7OA 1K7DA 5EBWC 5KX5A 1YJNV 3DXRB 3E86A 3J80N 4ZI7B 4MW3A 1Q82W 4UCUA 2YEVA 1WJZA 4X89A 4X65B 4D6TH 1V54C 2UXCO 4O4HA 4JI5O 4GZRB 3GWKC 3RN4A 4DUYO 4DYLA 4DR7B 5EBMC 5TISZ 4DUZB 2IJHA 2GUZA 2XASA 3QO8A 2CTQA 2B1GA 3AG1C 3ABMB 1SESA 1KP3A 1GN3A 4DUZO 3K04A 5BMVB 4YY3B 1TVKB 3SJBC 1F51A 3OUFA 2DWEC 5LL6Y 1M56C 4N23A 4X66O 4X20A 2VWJA 3RYHB 2JS5A 1N36B 1IBLO 1W59A 2JEUA 4WFHA 4DR2B 1B6QA 1WLEA 3CCRV 5LA6B 1TA8A 4LF8O 1XMOO 1L0NH 2UXBO 2CTWA 4I0XA 4LNUA 3ICXA 1NKDA 1YHQV 4Z1MG 4K3AA 1M9NA 3IAYA 4LWSB 1JJ2U 4TV8B 4YHHB 2VRZA 1FXKB 4LBEC 4FM1A 2EZPA 2QWNB 3WB1A 4U3JA 4A5UB 4IHJA 2EIJC 4HAMA 3ABKC 4DR3B 3CXCU 2LFSA 3H01A 3FFQA 3RYFA 2F4VB 4UB8Z 4JI1B 5JJEB 1P4RA 4GKKO 1V55C 3LNMB 5L3FA 2ZQMA 3FB8C 4JAUA 3RT3C 3D36C 4PDRA 2HJFC 3CJHA 4O4HB 3OW2U 1GM8A 2YXYA 4MVZA 1GK9A 2BCCH 4WFGA 4E2LA 4JYAB 2DYSC 3K08A 5DECA 1Q6IA 3HKCA 1OCRB 5C8YA 1JVMA 5GONB 1W2BU 4UV9A 3OE7G 3D3QA 1GMGA 3NXSA 1OCCB 3OGCC 1OCOC 2QTOA 4UVBA 4B3SO 2EINC 3SYCA 4EKWA 4DR5O 2LGWA 4ASUG 3KCXA 3EFFK 3VQYA 4QJFB 4X1IA 3JATA 1VQ7V 2DYRB 3AG4C 5LGNA 1K3EA 3A0BZ 5CA0A 2Q9LA 1FFTB 1RPRA 4O4JA 3JAWA 1GAXA 1SZTA 2AXTZ 4YJ2A 5DEDA 1GH6A 3CHXA 4FFBB 3CSXA 4X9QA 1TUBA 1QHTA 2P5OA 4MVUA 5BY1A 4NR1A 1NT2B 2V7QG 2JVDA 5AG2A 2R70A 3KCYA 3W7XA 4LFCB 2HG5C 4ABMA 4LWSA 2B1IA 2HHHB 2CGOA 1KQSU 3FB5C 3ZRVA 3RYIB 4WFBV 3JALA 1K5QA 4B3RB 3UM7A 3OR7C 2GBOA 3OTOO 4KFMA 5CBGA 3SR2C 2ARHA 1I0HA 1ENVA 2ZNJA 2IM9A 2EIKC 1VP7A 5LYJB 5HFMA 4ZOLB 1HDJA 5JH7B 5LA6A 1ZL8A 2QSAA 1S5LZ 3EXAA 2N05A 3QVNA 2ZR2A 4HNAA 5J2UB 3W7UA 3G6EV 2CAZC 3CE2A 5DM6V 4OX9O 1S5HC 1XREA 5LMNB 1J5EO 1HR0B 2Q7GA 1N8RW 5JCOC 2OTJV 4JI2B 4JYCA 1N4CA 2NN4A 1R3KC 2OCCB 3OT7A 4DR4O 3DXRA 1Q6UA 2HR3A 3W7TA 2IU3A 2KSDA 2JRIA 4LFBO 5JQGB 5C8YB 3Q4HB 1BHBA 1WPBA 3ZHUA 2Q5ZA 4JI6B 4K0KB 1PP9H 4J11A 1M57B 4FM0A 4I9QA 1E1QG 3P32A 3ZHRA 4R50A 3N2KA 3RYFB 4KHPO 5LP6B 2IBZH 4DV0O 1HR0O 2FKXA 2KG7A 1N0NA 1R6NA 1P7BA 3VQVA 1EN6A 2XAHA 2Y4TA 2N04A 4YJ3B 4WFEA 5FNVB 1XEQA 4H0LB 4GKJB 1R1BA 5F2VO 5LMUO 3CPWU 5IJ9A 5JVDA 2E74B 4B3RO 2ZM6B 1VQNV 2NNUA 2UU9O 1WPXA 4I9WA 1XI1A 2DWDC 4X62O 3E8GA 3TETA 4FLWA 4XDJA 4O2BB 1YZBA 1NBMG 1NTMH 3CRQA 3B8MA 2QA4V 3S3XA 4BWAA 1AI7A 4O2AB 3WG7B 3CC4V 3SPCA 3CMAV 5C93A 5CA1A 1ZX3A 2JS3A 4MW8A 2BSKB 1DF4A 3E22A 1XQ8A 3RYCA 2LGQA 3QO7A 5BR8B 2F66C 4I4TB 1SQBH 3HKBA 1JQ0A 1Y6XA 2B5UA 2FB5A 3K5MA 1MSDA 3APQA 2QM4A 2A7WA 2YUAA 1MNGA 5B1OA 4LF8B 4LF7O 1KP2A 2Y69C 3ZS8C 4ZKIA 4CBCA 4DR5B 1B3QA 3JD0A 2IJIA 2ZE8A 1N0JA 2H94A 2WLIA 5LOVA 1WA8A 4X1KA 2CGNA 4EB6B 4RO2A 5KHKA 4U7NA 5H6RA 5CB4A 1M56B 1DTOA 3TK1A 2Q0AA 3L75H 5EIBC 3TCUA 1URFA 5EC2C 1D2DA 1EN5A 1Y74B 2ZR3A 4PD4F 1WNSA 3E22B 1K5SA 3K58A 2X6CA 1Y76B 4DR7O 3GVMA 1XL4A 3UKMA 1I94B 4TQFA 1IDSA 3KZIZ 4O2AA 1M90W 1AR1B 5L3EA 2V1DA 2WLLA 3IC9A 3K5OA 3ABKB 4X8AA 3CX5F 2QE7G 5B1NA 1H8HG 3JD4A 4YHHO 4HZ3A 1AILA 3KKYA 3CP1A 1V55B 3AEIA 1VF5B 1BE3H 4PDVA 4DV3B 2QR4A 1ZL8B 5B1BC 3DTUB 3PJSK 4G28B 2LW1A 4J41A 1SQXH 4JAAA 3JSNA 4DV6O 4FLTA 4I50B 5IWAO 4X1YB 2W0XA 3ZIAG 4JI5B 3JASA 3UCSC 2ZINA 1FXVA 2B9ZA 4UCSA 4YY3O 1GM9A 3ML0A 3P3NA 4KL1A 1Q8IA 5L3DA 1AVMA 4LFAB 2CE4A 2WLNA 3ETQA 5CMUA 2LQTA 1S76D 3SYPA 4R6ZA 1SS3A 2F4VO 3E8HA 1H2GA 2UUAO 2ZIMA 3A0HZ 2DYRC 3AG4B 2UUBO 1K33A 5IYZA 5EIBD 4X66B 1GRJA 2HP8A 1QBZA 1XNQO 5IJ0A 1FFXB 4AI8A 5A2QN 1QNMA 2HVJC 4JI8O 4MTFA 2EZOA 1RM1C 3Q4HA 4IIJA 5J2TB 1QR8A 1THZA 3UO3A 4CC5A 2VQFB 2OCHA 1DLBA 2W6IG 1BGYH 1JA8A 1U96A 3M8AA 1I94O 4J80A 4OX9B 5H5NA 3ETGA 2CTPA 3F7VC 1PD3A 4I4TA 3E8FA 3WB0A 1N32B 3ZMUA 3K79A 1VQ4V 5L3BA 4JI7B 3LSQA 4Q20A 4R8CA 2XNDG 1IZ3A 1GM7A 5BZBA 4MS2A 1H5WA 1Y67A 2ZKOA 1AP5A 4DR4B 4NXMB 2DQ3A 2UXBB 3M99B 1Q6HA 1UJWB 1FXKA 4PHZA 2JJ2G 4MSWC 1MSWD 1NVPB 4LF5O 1H2SB 1N36O 1YI2V 3ZRWB 2CH7A 4KP4A 5JJJB 3FYEB 1LUVA 3X2QB 1FOUA 1VARA 1I7FA 2WLHA 3JAKA 1GN2A 4TV8A 1UPGA 4DV5B 3E35A 1ZUQA 1R6TA 3D8CA 2FYUH 1XHXA 3MD0A 1KBHA 5EYPA 4PA9A 2F1MA 2X6AA 1BQ0A 4EEQA 3IC7A 2BE3A 3AG3B 2QKSA 2PI4A 5LXTA 3FAVA 1TVKA 3K9AA 1AR5A 1WP7A 1SZXA 4MVRA 5FLXN 4KXRA 4P30A 4B3SB 3VQWA 4I7ZB 5BR8O 1XHZA 2QWRB 3H1JH 3B09A 4YJ3A 3T1HO 3CCLV 3BVOA 1PV0A 3ABLC 2HFEC 3BFRA 2JJ1G 2HJDA 4NTYA 2UXNA 1ORQC 1IURA 3AK2A 3ZMTA 3CD6V 2Z3YA 3SGIA 1N32O 5KUKA 2ZE7A 2WLJA 4H44B 4JGSA 2ITDC 1WA8B 4X1KB 3FKSG 4LF4O 4JV5O 5LBQA 4PI0A 4J7ZA 4DV6B 1N33O 3S3WA 2ZM6O 2QWQB 4IIJB 2PTMA 4GUNA 1AI5A 2H8PC 2XTAA 3CS5A 1E79G 5GONA 4LH6A 5L3CA 4MTGA 1Q81W 2PYLA 4LC1A 2P06A 2BTQB 4FLZA 1PL4A 4FM2A 2NLJC 3R65A 4DR6B 4W4KA 2GSMB 2R9RB 2BSKA 5B3SC 4GX0A 1SQGA 1JPXA 1KECA 1VQMV 4JTCB 4B7KA 5IYZB 1I08A 1JR9A 2EIMC 4LFBB 3SJQC 4BAYA 2G38A 1FS0G 2X0LA 3E83A 4P9PA 3QF7A 4LCUC 4LF9O 3OMAB 3ZMSA
chains in the Genus database with same CATH topology
1MMMA 1MA1A 4FFKA 5AG2A 1N0JA 4C7UA 3CEIA 1AR5A 1SZXA 1N0NA 1XDCA 1GN4A 2RCVA 1QNMA 1EN6A 3BFRA 1LUWA 1I0HA 1B06A 1WB8A 1EN5A 3AK2A 1JA8A 1VEWA 4YIOA 3QVNA 2ADPA 3DC6A 5A9GA 1XILA 1IDSA 1BS3A 1AP6A 3AK1A 4F6EA 1EM1A 1XREA 2GDSA 3K9SA 1BSMA 3MDSA 3LSUA 3DC5A 1IXBA 3IC9A 2ADQB 3AK3A 4JYYA 3C3TA 1Y67A 1AP5A 1GN6A 4GUNA 2AW9A 4JZGA 3KKYA 1PM9A 3OT7A 3RN4A 1EN4A 4YIPA 4E4EA 1PL4A 2P4KA 3TJTA 3C3SA 4BR6A 1KKCA 2QKAA 1LUVA 1VARA 3EVKA 1XUQA 1ZTEA 1GN2A 2CDYA 1AR4A 1ZUQA 1GN3A 1BT8A 1I08A 1ZSPA 1JR9A 1AVMA 4JZ2A 1MSDA 1IX9A 2CE4A 1P7GA 3KDRA 2QKCA 1MNGA 1ZLZA 1D5NA 1WB7A 4X9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMM A;  1MA1 A;  4FFK A;  5AG2 A;  1N0J A;  4C7U A;  3CEI A;  1AR5 A;  1SZX A;  1N0N A;  1XDC A;  1GN4 A;  2RCV A;  1QNM A;  1EN6 A;  3BFR A;  1LUW A;  1I0H A;  1B06 A;  1WB8 A;  1EN5 A;  3AK2 A;  1JA8 A;  1VEW A;  4YIO A;  3QVN A;  2ADP A;  3DC6 A;  5A9G A;  1XIL A;  1IDS A;  1BS3 A;  1AP6 A;  3AK1 A;  4F6E A;  1EM1 A;  1XRE A;  2GDS A;  3K9S A;  1BSM A;  3MDS A;  3LSU A;  3DC5 A;  1IXB A;  3IC9 A;  2ADQ B;  3AK3 A;  4JYY A;  3C3T A;  1Y67 A;  1AP5 A;  1GN6 A;  4GUN A;  2AW9 A;  4JZG A;  3KKY A;  1PM9 A;  3OT7 A;  3RN4 A;  1EN4 A;  4YIP A;  4E4E A;  1PL4 A;  2P4K A;  3TJT A;  3C3S A;  4BR6 A;  1KKC A;  2QKA A;  1LUV A;  1VAR A;  3EVK A;  1XUQ A;  1ZTE A;  1GN2 A;  2CDY A;  1AR4 A;  1ZUQ A;  1GN3 A;  1BT8 A;  1I08 A;  1ZSP A;  1JR9 A;  1AVM A;  4JZ2 A;  1MSD A;  1IX9 A;  2CE4 A;  1P7G A;  2QKC A;  1MNG A;  1ZLZ A;  1D5N A;  1WB7 A;  4X9Q A; 
#chains in the Genus database with same CATH topology
 1MMM A;  3B2E E;  4HNA B;  3UQ8 A;  1G8M A;  4C7U A;  1JNB A;  2EX3 A;  3CB2 A;  2WAM A;  5LYJ A;  1S3J A;  3ASO B;  1DF5 A;  1JJO A;  4I50 A;  1NQT A;  1I5X A;  5H6Q A;  5D5P A;  2WLL B;  3OUS A;  1QU7 A;  5JWP A;  3RYH A;  2Y69 B;  3FX7 A;  3WU2 Z;  1H2M A;  4J7K A;  4U3F H;  5LMU B;  4IYH A;  4YIO A;  1JCH A;  1IBK B;  3FD9 A;  4QE7 A;  1Q90 D;  1OCZ C;  3SPG A;  3T1H B;  1QLE C;  1BSM A;  3JAT B;  1H8E G;  2YEV B;  4JYY A;  3T4Z A;  4X1I B;  2ITC C;  1Y74 A;  3P3P A;  1MG1 A;  1EZV H;  3A8T A;  2E3C A;  5JJN B;  3BEH A;  2CUG A;  1Z5V A;  4JYB A;  3ZRS A;  1SET A;  3N2K B;  3CRR A;  4DV1 O;  4K8X A;  1EZJ A;  4ZI7 A;  4NVP A;  3OMN B;  5KHJ A;  4BR6 A;  1VQ6 V;  3RVZ A;  4FVM A;  4Z1V A;  4B08 A;  1BCC H;  2Q6A A;  4BIO A;  3ZHQ A;  1K4C C;  3OEE G;  4IYI A;  1AI4 A;  1PNK A;  2HHH O;  4TV9 A;  4DR1 O;  5B1B B;  1ZSP A;  4IL6 Z;  2BOC C;  3JYC A;  3I56 V;  3HKD B;  4OXS A;  2OIE A;  5LGT A;  4UCO A;  4PA3 A;  3BA9 A;  1XL6 A;  1NI8 A;  1VQ5 V;  4NKG B;  4B3T O;  4Z2W A;  3F5T A;  2EIL C;  1IBL B;  4XDK A;  4OPH A;  3IFX A;  2JK5 C;  2JGU A;  4HYO A;  4U3J B;  4DK1 A;  3ZMV A;  4AQY B;  4FLX A;  4DV4 B;  5KAI Z;  5CA3 A;  2H3O A;  3G67 A;  1FJG B;  1X59 A;  4LF4 B;  2OWO A;  3CCV V;  3N27 A;  5LXT B;  4O4L B;  3B4S A;  1K73 W;  1XMO B;  1U97 A;  2KQX A;  4GLX A;  2HKO A;  2K9P A;  3QO5 A;  3A0R A;  2WLK A;  3JAL B;  4F4L A;  3MHS C;  2PGG A;  2DN9 A;  4IT5 A;  4WCE V;  3K5N A;  3SPJ A;  1XMQ O;  5KHI A;  3BAB A;  2LW7 A;  1SKV A;  2ZE5 A;  3T1Y B;  4LF6 B;  4XBF A;  1RPO A;  3L73 H;  3U0Z A;  4L8J A;  4MVO A;  1SER A;  1O9G A;  2CTR A;  1NVP D;  5GTI Z;  1OZ0 A;  2F95 B;  4JI6 O;  4MT8 A;  3AG1 B;  1G6U A;  4O4J B;  4JI2 O;  3ABM C;  2C2A A;  4X64 O;  3QG5 A;  3TXQ A;  1V54 B;  4DV3 O;  4KHP B;  1AJN A;  1BZK A;  2YC0 A;  5JCO A;  3STZ C;  1XUQ A;  1ZTE A;  3K57 A;  5CB4 B;  2XOK G;  4FLY A;  3AG7 A;  2VQE B;  2YSU B;  2K1E A;  1IX9 A;  3HPL C;  2VS0 A;  1JFF A;  1ZLZ A;  4PA7 A;  3WFV A;  3TXS A;  2P7T C;  5JQG A;  4K0K O;  3L74 H;  2E5L B;  1YXB A;  3X2Q C;  3DSQ A;  5GW7 A;  3ABU A;  4QNH B;  4EB6 A;  2L6L A;  1BHA A;  3SPI A;  1YJW V;  3SDL A;  3K59 A;  1Q86 W;  3CEI A;  2WSS G;  5ITZ B;  4PJ0 Z;  1Z5W A;  3JD2 A;  5KHG A;  4AQY O;  1YJ9 V;  3CRM A;  2YIB A;  1NU1 H;  3RFR A;  2Q67 A;  4UCV A;  3LDC A;  3ZJZ A;  3SYA A;  2QM7 A;  4QPJ A;  1FXK C;  4J7J A;  1VQP V;  4JI0 O;  1PPJ H;  1N33 B;  1VQL V;  4CS4 A;  3OM3 B;  3JAR B;  1SQV H;  3AK1 A;  2UXD O;  4F6E A;  1EM1 A;  3SPH A;  2QWO B;  1CPY A;  5B1A B;  3L9D A;  1IXB A;  2EIN B;  1NR1 A;  4WFA V;  1HW7 A;  5B66 Z;  4LP8 A;  3N2G A;  4JZG A;  4O2B A;  2A06 H;  2Q68 A;  2AGA A;  1EN4 A;  2E5L O;  1OCR C;  3LDE A;  2XAJ A;  4IGG A;  1NTK H;  4QE9 A;  5FNV A;  4DV7 B;  5EBL C;  3BRC A;  4GT1 A;  1OCC C;  1WN7 A;  3C3S A;  3E89 A;  5KHH A;  3HKE B;  2ZE6 A;  1HNW O;  5IY5 C;  4LF5 B;  3L71 H;  3FB6 C;  2IJJ A;  1M1K W;  3KG2 A;  1EBO A;  1TUB B;  3T4D A;  2XT9 A;  1DGS A;  1F4M A;  1QVF U;  1D5N A;  1CXZ B;  5B3S B;  1IXM A;  2OT5 A;  4MTX A;  4NTX A;  2GTS A;  1QQC A;  1K8A W;  2EIM B;  4BIU A;  2EIK B;  5KLV H;  1KUQ A;  4H33 A;  1P49 A;  4HBN A;  3P30 A;  1QLN A;  1SRY A;  2OIG A;  1ZAU A;  1HP8 A;  1RSO B;  1AB3 A;  2YS8 A;  3STL C;  5IJ0 B;  3ASN B;  1ROP A;  2D2C B;  3BCC H;  1M93 A;  4QIW F;  1R6K A;  3W7W A;  2P90 A;  3HKB B;  4CH3 A;  4AIL C;  2IU0 A;  3BAA A;  3K9S A;  1MZF A;  5KUM A;  3RYC B;  3LSU A;  1X4T A;  4JAV A;  2QJ1 A;  4PDL A;  3LNN A;  2XAF A;  3C3T A;  2QEX V;  4DUY B;  2V4D A;  4TT3 G;  4QPK A;  2YDE A;  1KD1 W;  3F5W C;  3HKE A;  4JV5 B;  2N74 A;  1BQZ A;  3M7M X;  3ZN1 A;  1OV9 A;  4LF9 B;  2RQ6 A;  1JX9 A;  1Q43 A;  1PM9 A;  4DV5 O;  5IDJ A;  2UXD B;  1I5Y A;  4E4E A;  1VQ9 V;  4UXN A;  3ZMZ A;  2P22 C;  1UFI A;  3TJT A;  4DW1 A;  3AG2 B;  4FMT A;  4GKK B;  2UUB B;  2QKA A;  2Z0A A;  4LNU B;  4FPP A;  5IWA B;  5D5Q A;  1BL8 A;  2ZDI A;  3O9O A;  2FL4 A;  2HEP A;  3EVK A;  5BMV A;  3PN1 A;  5KMG A;  2PY5 A;  4B7E A;  3U10 A;  3SYO A;  4BW9 A;  3HR0 A;  1QVG U;  3FB7 C;  1KC8 W;  2XHB A;  3QNE A;  2IH1 C;  2JGD B;  4DK0 A;  4ZIB A;  2AHY A;  3JCZ A;  1B04 A;  1N34 B;  4WF9 V;  1TGO A;  1XNR O;  1VMG A;  1XOU A;  1M5I A;  4F6R B;  4PEL A;  4YXW G;  1K9M W;  1YIJ V;  2EBO A;  1SF9 A;  4BIZ A;  4RWU A;  2RDC A;  1SQF A;  2MK3 A;  4DV2 B;  1G4Y B;  5IE9 A;  4OGQ B;  3CRA A;  4UUJ C;  5LP6 C;  5GTH Z;  4UV8 A;  3JAW B;  1YCI A;  4UVC A;  2EIL B;  2QM8 A;  2W6J G;  4TUY B;  1S0V A;  1PKX A;  4GX2 A;  1TAE A;  3T1Y O;  1IVS A;  1R3I C;  5ITZ A;  3CCS V;  1FXH A;  1AJP A;  4Q6G A;  2GDS A;  3UO2 A;  2EJ7 A;  1YF2 A;  3MDS A;  1IBK O;  1AI6 A;  2R9I A;  5LMN O;  1J5E B;  1XBL A;  4GKJ O;  1EFR G;  2RMK B;  2YIA A;  4O4I B;  4TSF G;  2Y0P A;  4TWK A;  2DE0 X;  2RNB A;  1VQ8 V;  5FL7 G;  1W0J G;  4P2Z A;  2F23 A;  1H38 A;  2A79 B;  1FAF A;  1KKC A;  3H1L H;  2ZD9 A;  5IYB O;  3H1I H;  3WG7 C;  5HFL A;  1AR4 A;  3ZHS A;  4FLU A;  2Q0O C;  2E75 B;  3ABT A;  4BW5 A;  2GTA A;  3MHH C;  2A0L A;  4JPR A;  4JZ2 A;  4GX1 A;  4NXN O;  4KUM A;  5CA1 B;  2YI8 A;  4J9Y B;  3KDR A;  3H1K H;  2P4V A;  1YSC A;  3DGE A;  5J2U A;  1QR9 A;  2ODM A;  1NS1 A;  3B77 A;  3RYI A;  1VF7 A;  1TUE B;  5IYD O;  2F93 B;  4DRX A;  4ZOL A;  2X6B A;  3OEH G;  2XUM A;  1W0K G;  4ZHQ B;  4DR6 O;  4UCT A;  2FTK A;  2M7W A;  1SA0 B;  3R66 A;  5KMG B;  5KAF Z;  1YTF D;  2L35 A;  1XDC A;  1GN4 A;  2EJR A;  2ZXW C;  2A3Q A;  2Z5U A;  1WP8 A;  3ZRX A;  1FKA O;  1NTZ H;  3G80 A;  4DV1 B;  3JAR A;  2WA3 A;  2QWP B;  4X20 B;  3JAK B;  1B06 A;  4G2K A;  3JD3 A;  2PUS A;  4FFB A;  4ZBM A;  3CME V;  1IJG A;  2DW4 A;  3CCU V;  2UU9 B;  4MVM A;  2LFR A;  5L3G A;  2ADP A;  3DC6 A;  1D5A A;  1BS3 A;  2YI9 A;  1HNZ B;  1AP6 A;  2VQF O;  3OD4 A;  2AHZ A;  4B3M O;  2IW5 A;  4RQF A;  3DC5 A;  3WB2 A;  2GHY A;  3CCJ V;  4NB5 A;  1IBM O;  1Y66 A;  4TOI A;  2EUL A;  1F4N A;  1GN6 A;  2YXL A;  2WA4 A;  5IYC O;  1S72 V;  4OPA A;  3LDD A;  3VOU A;  2IJK A;  4G27 B;  4EFE A;  2QDO A;  3B8N A;  4CS2 A;  4LFA O;  1NZ6 A;  5H2F Z;  5B1A C;  3RW0 A;  1RFY A;  1JFF B;  3H1H H;  2ZDI C;  4JTD B;  3HB3 B;  4UVA A;  4DXW A;  4J9Z B;  2VWK A;  4XDL A;  2CDY A;  2OYQ A;  2E76 B;  2VQE O;  4LH7 A;  1N34 O;  2Q7H A;  3GWO A;  1BT8 A;  2DQ0 A;  3D3I A;  3UT5 A;  1HNW B;  1K34 A;  1P7G A;  4TUY A;  2KB1 A;  1FFX A;  4X62 B;  1J95 A;  1WB7 A;  4X64 B;  3ZCC A;  2OTL V;  3K0D A;  1L0L H;  2DOS A;  3BA8 A;  4X65 O;  2W0F C;  2R72 A;  4W4L A;  4LF7 B;  2Y4U A;  3CXH F;  5IY5 B;  3A2F A;  2PI5 A;  1RM1 B;  1YEW A;  1YDX A;  2XAG A;  1US6 A;  4DV7 O;  1KMI Z;  4UB6 Z;  1E1R G;  4GX5 A;  3J7A U;  1WAZ A;  4I0X B;  4RUF A;  3ZN0 A;  2XAQ A;  2YIC A;  3LUT B;  1NH2 B;  1HWY A;  4JYA O;  5EK0 A;  2R9A A;  1LUW A;  2JDI G;  1K4D C;  2JEX A;  1R3L C;  4P9O A;  3FAV B;  2Q7E A;  4ZHQ A;  1ARO P;  4FZ0 A;  2JGD A;  5E79 Z;  1SA0 A;  4GYC B;  3RBZ A;  2WLM A;  1F7Y A;  5IJ9 B;  3BHP A;  4QGP A;  2UXX A;  3OR6 C;  4DRX B;  3BY6 A;  4CH5 A;  2AZ0 A;  3U11 A;  1IBM B;  2O57 A;  1NJI W;  5CBH A;  3SJA C;  2P6J A;  3ZHV A;  2ADQ B;  3AK3 A;  3J81 N;  3H9V A;  2ZIO A;  1FYJ A;  1Y76 A;  3F7Y C;  2BTO A;  3ASN C;  3IJ4 A;  3W7S A;  3I55 V;  2AW9 A;  4FIP C;  1DK1 A;  4FK5 C;  3CC7 V;  3CC2 V;  5EZY A;  4RQE A;  4CC6 A;  1ZWI C;  4ICG A;  5FPR A;  5KX5 B;  1LNQ A;  2RN9 A;  3ETD A;  1L8D A;  1H2K A;  2P4K A;  3GB7 C;  3G6B A;  4MTO A;  3ZX6 A;  4DR1 B;  2ZNI A;  4PA4 A;  1G1X B;  4PV1 B;  5LOV B;  4R7C A;  2JIZ G;  2P67 A;  2WLI B;  4JAS A;  2KKW A;  3G71 V;  4TV9 B;  4LFC O;  5EC1 C;  1RSO A;  2BTQ A;  4O4I A;  2ILM A;  4FJC C;  1HNZ O;  1YVW A;  3APO A;  3C90 A;  2ETN A;  3QTC A;  4AHC A;  3I5D A;  3T2M A;  3OTO B;  1SQQ H;  3L72 H;  3ZED A;  3CJH B;  3AG2 C;  4UCR A;  2EIJ B;  4I55 B;  1R3J C;  2RJZ A;  4MVS A;  3ABL B;  2Q4P A;  4JI3 B;  2YID A;  5EZY B;  1FJG O;  5J2T A;  4LR3 A;  3BPZ A;  4DV2 O;  4PDM A;  1K92 A;  4F6R A;  1FD9 A;  5CN0 A;  1F23 A;  4FLV A;  4H13 B;  4JI4 B;  3AG3 C;  3E8B A;  4J10 A;  4CH4 A;  2DYS B;  3K06 A;  1PL0 A;  3B40 A;  3OAA G;  1WB8 A;  2ZT9 B;  5LHI A;  1NH2 D;  1OHH G;  4JI4 O;  4CZZ A;  4DO2 A;  4JI7 O;  3E2E A;  2YXH A;  2GV9 A;  1OCO B;  1R73 A;  1XIL A;  4WBN B;  3K3W A;  1PNL A;  4X1Y A;  1O9H A;  1RP3 B;  1Q5O A;  5JVD B;  3JAS B;  2UUC O;  4K35 A;  2WWW A;  3N2G B;  2IH3 C;  4I5S A;  3K0G A;  2QGN A;  4WBN A;  2Q8V A;  1BMF G;  2LP7 A;  1JMK C;  1XNR B;  1Q3E A;  5K1P A;  4YIP A;  1KB9 F;  3CCQ V;  2Q69 A;  3JD1 A;  1JOY A;  1T5E A;  2BOB C;  1H2L A;  1GKF A;  1L1F A;  2NR5 A;  2DJV A;  3VBB A;  4K8Z A;  3ZBH A;  3LSS A;  4RUE A;  2GUZ B;  4PA6 A;  4YJ2 B;  1S77 D;  5CA0 B;  2UUA B;  1MOF A;  2M6Y A;  3CYO A;  5CBF A;  2CK3 G;  3UT5 B;  2QKC A;  1VF6 C;  4NXM O;  2DMX A;  3O65 A;  2Y48 A;  1AJQ A;  5DN6 G;  5BXZ A;  5J9P C;  1MA1 A;  1XMQ B;  1XNQ B;  1YTF B;  3ZHT A;  3FYI B;  4FZ1 A;  3SYQ A;  1NR7 A;  4TQD A;  2UUC B;  5KA5 A;  5K1X A;  2RCV A;  4B3T B;  4DR2 O;  2FML A;  3EHB B;  3HKC B;  3JCU Z;  4CH6 A;  1KKD A;  1K97 A;  4JF3 A;  3CRC A;  4JI3 O;  4X88 A;  2AZ2 A;  1OCZ B;  3ASO C;  4NXN B;  5IT9 N;  2PF4 E;  4MVQ A;  4B3M B;  5LGU A;  2OCC C;  2WPD G;  4D7T A;  5A9G A;  1M4U A;  5LHG A;  3OMI B;  2ZXW B;  1VIB A;  1MZE A;  4DW0 A;  2X7R B;  1FPO A;  2MW2 B;  2ZCE A;  2UXC B;  2F43 G;  2YIB D;  2LO1 A;  3VQX A;  4DV0 B;  4IHJ B;  1VQK V;  3T1C A;  1V9P A;  2LJ2 A;  3RWR D;  1QLE B;  1GTO A;  1CP9 A;  1COW G;  3OFN G;  1S5J A;  4PI2 A;  1LR1 A;  3NR7 A;  1KYO F;  4LF6 O;  3G4S V;  2D3O W;  2Q73 A;  1M57 C;  4CS3 A;  4DV4 O;  4WFF A;  5B5E Z;  5FPO A;  3K03 A;  1MAB G;  1QCE A;  5JH7 A;  3JSL A;  1P84 F;  3OTF A;  2HLD G;  4O4L A;  1H2N A;  3OGI B;  4EFB A;  3JAM N;  1VQO V;  4JI8 B;  1Y4M A;  2A9H A;  4RAI A;  1Z2G A;  5EYP B;  5KA6 A;  1OJH A;  2PZS A;  2ATK C;  4J42 A;  1GO3 F;  4H37 A;  3CCE V;  2PYJ A;  1KU9 A;  2CH7 B;  5E1A C;  3K5L A;  4JI0 B;  3MAQ A;  3RGB A;  1A32 A;  4NYK A;  3ETE A;  1VF6 A;  4L87 A;  3L70 H;  1SQP H;  3ZRW A;  4FFK A;  3CWB H;  5LP6 A;  4D7S A;  4JTA B;  3SJC C;  2KG7 B;  4DR3 O;  1YIT V;  4GCZ A;  3D36 A;  3IGA C;  1CEZ A;  1HNX B;  4UFZ A;  1Q7Y W;  2Y0I A;  3CCM V;  4NTW A;  5H9C A;  1HNX O;  4I55 A;  1PNM A;  1VEW A;  4N21 A;  3THO A;  5LHH A;  1SC5 B;  3HKD A;  4JI1 O;  3RVY A;  2HVK C;  3TGU H;  2QTS A;  4U7O A;  1K7D A;  5EBW C;  5KX5 A;  1YJN V;  3DXR B;  3E86 A;  3J80 N;  4ZI7 B;  4MW3 A;  1Q82 W;  4UCU A;  2YEV A;  1WJZ A;  4X89 A;  4X65 B;  4D6T H;  1V54 C;  2UXC O;  4O4H A;  4JI5 O;  4GZR B;  3GWK C;  3RN4 A;  4DUY O;  4DYL A;  4DR7 B;  5EBM C;  5TIS Z;  4DUZ B;  2IJH A;  2GUZ A;  2XAS A;  3QO8 A;  2CTQ A;  2B1G A;  3AG1 C;  3ABM B;  1SES A;  1KP3 A;  1GN3 A;  4DUZ O;  3K04 A;  5BMV B;  4YY3 B;  1TVK B;  3SJB C;  1F51 A;  3OUF A;  2DWE C;  5LL6 Y;  1M56 C;  4N23 A;  4X66 O;  4X20 A;  2VWJ A;  3RYH B;  2JS5 A;  1N36 B;  1IBL O;  1W59 A;  2JEU A;  4WFH A;  4DR2 B;  1B6Q A;  1WLE A;  3CCR V;  5LA6 B;  1TA8 A;  4LF8 O;  1XMO O;  1L0N H;  2UXB O;  2CTW A;  4I0X A;  4LNU A;  3ICX A;  1NKD A;  1YHQ V;  4Z1M G;  4K3A A;  1M9N A;  3IAY A;  4LWS B;  1JJ2 U;  4TV8 B;  4YHH B;  2VRZ A;  1FXK B;  4LBE C;  4FM1 A;  2EZP A;  2QWN B;  3WB1 A;  4U3J A;  4A5U B;  4IHJ A;  2EIJ C;  4HAM A;  3ABK C;  4DR3 B;  3CXC U;  2LFS A;  3H01 A;  3FFQ A;  3RYF A;  2F4V B;  4UB8 Z;  4JI1 B;  5JJE B;  1P4R A;  4GKK O;  1V55 C;  3LNM B;  5L3F A;  2ZQM A;  3FB8 C;  4JAU A;  3RT3 C;  3D36 C;  4PDR A;  2HJF C;  3CJH A;  4O4H B;  3OW2 U;  1GM8 A;  2YXY A;  4MVZ A;  1GK9 A;  2BCC H;  4WFG A;  4E2L A;  4JYA B;  2DYS C;  3K08 A;  5DEC A;  1Q6I A;  3HKC A;  1OCR B;  5C8Y A;  1JVM A;  5GON B;  1W2B U;  4UV9 A;  3OE7 G;  3D3Q A;  1GMG A;  3NXS A;  1OCC B;  3OGC C;  1OCO C;  2QTO A;  4UVB A;  4B3S O;  2EIN C;  3SYC A;  4EKW A;  4DR5 O;  2LGW A;  4ASU G;  3KCX A;  3EFF K;  3VQY A;  4QJF B;  4X1I A;  3JAT A;  1VQ7 V;  2DYR B;  3AG4 C;  5LGN A;  1K3E A;  3A0B Z;  5CA0 A;  2Q9L A;  1FFT B;  1RPR A;  4O4J A;  3JAW A;  1GAX A;  1SZT A;  2AXT Z;  4YJ2 A;  5DED A;  1GH6 A;  3CHX A;  4FFB B;  3CSX A;  4X9Q A;  1TUB A;  1QHT A;  2P5O A;  4MVU A;  5BY1 A;  4NR1 A;  1NT2 B;  2V7Q G;  2JVD A;  5AG2 A;  2R70 A;  3KCY A;  3W7X A;  4LFC B;  2HG5 C;  4ABM A;  4LWS A;  2B1I A;  2HHH B;  2CGO A;  1KQS U;  3FB5 C;  3ZRV A;  3RYI B;  4WFB V;  3JAL A;  1K5Q A;  4B3R B;  3UM7 A;  3OR7 C;  2GBO A;  3OTO O;  4KFM A;  5CBG A;  3SR2 C;  2ARH A;  1I0H A;  1ENV A;  2ZNJ A;  2IM9 A;  2EIK C;  1VP7 A;  5LYJ B;  5HFM A;  4ZOL B;  1HDJ A;  5JH7 B;  5LA6 A;  1ZL8 A;  2QSA A;  1S5L Z;  3EXA A;  2N05 A;  3QVN A;  2ZR2 A;  4HNA A;  5J2U B;  3W7U A;  3G6E V;  2CAZ C;  3CE2 A;  5DM6 V;  4OX9 O;  1S5H C;  1XRE A;  5LMN B;  1J5E O;  1HR0 B;  2Q7G A;  1N8R W;  5JCO C;  2OTJ V;  4JI2 B;  4JYC A;  1N4C A;  2NN4 A;  1R3K C;  2OCC B;  3OT7 A;  4DR4 O;  3DXR A;  1Q6U A;  2HR3 A;  3W7T A;  2IU3 A;  2KSD A;  2JRI A;  4LFB O;  5JQG B;  5C8Y B;  3Q4H B;  1BHB A;  1WPB A;  3ZHU A;  2Q5Z A;  4JI6 B;  4K0K B;  1PP9 H;  4J11 A;  1M57 B;  4FM0 A;  4I9Q A;  1E1Q G;  3P32 A;  3ZHR A;  4R50 A;  3N2K A;  3RYF B;  4KHP O;  5LP6 B;  2IBZ H;  4DV0 O;  1HR0 O;  2FKX A;  2KG7 A;  1N0N A;  1R6N A;  1P7B A;  3VQV A;  1EN6 A;  2XAH A;  2Y4T A;  2N04 A;  4YJ3 B;  4WFE A;  5FNV B;  1XEQ A;  4H0L B;  4GKJ B;  1R1B A;  5F2V O;  5LMU O;  3CPW U;  5IJ9 A;  5JVD A;  2E74 B;  4B3R O;  2ZM6 B;  1VQN V;  2NNU A;  2UU9 O;  1WPX A;  4I9W A;  1XI1 A;  2DWD C;  4X62 O;  3E8G A;  3TET A;  4FLW A;  4XDJ A;  4O2B B;  1YZB A;  1NBM G;  1NTM H;  3CRQ A;  3B8M A;  2QA4 V;  3S3X A;  4BWA A;  1AI7 A;  4O2A B;  3WG7 B;  3CC4 V;  3SPC A;  3CMA V;  5C93 A;  5CA1 A;  1ZX3 A;  2JS3 A;  4MW8 A;  2BSK B;  1DF4 A;  3E22 A;  1XQ8 A;  3RYC A;  2LGQ A;  3QO7 A;  5BR8 B;  2F66 C;  4I4T B;  1SQB H;  3HKB A;  1JQ0 A;  1Y6X A;  2B5U A;  2FB5 A;  3K5M A;  1MSD A;  3APQ A;  2QM4 A;  2A7W A;  2YUA A;  1MNG A;  5B1O A;  4LF8 B;  4LF7 O;  1KP2 A;  2Y69 C;  3ZS8 C;  4ZKI A;  4CBC A;  4DR5 B;  1B3Q A;  3JD0 A;  2IJI A;  2ZE8 A;  1N0J A;  2H94 A;  2WLI A;  5LOV A;  1WA8 A;  4X1K A;  2CGN A;  4EB6 B;  4RO2 A;  5KHK A;  4U7N A;  5H6R A;  5CB4 A;  1M56 B;  1DTO A;  3TK1 A;  2Q0A A;  3L75 H;  5EIB C;  3TCU A;  1URF A;  5EC2 C;  1D2D A;  1EN5 A;  1Y74 B;  2ZR3 A;  4PD4 F;  1WNS A;  3E22 B;  1K5S A;  3K58 A;  2X6C A;  1Y76 B;  4DR7 O;  3GVM A;  1XL4 A;  3UKM A;  1I94 B;  4TQF A;  1IDS A;  3KZI Z;  4O2A A;  1M90 W;  1AR1 B;  5L3E A;  2V1D A;  2WLL A;  3IC9 A;  3K5O A;  3ABK B;  4X8A A;  3CX5 F;  2QE7 G;  5B1N A;  1H8H G;  3JD4 A;  4YHH O;  4HZ3 A;  1AIL A;  3KKY A;  3CP1 A;  1V55 B;  3AEI A;  1VF5 B;  1BE3 H;  4PDV A;  4DV3 B;  2QR4 A;  1ZL8 B;  5B1B C;  3DTU B;  3PJS K;  4G28 B;  2LW1 A;  4J41 A;  1SQX H;  4JAA A;  3JSN A;  4DV6 O;  4FLT A;  4I50 B;  5IWA O;  4X1Y B;  2W0X A;  3ZIA G;  4JI5 B;  3JAS A;  3UCS C;  2ZIN A;  1FXV A;  2B9Z A;  4UCS A;  4YY3 O;  1GM9 A;  3ML0 A;  3P3N A;  4KL1 A;  1Q8I A;  5L3D A;  1AVM A;  4LFA B;  2CE4 A;  2WLN A;  3ETQ A;  5CMU A;  2LQT A;  1S76 D;  3SYP A;  4R6Z A;  1SS3 A;  2F4V O;  3E8H A;  1H2G A;  2UUA O;  2ZIM A;  3A0H Z;  2DYR C;  3AG4 B;  2UUB O;  1K33 A;  5IYZ A;  5EIB D;  4X66 B;  1GRJ A;  2HP8 A;  1QBZ A;  1XNQ O;  5IJ0 A;  1FFX B;  4AI8 A;  5A2Q N;  1QNM A;  2HVJ C;  4JI8 O;  4MTF A;  2EZO A;  1RM1 C;  3Q4H A;  4IIJ A;  5J2T B;  1QR8 A;  1THZ A;  3UO3 A;  4CC5 A;  2VQF B;  2OCH A;  1DLB A;  2W6I G;  1BGY H;  1JA8 A;  1U96 A;  3M8A A;  1I94 O;  4J80 A;  4OX9 B;  5H5N A;  3ETG A;  2CTP A;  3F7V C;  1PD3 A;  4I4T A;  3E8F A;  3WB0 A;  1N32 B;  3ZMU A;  3K79 A;  1VQ4 V;  5L3B A;  4JI7 B;  3LSQ A;  4Q20 A;  4R8C A;  2XND G;  1IZ3 A;  1GM7 A;  5BZB A;  4MS2 A;  1H5W A;  1Y67 A;  2ZKO A;  1AP5 A;  4DR4 B;  4NXM B;  2DQ3 A;  2UXB B;  3M99 B;  1Q6H A;  1UJW B;  1FXK A;  4PHZ A;  2JJ2 G;  4MSW C;  1MSW D;  1NVP B;  4LF5 O;  1H2S B;  1N36 O;  1YI2 V;  3ZRW B;  2CH7 A;  4KP4 A;  5JJJ B;  3FYE B;  1LUV A;  3X2Q B;  1FOU A;  1VAR A;  1I7F A;  2WLH A;  3JAK A;  1GN2 A;  4TV8 A;  1UPG A;  4DV5 B;  3E35 A;  1ZUQ A;  1R6T A;  3D8C A;  2FYU H;  1XHX A;  3MD0 A;  1KBH A;  5EYP A;  4PA9 A;  2F1M A;  2X6A A;  1BQ0 A;  4EEQ A;  3IC7 A;  2BE3 A;  3AG3 B;  2QKS A;  2PI4 A;  5LXT A;  3FAV A;  1TVK A;  3K9A A;  1AR5 A;  1WP7 A;  1SZX A;  4MVR A;  5FLX N;  4KXR A;  4P30 A;  4B3S B;  3VQW A;  4I7Z B;  5BR8 O;  1XHZ A;  2QWR B;  3H1J H;  3B09 A;  4YJ3 A;  3T1H O;  3CCL V;  3BVO A;  1PV0 A;  3ABL C;  2HFE C;  3BFR A;  2JJ1 G;  2HJD A;  4NTY A;  2UXN A;  1ORQ C;  1IUR A;  3AK2 A;  3ZMT A;  3CD6 V;  2Z3Y A;  3SGI A;  1N32 O;  5KUK A;  2ZE7 A;  2WLJ A;  4H44 B;  4JGS A;  2ITD C;  1WA8 B;  4X1K B;  3FKS G;  4LF4 O;  4JV5 O;  5LBQ A;  4PI0 A;  4J7Z A;  4DV6 B;  1N33 O;  3S3W A;  2ZM6 O;  2QWQ B;  4IIJ B;  2PTM A;  4GUN A;  1AI5 A;  2H8P C;  2XTA A;  3CS5 A;  1E79 G;  5GON A;  4LH6 A;  5L3C A;  4MTG A;  1Q81 W;  2PYL A;  4LC1 A;  2P06 A;  2BTQ B;  4FLZ A;  1PL4 A;  4FM2 A;  2NLJ C;  3R65 A;  4DR6 B;  4W4K A;  2GSM B;  2R9R B;  2BSK A;  5B3S C;  4GX0 A;  1SQG A;  1JPX A;  1KEC A;  1VQM V;  4JTC B;  4B7K A;  5IYZ B;  1I08 A;  1JR9 A;  2EIM C;  4LFB B;  3SJQ C;  4BAY A;  2G38 A;  1FS0 G;  2X0L A;  3E83 A;  4P9P A;  3QF7 A;  4LCU C;  4LF9 O;  3OMA B;  3ZMS A; 
#chains in the Genus database with same CATH homology
 1MMM A;  1MA1 A;  4FFK A;  5AG2 A;  1N0J A;  4C7U A;  3CEI A;  1AR5 A;  1SZX A;  1N0N A;  1XDC A;  1GN4 A;  2RCV A;  1QNM A;  1EN6 A;  3BFR A;  1LUW A;  1I0H A;  1B06 A;  1WB8 A;  1EN5 A;  3AK2 A;  1JA8 A;  1VEW A;  4YIO A;  3QVN A;  2ADP A;  3DC6 A;  5A9G A;  1XIL A;  1IDS A;  1BS3 A;  1AP6 A;  3AK1 A;  4F6E A;  1EM1 A;  1XRE A;  2GDS A;  3K9S A;  1BSM A;  3MDS A;  3LSU A;  3DC5 A;  1IXB A;  3IC9 A;  2ADQ B;  3AK3 A;  4JYY A;  3C3T A;  1Y67 A;  1AP5 A;  1GN6 A;  4GUN A;  2AW9 A;  4JZG A;  3KKY A;  1PM9 A;  3OT7 A;  3RN4 A;  1EN4 A;  4YIP A;  4E4E A;  1PL4 A;  2P4K A;  3TJT A;  3C3S A;  4BR6 A;  1KKC A;  2QKA A;  1LUV A;  1VAR A;  3EVK A;  1XUQ A;  1ZTE A;  1GN2 A;  2CDY A;  1AR4 A;  1ZUQ A;  1GN3 A;  1BT8 A;  1I08 A;  1ZSP A;  1JR9 A;  1AVM A;  4JZ2 A;  1MSD A;  1IX9 A;  2CE4 A;  1P7G A;  3KDR A;  2QKC A;  1MNG A;  1ZLZ A;  1D5N A;  1WB7 A;  4X9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...