1B07A

Crk sh3 domain complexed with peptoid inhibitor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
59
structure length
59
Chain Sequence
b'SAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (PROTO-ONCOGENE CRK (CRK))
molecule tags Sh3 domain
source organism Mus musculus
publication title Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
pubmed doi rcsb
total genus 10
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1b07A00
2DBKA 1PRLC 1NEBA 1G83A 4J9BA 1WXTA 4IIOA 1BB9A 2YUNA 4J9IA 4F17A 2EQIA 4AG1C 3H0HA 2KGTA 2F2WA 2KYMA 1X2KA 2EYWA 1UHCA 2A08A 3FJ5A 5IXFA 1SHGA 2LJ3A 1NLOC 1T3LA 4JJDA 2BZXA 2CDTA 2KXCA 2JXBA 1ZUUA 2DL3A 2D1XA 2KRNA 5FW9A 1JXOA 3UA7A 1PWTA 3U23A 1ZX6A 2K9GA 2EGAA 2FRYA 2KT1A 2O2OA 3M0UA 1I1JA 2I0NA 2GQIA 1GBRA 1G2BA 1OOTA 1RLPC 2F2XA 1YN8A 2ABLA 2LP5A 2PZ1A 2JW4A 4CC4B 2LJ0A 2L0AA 4AG2C 2OI3A 1PNJA 1WDXA 2RPNA 2YSQA 1AWJA 3CQTA 2ED0A 1TUCA 4J9CA 4HXJA 2V1RA 3SEMA 1PRMC 1RI9A 4D8DA 2G6FX 1W1FA 2D8JA 2OAWA 3VRZA 2DA9A 1T0JA 1UECA 1EFNA 3UATA 5IXBA 2CUBA 2KYBA 3I5SA 4A63B 2M51A 1H92A 2JS0A 1JXMA 3UF4A 2O31A 3SHWA 4RTTA 1B07A 2LMJA 4WCIA 4KRTA 1J3TA 4DEYA 5L23A 1ABQA 2JM8A 5IHIA 1ZSGA 1A0NB 2DYBA 1HSQA 4LN2A 4JJCA 3EG0A 2L2PA 1TG0A 3VS0A 1QLYA 1QKWA 2K2MA 1MV0B 1PKTA 4CC3A 2BZ8A 5FWCA 3LH5A 1E6GA 2YDLA 2D0NA 3TSZA 4Z88A 4RTUA 4FSSA 1SRMA 2FPEA 4J9FA 2AZVA 4ORZA 1ABOA 1X43A 1ZBJA 1E7OA 1WIEA 1XOVA 1MUZA 3ZL7C 4RTVA 2GTJA 2RQUA 1NG2A 1SSHA 1ZUYA 2DBMA 1W6XA 1UJ0A 2EW3A 1UFFA 2OJ2A 4JPBW 4Z89A 2EYZA 1NM7A 2CT4A 5GJVB 2CSIA 4LNPA 1M3CA 2BTTA 2DVJA 2EGEA 4J9GA 2DLPA 1Y57A 2DL4A 2JMCA 1BBZA 2EYXA 2W10A 1SPKA 2LNHB 5IH2A 1N5ZA 2P4RA 2AKKA 1Z9ZA 5HCKA 2X3XD 2LJ1A 3REAB 3NGPA 4RTXA 1PHTA 2HEQA 3I35A 1AD5A 3VS1A 1M27C 4ESRA 2MCNA 1PKSA 1GRIA 2HSPA 1K1ZA 4LUDA 5IHKA 3NHNA 1QWEA 2F2VA 4J9DA 3O5ZA 2CH4A 1ZLMA 2DF6A 1RLQC 3PVLA 2CT3A 1AEYA 2BZYA 1X6BA 1K9AA 1OV3A 2RQWA 2J6FA 1OPKA 3EHRA 1QKXA 3EGUA 2ENMA 1YWOA 1WX6A 2KRMA 4CC2A 4RTWA 5GJWB 4D8KA 2ED1A 4RUGA 4AFZC 4JJBA 1AZEA 2DL7A 3VS6A 2EYYA 1YCSB 4JZ4A 2ROTA 3IQLA 5FWBA 2DL8A 2CREA 2DILA 2C0OA 1M8MA 5EC7A 4Z8AA 2YUOA 3VS3A 2PNIA 3A98A 1Z9QA 4J9EA 3VS4A 1AWXA 1OEBA 2FRWA 2RQTA 4GLMA 3UA6A 2DX1A 1CKAA 2LZ6B 4OMPA 1U3OA 4LE9A 5I11A 1X27A 2D8HA 1MV3A 2VVKA 2A36A 1JEGA 4OMOA 2DL5A 1AOJA 4R0KA 1QWFA 3VS2A 1UJYA 1NYGA 2J06A 3KFVA 2H8HA 5IHNA 1WLPB 2FEIA 2KROA 3NMZC 1T0HA 2KBTA 3M0SA 1RUWA 4M4ZA 1KIKA 1UTIA 2JT4A 4OMMA 4HVUA 1AWOA 4RTYA 3C0CA 3TVTA 1K0XA 4JZ3A 1B3QA 3RBBB 2GBQA 1GCQA 2DMOA 1JQQA 2DNUA 1E6HA 1SEMA 2KRSA 2KXDA 3PVQA 1AWWA 1M3BA 1I07A 2KEAA 1X6GA 1VYUA 2AKLA 2EKHA 1W70A 4DEXA 3QWXX 2NWMA 3QWYA 1S1NA 1NLPC 3M0QA 2B86A 1ARKA 2VKNA 3THKA 2AK5A 4AFSC 1QCFA 2HDAA 1UGVA 2J7IA 4HVVA 2W0ZA 2KNBB 1CSKA 2DJQA 2RF0A 1JU5C 1X69A 1GBQA 2EGCA 4J9HA 3VRYA 1Y0MA 1I0CA 4GBQA 3I5RA 1NYFA 2K7AA 2LX7A 1FMKA 4OMLA 1WXBA 1KFZA 1JO8A 2AZSA 2FPDA 2X3WD 2J6KA 1NEGA 2FPFA 3EHQA 1SRLA 2PTKA 3I9QA 2EBPA 1BK2A 2HCKA 2EVRA 2RNAA 2MIOA 1UDLA 4F16A 1OPLA 1HJDA 1YP5A 1WXUA 2DM1A 2M0YA 4QT7A 3R6NA 1SHFA 2YUPA 1WA7A 1VYTA 4OMQA 1IO6A 1UE9A 3RNJA 4RTZA 1H3HA 2DRMA 2K79A 2KE9A 3ULRB 1GCQC 2JM9A 2JS2A 2ECZA 1VYVA 3M0PA 2RQVA 3EG1A 2CUDA 1FYNA 1V1CA 2HBWA 2KT8A 1HD3A 1YNZA 1KJWA 3GBQA 3REBB 2ESWA 2L3PA 2FO0A 2J05A 4F14A 1K76A 2K6DA 3H41A 2YUQA 3EG3A 1K0SA 1UUEA 2O9VA 1YWPA 4LUEA 4AFQC 2SEMA 5I22A 4E6RA 1X2QA 1GL5A 1GFCA 3M0TA 2QDLA 1H8KA 2RN8A 2LCSA 2DE0X 2FG0A 2JMAA 2J6OA 2MOXA 4X1VA 1KSWA 2C0IA 2LQNA 4K11A 2LQWA 1UHFA 4OMNA 3EG2A 1GCPA 5ECAA 1WI7A 2EPDA 2A28A 4ZNXA 2V1QA 2RMOA 2RQRA 4HVWA 4IIMA 4HCKA 1TUDA 2JTEA 2XMFA 1WFWA 2GTOA 4EIKA 2CH4W 2VWFA 3M0RA 2SRCA 4AFUC 2NUZA 3NPFA 2ROLA 2GGRA 1VA7A 1AZGB 1GFDA 2IIMA 2E5KA 2A37A 2L3QA 2YT6A 1M30A 3H0FA 2O9SA 2KR3A 4CC7A 1M3AA 4Y92A 1LCKA 1WYXA 1U06A 3VS7A 1K4US 2CSQA 2K3BA 1CKBA 2L3SA 2DRKA 3H0IA 1BU1A 1ZUKA 3TSWA 1U5SA 3PE0A 3VS5A 2GNCA 2C0TA 3JV3A 1AVZC 1T3SA 1UG1A 2O88A
chains in the Genus database with same CATH superfamily
1PRLC 3QBYA 1WXTA 3SFMA 4F17A 3CCUT 3A1PA 1YJ9Q 4AG1C 1VQPT 2A3LA 3H0HA 1VQ8A 1G3SA 3PMIA 1MNDA 1YJNT 1NLOC 1T3LA 2HL3A 4ZTFA 2KXCA 1VQ9A 1Y71A 1QP3A 5KCHA 2D1XA 5KCOA 4C5EA 1YHQA 3U23A 1KC8U 3TU4K 4A4HA 2F1LA 1RLPC 2F2XA 2PZ1A 2LP5A 3OS1A 4M75E 2LJ0A 2IVWA 3EGDA 3KXTA 2PUKB 2YSQA 1AWJA 3CCSQ 3OS5A 3V8LA 2ED0A 1U8RA 4PJOE 4QQGA 3DB4A 4PL6A 4KUDK 1KHCA 1WJSA 4M77F 3JCMX 1SKUB 1EFNA 4IUPA 4BB7A 3QO3A 2CZ6B 2WSFE 4A63B 2E65A 4KULA 2JNGA 4YTLA 4BI8B 2LVMA 3UT1A 4DA4A 4Q5WA 3DLLA 3VV0A 4WCIA 1QQJA 5J39A 1ZHIA 1VQ9T 4N4HA 1G3YA 1V29B 1M90U 2FZCB 5GANg 1PKTA 3ME9A 3CC4A 4EDUA 4B9WA 1IRXA 1E6GA 2YHTA 3ASKA 3JCMe 3JB9F 3TSZA 5CKDA 4M7AB 1SRMA 4M77B 2AZVA 4XTZA 1M2VB 4BDZA 3BDUA 3L2RA 3M59A 5KYUA 1X43A 1ZBJA 2NUTA 1E7OA 1WIEA 4QQ6A 2WSEE 2ZPIB 1K73R 1M1FA 3X20B 1M1GA 2RQUA 4PJOA 3CCET 1ZUYA 2XG8D 1UFFA 3E9GA 4JPBW 1NJIU 1RAIB 4C92F 1PSFA 5GANe 2EJ9A 2CP2A 5GJVB 2CSIA 4LNPA 3CD6A 2GCXA 4OB2B 1YHQQ 1VQ7T 3LYIA 3HPWA 2O4XB 1VIFA 3E1SA 2P4RA 1Z9ZA 3G71T 2CYZB 3JB9D 1VQOA 2HEQA 4WTOB 3JCMP 2BKDN 1KD1U 2V8IA 2MCNA 5CIUA 3M56A 1GRIA 3CMAQ 3MP1A 6AT1B 3GOXA 3HRTA 1LJOA 3NHNA 3CCEQ 2F2VA 4J9DA 3PVLA 2BE9B 2CT3A 2BZYA 1X6BA 1K9AA 2RJEA 1WHLA 2J6FA 1OPKA 1D3BB 2CZ0B 2L3RA 3TEEA 1NPPA 2RB6A 4M7DC 2EQKA 1PG5B 2VGMA 4CC2A 4RTWA 3HTRA 4F7UF 3M9QA 2X35A 4JLGA 5GANd 2ED1A 4RUGA 1IGUA 4AFZC 1KC8C 3PFSA 4XK8E 4PNOA 1YCSB 2ROTA 3OYIA 3PNWC 1N9RA 2C0OA 1M8MA 2DERA 1W4SA 4XU2A 1AWXA 4GLMA 1CKAA 3KUFA 3G4ST 4LE9A 3CCMA 1Q95G 1MV3A 3MJXA 2A36A 4KT0E 2MWPA 4M78D 3V7RA 1QWFA 5KYXA 1NYGA 5EG2A 4M75D 2GFAA 5FU6C 3QJYA 1WQWA 5IT9E 5IHNA 2FEIA 3UDCA 3V7SA 1T0HA 3M0SA 3OYEA 4E7HA 1XTDA 1Q86C 1Y7XA 2WSCE 2BE7D 1UTIA 2DTOA 3T9NA 3GNGA 1K73U 4JJNK 3TVTA 4XQ3A 1B3QA 2KAFA 3PVQA 1SEMA 2KRSA 2H3EB 1RAGB 2V8KA 2OX7A 1K9MR 5HKCA 1VYUA 2XD0A 1W70A 3QWXX 4BY6B 3R6OA 1QVFA 4C0DB 1NLPC 3M0QA 2B86A 2MK5A 1VQ6Q 1QCFA 1UGVA 2FL7A 5LJ5j 3X25B 3CCMQ 2DJQA 1O9SA 3MCAB 4FYVB 3I56Q 4LD9K 4WF2A 1JJ2P 4XTVA 2EGCA 1GBQA 3OS0A 2QGGA 5C6SA 3EFRA 4OMLA 1NYFA 1NPRA 3OW2S 1N27A 2GQVA 3MO8A 2DXUA 2XDDA 2QEXA 1NEGA 3GIBA 1C6VX 1IZ6A 1BI2A 1RAAB 3JCMJ 3I9QA 5D6WA 2F69A 2YLBA 3M4YA 1UDLA 1IB8A 4OB1B 4F16A 1QVPA 1VQ6T 1VQ4A 2R5AA 4M7DG 1QP2A 2YUPA 1VYTA 4OMQA 4DOVA 3CCVT 1TWBA 3V8KA 1UE9A 2K79A 4OP0A 2DXCA 1GCQC 3OBYA 2K3XA 5DM7R 4PLIA 3MEVA 3QYHB 3M0PA 1R0BG 1C0MA 3MPUB 4DOWA 3LWIA 2KT8A 1ZA2B 4F7UB 2CZ1B 3REBB 2ESWA 4CRIA 3OQ5A 2J05A 4F14A 1K76A 1N9SA 2YLCA 5FRNA 7AT1B 3JB9G 2HQHA 3M5AA 1Q81U 3FRNA 1PCXA 4B6MA 5I2SA 5GAOl 2QQSA 1DJ7B 2L89A 3P8HA 2H3JA 4R55A 1GL5A 4DQ2A 2DE0X 2FG0A 3VKIA 2J6OA 2CS7A 1KSWA 2C0IA 2LQNA 2QTVA 3OB9A 1GCPA 1WI7A 3OYJA 1YIJA 2A28A 4ZNXA 2RMOA 1MMAA 2RQRA 4HCKA 2JTEA 3L1AA 4EIKA 3M0RA 1VQ6A 1W2BP 3OYLA 1VA7A 1VQNA 3X28B 4M7DF 2ZPGB 2JUFA 2LC4A 2IIMA 2EQJA 5GAN4 2FYKA 4CC7A 1YI2T 4Y92A 2R58A 2RK1A 5D6YA 1U06A 3VS7A 3VUBA 3H8ZA 3CCQA 2DEQA 3TREA 5KYYA 4FW2A 4J5YA 2DD5A 2DTHA 3A8LB 3OA6A 3QDRB 3VS5A 2GNCA 3CXCP 5GAN8 3GPLA 4BI4A 3NTHA 1I8FA 2O88A 2DBKA 1G83A 3MP8A 3CCUQ 1K8AR 4J9BA 1Q82R 2Z0WA 5HK3A 2YUNA 1VQPQ 2A7YA 2FZGB 1M4ZA 2P0KA 3CCQT 1X6OA 2E10A 2KYMA 1EX4A 3QSUA 1X2KA 3OMGA 2EQUA 1VQMQ 1WGSA 2Y4YA 1QVGS 1SHGA 1R0CB 2D9TA 1VQ7Q 4KBMB 1K8AC 1H3ZA 5KYWA 5CQXA 2HMAA 2JXBA 2PUOB 4EMKB 2DL3A 3LWHA 4MMLA 1VOMA 1I5OB 2EGAA 2KT1A 2RH2A 3M0UA 2OTLQ 5CKEA 2P0PA 2JVVA 3G6EA 1TH7A 3VUZA 1OOTA 4BDYA 4XTUA 2YRDA 4CC4B 2M02A 4ZN1A 2HQEA 3SB2A 1QVGP 3CBOA 2OAUA 2V1RA 1RAHB 4LDWA 3LX7A 3I55T 1YCYA 2E12A 3M53A 2G6FX 2D8JA 3LGLA 3LW5E 4QW2A 1T0JA 1UECA 2HNIA 1S72A 4M75B 4HA8A 4DBHA 3QZ9B 1NJIC 2CUBA 2KYBA 3CCVQ 2KVQG 4KH0B 2CP5A 3S3MA 1ZSZC 5FU7C 2XICA 1ZSZB 2COZA 3UF4A 2O31A 4M77D 3M4GA 3META 2VUBA 5GAMe 3RKWA 2LMJA 1M1KU 1VQ5Q 4EMKC 5GMKj 4OMFB 3NTKA 2O01E 5IHIA 3RR6A 1WHGA 2DD4A 5GAMf 2DYIA 1G3TA 1K9MU 1HSQA 2QTXA 3EG9B 2RI2A 4JRKA 1TG0A 2HQXA 2NUPB 5FRMA 1MV0B 2BZ8A 2VYTA 3F70A 4LDVA 2RJCA 2D0NA 4FSXA 2LTOA 4RTUA 2L5QA 4ORZA 8AT1B 3A8HB 1BCOA 3URGA 1ZBXA 1XOVA 2RO0A 1MUZA 2X4WA 3ZL7C 3BFMA 5LJ5d 1NZ9A 1BI1A 1W6XA 3RIRA 5GMKl 4Y91A 4Z89A 2CT4A 2BTTA 2LCLA 4HCBA 4FYYB 3FC3A 4XTWA 2X9HA 2CP7A 3MEUA 1RADB 1N5ZA 5CQYA 5GAMd 3CCJQ 5M9OA 1VQ4T 2QK0A 4RCBA 1AD5A 1FWZA 2LT1A 3S3OA 1M27C 4C8QF 1M90C 1D1CA 4MDXA 1QWEA 5C0MA 3TQ7P 1KQSP 3MP6A 1SF9A 3CC4T 4FU6A 1YITQ 2LQKA 2RQWA 3S6WA 2AIRB 3SD4A 1QKXA 1B7TA 3CCEA 3EGUA 4JS5A 2ZCFB 2ENMA 4E47A 1VQLQ 1KD1R 2XI9A 4IUUA 5GMKe 4PJOD 1OZ2A 2VGNA 4XAXB 5IN1A 3DLMA 5GAMj 5CKHA 4BI3A 1VQ4Q 3CPWP 2M0OA 2DL8A 2CREA 2LCCA 4ELZC 4C8QB 3VS3A 1Z9QA 3EGXA 4C0FA 1YJWT 1OEBA 2DJZA 2RQTA 3E9FA 4C8QD 2LZ6B 4F7UA 1KQSS 1WJQA 1YIJT 1VQKA 1ZQ1A 4FT4A 1LOJA 2K3YA 3CC2T 4MZMA 3OS2A 4PJLA 2MWOA 3CMAA 3O8VA 4FYXB 1YJ9A 2DK3A 3KFVA 1N8RU 4M78F 2XU8A 1WZOA 1Y96A 2QQBA 2KROA 1D0XA 4M4ZA 1KIKA 2RA2A 1TOVA 1JJ2A 5GAOn 1AWOA 1X01A 5CK9A 3HFNA 3C0CA 3CMAT 1K0XA 4JZ3A 2GBQA 1IREB 3JCMQ 3CCST 2DTIA 2KXDA 3JSCA 1AWWA 4RMOA 1JBMA 3OYDA 1M3BA 1I07A 1X6GA 2EKHA 3OW2A 5LJ3j 4DEXA 5GAMg 3G6EQ 2VKNA 4NS5A 1YJNQ 2RHZA 2AK5A 4AFSC 2QEXQ 3CCMT 4HVVA 2W0ZA 2KNBB 2RF0A 1X69A 3A5ZB 4J9HA 3VRYA 3HHTB 2K7AA 1BIBA 2A0FB 1KFZA 2QG9B 2AZSA 1Q7YR 2FPDA 5GAN2 1HK9A 4L5GA 2FPFA 3J7AF 1SRLA 2EBPA 4O6JA 2EJFA 1BK2A 2EVRA 2RNAA 2MIOA 1FMWA 2X4JA 4KGXB 1WQ7A 1OPLA 1YP5A 3DKMA 4EMGA 2KDSA 2M0YA 1UGQB 4J6YA 2PVDB 1FX7A 4BE0A 3CEYA 2QEXT 1IO6A 1M8VA 4GY5A 3RNJA 1KC8R 4KH1B 1PD0A 3ULRB 2JM9A 4E7JA 3PTAA 2ECZA 1VYVA 3RMQA 3EG1A 1IXDA 1ACMB 3FEOA 3FDRA 2L3PA 1U1TA 4ZGDB 3G1JA 3H41A 3G4SQ 5CKFA 3QJ6A 1Q82C 1K0SA 1V76A 1UUEA 2F5KA 4AFQC 2DPPB 4L6V5 4E6RA 5GMKh 1QMCA 2PVGB 1GFCA 4KGVB 2QDLA 2RN8A 3C12A 5FU7B 2JMAA 4A4GA 3L42A 4E7KA 2DAQA 5GAMh 1G8XA 3HP9A 1D0ZA 1MNEA 1XQHA 3EG2A 5ECAA 2ATCB 2EPDA 2LX9A 3H9NA 4HVWA 1TS9A 4C0GA 2XMFA 4OGEA 2CH4W 1PM3A 2SRCA 3OYAA 4AFUC 3VJPA 4QKUA 3NPFA 2ROLA 2GGRA 2OTJQ 4HKEA 3QKJA 5IAYA 1WHJA 1M30A 3H0FA 4MZTA 2KR3A 2BIVA 4C8QG 1Y07A 5GANh 3QG1A 4C92C 4DBQA 1K4US 3CMEQ 1Q7YU 2L3SA 3H0IA 2FVUA 2MF2A 3CD6T 4PFPA 1ZUKA 4OB0B 3TSWA 1U5SA 4RG2A 3LH0A 1AVZC 1UG1A 1EZZB 2ZGWA 1NEBA 1HYOA 2IPOB 4AMCA 4IIOA 1BB9A 4J9IA 2KY9A 3G71A 3MHXA 3JCMh 3CCJA 4PJOB 1VQOT 1LVKA 2DZCA 2KGTA 3ER0A 2XDBA 5LJ3h 2F5TX 2A08A 1VQLT 2DETA 1KHIA 2LJ3A 5GAN6 3FLGA 2DEUA 2CDTA 1ZUUA 1K9MC 1VQNT 4LDUA 2K5IA 1PWTA 1PD1A 4IUQA 1ZX6A 1YI2A 2K9GA 4N4IA 2O2OA 2FRYA 4JRIA 1I1JA 3L2UA 2GQIA 4LD6A 3PIOA 2ABLA 2JW4A 2L0AA 4AG2C 1WHMA 4IURA 1WDXA 2VASA 4X9CA 1OU9A 2R57A 3CQTA 2DIGA 1TUCA 1YITT 3PT9A 4M78G 4J9CA 1RI9A 4D8DA 3FJPA 1W1FA 1W2BS 2OAWA 4C8QE 4E7SA 4E7LA 3L2QA 3UATA 1EIFA 5IXBA 2JZ2A 3A8GB 3Q1JA 3I5SA 2RHIA 2M51A 1VQKT 3QZ5B 1OX9A 3MEWA 1JXMA 1YFNA 2K57A 3SHWA 2RJFA 3CCLQ 1UGRB 4M7DE 3QYGB 4ATOA 1Q86U 3CCRT 2DKGA 1J3TA 1VQ5T 3QXEB 4R56A 2NYSA 3OBWA 2JM8A 1VQLA 1M5Q1 1RACB 4N0AA 5KYNA 1A0NB 4EPCA 2DYBA 2AT1B 4LXCA 3G6ET 2VV5A 3EG0A 3CC7A 4RG8A 3VS0A 3QPHA 1QKWA 2K2MA 3ZEHA 4CC3A 3CCSA 3FB9A 4BACA 5KYYB 4C8QC 1YBYA 2YDLA 1LPLA 2CP3A 2XDPA 1Q86R 4MZPA 4J9FA 4M7DA 3X26B 2DIQA 2O4XA 1GXIE 3CC7T 1BYMA 2B8AA 4F7UE 1NG2A 1VQ8Q 1SSHA 4OF1A 2OJ2A 2YXYA 1H641 2CGHA 3MEAA 4ZTJA 1RABB 4M78E 9ATCB 1NM7A 2MAMA 2DZ9A 5DLOA 2HKQB 3I56A 4J9GA 5CKBA 1M9SA 1B34B 4HT9A 3CCLA 1M90R 1P92A 2JMCA 1M1KC 1Y96B 1Q7YC 1HXDA 4C92B 2EYXA 3MKDA 5IH2A 2JN0A 3M57A 2D0QB 2QDYB 3CCRA 5I2MA 5DY9A 1WNLA 3JB9J 5HCKA 2X3XD 2LJ1A 3CCUA 2HBPA 1OZ3A 3NGPA 4RTXA 1PHTA 2E1HA 1VQPA 3VS1A 2ZPBB 4D6WA 1QW1A 1VQ8T 2E64A 4ESRA 3A8MB 3PGGA 3QDFA 4LUDA 5IHKA 2QYZA 3RKXA 2PVOB 3QUIA 2CH4A 4C5IA 1ZLMA 4J83A 4FM4B 4C8QA 1OV3A 1YHQT 3EHRA 1BIAA 3I55Q 1U1SA 1YI2Q 2P84A 4A54A 1YWOA 4BE1A 2KRMA 2C06A 1UEBA 3WVEB 1TU0B 3RUXA 5GJWB 1R8OB 4JJBA 4XTYA 3VS6A 1JB0E 2LNVA 4FL6A 3C95A 1KQSA 3M54A 2DILA 5EC7A 3JCMc 4Z8AA 3OYGA 2EFIA 4O5VA 3VS4A 3OYYA 2QA4A 2DVEA 4OMPA 5I11A 3JCMd 4QVDA 2VVKA 2RM4A 3EAEA 5CCAA 3PIPA 3V7CA 1TSFA 2XHCA 3JCMV 1D09B 4C0DC 4IKFA 5GAN5 1VIEA 2E6ZA 2H8HA 4F04B 4DBFA 3NTIA 5LJ5g 1FXXA 1N6AA 4M78C 1G3WA 4OMMA 4HVUA 1TUGB 4PK4A 2PU9B 3CC2A 1FMVA 3CMEA 1WJRA 4RTYA 5J26A 4ZGEB 4ZGJB 4ANJA 2HL5C 3CPWA 3RBBB 4M75C 1YJ9T 4OB3B 1GCQA 5GAOm 5J3BA 2DNUA 1E6HA 5CVIA 4IUTA 1KK7A 2KEAA 2MMPA 2MI6A 1QVFP 3C4SA 4PJOC 2AKLA 3ZFJA 1IHVA 2NWMA 4A53A 3BE3A 3THKA 3GP8A 4J6WA 2HDAA 2K5LA 1K8AU 2I2LA 3M55A 1KQ2A 3CD6Q 5GAOr 1JU5C 3OY9A 3LGFA 3JCMf 3E2UA 2GF7A 5KYXB 2QA4T 1I0CA 4GBQA 2LQ8A 2VB6A 2LX7A 1FMKA 5KE2A 1QCOA 2QQAA 3G7ZA 2K2VA 2X3WD 2J6KA 1VQ7A 3EHQA 5HY6A 3OYBA 3CPWS 1RAFB 4NL2A 1HJDA 1O75A 4JRPA 1WXUA 4M75F 5GANf 2DM1A 1D1AA 4M78A 4QT7A 3LLRA 2E41A 1SHFA 3HKSA 1M2OA 3CMET 1SG5A 5A2QE 2FZKB 1H3HA 4M75A 3I55A 1UGPB 2Y90A 3EFSA 3BDLA 4CI0C 2QA4Q 4N0AC 1S72T 2CUDA 1C1AA 1OQKA 1FYNA 1V1CA 1M1KR 2HBWA 5D6XA 4XU0A 1HD3A 2CP0A 3J80E 5CO7A 5KH6A 1TTHB 8ATCB 1BI0A 3AT1B 1YJWQ 2K6DA 2HAXA 1OU8A 2RI3A 2YUQA 3EG3A 1YWPA 3EFOB 4LUEA 3SWNB 1UB4A 5LJ3e 4TVRA 1X2QA 5A0LA 3UWNA 3M0TA 5DLQE 5FLXE 2AHJB 2HKNA 2YRCA 2QGFB 4PKCC 2Y4XA 4AT1B 2COYA 2MOXA 4EMKA 1YJNA 5LJ3f 2LQWA 3JAME 3E19A 3HRSA 2JJ9A 4ZN3A 1TUDA 2BUDA 2GTOA 3RDVA 1D0YA 3H6ZA 3HRUA 2ZAEA 3S3NA 2EYQA 2NUZA 2KK4A 4BUGA 4DBRA 2RJDA 4QVZA 4C92E 1AZGB 2EIFA 1GFDA 2OTJT 2L3QA 1M3AA 1LCKA 4XU3A 2K3BA 2E3IA 3WVDB 1CKBA 2EJGA 4XTXA 1PC0A 3OYKA 3QHSA 1AT1B 3EH1A 5KE3A 1BKBA 4C0ZA 3CCLT 2RD1A 2P0QA 3PE0A 5CAIA 2OTLT 2XK0A 3OYMA 2OTJA 3D7SB 4DEYA 4QVCA 2LT4A 1VQOQ 2EQIA 2QQRA 4BD3A 2L8DA 2F2WA 4OVAA 2YRVA 2EYWA 1UHCA 4LDXA 3FJ5A 5IXFA 2OTLA 3BW1A 4A4EA 3JCMW 4JJDA 2BZXA 4KUIA 2KRNA 2QASA 3A8OB 5FW9A 1JXOA 2NLUA 3UA7A 3VU3C 2E6NA 3P8BB 4JRQA 2E70A 2I0NA 1GBRA 4HT8A 1G2BA 4JLIA 4PFZA 2HZYA 1YN8A 3L2ZA 2EKOA 4JDSA 2OI3A 1PNJA 2RPNA 1D3BA 4M7DD 2EWNA 4L59A 2M16A 4FCYA 4HXJA 4VUBA 3SEMA 1PRMC 2COWA 3VRZA 2DA9A 1YJWA 1MMDA 4J7FA 1N8RC 1H92A 2JS0A 4JUVA 4RCCA 1I5LA 3G71Q 2ZZDA 1F1BB 4RTTA 1B07A 2X4XA 3HSBA 4J8OA 2ZPFB 3OYNA 4KRTA 4A4KA 3CCRQ 5L23A 1ABQA 3CBMA 1ZSGA 1BI3A 2NUPA 3GLXA 2QI2A 2P4TA 4XU1A 4MDWA 1KG1A 4LN2A 3SWNC 4JJCA 2R5MA 1X75C 2L2PA 1KD1C 4E7ZA 1QLYA 4M7AE 5FWCA 3RERA 1SSFA 3LH5A 4IUVA 1MMNA 3RKYA 1D1BA 4Z88A 4Y28E 3CXCA 4FSSA 4BE2A 3AHUA 2FPEA 4A4FA 2ZPHB 2D6FA 1ABOA 2M1HA 1QVGA 4RTVA 4C92D 1R77A 5LJ3g 2GTJA 1OULA 2EAYA 4M75G 2DBMA 1UJ0A 2EW3A 2EYZA 2V8JA 3UPUA 1WPYA 4V2SA 1M3CA 3PMTA 2DVJA 1VQ5A 4M77A 2EGEA 1N8RR 4M7AA 4Z02A 1ZSZA 2DLPA 2K4YA 1Y57A 4LDYA 2CZ7B 2DL4A 2FB7A 5AYFA 1NJIR 3HL8A 1BBZA 5I21A 2W10A 3OSSC 1SPKA 4M78B 1AHJB 2LNHB 5LL6S 4C5HA 2AKKA 3GNFB 2M9UA 1S72Q 1XNIA 3P8DA 3EGXB 3REAB 3RMSA 4C92A 1RL2A 3I35A 3G4SA 4M77E 1PKSA 2HSPA 4X9DA 1K1ZA 1I4K1 5FU6B 2JOYA 3O5ZA 2V26A 2DF6A 1RLQC 1AEYA 2WACA 2VXEA 1JJ2S 1VQMT 2E4HA 2RHUA 2VXFA 4J7IA 5D7UA 1Q82U 2DXBA 3HFOA 1WX6A 1B34A 3NFCA 4NL3A 4D8KA 3J81E 3QIIA 1AZEA 5GAN3 2DL7A 1WHKA 2LRQA 4FYWB 3CPFA 2EYYA 4HCZA 2GFUA 1VQNQ 4JZ4A 2RHXA 3IQLA 5FWBA 1VQMA 3EGDB 1UGSB 3BY7A 2YUOA 2PNIA 3A98A 4M77C 3CC4Q 4J9EA 1RI0A 5GMKi 4M7AC 2FRWA 3ZBDA 3OYHA 4M7DB 4C5GA 3UA6A 2DX1A 1OI1A 1BCMA 1U3OA 1X27A 2DO3A 1MMGA 2D8HA 4B9XA 2QAZA 4QQDA 1XJWB 1JEGA 3VYGA 4OMOA 5GMKm 2DL5A 1G5VA 1AOJA 4R0KA 3VS2A 4J6XA 3L2WA 5FROA 1UJYA 1NBEB 1IHWA 2RHYA 2J06A 3OYCA 3JB9I 3JRZA 5LJ5e 1QCNA 1WHHA 4FT2A 1WLPB 3NMZC 2KBTA 1RUWA 4PJMA 2JT4A 1VUBA 2G3RA 4EMHA 2IG0A 5HK0A 1NE8A 3DB3A 2QXFA 5GAOq 2DMOA 3OYFA 3L2VA 1JQQA 4GLKA 2E5QA 3N5BB 1Q81R 2ZPEB 3CCVA 1YIJQ 2KQWA 4MMKA 3CC2Q 3QWYA 1S1NA 2NUTB 4RKUE 5KYUB 4PJOF 1ARKA 1M2VA 1I81A 3JCMb 4P5NA 3EG9A 2J7IA 3JB9H 1CSKA 1Q81C 2CKKA 2HD0A 2X51A 1QVFS 1Y0MA 3I5RA 1WXBA 5GAOp 1JO8A 4X34A 2DXTA 1PSEA 3TCJA 5LJ5h 4BY6C 2X4YA 3CC7Q 3OMCA 5L8RE 2PTKA 5LJ3d 3FIFA 2HCKA 1VQ9Q 3RESA 2K5FA 2JTMA 4E7IA 2JTFA 5GAN7 3INZA 4N4GA 3CXCS 3R6NA 1K73C 1TXQA 2QQ9A 4C92G 1WA7A 1YITA 3SDZA 2VC8A 1RAEB 4UC4A 3X24B 3C94A 4RTZA 2DRMA 1VQKQ 2KE9A 4E2FB 2JS2A 4NOYA 5KYWB 3M58A 2RQVA 4FIBA 1YNZA 1KQ1A 1KJWA 3GBQA 3JCMg 2XKOC 3EFOA 3SWNA 4ELYC 4M7AG 2FO0A 2KSSA 5CR2A 3CCQQ 4OGCA 3OW2P 4PJNA 3V8JA 4PJOG 2O9VA 5AT1B 1MGQA 2SEMA 5I22A 5LJ5f 1OYXA 4FW1A 1LNXA 4ME7A 1H8KA 3KBGA 1IGQA 2LCSA 5A0DA 2RI5A 4X1VA 4M7AD 1W2BA 4K11A 4KGZB 2KI7A 1UHFA 4OMNA 3VYHB 3CCJT 4PFOA 2DFUA 2RK2A 4HCCA 2V1QA 4F7UG 4IIMA 5GANj 2MYSA 1WFWA 4PLLA 5A0GA 2XIDA 2MPXC 2VWFA 4JS4A 2KMTA 2YWWA 3EH2A 1MHNA 2E3HA 2LDMA 3GF5A 2HSEB 3OSVA 2CP6A 2E5KA 2A37A 2YT6A 3WXMB 2EQMA 2O9SA 1OX8A 1WYXA 3CBPA 2FHDA 4M77G 2PQWA 2CSQA 4PJJA 2DRKA 1JRIA 1BU1A 3I56T 1ZA1B 4II1A 2C0TA 3JV3A 4M7AF 1T3SA
chains in the Genus database with same CATH topology
2DBKA 1PRLC 1NEBA 1G83A 4J9BA 1WXTA 4IIOA 1BB9A 2YUNA 4J9IA 4F17A 2EQIA 4AG1C 3H0HA 2KGTA 2F2WA 2KYMA 1X2KA 2EYWA 1UHCA 2A08A 3FJ5A 5IXFA 1SHGA 2LJ3A 1NLOC 1T3LA 4JJDA 2BZXA 2CDTA 2KXCA 2JXBA 1ZUUA 2DL3A 2D1XA 2KRNA 5FW9A 1JXOA 3UA7A 1PWTA 3U23A 1ZX6A 2K9GA 2EGAA 2FRYA 2KT1A 2O2OA 3M0UA 1I1JA 2I0NA 2GQIA 1GBRA 1G2BA 1OOTA 1RLPC 2F2XA 1YN8A 2ABLA 2LP5A 2PZ1A 2JW4A 4CC4B 2LJ0A 2L0AA 4AG2C 2OI3A 1PNJA 1WDXA 2RPNA 2YSQA 1AWJA 3CQTA 2ED0A 1TUCA 4J9CA 4HXJA 2V1RA 3SEMA 1PRMC 1RI9A 4D8DA 2G6FX 1W1FA 2D8JA 2OAWA 3VRZA 2DA9A 1T0JA 1UECA 1EFNA 3UATA 5IXBA 2CUBA 2KYBA 3I5SA 4A63B 2M51A 1H92A 2JS0A 1JXMA 3UF4A 2O31A 3SHWA 4RTTA 1B07A 2LMJA 4WCIA 4KRTA 1J3TA 4DEYA 5L23A 1ABQA 2JM8A 5IHIA 1ZSGA 1A0NB 2DYBA 1HSQA 4LN2A 4JJCA 3EG0A 2L2PA 1TG0A 3VS0A 1QLYA 1QKWA 2K2MA 1MV0B 1PKTA 4CC3A 2BZ8A 5FWCA 3LH5A 1E6GA 2YDLA 2D0NA 3TSZA 4Z88A 4RTUA 4FSSA 1SRMA 2FPEA 4J9FA 2AZVA 4ORZA 1ABOA 1X43A 1ZBJA 1E7OA 1WIEA 1XOVA 1MUZA 3ZL7C 4RTVA 2GTJA 2RQUA 1NG2A 1SSHA 1ZUYA 2DBMA 1W6XA 1UJ0A 2EW3A 1UFFA 2OJ2A 4JPBW 4Z89A 2EYZA 1NM7A 2CT4A 5GJVB 2CSIA 4LNPA 1M3CA 2BTTA 2DVJA 2EGEA 4J9GA 2DLPA 1Y57A 2DL4A 2JMCA 1BBZA 2EYXA 2W10A 1SPKA 2LNHB 5IH2A 1N5ZA 2P4RA 2AKKA 1Z9ZA 5HCKA 2X3XD 2LJ1A 3REAB 3NGPA 4RTXA 1PHTA 2HEQA 3I35A 1AD5A 3VS1A 1M27C 4ESRA 2MCNA 1PKSA 1GRIA 2HSPA 1K1ZA 4LUDA 5IHKA 3NHNA 1QWEA 2F2VA 4J9DA 3O5ZA 2CH4A 1ZLMA 2DF6A 1RLQC 3PVLA 2CT3A 1AEYA 2BZYA 1X6BA 1K9AA 1OV3A 2RQWA 2J6FA 1OPKA 3EHRA 1QKXA 3EGUA 2ENMA 1YWOA 1WX6A 2KRMA 4CC2A 4RTWA 5GJWB 4D8KA 2ED1A 4RUGA 4AFZC 4JJBA 1AZEA 2DL7A 3VS6A 2EYYA 1YCSB 4JZ4A 2ROTA 3IQLA 5FWBA 2DL8A 2CREA 2DILA 2C0OA 1M8MA 5EC7A 4Z8AA 2YUOA 3VS3A 2PNIA 3A98A 1Z9QA 4J9EA 3VS4A 1AWXA 1OEBA 2FRWA 2RQTA 4GLMA 3UA6A 2DX1A 1CKAA 2LZ6B 4OMPA 1U3OA 4LE9A 5I11A 1X27A 2D8HA 1MV3A 2VVKA 2A36A 1JEGA 4OMOA 2DL5A 1AOJA 4R0KA 1QWFA 3VS2A 1UJYA 1NYGA 2J06A 3KFVA 2H8HA 5IHNA 1WLPB 2FEIA 2KROA 3NMZC 1T0HA 2KBTA 3M0SA 1RUWA 4M4ZA 1KIKA 1UTIA 2JT4A 4OMMA 4HVUA 1AWOA 4RTYA 3C0CA 3TVTA 1K0XA 4JZ3A 1B3QA 3RBBB 2GBQA 1GCQA 2DMOA 1JQQA 2DNUA 1E6HA 1SEMA 2KRSA 2KXDA 3PVQA 1AWWA 1M3BA 1I07A 2KEAA 1X6GA 1VYUA 2AKLA 2EKHA 1W70A 4DEXA 3QWXX 2NWMA 3QWYA 1S1NA 1NLPC 3M0QA 2B86A 1ARKA 2VKNA 3THKA 2AK5A 4AFSC 1QCFA 2HDAA 1UGVA 2J7IA 4HVVA 2W0ZA 2KNBB 1CSKA 2DJQA 2RF0A 1JU5C 1X69A 1GBQA 2EGCA 4J9HA 3VRYA 1Y0MA 1I0CA 4GBQA 3I5RA 1NYFA 2K7AA 2LX7A 1FMKA 4OMLA 1WXBA 1KFZA 1JO8A 2AZSA 2FPDA 2X3WD 2J6KA 1NEGA 2FPFA 3EHQA 1SRLA 2PTKA 3I9QA 2EBPA 1BK2A 2HCKA 2EVRA 2RNAA 2MIOA 1UDLA 4F16A 1OPLA 1HJDA 1YP5A 1WXUA 2DM1A 2M0YA 4QT7A 3R6NA 1SHFA 2YUPA 1WA7A 1VYTA 4OMQA 1IO6A 1UE9A 3RNJA 4RTZA 1H3HA 2DRMA 2K79A 2KE9A 3ULRB 1GCQC 2JM9A 2JS2A 2ECZA 1VYVA 3M0PA 2RQVA 3EG1A 2CUDA 1FYNA 1V1CA 2HBWA 2KT8A 1HD3A 1YNZA 1KJWA 3GBQA 3REBB 2ESWA 2L3PA 2FO0A 2J05A 4F14A 1K76A 2K6DA 3H41A 2YUQA 3EG3A 1K0SA 1UUEA 2O9VA 1YWPA 4LUEA 4AFQC 2SEMA 5I22A 4E6RA 1X2QA 1GL5A 1GFCA 3M0TA 2QDLA 1H8KA 2RN8A 2LCSA 2DE0X 2FG0A 2JMAA 2J6OA 2MOXA 4X1VA 1KSWA 2C0IA 2LQNA 4K11A 2LQWA 1UHFA 4OMNA 3EG2A 1GCPA 5ECAA 1WI7A 2EPDA 2A28A 4ZNXA 2V1QA 2RMOA 2RQRA 4HVWA 4IIMA 4HCKA 1TUDA 2JTEA 2XMFA 1WFWA 2GTOA 4EIKA 2CH4W 2VWFA 3M0RA 2SRCA 4AFUC 2NUZA 3NPFA 2ROLA 2GGRA 1VA7A 1AZGB 1GFDA 2IIMA 2E5KA 2A37A 2L3QA 2YT6A 1M30A 3H0FA 2O9SA 2KR3A 4CC7A 1M3AA 4Y92A 1LCKA 1WYXA 1U06A 3VS7A 1K4US 2CSQA 2K3BA 1CKBA 2L3SA 2DRKA 3H0IA 1BU1A 1ZUKA 3TSWA 1U5SA 3PE0A 3VS5A 2GNCA 2C0TA 3JV3A 1AVZC 1T3SA 1UG1A 2O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBK A;  1PRL C;  1NEB A;  1G83 A;  4J9B A;  1WXT A;  4IIO A;  1BB9 A;  2YUN A;  4J9I A;  4F17 A;  2EQI A;  4AG1 C;  3H0H A;  2KGT A;  2F2W A;  2KYM A;  1X2K A;  2EYW A;  1UHC A;  2A08 A;  3FJ5 A;  5IXF A;  1SHG A;  2LJ3 A;  1NLO C;  1T3L A;  4JJD A;  2BZX A;  2CDT A;  2KXC A;  2JXB A;  1ZUU A;  2DL3 A;  2D1X A;  2KRN A;  5FW9 A;  1JXO A;  3UA7 A;  1PWT A;  3U23 A;  1ZX6 A;  2K9G A;  2EGA A;  2FRY A;  2KT1 A;  2O2O A;  3M0U A;  1I1J A;  2I0N A;  2GQI A;  1GBR A;  1G2B A;  1OOT A;  1RLP C;  2F2X A;  1YN8 A;  2ABL A;  2LP5 A;  2PZ1 A;  2JW4 A;  4CC4 B;  2LJ0 A;  2L0A A;  4AG2 C;  2OI3 A;  1PNJ A;  1WDX A;  2RPN A;  2YSQ A;  1AWJ A;  3CQT A;  2ED0 A;  1TUC A;  4J9C A;  4HXJ A;  2V1R A;  3SEM A;  1PRM C;  1RI9 A;  4D8D A;  2G6F X;  1W1F A;  2D8J A;  2OAW A;  3VRZ A;  2DA9 A;  1T0J A;  1UEC A;  1EFN A;  3UAT A;  5IXB A;  2CUB A;  2KYB A;  3I5S A;  4A63 B;  2M51 A;  1H92 A;  2JS0 A;  1JXM A;  3UF4 A;  2O31 A;  3SHW A;  4RTT A;  1B07 A;  2LMJ A;  4WCI A;  4KRT A;  1J3T A;  4DEY A;  5L23 A;  1ABQ A;  2JM8 A;  5IHI A;  1ZSG A;  1A0N B;  2DYB A;  1HSQ A;  4LN2 A;  4JJC A;  3EG0 A;  2L2P A;  1TG0 A;  3VS0 A;  1QLY A;  1QKW A;  2K2M A;  1MV0 B;  1PKT A;  4CC3 A;  2BZ8 A;  5FWC A;  3LH5 A;  1E6G A;  2YDL A;  2D0N A;  3TSZ A;  4Z88 A;  4RTU A;  4FSS A;  1SRM A;  2FPE A;  4J9F A;  2AZV A;  4ORZ A;  1ABO A;  1X43 A;  1ZBJ A;  1E7O A;  1WIE A;  1XOV A;  1MUZ A;  3ZL7 C;  4RTV A;  2GTJ A;  2RQU A;  1NG2 A;  1SSH A;  1ZUY A;  2DBM A;  1W6X A;  1UJ0 A;  2EW3 A;  1UFF A;  2OJ2 A;  4JPB W;  4Z89 A;  2EYZ A;  1NM7 A;  2CT4 A;  5GJV B;  2CSI A;  4LNP A;  1M3C A;  2BTT A;  2DVJ A;  2EGE A;  4J9G A;  2DLP A;  1Y57 A;  2DL4 A;  2JMC A;  1BBZ A;  2EYX A;  2W10 A;  1SPK A;  2LNH B;  5IH2 A;  1N5Z A;  2P4R A;  2AKK A;  1Z9Z A;  5HCK A;  2X3X D;  2LJ1 A;  3REA B;  3NGP A;  4RTX A;  1PHT A;  2HEQ A;  3I35 A;  1AD5 A;  3VS1 A;  1M27 C;  4ESR A;  2MCN A;  1PKS A;  1GRI A;  2HSP A;  1K1Z A;  4LUD A;  5IHK A;  3NHN A;  1QWE A;  2F2V A;  4J9D A;  3O5Z A;  2CH4 A;  1ZLM A;  2DF6 A;  1RLQ C;  3PVL A;  2CT3 A;  1AEY A;  2BZY A;  1X6B A;  1K9A A;  1OV3 A;  2RQW A;  2J6F A;  1OPK A;  3EHR A;  1QKX A;  3EGU A;  2ENM A;  1YWO A;  1WX6 A;  2KRM A;  4CC2 A;  4RTW A;  5GJW B;  4D8K A;  2ED1 A;  4RUG A;  4AFZ C;  4JJB A;  1AZE A;  2DL7 A;  3VS6 A;  2EYY A;  1YCS B;  4JZ4 A;  2ROT A;  3IQL A;  5FWB A;  2DL8 A;  2CRE A;  2DIL A;  2C0O A;  1M8M A;  5EC7 A;  4Z8A A;  2YUO A;  3VS3 A;  2PNI A;  3A98 A;  1Z9Q A;  4J9E A;  3VS4 A;  1AWX A;  1OEB A;  2FRW A;  2RQT A;  4GLM A;  3UA6 A;  2DX1 A;  1CKA A;  2LZ6 B;  4OMP A;  1U3O A;  4LE9 A;  5I11 A;  1X27 A;  2D8H A;  1MV3 A;  2VVK A;  2A36 A;  1JEG A;  4OMO A;  2DL5 A;  1AOJ A;  4R0K A;  1QWF A;  3VS2 A;  1UJY A;  1NYG A;  2J06 A;  3KFV A;  2H8H A;  5IHN A;  1WLP B;  2FEI A;  2KRO A;  3NMZ C;  1T0H A;  2KBT A;  3M0S A;  1RUW A;  4M4Z A;  1KIK A;  1UTI A;  2JT4 A;  4OMM A;  4HVU A;  1AWO A;  4RTY A;  3C0C A;  3TVT A;  1K0X A;  4JZ3 A;  1B3Q A;  3RBB B;  2GBQ A;  1GCQ A;  2DMO A;  1JQQ A;  2DNU A;  1E6H A;  1SEM A;  2KRS A;  2KXD A;  3PVQ A;  1AWW A;  1M3B A;  1I07 A;  2KEA A;  1X6G A;  1VYU A;  2AKL A;  2EKH A;  1W70 A;  4DEX A;  3QWX X;  2NWM A;  3QWY A;  1S1N A;  1NLP C;  3M0Q A;  2B86 A;  1ARK A;  2VKN A;  3THK A;  2AK5 A;  4AFS C;  1QCF A;  2HDA A;  1UGV A;  2J7I A;  4HVV A;  2W0Z A;  2KNB B;  1CSK A;  2DJQ A;  2RF0 A;  1JU5 C;  1X69 A;  1GBQ A;  2EGC A;  4J9H A;  3VRY A;  1Y0M A;  1I0C A;  4GBQ A;  3I5R A;  1NYF A;  2K7A A;  2LX7 A;  1FMK A;  4OML A;  1WXB A;  1KFZ A;  1JO8 A;  2AZS A;  2FPD A;  2X3W D;  2J6K A;  1NEG A;  2FPF A;  3EHQ A;  1SRL A;  2PTK A;  3I9Q A;  2EBP A;  1BK2 A;  2HCK A;  2EVR A;  2RNA A;  2MIO A;  1UDL A;  4F16 A;  1OPL A;  1HJD A;  1YP5 A;  1WXU A;  2DM1 A;  2M0Y A;  4QT7 A;  3R6N A;  1SHF A;  2YUP A;  1WA7 A;  1VYT A;  4OMQ A;  1IO6 A;  1UE9 A;  3RNJ A;  4RTZ A;  1H3H A;  2DRM A;  2K79 A;  2KE9 A;  3ULR B;  1GCQ C;  2JM9 A;  2JS2 A;  2ECZ A;  1VYV A;  3M0P A;  2RQV A;  3EG1 A;  2CUD A;  1FYN A;  1V1C A;  2HBW A;  2KT8 A;  1HD3 A;  1YNZ A;  1KJW A;  3GBQ A;  3REB B;  2ESW A;  2L3P A;  2FO0 A;  2J05 A;  4F14 A;  1K76 A;  2K6D A;  3H41 A;  2YUQ A;  3EG3 A;  1K0S A;  1UUE A;  2O9V A;  1YWP A;  4LUE A;  4AFQ C;  2SEM A;  5I22 A;  4E6R A;  1X2Q A;  1GL5 A;  1GFC A;  3M0T A;  2QDL A;  1H8K A;  2RN8 A;  2LCS A;  2DE0 X;  2FG0 A;  2JMA A;  2J6O A;  2MOX A;  4X1V A;  1KSW A;  2C0I A;  2LQN A;  4K11 A;  2LQW A;  1UHF A;  4OMN A;  3EG2 A;  1GCP A;  5ECA A;  1WI7 A;  2EPD A;  2A28 A;  4ZNX A;  2V1Q A;  2RMO A;  2RQR A;  4HVW A;  4IIM A;  4HCK A;  1TUD A;  2JTE A;  2XMF A;  1WFW A;  2GTO A;  4EIK A;  2CH4 W;  2VWF A;  3M0R A;  2SRC A;  4AFU C;  2NUZ A;  3NPF A;  2ROL A;  2GGR A;  1VA7 A;  1AZG B;  1GFD A;  2IIM A;  2E5K A;  2A37 A;  2L3Q A;  2YT6 A;  1M30 A;  3H0F A;  2O9S A;  2KR3 A;  4CC7 A;  1M3A A;  4Y92 A;  1LCK A;  1WYX A;  1U06 A;  3VS7 A;  1K4U S;  2CSQ A;  2K3B A;  1CKB A;  2L3S A;  2DRK A;  3H0I A;  1BU1 A;  1ZUK A;  3TSW A;  1U5S A;  3PE0 A;  3VS5 A;  2GNC A;  2C0T A;  3JV3 A;  1AVZ C;  1T3S A;  1UG1 A;  2O88 A; 
#chains in the Genus database with same CATH topology
 1PRL C;  3QBY A;  1WXT A;  3SFM A;  4F17 A;  3CCU T;  3A1P A;  1YJ9 Q;  4AG1 C;  1VQP T;  2A3L A;  3H0H A;  1VQ8 A;  1G3S A;  3PMI A;  1MND A;  1YJN T;  1NLO C;  1T3L A;  2HL3 A;  4ZTF A;  2KXC A;  1VQ9 A;  1Y71 A;  1QP3 A;  5KCH A;  2D1X A;  5KCO A;  4C5E A;  1YHQ A;  3U23 A;  1KC8 U;  3TU4 K;  4A4H A;  2F1L A;  1RLP C;  2F2X A;  2PZ1 A;  2LP5 A;  3OS1 A;  4M75 E;  2LJ0 A;  2IVW A;  3EGD A;  3KXT A;  2PUK B;  2YSQ A;  1AWJ A;  3CCS Q;  3OS5 A;  3V8L A;  2ED0 A;  1U8R A;  4PJO E;  4QQG A;  3DB4 A;  4PL6 A;  4KUD K;  1KHC A;  1WJS A;  4M77 F;  3JCM X;  1SKU B;  1EFN A;  4IUP A;  4BB7 A;  3QO3 A;  2CZ6 B;  2WSF E;  4A63 B;  2E65 A;  4KUL A;  2JNG A;  4YTL A;  4BI8 B;  2LVM A;  3UT1 A;  4DA4 A;  4Q5W A;  3DLL A;  3VV0 A;  4WCI A;  1QQJ A;  5J39 A;  1ZHI A;  1VQ9 T;  4N4H A;  1G3Y A;  1V29 B;  1M90 U;  2FZC B;  5GAN g;  1PKT A;  3ME9 A;  3CC4 A;  4EDU A;  4B9W A;  1IRX A;  1E6G A;  2YHT A;  3ASK A;  3JCM e;  3JB9 F;  3TSZ A;  5CKD A;  4M7A B;  1SRM A;  4M77 B;  2AZV A;  4XTZ A;  1M2V B;  4BDZ A;  3BDU A;  3L2R A;  3M59 A;  5KYU A;  1X43 A;  1ZBJ A;  2NUT A;  1E7O A;  1WIE A;  4QQ6 A;  2WSE E;  2ZPI B;  1K73 R;  1M1F A;  3X20 B;  1M1G A;  2RQU A;  4PJO A;  3CCE T;  1ZUY A;  2XG8 D;  1UFF A;  3E9G A;  4JPB W;  1NJI U;  1RAI B;  4C92 F;  1PSF A;  5GAN e;  2EJ9 A;  2CP2 A;  5GJV B;  2CSI A;  4LNP A;  3CD6 A;  2GCX A;  4OB2 B;  1YHQ Q;  1VQ7 T;  3LYI A;  3HPW A;  2O4X B;  1VIF A;  3E1S A;  2P4R A;  1Z9Z A;  3G71 T;  2CYZ B;  3JB9 D;  1VQO A;  2HEQ A;  4WTO B;  3JCM P;  2BKD N;  1KD1 U;  2V8I A;  2MCN A;  5CIU A;  3M56 A;  1GRI A;  3CMA Q;  3MP1 A;  6AT1 B;  3GOX A;  3HRT A;  1LJO A;  3NHN A;  3CCE Q;  2F2V A;  4J9D A;  3PVL A;  2BE9 B;  2CT3 A;  2BZY A;  1X6B A;  1K9A A;  2RJE A;  1WHL A;  2J6F A;  1OPK A;  1D3B B;  2CZ0 B;  2L3R A;  3TEE A;  1NPP A;  2RB6 A;  4M7D C;  2EQK A;  1PG5 B;  2VGM A;  4CC2 A;  4RTW A;  3HTR A;  4F7U F;  3M9Q A;  2X35 A;  4JLG A;  5GAN d;  2ED1 A;  4RUG A;  1IGU A;  4AFZ C;  1KC8 C;  3PFS A;  4XK8 E;  4PNO A;  1YCS B;  2ROT A;  3OYI A;  3PNW C;  1N9R A;  2C0O A;  1M8M A;  2DER A;  1W4S A;  4XU2 A;  1AWX A;  4GLM A;  1CKA A;  3KUF A;  3G4S T;  4LE9 A;  3CCM A;  1Q95 G;  1MV3 A;  3MJX A;  2A36 A;  4KT0 E;  2MWP A;  4M78 D;  3V7R A;  1QWF A;  5KYX A;  1NYG A;  5EG2 A;  4M75 D;  2GFA A;  5FU6 C;  3QJY A;  1WQW A;  5IT9 E;  5IHN A;  2FEI A;  3UDC A;  3V7S A;  1T0H A;  3M0S A;  3OYE A;  4E7H A;  1XTD A;  1Q86 C;  1Y7X A;  2WSC E;  2BE7 D;  1UTI A;  2DTO A;  3T9N A;  3GNG A;  1K73 U;  4JJN K;  3TVT A;  4XQ3 A;  1B3Q A;  2KAF A;  3PVQ A;  1SEM A;  2KRS A;  2H3E B;  1RAG B;  2V8K A;  2OX7 A;  1K9M R;  5HKC A;  1VYU A;  2XD0 A;  1W70 A;  3QWX X;  4BY6 B;  3R6O A;  1QVF A;  4C0D B;  1NLP C;  3M0Q A;  2B86 A;  2MK5 A;  1VQ6 Q;  1QCF A;  1UGV A;  2FL7 A;  5LJ5 j;  3X25 B;  3CCM Q;  2DJQ A;  1O9S A;  3MCA B;  4FYV B;  3I56 Q;  4LD9 K;  4WF2 A;  1JJ2 P;  4XTV A;  2EGC A;  1GBQ A;  3OS0 A;  2QGG A;  5C6S A;  3EFR A;  4OML A;  1NYF A;  1NPR A;  3OW2 S;  1N27 A;  2GQV A;  3MO8 A;  2DXU A;  2XDD A;  2QEX A;  1NEG A;  3GIB A;  1C6V X;  1IZ6 A;  1BI2 A;  1RAA B;  3JCM J;  3I9Q A;  5D6W A;  2F69 A;  2YLB A;  3M4Y A;  1UDL A;  1IB8 A;  4OB1 B;  4F16 A;  1QVP A;  1VQ6 T;  1VQ4 A;  2R5A A;  4M7D G;  1QP2 A;  2YUP A;  1VYT A;  4OMQ A;  4DOV A;  3CCV T;  1TWB A;  3V8K A;  1UE9 A;  2K79 A;  4OP0 A;  2DXC A;  1GCQ C;  3OBY A;  2K3X A;  5DM7 R;  4PLI A;  3MEV A;  3QYH B;  3M0P A;  1R0B G;  1C0M A;  3MPU B;  4DOW A;  3LWI A;  2KT8 A;  1ZA2 B;  4F7U B;  2CZ1 B;  3REB B;  2ESW A;  4CRI A;  3OQ5 A;  2J05 A;  4F14 A;  1K76 A;  1N9S A;  2YLC A;  5FRN A;  7AT1 B;  3JB9 G;  2HQH A;  3M5A A;  1Q81 U;  3FRN A;  1PCX A;  4B6M A;  5I2S A;  5GAO l;  2QQS A;  1DJ7 B;  2L89 A;  3P8H A;  2H3J A;  4R55 A;  1GL5 A;  4DQ2 A;  2DE0 X;  2FG0 A;  3VKI A;  2J6O A;  2CS7 A;  1KSW A;  2C0I A;  2LQN A;  2QTV A;  3OB9 A;  1GCP A;  1WI7 A;  3OYJ A;  1YIJ A;  2A28 A;  4ZNX A;  2RMO A;  1MMA A;  2RQR A;  4HCK A;  2JTE A;  3L1A A;  4EIK A;  3M0R A;  1VQ6 A;  1W2B P;  3OYL A;  1VA7 A;  1VQN A;  3X28 B;  4M7D F;  2ZPG B;  2JUF A;  2LC4 A;  2IIM A;  2EQJ A;  5GAN 4;  2FYK A;  4CC7 A;  1YI2 T;  4Y92 A;  2R58 A;  2RK1 A;  5D6Y A;  1U06 A;  3VS7 A;  3VUB A;  3H8Z A;  3CCQ A;  2DEQ A;  3TRE A;  5KYY A;  4FW2 A;  4J5Y A;  2DD5 A;  2DTH A;  3A8L B;  3OA6 A;  3QDR B;  3VS5 A;  2GNC A;  3CXC P;  5GAN 8;  3GPL A;  4BI4 A;  3NTH A;  1I8F A;  2O88 A;  2DBK A;  1G83 A;  3MP8 A;  3CCU Q;  1K8A R;  4J9B A;  1Q82 R;  2Z0W A;  5HK3 A;  2YUN A;  1VQP Q;  2A7Y A;  2FZG B;  1M4Z A;  2P0K A;  3CCQ T;  1X6O A;  2E10 A;  2KYM A;  1EX4 A;  3QSU A;  1X2K A;  3OMG A;  2EQU A;  1VQM Q;  1WGS A;  2Y4Y A;  1QVG S;  1SHG A;  1R0C B;  2D9T A;  1VQ7 Q;  4KBM B;  1K8A C;  1H3Z A;  5KYW A;  5CQX A;  2HMA A;  2JXB A;  2PUO B;  4EMK B;  2DL3 A;  3LWH A;  4MML A;  1VOM A;  1I5O B;  2EGA A;  2KT1 A;  2RH2 A;  3M0U A;  2OTL Q;  5CKE A;  2P0P A;  2JVV A;  3G6E A;  1TH7 A;  3VUZ A;  1OOT A;  4BDY A;  4XTU A;  2YRD A;  4CC4 B;  2M02 A;  4ZN1 A;  2HQE A;  3SB2 A;  1QVG P;  3CBO A;  2OAU A;  2V1R A;  1RAH B;  4LDW A;  3LX7 A;  3I55 T;  1YCY A;  2E12 A;  3M53 A;  2G6F X;  2D8J A;  3LGL A;  3LW5 E;  4QW2 A;  1T0J A;  1UEC A;  2HNI A;  1S72 A;  4M75 B;  4HA8 A;  4DBH A;  3QZ9 B;  1NJI C;  2CUB A;  2KYB A;  3CCV Q;  2KVQ G;  4KH0 B;  2CP5 A;  3S3M A;  1ZSZ C;  5FU7 C;  2XIC A;  1ZSZ B;  2COZ A;  3UF4 A;  2O31 A;  4M77 D;  3M4G A;  3MET A;  2VUB A;  5GAM e;  3RKW A;  2LMJ A;  1M1K U;  1VQ5 Q;  4EMK C;  5GMK j;  4OMF B;  3NTK A;  2O01 E;  5IHI A;  3RR6 A;  1WHG A;  2DD4 A;  5GAM f;  2DYI A;  1G3T A;  1K9M U;  1HSQ A;  2QTX A;  3EG9 B;  2RI2 A;  4JRK A;  1TG0 A;  2HQX A;  2NUP B;  5FRM A;  1MV0 B;  2BZ8 A;  2VYT A;  3F70 A;  4LDV A;  2RJC A;  2D0N A;  4FSX A;  2LTO A;  4RTU A;  2L5Q A;  4ORZ A;  8AT1 B;  3A8H B;  1BCO A;  3URG A;  1ZBX A;  1XOV A;  2RO0 A;  1MUZ A;  2X4W A;  3ZL7 C;  3BFM A;  5LJ5 d;  1NZ9 A;  1BI1 A;  1W6X A;  3RIR A;  5GMK l;  4Y91 A;  4Z89 A;  2CT4 A;  2BTT A;  2LCL A;  4HCB A;  4FYY B;  3FC3 A;  4XTW A;  2X9H A;  2CP7 A;  3MEU A;  1RAD B;  1N5Z A;  5CQY A;  5GAM d;  3CCJ Q;  5M9O A;  1VQ4 T;  2QK0 A;  4RCB A;  1AD5 A;  1FWZ A;  2LT1 A;  3S3O A;  1M27 C;  4C8Q F;  1M90 C;  1D1C A;  4MDX A;  1QWE A;  5C0M A;  3TQ7 P;  1KQS P;  3MP6 A;  1SF9 A;  3CC4 T;  4FU6 A;  1YIT Q;  2LQK A;  2RQW A;  3S6W A;  2AIR B;  3SD4 A;  1QKX A;  1B7T A;  3CCE A;  3EGU A;  4JS5 A;  2ZCF B;  2ENM A;  4E47 A;  1VQL Q;  1KD1 R;  2XI9 A;  4IUU A;  5GMK e;  4PJO D;  1OZ2 A;  2VGN A;  4XAX B;  5IN1 A;  3DLM A;  5GAM j;  5CKH A;  4BI3 A;  1VQ4 Q;  3CPW P;  2M0O A;  2DL8 A;  2CRE A;  2LCC A;  4ELZ C;  4C8Q B;  3VS3 A;  1Z9Q A;  3EGX A;  4C0F A;  1YJW T;  1OEB A;  2DJZ A;  2RQT A;  3E9F A;  4C8Q D;  2LZ6 B;  4F7U A;  1KQS S;  1WJQ A;  1YIJ T;  1VQK A;  1ZQ1 A;  4FT4 A;  1LOJ A;  2K3Y A;  3CC2 T;  4MZM A;  3OS2 A;  4PJL A;  2MWO A;  3CMA A;  3O8V A;  4FYX B;  1YJ9 A;  2DK3 A;  3KFV A;  1N8R U;  4M78 F;  2XU8 A;  1WZO A;  1Y96 A;  2QQB A;  2KRO A;  1D0X A;  4M4Z A;  1KIK A;  2RA2 A;  1TOV A;  1JJ2 A;  5GAO n;  1AWO A;  1X01 A;  5CK9 A;  3HFN A;  3C0C A;  3CMA T;  1K0X A;  4JZ3 A;  2GBQ A;  1IRE B;  3JCM Q;  3CCS T;  2DTI A;  2KXD A;  3JSC A;  1AWW A;  4RMO A;  1JBM A;  3OYD A;  1M3B A;  1I07 A;  1X6G A;  2EKH A;  3OW2 A;  5LJ3 j;  4DEX A;  5GAM g;  3G6E Q;  2VKN A;  4NS5 A;  1YJN Q;  2RHZ A;  2AK5 A;  4AFS C;  2QEX Q;  3CCM T;  4HVV A;  2W0Z A;  2KNB B;  2RF0 A;  1X69 A;  3A5Z B;  4J9H A;  3VRY A;  3HHT B;  2K7A A;  1BIB A;  2A0F B;  1KFZ A;  2QG9 B;  2AZS A;  1Q7Y R;  2FPD A;  5GAN 2;  1HK9 A;  4L5G A;  2FPF A;  3J7A F;  1SRL A;  2EBP A;  4O6J A;  2EJF A;  1BK2 A;  2EVR A;  2RNA A;  2MIO A;  1FMW A;  2X4J A;  4KGX B;  1WQ7 A;  1OPL A;  1YP5 A;  3DKM A;  4EMG A;  2KDS A;  2M0Y A;  1UGQ B;  4J6Y A;  2PVD B;  1FX7 A;  4BE0 A;  3CEY A;  2QEX T;  1IO6 A;  1M8V A;  4GY5 A;  3RNJ A;  1KC8 R;  4KH1 B;  1PD0 A;  3ULR B;  2JM9 A;  4E7J A;  3PTA A;  2ECZ A;  1VYV A;  3RMQ A;  3EG1 A;  1IXD A;  1ACM B;  3FEO A;  3FDR A;  2L3P A;  1U1T A;  4ZGD B;  3G1J A;  3H41 A;  3G4S Q;  5CKF A;  3QJ6 A;  1Q82 C;  1K0S A;  1V76 A;  1UUE A;  2F5K A;  4AFQ C;  2DPP B;  4L6V 5;  4E6R A;  5GMK h;  1QMC A;  2PVG B;  1GFC A;  4KGV B;  2QDL A;  2RN8 A;  3C12 A;  5FU7 B;  2JMA A;  4A4G A;  3L42 A;  4E7K A;  2DAQ A;  5GAM h;  1G8X A;  3HP9 A;  1D0Z A;  1MNE A;  1XQH A;  3EG2 A;  5ECA A;  2ATC B;  2EPD A;  2LX9 A;  3H9N A;  4HVW A;  1TS9 A;  4C0G A;  2XMF A;  4OGE A;  2CH4 W;  1PM3 A;  2SRC A;  3OYA A;  4AFU C;  3VJP A;  4QKU A;  3NPF A;  2ROL A;  2GGR A;  2OTJ Q;  4HKE A;  3QKJ A;  5IAY A;  1WHJ A;  1M30 A;  3H0F A;  4MZT A;  2KR3 A;  2BIV A;  4C8Q G;  1Y07 A;  5GAN h;  3QG1 A;  4C92 C;  4DBQ A;  1K4U S;  3CME Q;  1Q7Y U;  2L3S A;  3H0I A;  2FVU A;  2MF2 A;  3CD6 T;  4PFP A;  1ZUK A;  4OB0 B;  3TSW A;  1U5S A;  4RG2 A;  3LH0 A;  1AVZ C;  1UG1 A;  1EZZ B;  2ZGW A;  1NEB A;  1HYO A;  2IPO B;  4AMC A;  4IIO A;  1BB9 A;  4J9I A;  2KY9 A;  3G71 A;  3MHX A;  3JCM h;  3CCJ A;  4PJO B;  1VQO T;  1LVK A;  2DZC A;  2KGT A;  3ER0 A;  2XDB A;  5LJ3 h;  2F5T X;  2A08 A;  1VQL T;  2DET A;  1KHI A;  2LJ3 A;  5GAN 6;  3FLG A;  2DEU A;  2CDT A;  1ZUU A;  1K9M C;  1VQN T;  4LDU A;  2K5I A;  1PWT A;  1PD1 A;  4IUQ A;  1ZX6 A;  1YI2 A;  2K9G A;  4N4I A;  2O2O A;  2FRY A;  4JRI A;  1I1J A;  3L2U A;  2GQI A;  4LD6 A;  3PIO A;  2ABL A;  2JW4 A;  2L0A A;  4AG2 C;  1WHM A;  4IUR A;  1WDX A;  2VAS A;  4X9C A;  1OU9 A;  2R57 A;  3CQT A;  2DIG A;  1TUC A;  1YIT T;  3PT9 A;  4M78 G;  4J9C A;  1RI9 A;  4D8D A;  3FJP A;  1W1F A;  1W2B S;  2OAW A;  4C8Q E;  4E7S A;  4E7L A;  3L2Q A;  3UAT A;  1EIF A;  5IXB A;  2JZ2 A;  3A8G B;  3Q1J A;  3I5S A;  2RHI A;  2M51 A;  1VQK T;  3QZ5 B;  1OX9 A;  3MEW A;  1JXM A;  1YFN A;  2K57 A;  3SHW A;  2RJF A;  3CCL Q;  1UGR B;  4M7D E;  3QYG B;  4ATO A;  1Q86 U;  3CCR T;  2DKG A;  1J3T A;  1VQ5 T;  3QXE B;  4R56 A;  2NYS A;  3OBW A;  2JM8 A;  1VQL A;  1M5Q 1;  1RAC B;  4N0A A;  5KYN A;  1A0N B;  4EPC A;  2DYB A;  2AT1 B;  4LXC A;  3G6E T;  2VV5 A;  3EG0 A;  3CC7 A;  4RG8 A;  3VS0 A;  3QPH A;  1QKW A;  2K2M A;  3ZEH A;  4CC3 A;  3CCS A;  3FB9 A;  4BAC A;  5KYY B;  4C8Q C;  1YBY A;  2YDL A;  1LPL A;  2CP3 A;  2XDP A;  1Q86 R;  4MZP A;  4J9F A;  4M7D A;  3X26 B;  2DIQ A;  2O4X A;  1GXI E;  3CC7 T;  1BYM A;  2B8A A;  4F7U E;  1NG2 A;  1VQ8 Q;  1SSH A;  4OF1 A;  2OJ2 A;  2YXY A;  1H64 1;  2CGH A;  3MEA A;  4ZTJ A;  1RAB B;  4M78 E;  9ATC B;  1NM7 A;  2MAM A;  2DZ9 A;  5DLO A;  2HKQ B;  3I56 A;  4J9G A;  5CKB A;  1M9S A;  1B34 B;  4HT9 A;  3CCL A;  1M90 R;  1P92 A;  2JMC A;  1M1K C;  1Y96 B;  1Q7Y C;  1HXD A;  4C92 B;  2EYX A;  3MKD A;  5IH2 A;  2JN0 A;  3M57 A;  2D0Q B;  2QDY B;  3CCR A;  5I2M A;  5DY9 A;  1WNL A;  3JB9 J;  5HCK A;  2X3X D;  2LJ1 A;  3CCU A;  2HBP A;  1OZ3 A;  3NGP A;  4RTX A;  1PHT A;  2E1H A;  1VQP A;  3VS1 A;  2ZPB B;  4D6W A;  1QW1 A;  1VQ8 T;  2E64 A;  4ESR A;  3A8M B;  3PGG A;  3QDF A;  4LUD A;  5IHK A;  2QYZ A;  3RKX A;  2PVO B;  3QUI A;  2CH4 A;  4C5I A;  1ZLM A;  4J83 A;  4FM4 B;  4C8Q A;  1OV3 A;  1YHQ T;  3EHR A;  1BIA A;  3I55 Q;  1U1S A;  1YI2 Q;  2P84 A;  4A54 A;  1YWO A;  4BE1 A;  2KRM A;  2C06 A;  1UEB A;  3WVE B;  1TU0 B;  3RUX A;  5GJW B;  1R8O B;  4JJB A;  4XTY A;  3VS6 A;  1JB0 E;  2LNV A;  4FL6 A;  3C95 A;  1KQS A;  3M54 A;  2DIL A;  5EC7 A;  3JCM c;  4Z8A A;  3OYG A;  2EFI A;  4O5V A;  3VS4 A;  3OYY A;  2QA4 A;  2DVE A;  4OMP A;  5I11 A;  3JCM d;  4QVD A;  2VVK A;  2RM4 A;  3EAE A;  5CCA A;  3PIP A;  3V7C A;  1TSF A;  2XHC A;  3JCM V;  1D09 B;  4C0D C;  4IKF A;  5GAN 5;  1VIE A;  2E6Z A;  2H8H A;  4F04 B;  4DBF A;  3NTI A;  5LJ5 g;  1FXX A;  1N6A A;  4M78 C;  1G3W A;  4OMM A;  4HVU A;  1TUG B;  4PK4 A;  2PU9 B;  3CC2 A;  1FMV A;  3CME A;  1WJR A;  4RTY A;  5J26 A;  4ZGE B;  4ZGJ B;  4ANJ A;  2HL5 C;  3CPW A;  3RBB B;  4M75 C;  1YJ9 T;  4OB3 B;  1GCQ A;  5GAO m;  5J3B A;  2DNU A;  1E6H A;  5CVI A;  4IUT A;  1KK7 A;  2KEA A;  2MMP A;  2MI6 A;  1QVF P;  3C4S A;  4PJO C;  2AKL A;  3ZFJ A;  1IHV A;  2NWM A;  4A53 A;  3BE3 A;  3THK A;  3GP8 A;  4J6W A;  2HDA A;  2K5L A;  1K8A U;  2I2L A;  3M55 A;  1KQ2 A;  3CD6 Q;  5GAO r;  1JU5 C;  3OY9 A;  3LGF A;  3JCM f;  3E2U A;  2GF7 A;  5KYX B;  2QA4 T;  1I0C A;  4GBQ A;  2LQ8 A;  2VB6 A;  2LX7 A;  1FMK A;  5KE2 A;  1QCO A;  2QQA A;  3G7Z A;  2K2V A;  2X3W D;  2J6K A;  1VQ7 A;  3EHQ A;  5HY6 A;  3OYB A;  3CPW S;  1RAF B;  4NL2 A;  1HJD A;  1O75 A;  4JRP A;  1WXU A;  4M75 F;  5GAN f;  2DM1 A;  1D1A A;  4M78 A;  4QT7 A;  3LLR A;  2E41 A;  1SHF A;  3HKS A;  1M2O A;  3CME T;  1SG5 A;  5A2Q E;  2FZK B;  1H3H A;  4M75 A;  3I55 A;  1UGP B;  2Y90 A;  3EFS A;  3BDL A;  4CI0 C;  2QA4 Q;  4N0A C;  1S72 T;  2CUD A;  1C1A A;  1OQK A;  1FYN A;  1V1C A;  1M1K R;  2HBW A;  5D6X A;  4XU0 A;  1HD3 A;  2CP0 A;  3J80 E;  5CO7 A;  5KH6 A;  1TTH B;  8ATC B;  1BI0 A;  3AT1 B;  1YJW Q;  2K6D A;  2HAX A;  1OU8 A;  2RI3 A;  2YUQ A;  3EG3 A;  1YWP A;  3EFO B;  4LUE A;  3SWN B;  1UB4 A;  5LJ3 e;  4TVR A;  1X2Q A;  5A0L A;  3UWN A;  3M0T A;  5DLQ E;  5FLX E;  2AHJ B;  2HKN A;  2YRC A;  2QGF B;  4PKC C;  2Y4X A;  4AT1 B;  2COY A;  2MOX A;  4EMK A;  1YJN A;  5LJ3 f;  2LQW A;  3JAM E;  3E19 A;  3HRS A;  2JJ9 A;  4ZN3 A;  1TUD A;  2BUD A;  2GTO A;  3RDV A;  1D0Y A;  3H6Z A;  3HRU A;  2ZAE A;  3S3N A;  2EYQ A;  2NUZ A;  2KK4 A;  4BUG A;  4DBR A;  2RJD A;  4QVZ A;  4C92 E;  1AZG B;  2EIF A;  1GFD A;  2OTJ T;  2L3Q A;  1M3A A;  1LCK A;  4XU3 A;  2K3B A;  2E3I A;  3WVD B;  1CKB A;  2EJG A;  4XTX A;  1PC0 A;  3OYK A;  3QHS A;  1AT1 B;  3EH1 A;  5KE3 A;  1BKB A;  4C0Z A;  3CCL T;  2RD1 A;  2P0Q A;  3PE0 A;  5CAI A;  2OTL T;  2XK0 A;  3OYM A;  2OTJ A;  3D7S B;  4DEY A;  4QVC A;  2LT4 A;  1VQO Q;  2EQI A;  2QQR A;  4BD3 A;  2L8D A;  2F2W A;  4OVA A;  2YRV A;  2EYW A;  1UHC A;  4LDX A;  3FJ5 A;  5IXF A;  2OTL A;  3BW1 A;  4A4E A;  3JCM W;  4JJD A;  2BZX A;  4KUI A;  2KRN A;  2QAS A;  3A8O B;  5FW9 A;  1JXO A;  2NLU A;  3UA7 A;  3VU3 C;  2E6N A;  3P8B B;  4JRQ A;  2E70 A;  2I0N A;  1GBR A;  4HT8 A;  1G2B A;  4JLI A;  4PFZ A;  2HZY A;  1YN8 A;  3L2Z A;  2EKO A;  4JDS A;  2OI3 A;  1PNJ A;  2RPN A;  1D3B A;  4M7D D;  2EWN A;  4L59 A;  2M16 A;  4FCY A;  4HXJ A;  4VUB A;  3SEM A;  1PRM C;  2COW A;  3VRZ A;  2DA9 A;  1YJW A;  1MMD A;  4J7F A;  1N8R C;  1H92 A;  2JS0 A;  4JUV A;  4RCC A;  1I5L A;  3G71 Q;  2ZZD A;  1F1B B;  4RTT A;  1B07 A;  2X4X A;  3HSB A;  4J8O A;  2ZPF B;  3OYN A;  4KRT A;  4A4K A;  3CCR Q;  5L23 A;  1ABQ A;  3CBM A;  1ZSG A;  1BI3 A;  2NUP A;  3GLX A;  2QI2 A;  2P4T A;  4XU1 A;  4MDW A;  1KG1 A;  4LN2 A;  3SWN C;  4JJC A;  2R5M A;  1X75 C;  2L2P A;  1KD1 C;  4E7Z A;  1QLY A;  4M7A E;  5FWC A;  3RER A;  1SSF A;  3LH5 A;  4IUV A;  1MMN A;  3RKY A;  1D1B A;  4Z88 A;  4Y28 E;  3CXC A;  4FSS A;  4BE2 A;  3AHU A;  2FPE A;  4A4F A;  2ZPH B;  2D6F A;  1ABO A;  2M1H A;  1QVG A;  4RTV A;  4C92 D;  1R77 A;  5LJ3 g;  2GTJ A;  1OUL A;  2EAY A;  4M75 G;  2DBM A;  1UJ0 A;  2EW3 A;  2EYZ A;  2V8J A;  3UPU A;  1WPY A;  4V2S A;  1M3C A;  3PMT A;  2DVJ A;  1VQ5 A;  4M77 A;  2EGE A;  1N8R R;  4M7A A;  4Z02 A;  1ZSZ A;  2DLP A;  2K4Y A;  1Y57 A;  4LDY A;  2CZ7 B;  2DL4 A;  2FB7 A;  5AYF A;  1NJI R;  3HL8 A;  1BBZ A;  5I21 A;  2W10 A;  3OSS C;  1SPK A;  4M78 B;  1AHJ B;  2LNH B;  5LL6 S;  4C5H A;  2AKK A;  3GNF B;  2M9U A;  1S72 Q;  1XNI A;  3P8D A;  3EGX B;  3REA B;  3RMS A;  4C92 A;  1RL2 A;  3I35 A;  3G4S A;  4M77 E;  1PKS A;  2HSP A;  4X9D A;  1K1Z A;  1I4K 1;  5FU6 B;  2JOY A;  3O5Z A;  2V26 A;  2DF6 A;  1RLQ C;  1AEY A;  2WAC A;  2VXE A;  1JJ2 S;  1VQM T;  2E4H A;  2RHU A;  2VXF A;  4J7I A;  5D7U A;  1Q82 U;  2DXB A;  3HFO A;  1WX6 A;  1B34 A;  3NFC A;  4NL3 A;  4D8K A;  3J81 E;  3QII A;  1AZE A;  5GAN 3;  2DL7 A;  1WHK A;  2LRQ A;  4FYW B;  3CPF A;  2EYY A;  4HCZ A;  2GFU A;  1VQN Q;  4JZ4 A;  2RHX A;  3IQL A;  5FWB A;  1VQM A;  3EGD B;  1UGS B;  3BY7 A;  2YUO A;  2PNI A;  3A98 A;  4M77 C;  3CC4 Q;  4J9E A;  1RI0 A;  5GMK i;  4M7A C;  2FRW A;  3ZBD A;  3OYH A;  4M7D B;  4C5G A;  3UA6 A;  2DX1 A;  1OI1 A;  1BCM A;  1U3O A;  1X27 A;  2DO3 A;  1MMG A;  2D8H A;  4B9X A;  2QAZ A;  4QQD A;  1XJW B;  1JEG A;  3VYG A;  4OMO A;  5GMK m;  2DL5 A;  1G5V A;  1AOJ A;  4R0K A;  3VS2 A;  4J6X A;  3L2W A;  5FRO A;  1UJY A;  1NBE B;  1IHW A;  2RHY A;  2J06 A;  3OYC A;  3JB9 I;  3JRZ A;  5LJ5 e;  1QCN A;  1WHH A;  4FT2 A;  1WLP B;  3NMZ C;  2KBT A;  1RUW A;  4PJM A;  2JT4 A;  1VUB A;  2G3R A;  4EMH A;  2IG0 A;  5HK0 A;  1NE8 A;  3DB3 A;  2QXF A;  5GAO q;  2DMO A;  3OYF A;  3L2V A;  1JQQ A;  4GLK A;  2E5Q A;  3N5B B;  1Q81 R;  2ZPE B;  3CCV A;  1YIJ Q;  2KQW A;  4MMK A;  3CC2 Q;  3QWY A;  1S1N A;  2NUT B;  4RKU E;  5KYU B;  4PJO F;  1ARK A;  1M2V A;  1I81 A;  3JCM b;  4P5N A;  3EG9 A;  2J7I A;  3JB9 H;  1CSK A;  1Q81 C;  2CKK A;  2HD0 A;  2X51 A;  1QVF S;  1Y0M A;  3I5R A;  1WXB A;  5GAO p;  1JO8 A;  4X34 A;  2DXT A;  1PSE A;  3TCJ A;  5LJ5 h;  4BY6 C;  2X4Y A;  3CC7 Q;  3OMC A;  5L8R E;  2PTK A;  5LJ3 d;  3FIF A;  2HCK A;  1VQ9 Q;  3RES A;  2K5F A;  2JTM A;  4E7I A;  2JTF A;  5GAN 7;  3INZ A;  4N4G A;  3CXC S;  3R6N A;  1K73 C;  1TXQ A;  2QQ9 A;  4C92 G;  1WA7 A;  1YIT A;  3SDZ A;  2VC8 A;  1RAE B;  4UC4 A;  3X24 B;  3C94 A;  4RTZ A;  2DRM A;  1VQK Q;  2KE9 A;  4E2F B;  2JS2 A;  4NOY A;  5KYW B;  3M58 A;  2RQV A;  4FIB A;  1YNZ A;  1KQ1 A;  1KJW A;  3GBQ A;  3JCM g;  2XKO C;  3EFO A;  3SWN A;  4ELY C;  4M7A G;  2FO0 A;  2KSS A;  5CR2 A;  3CCQ Q;  4OGC A;  3OW2 P;  4PJN A;  3V8J A;  4PJO G;  2O9V A;  5AT1 B;  1MGQ A;  2SEM A;  5I22 A;  5LJ5 f;  1OYX A;  4FW1 A;  1LNX A;  4ME7 A;  1H8K A;  3KBG A;  1IGQ A;  2LCS A;  5A0D A;  2RI5 A;  4X1V A;  4M7A D;  1W2B A;  4K11 A;  4KGZ B;  2KI7 A;  1UHF A;  4OMN A;  3VYH B;  3CCJ T;  4PFO A;  2DFU A;  2RK2 A;  4HCC A;  2V1Q A;  4F7U G;  4IIM A;  5GAN j;  2MYS A;  1WFW A;  4PLL A;  5A0G A;  2XID A;  2MPX C;  2VWF A;  4JS4 A;  2KMT A;  2YWW A;  3EH2 A;  1MHN A;  2E3H A;  2LDM A;  3GF5 A;  2HSE B;  3OSV A;  2CP6 A;  2E5K A;  2A37 A;  2YT6 A;  3WXM B;  2EQM A;  2O9S A;  1OX8 A;  1WYX A;  3CBP A;  2FHD A;  4M77 G;  2PQW A;  2CSQ A;  4PJJ A;  2DRK A;  1JRI A;  1BU1 A;  3I56 T;  1ZA1 B;  4II1 A;  2C0T A;  3JV3 A;  4M7A F;  1T3S A; 
#chains in the Genus database with same CATH homology
 2DBK A;  1PRL C;  1NEB A;  1G83 A;  4J9B A;  1WXT A;  4IIO A;  1BB9 A;  2YUN A;  4J9I A;  4F17 A;  2EQI A;  4AG1 C;  3H0H A;  2KGT A;  2F2W A;  2KYM A;  1X2K A;  2EYW A;  1UHC A;  2A08 A;  3FJ5 A;  5IXF A;  1SHG A;  2LJ3 A;  1NLO C;  1T3L A;  4JJD A;  2BZX A;  2CDT A;  2KXC A;  2JXB A;  1ZUU A;  2DL3 A;  2D1X A;  2KRN A;  5FW9 A;  1JXO A;  3UA7 A;  1PWT A;  3U23 A;  1ZX6 A;  2K9G A;  2EGA A;  2FRY A;  2KT1 A;  2O2O A;  3M0U A;  1I1J A;  2I0N A;  2GQI A;  1GBR A;  1G2B A;  1OOT A;  1RLP C;  2F2X A;  1YN8 A;  2ABL A;  2LP5 A;  2PZ1 A;  2JW4 A;  4CC4 B;  2LJ0 A;  2L0A A;  4AG2 C;  2OI3 A;  1PNJ A;  1WDX A;  2RPN A;  2YSQ A;  1AWJ A;  3CQT A;  2ED0 A;  1TUC A;  4J9C A;  4HXJ A;  2V1R A;  3SEM A;  1PRM C;  1RI9 A;  4D8D A;  2G6F X;  1W1F A;  2D8J A;  2OAW A;  3VRZ A;  2DA9 A;  1T0J A;  1UEC A;  1EFN A;  3UAT A;  5IXB A;  2CUB A;  2KYB A;  3I5S A;  4A63 B;  2M51 A;  1H92 A;  2JS0 A;  1JXM A;  3UF4 A;  2O31 A;  3SHW A;  4RTT A;  1B07 A;  2LMJ A;  4WCI A;  4KRT A;  1J3T A;  4DEY A;  5L23 A;  1ABQ A;  2JM8 A;  5IHI A;  1ZSG A;  1A0N B;  2DYB A;  1HSQ A;  4LN2 A;  4JJC A;  3EG0 A;  2L2P A;  1TG0 A;  3VS0 A;  1QLY A;  1QKW A;  2K2M A;  1MV0 B;  1PKT A;  4CC3 A;  2BZ8 A;  5FWC A;  3LH5 A;  1E6G A;  2YDL A;  2D0N A;  3TSZ A;  4Z88 A;  4RTU A;  4FSS A;  1SRM A;  2FPE A;  4J9F A;  2AZV A;  4ORZ A;  1ABO A;  1X43 A;  1ZBJ A;  1E7O A;  1WIE A;  1XOV A;  1MUZ A;  3ZL7 C;  4RTV A;  2GTJ A;  2RQU A;  1NG2 A;  1SSH A;  1ZUY A;  2DBM A;  1W6X A;  1UJ0 A;  2EW3 A;  1UFF A;  2OJ2 A;  4JPB W;  4Z89 A;  2EYZ A;  1NM7 A;  2CT4 A;  5GJV B;  2CSI A;  4LNP A;  1M3C A;  2BTT A;  2DVJ A;  2EGE A;  4J9G A;  2DLP A;  1Y57 A;  2DL4 A;  2JMC A;  1BBZ A;  2EYX A;  2W10 A;  1SPK A;  2LNH B;  5IH2 A;  1N5Z A;  2P4R A;  2AKK A;  1Z9Z A;  5HCK A;  2X3X D;  2LJ1 A;  3REA B;  3NGP A;  4RTX A;  1PHT A;  2HEQ A;  3I35 A;  1AD5 A;  3VS1 A;  1M27 C;  4ESR A;  2MCN A;  1PKS A;  1GRI A;  2HSP A;  1K1Z A;  4LUD A;  5IHK A;  3NHN A;  1QWE A;  2F2V A;  4J9D A;  3O5Z A;  2CH4 A;  1ZLM A;  2DF6 A;  1RLQ C;  3PVL A;  2CT3 A;  1AEY A;  2BZY A;  1X6B A;  1K9A A;  1OV3 A;  2RQW A;  2J6F A;  1OPK A;  3EHR A;  1QKX A;  3EGU A;  2ENM A;  1YWO A;  1WX6 A;  2KRM A;  4CC2 A;  4RTW A;  5GJW B;  4D8K A;  2ED1 A;  4RUG A;  4AFZ C;  4JJB A;  1AZE A;  2DL7 A;  3VS6 A;  2EYY A;  1YCS B;  4JZ4 A;  2ROT A;  3IQL A;  5FWB A;  2DL8 A;  2CRE A;  2DIL A;  2C0O A;  1M8M A;  5EC7 A;  4Z8A A;  2YUO A;  3VS3 A;  2PNI A;  3A98 A;  1Z9Q A;  4J9E A;  3VS4 A;  1AWX A;  1OEB A;  2FRW A;  2RQT A;  4GLM A;  3UA6 A;  2DX1 A;  1CKA A;  2LZ6 B;  4OMP A;  1U3O A;  4LE9 A;  5I11 A;  1X27 A;  2D8H A;  1MV3 A;  2VVK A;  2A36 A;  1JEG A;  4OMO A;  2DL5 A;  1AOJ A;  4R0K A;  1QWF A;  3VS2 A;  1UJY A;  1NYG A;  2J06 A;  3KFV A;  2H8H A;  5IHN A;  1WLP B;  2FEI A;  2KRO A;  3NMZ C;  1T0H A;  2KBT A;  3M0S A;  1RUW A;  4M4Z A;  1KIK A;  1UTI A;  2JT4 A;  4OMM A;  4HVU A;  1AWO A;  4RTY A;  3C0C A;  3TVT A;  1K0X A;  4JZ3 A;  1B3Q A;  3RBB B;  2GBQ A;  1GCQ A;  2DMO A;  1JQQ A;  2DNU A;  1E6H A;  1SEM A;  2KRS A;  2KXD A;  3PVQ A;  1AWW A;  1M3B A;  1I07 A;  2KEA A;  1X6G A;  1VYU A;  2AKL A;  2EKH A;  1W70 A;  4DEX A;  3QWX X;  2NWM A;  3QWY A;  1S1N A;  1NLP C;  3M0Q A;  2B86 A;  1ARK A;  2VKN A;  3THK A;  2AK5 A;  4AFS C;  1QCF A;  2HDA A;  1UGV A;  2J7I A;  4HVV A;  2W0Z A;  2KNB B;  1CSK A;  2DJQ A;  2RF0 A;  1JU5 C;  1X69 A;  1GBQ A;  2EGC A;  4J9H A;  3VRY A;  1Y0M A;  1I0C A;  4GBQ A;  3I5R A;  1NYF A;  2K7A A;  2LX7 A;  1FMK A;  4OML A;  1WXB A;  1KFZ A;  1JO8 A;  2AZS A;  2FPD A;  2X3W D;  2J6K A;  1NEG A;  2FPF A;  3EHQ A;  1SRL A;  2PTK A;  3I9Q A;  2EBP A;  1BK2 A;  2HCK A;  2EVR A;  2RNA A;  2MIO A;  1UDL A;  4F16 A;  1OPL A;  1HJD A;  1YP5 A;  1WXU A;  2DM1 A;  2M0Y A;  4QT7 A;  3R6N A;  1SHF A;  2YUP A;  1WA7 A;  1VYT A;  4OMQ A;  1IO6 A;  1UE9 A;  3RNJ A;  4RTZ A;  1H3H A;  2DRM A;  2K79 A;  2KE9 A;  3ULR B;  1GCQ C;  2JM9 A;  2JS2 A;  2ECZ A;  1VYV A;  3M0P A;  2RQV A;  3EG1 A;  2CUD A;  1FYN A;  1V1C A;  2HBW A;  2KT8 A;  1HD3 A;  1YNZ A;  1KJW A;  3GBQ A;  3REB B;  2ESW A;  2L3P A;  2FO0 A;  2J05 A;  4F14 A;  1K76 A;  2K6D A;  3H41 A;  2YUQ A;  3EG3 A;  1K0S A;  1UUE A;  2O9V A;  1YWP A;  4LUE A;  4AFQ C;  2SEM A;  5I22 A;  4E6R A;  1X2Q A;  1GL5 A;  1GFC A;  3M0T A;  2QDL A;  1H8K A;  2RN8 A;  2LCS A;  2DE0 X;  2FG0 A;  2JMA A;  2J6O A;  2MOX A;  4X1V A;  1KSW A;  2C0I A;  2LQN A;  4K11 A;  2LQW A;  1UHF A;  4OMN A;  3EG2 A;  1GCP A;  5ECA A;  1WI7 A;  2EPD A;  2A28 A;  4ZNX A;  2V1Q A;  2RMO A;  2RQR A;  4HVW A;  4IIM A;  4HCK A;  1TUD A;  2JTE A;  2XMF A;  1WFW A;  2GTO A;  4EIK A;  2CH4 W;  2VWF A;  3M0R A;  2SRC A;  4AFU C;  2NUZ A;  3NPF A;  2ROL A;  2GGR A;  1VA7 A;  1AZG B;  1GFD A;  2IIM A;  2E5K A;  2A37 A;  2L3Q A;  2YT6 A;  1M30 A;  3H0F A;  2O9S A;  2KR3 A;  4CC7 A;  1M3A A;  4Y92 A;  1LCK A;  1WYX A;  1U06 A;  3VS7 A;  1K4U S;  2CSQ A;  2K3B A;  1CKB A;  2L3S A;  2DRK A;  3H0I A;  1BU1 A;  1ZUK A;  3TSW A;  1U5S A;  3PE0 A;  3VS5 A;  2GNC A;  2C0T A;  3JV3 A;  1AVZ C;  1T3S A;  1UG1 A;  2O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...