1B0AA

5,10, methylene-tetrahydropholate dehydrogenase/cyclohydrolase from e coli.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
287
structure length
287
Chain Sequence
AAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNPASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDTLNADNTIDGILVQLPLPAGIDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVEYHDPQDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a bacterial, bifunctional 5,10 methylene-tetrahydrofolate dehydrogenase/cyclohydrolase.
pubmed rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase,hydrolase
molecule keywords PROTEIN (FOLD BIFUNCTIONAL PROTEIN)
total genus 100
structure length 287
sequence length 287
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b0aA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1b0aA02
3UXYA 3U5TA 1E3JA 3GLQA 4RQTA 2YHIA 3VDQA 4MKXA 1CIVA 5KJCA 2AQIA 3IQDB 4MIYA 2GNAA 1Z45A 2P9EA 3PJEA 4ALNA 2ZQYA 4CMAA 5AXCA 4DBZA 2FSSA 3QWFA 3GHYA 1NPTO 2BKAA 2B5WA 2X0RA 3AW9A 1PGNA 2PLAA 1PS8A 3EZLA 4L76A 4OXNA 4XIYA 3WGIA 1HL3A 3OFSA 2XPCA 4BL5A 5KNLA 3WLFA 2X7HA 1AE1A 5IJZA 5FYDA 3VC7A 1PL6A 1F14A 1MC5A 1LLDA 2X0IA 3H2ZA 3M1LA 3R1IA 1KVUA 4INAA 4ND4A 3TFQA 3M2PA 4UVDA 1AUPA 1N7GA 2D8AA 2YDXA 5ICMA 2J3KA 3F1LA 4LSMA 2GUGA 2H9IA 4LISA 1QMGA 1B8VA 3TNLA 2X22A 3KVOA 3D7LA 5A5FA 3D5TA 2YV1A 1G0NA 1VM6A 3ADPA 4D3FA 3FI9A 5KJ1A 5KKCA 1NBOA 2FP4A 4KWHA 4A10A 4BNYA 4L4SA 4ZRMA 3RCBA 4EJ6A 3ROKA 3EVNA 4UUOA 3S2FA 4CLDA 4GAEA 4RPLA 2VQ3A 4L9RA 5EQFA 4DIBA 1R0LA 2UDPA 3I5MA 1G6KA 3DR3A 4ND1A 1XLTA 1B16A 1KVQA 1EVZA 1D3AA 2OGUA 3JQBC 3K73O 4PCVA 4RZHA 4AICA 3B70A 3D4PA 2B5VA 1HZJA 1PJ2A 4NJMB 1TT5A 3VVBA 3WGTA 4CMGA 3TN7A 5JXWA 4PG8A 4GBJA 4NU6A 5CHEA 1BVRA 3P2OA 1LDNA 2YV3A 1SAYA 2Z95A 4J2HA 5ENDA 5A02A 2X1HA 4OMUA 1QRRA 2BGLA 3DQPA 3OETA 3ZDFA 3KUXA 1N1GA 4LCJA 2ZYDA 5JY6A 2VWQA 3GNQA 1E1MA 5JS6A 3PZRA 1YDEA 2Q1UA 1PU2A 3PHIA 3JD3A 3PDJA 2Q46A 3DBLA 4FFOA 4YPOA 3BMNA 2I3GA 3FTPA 1A4IA 4J7XA 1ZVMA 2FPGA 4J9UE 4AJHA 1HSZA 4EZBA 2FY8A 3MWDB 4WEOA 7MDHA 5BNIA 1IHYA 2NV6A 5ER9A 4RPGA 4D46A 4N5LA 4XYGA 1PWXA 4Z0PA 4AJ2A 3QWBA 3DZJA 4WOKA 1XU7A 4RLSA 5DCWA 2GZ2A 4IPTA 4CMBA 1DDOA 2ZB4A 4NNJA 4BVAA 1F8FA 1V3VA 1Y6JA 3PJFA 5BNFA 4EUHA 3GUYA 5IN4A 4PRLA 3JYQA 4D0RA 5CEFA 1GTMA 3DAPA 1IL0A 3GN1A 3T7EA 3M2TA 2QZ9A 4HV4A 2VYND 4EI2A 3OA0A 1BDBA 3E8XA 5I9LA 1ARZA 4K9DA 4MP3A 1EDZA 1YB1A 3CE6A 3H9JA 3DOOA 4UVGA 1P1FA 5H81A 3JCZA 1XIVA 1VSUA 3AWDA 3U4DA 2NVUA 1D1SA 5KVSA 3IUPA 4II3A 2YHUA 3D1LA 2AMFA 1JKJA 1DHRA 1PR9A 5BR7A 2Q99A 2BI7A 2WTBA 3RFXA 4WLFA 2J8ZA 1NWCA 1EZ4A 2QRLA 3UKOA 2FR8A 4G5HA 5ENVA 3WXBA 3ZWMA 1AHHA 4JBHA 5G2OA 1H5QA 1PS0A 1A7AA 2FPPA 3FSRA 1RWBA 3I3OA 2CFCA 4GWKA 1VPDA 3ENNA 3SBOA 2OUIA 3IJPA 5ADHA 4Q39A 4PLFA 1X13A 3KEOA 4BO1A 1HYGA 2HUNA 3MWEB 2O50A 3K2EA 4CV2A 3UVEA 4MDHA 4CLOA 4CV1A 3ZZNA 4BKRA 4QO8A 1GPJA 3GQVA 4FPXA 3I52A 4ND2A 4JJFA 2W2KA 2AE2A 1DFHA 1IE3A 2HCTA 1H6BA 5L3ZA 2GASA 1Y81A 3RI3A 4EGFA 1I01A 4W6ZA 1WNTA 2Z1MA 2QW8A 4IZIA 4DVJA 3I9MA 1YL7A 1ONNA 3MTGA 3GRKA 3JYNA 1AXGA 3CPSA 1WDMA 3EUWA 5TJ9A 3DZFA 1W8DA 4IIUA 5KKAA 2C2XA 1AHIA 2ZKLA 5JMWA 4QSMA 1ML3A 5TS3A 2Y1DA 2HLPA 2J3IA 3U4IA 4D79A 3H2SA 3JD1A 1FDUA 3VPXA 5DN9A 1XYGA 1OI7A 2UVDA 1KEWA 3TRIA 4YJHA 1QYCA 4TRMA 1YGYA 2ZQZA 3W8DA 4AJ4A 1GU7A 2GSDA 3PXXA 3A28A 4Z0HO 4WK6A 5THQA 1YL5A 1Q7CA 4BNFA 4BO2A 3ZWYA 1HDRA 3ROQA 1VJ0A 5AOVA 4Y6RA 4RPJA 1KC3A 1MGOA 4BKOA 3EHEA 3RQSA 3G3EA 4CV0A 5T57A 2PA3A 3EW7A 3WQSB 1FF9A 1E1KA 2Q49A 4P4LA 2OO5A 4AJEA 4DPLA 3ZWVA 4PVDA 1QSGA 3C1AA 1D7OA 1TT7A 4DREA 4WASA 1A7KA 1KVRA 4HNGA 4RGBA 4S1VA 5KJFA 4I5DA 3LC1O 1Y9AA 5JPIA 1QORA 4IDBA 4BB6A 4GSKA 3RU9A 1R16A 5FF9A 4E3ZA 4O6VA 5JLAA 3ZU3A 2AG8A 2Y66A 3PYXA 3H9GA 1EUDA 5AXDA 4M49A 4XR9A 3OEYA 3S55A 1JVSA 4BQRA 4IDCA 2G76A 5THKA 2JCYA 2WSBA 4BNJA 2NVWA 3RKUA 1R4MA 3IAHA 1HKUA 4A2CA 4B3JA 2HRZA 2O2YA 2B35A 4YT5A 5JDCA 3V2GA 1TLTA 1A9ZA 1O0SA 1U8XX 2B69A 4O0LA 4XB2A 1LTHR 4E6PA 2C7GA 1O6ZA 3AY3A 3OQ6A 1DB3A 4HFJA 3NUGA 1HT0A 3H9QA 1HLDA 2VUTA 1GYPA 3D4NA 4MOWA 3DEYX 3E48A 3C7AA 3MJCA 3JSAA 4DA9A 4FSHA 3DMTC 4M87A 4PLZA 1WDKA 5A9TA 3UF0A 3H3JA 1T2FA 3HDQA 4JNKA 1WWKA 1YQXA 1BHSA 1MFPA 3QSGA 1MV8A 1V9LA 4L4XA 5TJHA 4ND3A 1PJLA 3NAQA 3I4CA 3WMWA 1JN0A 1O9BA 3GRPA 5TT1A 3VH1A 1KC1A 3ENKA 4E5MA 1W4ZA 1R37A 1PSDA 2ZIZA 1ZMOA 2FWMX 3F5QA 4ZQGA 3PGXA 1NX6A 2J5RA 4IQ0A 2WYVA 2Y1OA 4Y98A 5EN4A 2DUUA 3TOXA 1GZ6A 2PGJA 3U0BA 1BRMA 4F46A 4ALMA 2A92A 6LDHA 5KVQA 1PZEA 4HUJA 3JTMA 2EWMA 4BNMA 4UREA 2IDZA 1ISIA 2YDYA 4EBFA 3ZWCA 1MG5A 2V65A 4UEJA 4URFA 4DYVA 2GERA 4XQEA 4ZD6A 4MPDA 5HA5A 2D5AA 4CMKA 1JDJA 3DOCA 3KETA 1MP0A 3VPFA 1Y8QB 4PVCA 3ROMA 3ORFA 5JDIA 2Q1WA 4ZQFA 2EKLA 1KS9A 3WGQA 5IZ4A 1EBFA 5HS6A 5I9NA 1C0KA 2BD0A 4TMFA 1WAMA 2HK9A 5L9AA 4FB5A 2HK8A 2DM6A 4IM7A 3KYDB 2P91A 1JA9A 3QVOA 3E6AA 3WDSA 1MC4A 2CF6A 1ZEJA 1H94A 3BIOA 3DAFA 4U8GA 4UEOA 4I1IA 4RF5A 1XSEA 1PL8A 1F0YA 2W90A 3AOEC 3PFFA 3FD8A 5GY7A 2H5LA 1HE3A 4FR5A 4DC1A 2IE0A 2VOJA 1U3WA 3GR6A 3ZWBA 5TX7A 1NQTA 4QTZA 3PLNA 4MVJE 2ZJ1A 1U1IA 4PZCA 4TZKA 1ISMA 4I9NA 1NXQA 1T24A 3PGJA 1P3DA 2I65A 2WE7A 3MJSA 4WCFC 3UCXA 2VRCD 3RC7A 1DLIA 4MVJM 4I5EA 1PGOA 3I9OA 4CMHA 1GCOA 3FF4A 3PVZA 4FC7A 1LSUA 4AJPA 1CDOA 4BO0A 3JQ8B 1PZFA 4MVJA 2VRBA 3FWNA 3ZHYA 3NGXA 4LGVA 1ZW1A 1E92A 3IMFA 3T7CA 3WG9A 4IDEA 1B3BA 1NTOA 1DAPA 2P5UA 4EUEA 3CSDA 5TRTA 2CDCA 1KY5A 4TROA 3MEQA 4L4RA 4CLRB 9LDTA 1NPDA 2JD0A 1P77A 1O8CA 4R9RA 2QYSA 2CZCA 3OM9A 5IZCA 1NHGA 5IG2A 3GVHA 4OJNA 2ZK7A 3RUAA 1J0XO 4BV9A 1C1XB 1K6XA 3SXPA 5I8WA 1J49A 1LA2A 2QZZA 3OJOA 4CPDA 1EUCA 1BXKA 1HDCA 3GEGA 2PV7A 3R3SA 5JW6A 2VZ8A 3LT0A 5JE8A 4YAIA 3AUAA 1IULA 3GDOA 3WBFA 4ALJA 2J3JA 1PQPA 4QUKA 4BO7A 3GEDA 3KBOA 5FI3A 5LDGA 4UUPA 4YWJA 3ZI0A 3BTUA 1OC4A 4CM9D 3OQ1A 4IINA 3ZNNA 8LDHA 3GVXA 2I5PO 3ZU4A 1ZKMA 4IY1A 1JQBA 4E32A 4RVDA 4K6FA 4BNKA 4MVJD 1VE9A 1LSJA 3TDKA 2A35A 2HK7A 4Y6PA 3GY0A 2GN4A 1U4SA 1W73A 1H0KA 1L1FA 4Z9YA 1QLJA 3PK0A 1U2GA 4A27A 3LLSA 5ITWA 3PZBA 3GFBA 4WPGA 3I83A 1NFRA 4B79A 1DIGA 1XEAA 4YDRA 3E03A 4I9UA 5L40A 3PTZA 5L7YA 1X1EA 4M89A 4RF3A 4UAGA 2B36A 1Q0HA 2JCVA 3RUEA 4HADA 1OFGA 5COQA 1Z6ZA 3TPCA 2RHRA 4HNHA 3VKUA 3OJFA 2QRKA 3BHJA 3WR5A 3QHAA 2EKQA 3DZGA 1YBVA 4CM9A 4UUNA 1QG6A 1YL6A 2VUSA 3AOGA 4MVJG 4E5PA 5U9CA 1DO8A 3ABIA 1A27A 1KY4A 2AEJA 3EC7A 4FD3A 4PLCA 4XZ3A 4J16A 3ZH2A 1E3IA 4LCEA 4M8SA 4ONEA 3LSYA 4W7IA 3BYZA 1ORRA 2EEZA 4IDAA 1TA4A 1DJNA 1C14A 1Z73A 2E49A 1HE4A 2UUPA 2PNFA 1GDHA 3WGYA 2CNBA 3F4LA 3AM5A 1PJBA 2BFPA 3QE3A 5B37A 2ZCVA 3HDJA 2OP0A 5EJ2A 4O59O 3RIHA 3ULKA 1YBAA 2DBVO 2DFVA 3DB2A 3VKVA 4BNIA 5JAIA 1Y7TA 4CM1A 3VH2A 5CDYA 2CF5A 1SOVA 4K6CA 3GVCA 1HYEA 1BXZA 3I6QA 1NQ5A 3JQ7B 3W1VA 2E4AA 2BLLA 1I3MA 3BMNB 3NRCA 3TWOA 2AG5A 1PGPA 3D3WA 3C7CB 3QVXA 4R16A 1I36A 2NU9A 1KEUA 1I30A 3JYLA 2CD9A 4E2WA 3PYLA 4BKPA 2WYWA 3JD0A 3KZVA 1XA0A 3MZ0A 2VCYA 4E13A 4J1QA 3U49A 3DL2A 5GMOA 4CM4A 3ASUA 1UAGA 5JAQA 4OH1A 4E4YA 2Y05A 1G0OA 1ZJZA 2C5EA 4DQXA 2ZB7A 5C3MA 1U5AA 1B8PA 4PRKA 1SZJG 1GEEA 4MKZA 4RV9A 4RL6A 3RC2A 4R5MA 2Y99A 5AQ1A 5A04A 3RSHA 1ONOA 4F6CA 2JHFA 1OOEA 3L9WA 4D45A 5A3VA 3B1JA 1EUZA 2JAHA 2A4KA 1NAHA 9LDBA 4KQWA 1XELA 1XQ1A 1N92A 1WMBA 1ZXBA 3O4RA 2DU8A 4BO3A 2R6JA 3DO5A 2HMWA 1EDOA 1LRLA 1ZSYA 2X9VA 2ZYAA 4P4NA 1P1HA 5T6BA 5KCZA 4G2NA 4HBGA 2FPIA 3ZN2A 1H2BA 4GLOA 3Q9UA 4WCFA 1MB4A 2Q50A 3UAGA 5I7FA 2D1YA 3RU7A 1T2DA 2BGKA 3KHUA 4XA8A 1F06A 1H9AA 3LT1A 2Y0DA 3IP3A 1U7HA 2EP5A 3C24A 1NFQA 2DT5A 3IDSA 1SCUA 1Z74A 1SNYA 2YV2A 3VZPA 3TOZA 4H3VA 1LXCA 2VYVA 4GVXA 3GG9A 3VH4A 3WTBA 2HSDA 4QFDA 4BKQA 5BNTA 2IEDA 3QIVA 1IYZA 4IDDA 1JAYA 1NVGA 1C3VA 1FDWA 3BTVA 5T5QA 1M6WA 1LRJA 4FN4A 2V6BA 3PI7A 5EQDA 3ZV5A 3ONEA 4XYMA 4XIJA 3JYPA 1O89A 5KTKA 3V1TC 4J1NA 1MG0A 1ADGA 2GRAA 1OC2A 4RLHA 5CPFA 3ZNQA 3FHLA 4YRAA 3BMCA 1G1AA 3H4VA 1E1NA 1SBYA 3EVTA 1UDBA 3S2EA 1LI4A 2E37A 4HKTA 3C8MA 2XF8A 3G79A 2W4QA 4OOEA 3JQGB 1RM4A 2FR1A 3OHSX 2NWQA 3LZ6A 3KB6A 2Y68A 2DLDA 3K8ZA 3DMTA 4YJDA 1BW9B 1ADBA 1B7GO 1I2CA 2TMGA 3KRTA 3ADOA 3H5AA 4DMMA 2NVUB 2GDZA 1UXKA 1UDAA 2QQ5A 1YKFA 3AM3A 1ULUA 4GMFA 4UEKA 2YQ4A 5CG2A 1GL3A 1C0PA 4FC6A 1PJCA 3QQPA 2PKQO 2VT3A 4MVJP 4JLWA 1R66A 1VC2A 2JFHA 3DDNA 1WP4A 4M55A 4PLGA 2YYYA 5HS4A 4EJMA 1YRLA 1CWUA 3Q1LA 1PL7A 5JBIA 3WB9A 3VHRA 3BTOA 1GCUA 4JJIA 1N7HA 3PDUA 4B7UA 4FJ1A 3IUSA 4E2ZA 2YZ7A 1HE2A 3PQEA 1VRWA 3JQCA 4BGEA 2Q3EA 4AJKA 4WJZA 5K6AA 4OYRA 2BI8A 4NBTA 3F3SA 4YB8A 4X54A 1ZNQO 1EFKA 4Z0TA 3WGZA 4CJXA 1N2SA 2D4AA 2YFQA 3A14A 3FBGA 1WMAA 5BQFA 2B0JA 3RUDA 1UZNA 2GGSA 3I4FA 3BMCB 3TL3A 2P5YA 4GQAA 1R4MB 2GCGA 4E33A 4DXHA 4IS3A 3U4HA 4YA6A 5COBA 3HADA 2DC1A 2NUAA 1EE2A 4FQ8A 3D5QA 3ZHZA 2AXQA 2OFPA 2Q2VA 1B8UA 5IAAA 1WZEA 1X7HA 2EIHA 1KEPA 5DOVA 1I2ZA 3NDJA 3OIGA 1EVIA 3P19A 1PJ4A 1L7EA 1E3LA 3EMKA 4BOYA 1E7RA 1PS9A 5BSFA 1HXHA 1EVJA 4Q9NA 5G0TA 2QHXA 5DP2A 1DRVA 3ETGA 5K6AC 5G0UA 4CQMA 3K2BA 4IJVA 3O8QB 4FGWA 4BO5A 3S8MA 2EERA 2HKIA 4AJNA 6ADHA 5G4KA 3GNTA 3GGGA 4U7WA 2D5CA 2F1KA 3E18A 3QVSA 5T67A 1E6UA 4WECA 4TRRA 4YCAA 4J49A 5BT9A 3C85A 5HWSA 1RYEA 1Z82A 2FSVA 3L77A 2CVQA 3UCEA 4IUYA 1K5HA 1DOHA 3AU8A 1HETA 4WNIA 4BGIA 2X5JO 2Y1CA 3WOHA 2YQ5A 3PJGA 3QJ5A 3I9JA 3LLVA 1UAYA 4WLUA 2R00C 5EL0A 3DBHA 3ICCA 4DIOA 3KXDA 5JAZA 5TQVA 3ST7A 2FHSA 1VL8A 1Y8RB 2Q2QA 2GD1O 4GX5A 4YT4A 4FJ0A 4B3HA 4E21A 1NHWA 4JQCA 5BSGA 2PD4A 4ROSA 5IN5A 5KVVA 4IBOA 4DL9A 3BXXA 1D1TA 2IYOA 4TVOA 3VVCA 1P9LA 1NPYA 2Q1TA 5K0ZA 3VH3A 2WEKA 3JQ9A 1Y8QA 1E6EA 1GUFA 2NU7A 2OBNA 3WBBA 3V5NA 4F3YA 2PZJA 4R68A 4WNCA 3NEPX 3RBXA 1LNQA 2DUWA 3KO8A 2ILTA 3KOUA 1HYHA 4JGBA 2V6FA 1PEDA 1HLPA 1SB8A 3RJ5A 4J7CA 4Y8VA 1LC0A 1PJSA 3FRJA 1YXMA 3MCVA 3RC1A 3ZV3A 4B8ZA 5EESA 2PH5A 4W82A 4HX5A 1EK5A 2VHVA 2DBQA 4LMPA 4YACA 5C7OO 1MX3A 4HWKA 1V8BA 4OOFA 4BMSA 3AFMA 3RD5A 5A05A 1CJCA 3B1KA 4B4WA 4BIIA 5EPOA 1BSVA 4PLPA 1LDEA 2C59A 1V3UA 3I9NA 4AVYA 3FR8A 4MIOA 3MJ4A 4QT0A 5JO0A 3DBHB 2I6TA 4IQGA 4DPKA 3ZNOA 4WLEA 4PG4A 2W2LA 1FDTA 1VLLA 3K31A 2I76A 3AOEA 4A0SA 3CMMA 4BNZA 1X0XA 1K6JA 2VHYA 1BXGB 3I6IA 4PG7A 1CEQA 3CZRA 1H6DA 1DIRA 1NQOA 2XXBA 3JD2A 1ULSA 4PG5A 1N9GB 3WSWA 4GPD1 5A03A 3FWZA 3V2HA 3HE3A 1LJ8A 4FJ2A 4L8VA 3L6EA 3OJLA 1K3TA 4WOJA 2O3SA 3GOHA 1WXDA 3E82A 4IQ8A 3F1KA 1X7DA 3EK2A 4OGWA 3OA2A 3L6DA 4OSPA 1E3WA 4JJGA 4K26A 3ONDA 4YBZA 1VSVA 1R0KA 1C0LA 1K2WA 4PGFA 4CL3A 3H3FA 1E5LA 4BNXA 4IJUA 1I5RA 3P7MA 4CM7A 4DLLA 1QV6A 1GYRA 4G81A 1ISGA 2WMDA 2NTJA 1EVYA 1GFSA 4RVSA 1ENYA 3BMQA 5H82A 1GUZA 1DFIA 2WYUA 1DBVO 1ZBQA 4RVUA 1P1RA 1VL6A 2EKPA 3LF2A 1MUUA 4QXMA 5AXAA 2C0CA 3DONA 2BFAA 2JL1A 3IP1A 4E0BA 2PGLA 4WKGA 3OQBA 4WLVA 2X5KO 3RFVA 2HMVA 2NSDA 3G49A 1GD1O 1W0CA 3BHIA 2VWPA 4E5NA 1ZJYA 5JFOA 2HMTA 4M54A 1DIAA 3KYDA 4TZTA 1X7GA 3R6DA 1H6AA 3RBVA 4R5HA 4Q3DA 1GEGA 2EW8A 4E12A 1B15A 1D8AA 4FFPA 1R6DA 1PGQA 1SPXA 3OICA 4CODB 2DKNA 2VHWA 1CQIA 1DRUA 4ZHSA 1LDBA 1KEVA 3GFGA 2IRWA 2X8LA 4P4GA 1P0FA 3GAZA 3ROPA 1IOLA 3G1UA 4GX0A 2OBYA 4QQRA 3E5RA 4GGOA 2OZPA 4R9SA 1JKIA 1VJTA 2D0IA 1EFLA 2POQX 1DJQA 1U4OA 2HMSA 2QIOA 1DEHA 1DSSG 1P31A 1ZSVA 4GH5A 1M66A 1XKQA 2O3TA 4N7RA 5BSEA 4BNVA 4CUZA 2PZKA 3KLPX 1CF2O 4EJ0A 1BDMA 4GL4A 4KTVE 2ZYGA 3DTYA 4ZRNA 2TMDA 3GZNB 3JQDA 5B4TA 5KWEA 1KVTA 3C3XA 2NQ8A 4KUEA 2OOSA 3X2EA 3TL2A 3RASA 4JP2A 3TZHA 2R2GA 1E77A 4NK4A 3WFIA 5J23A 2O4UX 2O23A 3AI1A 2HMUA 1LDYA 3Q2IA 5TT0A 3QLJA 4YQYA 1LDMA 3WLEA 1Q7BA 4W9NA 3IKVA 1I0ZA 3PP8A 4S3MA 4XEHA 4P8RA 5CFZA 3ZCXA 4FDAA 1E3EA 4B8WA 5DNAA 5JC1A 1B3RA 2Z1NA 1K89A 1EBUA 1NR1A 4WLNA 2V6GA 1XDWA 3SC6A 1Q0QA 2FMUA 2WE8A 1EMDA 4BUCA 4MVJF 4GWGA 3DBLB 5U1PA 2W2KB 1QP8A 1RJWA 3F9IA 2NU8A 3KYCA 4J0EA 3GPDG 4BNWA 4JN6B 3UGKA 4RPHA 2YFHA 4LRSB 2EGHA 3DOJA 4CM8B 3HZZA 4AJJA 5JSFA 1NASA 3HG7A 4NMHA 3HSKA 3OIDA 3V2UA 4D3DA 2VUUA 3L4BA 4O63O 1CQJA 2QG4A 3H9EO 4I5GA 4RF4A 3PQDA 4XB1A 4D42A 1K6IA 2VYNA 4PG6A 4GI2A 2J3HA 4BGUA 2IXAA 2JD1A 3MJVA 4TRJA 4CV3A 3KSZO 3G1TA 1NAIA 1GYQA 3MJTA 3WIEA 2GZ3A 1JWAB 3F6YA 2I66A 5CP8A 4BNLA 5K9ZA 3GEMA 4B3IA 4YJHB 3ANNA 1UXJA 3S2IA 4W4TA 2Z5LA 1R0SA 4DLBA 4YRDA 4XWYA 4EUFA 4WCFB 1TEHA 2BF7A 5TGDA 1H9BA 2DAPA 3L4BC 4FIZA 4OHUA 1GR0A 2DBZA 2ZTVA 2FR0A 3LQFA 1IZ0A 1E3SA 1T4BA 3WS7A 1YE3A 4DGSA 4L74A 2GF2A 1VKOA 5JCJD 3M6IA 3PWSA 3TSCA 5DULA 4A73A 2PWZA 4KMSA 1R4NB 4U6QA 2O3UA 2Y0CA 4BGVA 2H63A 4FFLA 1UP4A 2IXBA 3O26A 4GX1A 2NNLD 4RCVA 1J6UA 1VKNA 2CMDA 3D64A 1UZMA 3GDFA 3VDRA 3KEQA 4ALKA 1YBMA 1SB9A 3Q9NA 1T4DA 3NT5A 5F1KA 4DRYA 2VTEA 3L6OO 4MO2A 4NG5A 3SLKA 4B7CA 1ZSNA 2AEMA 3WYBA 1A4UA 3GT0A 3BAZA 4Y6SA 5G0SA 4D41A 1NYTA 1WPQA 2UYYA 1V3TA 1YOVA 4J1SA 5DT9A 3LC7O 1HF3A 1Q1NA 3CTMA 4HFNA 1ENOA 1LSOA 2O2SA 3JYOA 4EITA 2NVBA 5JY1A 1V35A 3WJ7A 5I7SA 2RH4A 3ASVA 2W98A 2FZEA 3BTSA 5TIIA 3RJ9A 2DQ4A 1NVTA 2CSUA 3NDRA 4ZJUA 2NLOA 1V6AA 2AQ8A 5T8KC 4R3NA 3CKYA 3W4IA 1Y1PA 5F1PA 4F45A 3JQAA 1RYDA 2A94A 1X1TA 4Q3EA 3NKLA 5KOIA 3ICPA 4JROA 2IZZA 1U5CA 4R51A 2XOXA 4CMJA 4KUHA 3TZKA 2EG9A 3CEAA 4ZU3A 2GN6A 3T4XA 3S2GA 1JW9B 2B4TO 2J5KA 5TSDA 1LQTA 1LC3A 5G0WA 4EYEA 1F8GA 2Q4EA 4FBGA 3KSDO 3CMCO 3JV7A 1XU9A 4Y67A 2RBEA 5FEUA 4NBVA 4DQUA 4DMLA 4BMVA 1CERA 1TXGA 3VZQA 2G82A 4BMNA 1T1RA 1UJMA 4BQPA 4N18A 7ADHA 1DAOA 4FS3A 5FWNA 2E6UX 4ZICA 1XG5A 4LRTB 5C5IA 2E48A 5JNLA 1E7YA 4R1SA 4U6SA 4KWIA 3NV9A 3DHEA 1ZK2A 2ZB3A 4CQLA 4DPMA 3WJAA 1P45A 2HJRA 4OIMA 2Y0EA 1F17A 1NM5A 3HB4X 3WTCA 3ZWWA 5T8KA 3HJAA 2PY6A 1BVUA 3FNHA 3FCOA 5DP1A 4CUJA 3NTOA 5B1YA 3VPGA 1P1KA 4I9HA 1PJQA 2FN7A 1I33A 1P1JA 2HRBA 3H5RA 3RUFA 3NX4A 3UICA 4IXTA 1CYDA 2EHDA 3GGOA 4A03A 2HDHA 1KETA 2H6EA 1MLDA 1M6HA 4ND5A 2WM3A 3UFXA 5B4VA 5EERA 3WGOA 1ISJA 4DQVA 1XCBA 5H83A 3KM0A 1H93A 2NTNA 3GMSA 2BHLA 2VN8A 2HU2A 5JO9A 3ETEA 5EINA 4BO8A 1U3TA 1WW8A 4A7PA 1CRWG 2O3JA 1LBEA 2DTDA 2CUKA 2UUOA 3KLMX 3WNVA 1AGNA 3U3XA 4C7KA 3BZUA 1JVBA 1GQYA 3JQ8A 1BGVA 3H6KA 4FW8A 4DLAA 3HQ4O 4OM8A 1A5ZA 3H7AA 3W6ZA 1PZGA 4HY3A 2AEFA 4M1QA 1HDYA 3R3JA 1R4NA 3VTFA 5HBRA 1HRDA 4ZQHA 2A9FA 3AU9A 4RORA 2C29D 4B4OA 2X23A 8ADHA 2P9GA 1YQGA 1DHTA 4U0JA 4C4OA 3F4BA 1C1DA 3O03A 1EEHA 3EDMA 2J5QA 3Q0EA 4JK3A 4GGPA 4RPKA 3B1FA 3SVTA 2NQTA 2QYTA 4J90A 4PZEA 4J3FA 3LVFO 1UP7A 2VT2A 5B12A 5JMPA 3RUIA 4IJKA 3L9XA 4R4JA 5DOZA 4TKLA 1Q0LA 4JBGA 4CR7A 3FR7A 2O3RA 2BH9A 3W4JA 1E7MA 3AJRA 1E7WA 3PIDA 4QEDA 2BFOA 2XXJA 3U62A 3DZHA 2X0NA 4GSLA 2GZ1A 5L4NA 1E6WA 1QYXA 4K28A 2VYVD 3BA1A 1T25A 3SJUA 3WQQA 3Q2KA 4WUVA 2LDXA 2DVMA 2JD2A 2BELA 2VHXA 3PHGA 4ILKA 5FFFA 5BSHA 3U4CA 3VTZA 3GNSA 3SLGA 4NH4A 3A4VA 5CPBA 5A9SB 5AVOA 3ZNPA 4YR9A 5JAMA 1TI7A 2X9NA 4OKIA 2AQKA 1LU9A 2DPGA 4JP3A 4R1UA 4Y9DA 4NIMA 4JBIA 4YYZA 4CMIB 4J4BA 3PWZA 2QX7A 5CDUA 5A5EA 1T2AA 3D0OA 2PTGA 3Q3CA 3SJ7A 2X6TA 2IZ0A 3A9WA 4XGIA 1UR5A 2GN8A 1Y8RA 3LF1A 4C7JA 2FOIA 1E3WB 4R54A 3F5SA 4RDIA 4P22A 4GVLA 4J6FA 1QYWA 4PLWA 2ET6A 5JDCC 4BNHA 4D7AA 1DC5A 1E1LA 2VNAA 1EQUA 2JHGA 3AFNA 3GA0A 4IDFA 4R01A 3ZHBA 1UXIA 4CM5A 3OSUA 4MP8A 4XKJA 3N58A 1IUKA 1O94A 2C2YA 3NJ4A 1B14A 1DXYA 1ZEMA 1EK6A 4RVHA 1GUYA 1VI2A 2OHXA 4IDGA 4CQLB 3N74A 4NFHA 3AK4A 2EP7A 1FK8A 4UUMA 1MA0A 3CIFA 4LK3A 3RVDA 3BMOB 3UH1A 1HDOA 5L7WA 5ICSA 3NT2A 3NTRA 2PK3A 4RO0A 1HSOA 3H65A 4XD2A 2X86A 2PD3A 3H9UA 3PFWO 4XYEA 3E9MA 4HFMA 5DF1A 2D3TA 3I9LA 1Z7BA 1U7TA 4IS2A 4RZIA 3H8VA 1W6UA 4XJTA 4NK5A 1SMKA 3D3WB 3UUWA 1OAAA 1UP6A 1A72A 1EQ2A 3WGGA 1WVGA 1GY8A 4AL4A 4F6LA 4YXFA 2HAEA 1ZK1A 4EEZA 3OIFA 1ZK0A 2ZB8A 5IDWA 4ID9A 5JC8A 5KIAA 1PX0A 1SO8A 4CM4B 1LSSA 4I5FA 5C7IO 2EXXA 2ZATA 1T26A 4CR6A 2O3QA 2C54A 3M1AA 3GPIA 3HFSA 4GKBA 4Q3CA 4BS9A 5JCXA 1XWFA 3HN7A 5GZ3A 4J1TA 1BWSA 1Y5MA 2GPTA 2SCUA 4I08A 3GC6A 1ADCA 3QW2A 5LCXA 1Z75A 3WX0A 1NFFA 4H16A 1SC6A 4IJWA 1Z7EA 3WIDA 4EEXA 5MDHA 1HDZA 3EZYA 3RUCA 4MVJH 3OF2A 4J0FA 2E82A 2NADA 4WLOA 3RWBA 4AG3A 4R69A 1CETA 4MJLA 4TRNA 5A1TA 2X0JA 2ZCUA 3W8EA 2YHIB 4KOAA 3GZNA 2PKQP 3HB5X 1BMDA 4Q3NA 1EE9A 5ILOA 2YY7A 3UCFA 1ZK3A 4BHTA 2WD8A 3E1KA 4OQZA 3RKRA 3COSA 1GPDG 3ZV6A 1K0UA 3W8FA 4XX0A 4FFNA 3B6ZA 2DPHA 5KJEA 2ZTLA 4U0KA 4KZPA 4OXKA 3RFTA 2C07A 2CY0A 4XCVA 4BKUA 3BMQB 1LLUA 2OMEA 1UXHA 3GVIA 5TLSA 1LLQA 1JWBB 3IIEA 1HZZA 4FGSA 3DWFA 4TKMA 3DBRA 4NHEA 4NR0A 3DZBA 1GV1A 3BHMA 5AYVA 3ONFA 1N8KA 1Q7GA 3QA9A 1DPGA 3T4EA 2JFFA 1XQ6A 3KYCB 3LU1A 1M2WA 3L0DA 3RAJA 4B7XA 5ER6A 4NI5A 2ZJ0A 2X58A 4NQZA 3G17A 3RROA 3VOSA 4ZA2A 3I1JA 1ZMTA 4J7UA 4WCDA 4EDFA 2BRUA 2F00A 2JKVA 1N1EA 1GV0A 2HQ1A 4CMEC 4DWVA 2NACA 3NGLA 2Y93A 1PZHA 4J9VA 3ZWXA 4FFMA 3QV1A 2CVOA 1VL0A 3IS3A 3ZWOA 1PJ3A 5HRUA 1R12A 2RIRA 3JD4A 3JQGA 4ZN6A 3A1NA 3FTNA 2GR9A 4YAKA 3DTTA 4R1NA 1PWZA 1YB5A 2G17A 4XDZA 4D3SA 3OEWA 4P38A 1D4FA 3FNEA 5DBFA 3ZU2A 3EAGA 4RF2A 5KVCA 5C7LO 1T2CA 2VZ9A 4YJGA 3U09A 2Y1GA 4L73A 1QR6A 1IPFA 1ZZEA 2H1SA 1JU9A 3FNFA 3NDIA 1GZ3A 4NJMA 1I32A 3PRJA 3D4OA 1HWYA 1ZIDA 1RM5A 4GMGA 3OJ0A 2VRCA 1P1IA 4PLYA 3DZIA 4YEDA 4HP8A 3TF5A 1O95A 5DBIA 2BFMA 4DC0A 1J5PA 2VZ0A 3RC9A 1R15A 2VTDA 2AHRA 3TZQA 4IXWA 5EIOA 4Z3KA 1M67A 1DFGA 2JJYA 2GN9A 3FN4A 1ENZA 3HFGA 3RBZA 5JDIC 4UVIA 3EGOA 4CLEA 4HFRA 4AJOA 3V1YA 3UW3A 4BB5A 1DC6A 3G0OA 2J6IA 1RPNA 3E9NA 3K5PA 3PHJA 3UOGA 2CDAA 3H5NA 5GZ1A 2EJVA 1ISFA 2V6MA 2VNSA 4NBUA 3CUKA 3TZ6A 1UDCA 3LT4A 4TQGA 5MGBA 3DAGA 1LRKA 1MFZA 1YONA 4U5QA 4XQCA 2AQHA 2RH8A 3ZWPA 2AE1A 3WGHA 1QYDA 3W4KA 3AM4A 4W7HA 2JAPA 4QFCA 1SOWA 1PQWA 4TVBA 3S1LA 5I7EA 1P74A 4KDEA 4D43A 4QX6A 4MP6A 2I9PA 3TJRA 5A3JA 3GH3A 1M75A 1S6YA 1XR3A 2NM0A 4PIVA 4XQ9A 1MXFA 4Q3AA 4TSKA 5C37A 5G4LA 1UH5A 3E9QA 3QRWA 3INTA 4YJGB 2W8ZA 4H7PA 1L7DA 4CQMB 3IC5A 3GF4A 1I3LA 4YVFA 1IB6A 3OMLA 3AY6A 1DIBA 2IYPA 4PN3A 4O1MA 4XQGA 2GYYA 4NZ9A 5TF4A 3JQAB 4PLTA 1TT5B 3INGA 1I8TA 1NVMB 2D2IA 5LC1A 4YT2A 1YB4A 1SEPA 1I10A 4LW8A 1KYQA 2WD7A 3WYEA 1GZ4A 4W9NC 1MXHA 4Z9XA 3U9LA 1WLYA 1KIFA 4B4VA 3JQ7A 1N5DA 4E2YA 3ZWNA 1Q2XA 5TC4A 2O4CA 5CAEA 2Y67A 1FDVA 3GUCA 4GX2A 2Q45A 5L51A 2DFDA 2VWGA 5IFLA 5T64A 3W6UA 1NQAO 5IF3A 5ILGA 5F5NA 3VZSA 1AN9A 2PZLA 3Q6IA 4FCCA 5ES3A 3FPLA 2V7PA 3DHYA 4UULA 3X2FA 1HE5A 4DBVO 5HM8A 1PQUA 2XAAA 4JIGA 3QVWA 3K30A 3WFJA 3K6JA 2OXIA 3JQEA 1LEHA 1YO6A 1E7SA 4XJSA 4PLVA 2P4QA 5L53A 4CLHA 4YTEA 5JYEA 2NU6A 1NR7A 1U8FO 3K96A 1IZ9A 4BO4A 1FJHA 2P4HX 4WE3A 5G0VA 3SC4A 1GQ2A 1P44A 3WYCA 3P2YA 3K9QO 1FDSA 3TQHA 4AJLA 2Q2WA 2FRDA 5DCUA 1X15A 4ZQEA 4CUKA 2RHCA 1Y5RA 4YJFA 5IDXA 5A06A 2OORA 2VOEA 3ZW9A 4J4HA 4BNGA 4CR8A 3MOGA 3JQFC 1P0CA 3B20A 3WSVA 1H2HA 3ZHXA 5LDHA 2B37A 3Q11A 4J43A 1IY8A 4CMCA 1YS4A 1ONPA 1JLLA 4HXYA 4LVCA 3PJDA 3OJEA 2PR2A 3HDHA 1YOVB 3IOYA 4LVUA 2O7QA 4MVJI 1HEUA 1M76A 2EGGA 4R3WA 3VPSA 2OL4A 1ID1A 1GQQA 4E5YA 1B0AA 4ZVVA 1XGKA 3INRA 4KP7A 3WICA 5FI5A 4N5MA 1DC3A 2WWRA 4DUPA 3KV3O 2C5AA 1WDLA 4ALLA 2X4GA 4R41A 3C1OA 3KYBA 1U2DA 3HWRA 4ZQBA 4DYDA 3NJ8A 1PJTA 2RAFA 1RM0A 1ZH8A 1BTOA 3K92A 2VHZA 1YJ8A 3ON5A 4RDHA 1KVSA 2JCXA 1N9GA 3GK3A 3PEFA 1QXSA 1UZLA 3QP9A 5I7VA 5DBGA 1QYVA 4MKRA 1I3NA 4MINA 5CEJA 5IXYA 4AFNA 1HTBA 3KTDA 1BG6A 2YW9A 1KBZA 4FOOA 3SX2A 1A9YA 3WQRA 3STHA 3IJRA 3DXFA 1NNUA 4CLOB 3ZWAA 3VAZA 2PH3A 4CQMD 2G0TA 2VWHA 2LDBA 1E5QA 1JKFA 3DC2A 3E5MA 4J91A 3GMDA 4OO3A 2EJWA 1ZUD1 1YVEI 3ITDA 1T1SA 4PZDA 2UAGA 3MOIA 4JXKA 4RVFA 4QO7A 3SEFA 5F3RA 4OKNA 3QY9A 2ZTUA 2NTVA 1KOLA 1A71A 1YH3A 3DMYA 3WNQA 2Q1SA 3ZW8A 4BO6A 4DTIA 3AY7A 4UVHA 4A26A 4NFYA 1S7CA 4NBRA 4XGKA 3AI3A 3GHHA 4YAEA 4BNTA 2BGMA 5ITVA 5CDGA 3ANMA 3QWIA 3VZRA 1LDGA 2I3AA 4BV8A 1XHLA 4E31A 4K1LA 2P68A 5EMHA 1JAXA 4NJOA 2BMAA 2YUTA 3LT2A 4YRBA 5CG1A 5U4QA 3ANLA 1QLHA 3F46A 3LDHA 4ESOA 4OXYA 5TNXA 5A9RA 3OBBA 1GADO 3WWYA 2WD7B 1ZCJA 1UXGA 3CZMA 1YDWA 4RVGA 3ITKA 2GO1A 3QVTA 4WEQA 2DTEA 1LQUA 2X5OA 3MTJA 4CMIA 4YAGA 4IMPA 2O7SA 2W2LD 1U9JA 1YWGO 4E30A 3PPIA 1T2EA 4NPCA 4W99A 3R0IA 1PTJA 4OAQA 2EV9A 3V1UA 5JCJA 2B83A 3L4SO 3V8BA 3IKTA 1U3VA 3C7DB 5IZCC 4QECA 1PIWA 4XYBA 5L4LA 2D59A 2AA3A 4CM6A 1RKXA 5COAA 3MJEA 4I8XA 4H15A 4BO9A 1VJ1A 3FPCA 3HUDA 3O38A 1FMCA 3HDYA 3DBVO 1ISHA 4EW6A 2IEBA 3GZ4A 3JQAD 4Q3BA 4PLHA 2FZWA 3BMOA 3QWHA 4IMRA 3JQ6A 3PWKA 4KUGA 4IIVA 5GZ6A 1C0IA 2P2SA 3DFUA 4AJ1A 3WWZA 2PGDA 3LYLA 1ZFNA 4A5OA 1WZIA 1C1DB 1GAEO 3EYWA 2EF1A 5DZSA 3EY4A 2IZ1A 4B4UA 4CLXA 2JFGA 4ZGWA 4YJFB 3VPHA 1NWHA 2HJSA 5IDYA 3AI2A 1X0VA 1PGJA 1KERA 4R1TA 1B2LA 3LK7A 4RJTA 4XGNA 3PHHA 3GN2A 1Y9EA 1V0JA 5G4KB 1F12A 2DTXA 3CXRA 1NP3A 1P33A 1BW9A 3UN1A 1OMOA 2R00A 3HN2A 4Z9FA 1OZAA 1QKIA 1ZK4A 2YJZA 2CVZA 4XYLA 4AJIA 3JQBA 2Y1FA 5CDSA 3UHAA 5I9MA 3CINA 3P5SA 3TZCA 3OECA 1U3UA 5CEEA 3N7UA 3HHPA 1UUFA 3TFOA 4FOSA 3GG2A 1HDXA 5AXBA 3NT4A 2I67A 5IDQA 5L45A 2QRJA 3CH6A 4J2OA 2Y1EA 3PIIA 1B26A 5DCYA 4YAJA 3ZGYA 5A9SA 1TB4A 1U28A 3JQ9C 3GVPA 2Q4BA 3KSUA 4JX8A 4NU5A 2CDBA 4CLRA 3FNGA 2ZTMA 4XRGA 5KJ6A 4E5KA 4G65A 5F21A 5IXSA 2DBRA 4IZHA 1ADFA 3DFZA 1YJQA 1H6CA 3GGPA 1LX6A 1TVEA 2WJPA 3HNPA 3RUHA 3ZV4A 3ZU5A 2PKRA 4LMRA 1IHXA 1SEVA 4XRRA 4NFSA 5JYDA 4NBWA 4D0SA 4IGEA 2B4QA 3D3EA 3OH8A 4Z6KA 3O9ZA 1PR3A 3L07A 1YQDA 4TWRA 1C1XA 2HO5A 3A06A 3LC2O 3GAFA 1AXEA 1I2BA 4KTTE 1E0DA 4OL9A 1IPEA 1X14A 3I23A 3QWAA 4YT8A 4D44A 3PQFA 5F1OA 2B4RO 4IGFA 3PYMA 4L0QA 3DBRB 3AUSA 4N54A 4DIFA 4N5NA 1ENPA 1FXSA 3DHNA 4LN1A 5I8ZA 2C82A 4J4TA 5HTOA 2EW2A 1DC4A 3NYWA 3PLRA 3O8QA 4OSOA 4GKVA 3FBTA 4GLLA 5DDIP 4LSWA 1ZXLA 2PD6A 5CDTA 3IL2A 1QV7A 3PHLA 2PZMA 4CM3A 4KQXA 4JCOA 2C7VA 4BNUA 1LUAA 2I99A 1DRWA 2GLXA 3F47A 4RQUA 4ITUA 1E7QA 3C1TA 3NTQA 1LLCA 4BNNA 4FFRA 1BXGA 5L4SA 1J4AA 1DIHA 1O5IA 4OQYA 3OP4A 1HDGO 3AUUA 2AW5A 4KDFA 4Z3DA 3I9KA 4NDNE 4UVEA 1ZO8A 1I24A 4II2A 4ALIA 3GDGA 5B4UA 5L95A 2PFGA 1JTVA 2WDZA 4O5OA 4PFJA 4XDYA 2UV8A 5F5LA 4CM8A 2RCYA 2IODA 3AUTA 4M86A 3WMXA 3ETDA 2G5CA 4E2XA 4CMEA 5L7TA 1I3KA 4XR4A 2P9CA 2G1UA 4WGGA 5A4DA 4YQZA 2X9GA 3JQFA 1DLJA 2OP1A 4L75A 2C20A 4CL8A 4MIEA 1RM3A 3DZKA 2O48X 1OBFO
chains in the Genus database with same CATH superfamily
4F2GA 2HWYA 1I13A 4BP9A 2PXAA 2OE2A 5IH3A 1K7EB 3GLQA 4L16A 2Q1XA 4O2AB 5AW3A 2C9DA 1H2WA 1LPAB 1SVUA 3KAQA 2AQIA 3DDCA 3IQDB 2EVWX 4OP3A 2J3QA 1ZMBA 1Q3TA 2ZIVB 3NUQA 2ZQYA 4A82A 2PUTA 4O1HA 2RGYA 3OZFA 2XTZA 1FUEA 3QWFA 4TWZA 3AW9A 3P5BA 3F5FA 4W1QA 4K3UA 1PGNA 3ICQB 2CZGA 4JP5A 2HV9A 4WMLA 2DR3A 5LOVA 3OFSA 1FDOA 4P9NA 1ZJJA 2FSPA 4JI1B 4OY3A 3B7PA 3HM2A 3GJ8A 1BD3A 2H5EA 3HU2A 3IKJA 2X40A 3LX8A 1XVAA 1AE1A 3I76A 2D5BA 1S89A 3OQJA 3EZ7A 2NW6A 1LLDA 3TFQA 1VGQA 2K2QB 4INAA 1RFGE 2GBLC 3G6WA 1P80A 1N7GA 4O8CA 2GUGA 3PNKA 2H9IA 1AT1A 4LISA 1UBEA 5EJFA 4DCSA 2Z43A 3EGCA 3TNLA 3VSDA 3MAGA 1L6IA 2ID4A 2I2XB 3IV6A 3D5TA 4M38A 2V7BA 4MS4A 3E84A 4WY5A 1JL3A 5FADA 5K2OA 5KJ1A 3FI9A 1J8MF 5KKCA 4D0LB 2QUZA 4O2RA 3LWBA 2PLRA 1E9VA 2PL5A 2FP4A 4TMYA 5LL6P 1CDZA 1FS5A 1SKAA 4KWHA 2QOEA 3UPDA 3KU1A 3LBAA 1GUBA 4BWGA 3V7FA 6REQA 3KQPA 4HNUA 1LJUA 2GFHA 4RD4A 3HCCA 5HQ3A 3WC4A 5LBTA 1RWMA 4EJ6A 3ROKA 1VIYA 2P9HA 4N4AA 3MOSA 4BJ3A 2NZ8A 4UUOA 1E1QD 4GAEA 2VQ3A 3K9CA 3LY8A 2UDPA 6YASA 4BZWA 3DR3A 3SC3A 1TCBA 2SKEA 4ND1A 4TUYA 1S0UA 3ISVA 1LPSA 2PUWA 3M3HA 2RJNA 1D3AA 2OGUA 3JQBC 3K73O 4H7HA 4PCVA 4PYQA 2G6TA 2V9ZA 3IP8A 4RZHA 1RI4A 4O4IF 1FRQA 3D4PA 1X92A 2V7VA 4RSGA 1IIRA 4UOQA 3T0FA 3VVBA 4AY5A 3RH0A 4M1TA 1EFVA 3OU6A 5CFPA 2YV5A 4M9ZA 5AJXA 3ZBPA 3RIGA 5CHEA 1JJVA 4GXQA 1V37A 4MO9A 2O57A 3P2OA 1Y3DE 4X0EA 1LDNA 2YV3A 4GR9A 3O4HA 4MW7A 1THTA 1UKYA 4J2HA 4ZAGA 3RVLA 5A02A 5AUOB 821PA 4LOLA 2BGLA 3JATA 2EJTA 2JVKA 2XQKA 3C6MA 3DQPA 3OETA 1ZC3A 2HF8A 4YHBA 4X61A 2V7QD 2W37A 3A6GA 2JZCA 4Z1MA 2EKZA 1EAYA 3JSXA 4GPIB 5TVGA 3WADA 3X1DA 3BOSA 3FPKA 3VM6A 4YRKA 3PHIA 3PDJA 1TMOA 2Q46A 5LP6F 2I3GA 4J7XA 2PG3A 2P3QA 2FPGA 1ULAA 4J9UE 1HSZA 2MWMA 3ZZMA 4LHSA 3DAHA 4L15A 4OX9B 4WFKA 3N9IA 4NBSA 2YVUA 5BNIA 4Z86A 1IHYA 2NV6A 1J1IA 2HTFA 1EYZA 4NYJR 3SZUA 3WV4A 1P17A 2AYYA 3LECA 2B8NA 4Z0PA 1Z4KA 4U7PB 2YN2A 3C5EA 2O8FB 5CA1B 5D00A 3QWBA 1ECGA 4XUGB 3PITA 3HGMA 1CJTC 2WUFA 4WOKA 1H3FA 1XLTC 3M34A 4DKXA 3H11A 4GRAA 2YQZA 3M5PA 4RLSA 4TV8A 5DCWA 3RYIB 3WFZA 4CMBA 4F4JA 4BVAA 1JDNA 3HDGA 4WKPA 3KDAA 5BNFA 5LU9A 3G82C 1ZCAA 4KO2S 1Z4QA 1JHQA 4PRLA 3HYTA 2WMOB 1E0KA 2J31A 3GN1A 1Z17A 4MCIA 2ZVPX 4G26A 3M2TA 4O2BA 3SXUA 4HV4A 1UBGA 2ZUEA 2VR1A 3NG1A 1BDBA 3E8XA 3OA0A 2OCKA 3DE0X 3GLHB 3C6QA 1GRCA 1IMJA 1DX4A 1DKNA 1EDZA 4G4SO 4K9DA 4UXIA 4Y6QA 5JVDA 2VDJA 2R7LA 3K2IA 3EXHB 4RD0A 1EIWA 3V32A 2RGAA 4UU0A 1RJ9A 1T5SA 5HF9A 4GS5A 1DEXA 1FLAA 4FYJA 1KDYA 2YINC 4QT4A 1HNWB 1OLUA 1WOMA 1YAHA 2C77A 1XT6A 3RRFA 4B82A 5MGNA 1CQWA 1FTSA 4XFKA 1XROA 4N40A 3RNLA 2AMFA 5A4MS 3E81A 3V00A 1DHRA 1PR9A 1M1XB 5DMHA 4ZK2A 2A84A 2WV7A 3FGPA 2BI7A 4LJRA 5E7JA 4IOMA 2HF9A 2V7WA 3OZRA 2MU1A 3UAWA 1KIMA 4B46A 5CCBA 2R1UA 4WLFA 1CS0A 2RHOA 1E1CA 5J4YA 2QRLA 4M7OA 3UKOA 4GMDA 3IO5A 1AHHA 4JBHA 5G2OA 1H5QA 2XRYA 3BIFA 1DKQA 1PS0A 3DD5A 3Q9LA 1CUJA 1YZKA 4LGCA 1D09A 1FYFA 2I4TA 4QTUB 3FSRA 1RWBA 2EL7A 4F4UA 3BE6A 1PKXA 2VJOA 3PA6A 2G4LA 1F3OA 1VPDA 5A3RA 3SBOA 1B1AA 2OUIA 1IQUA 2H7XA 2W00A 4FWBA 4IHKA 4WN9A 4PLFA 1XMIA 4Y1RA 2WUGA 1HYGA 1KFKB 3G6KA 1SCQA 3MWEB 4Q4DA 4CV2A 1KWGA 1PJ8A 2Q8NA 2QJRA 3KELA 1Y4SA 2DFNA 5E6UA 5BSMA 3RS7A 3ZZNA 3L0YA 1GPJA 3GQVA 3QM1A 3I52A 4FPXA 1IDN1 2WC1A 3SHFA 1U80A 4D2IA 2AXNA 1BQEA 2AE2A 1MJ5A 3CQ9A 3DL0A 2CNDA 3Q1KA 3WLJA 4AYXA 2ZWIA 3CKLA 4HHEA 1H6BA 4F56A 5K0BA 5KQGA 4BQFA 2H1WA 2WAMA 1KMNA 1Q0ZA 1KQNA 4CIXA 4D98A 4NNOA 2XSZA 2B8WA 3I61A 2XVZA 1WNTA 4ETMA 1QK4A 2Z1MA 3B3FA 1DG1G 3T7TA 2O8EB 3I9MA 3IHWA 3NHYA 3K71B 1YIDA 3L7LA 4RK4A 4OHOA 2QGFA 4WNAB 3E3MA 1NGSA 3CPSA 3H2IA 1WDMA 3KXKA 2Q5EA 1TJ5A 1KJ8A 3BILA 1I6KA 4JOQA 4OA8A 3EUWA 1YMQA 3VXKA 2ZFUA 3SM9A 3DZFA 4PFSA 3GV0A 5CXXA 4N9QA 3UG7A 3AVPA 3IPCA 1YOBA 2P9FA 4TQUS 3V7UA 5DLDA 1ML3A 1WCV1 3EEQA 1AKVA 3ND9A 2ZR0A 3KLBA 4PWZA 4D79A 3RODA 4BU1A 4BBJA 3NHFA 4RULA 1JEAA 3URMA 1AQLA 1PK7A 2Y6VA 4P2BA 5DN9A 1PR0A 4NENA 1L5GB 2WU1A 2QJWA 3U40A 2QTBA 3PWTA 4OHWA 4TRMA 2IUUA 1Q92A 4AJ4A 3DT6A 3GEHA 3PXXA 3Q7TA 4HWSA 3A28A 4TTTS 1KOGA 3NBQA 5THQA 2R60A 3K6SA 3BS4A 3QF4B 4BNFA 1CRPA 5JEEA 2VPYA 3UMBA 3ROQA 3KE9A 1GSAA 4MDEA 1GAXA 3ET5A 1GPUA 5ALRA 3RQSA 3THYB 4YDHB 2XLCA 5TDHA 3DE7X 3QBVA 3G3EA 1YKSA 4W5WA 5K8CA 1A5TA 4LA4A 2CJYA 1FF9A 2PKCA 1MMFB 1I2MA 2OO5A 1EINA 4WRRA 1QAQA 3OCWA 4DREA 4L9SA 2EBHX 4CIVA 4RGBA 4S1VA 2GZAA 5BRJA 1K08A 2ZBPA 1WHSB 3WL6A 4C0BA 4ZT2A 1O9HA 2WVJA 1CUXA 1R16A 4P5EA 4CG3A 1PJZA 3F8WA 4DV7B 2IYEA 2Z56A 3HVRA 3X1ZA 2AG8A 4PSKA 2DUJA 4WESA 4ZO4A 3UKJA 3H97A 4DE5A 4DYHA 5GVSA 1Z0DA 1QCDA 1Q3HA 4BEBA 2CXHA 1JVSA 5KC9A 1N3YA 1Z88A 2GVZC 1HMYA 4KVZA 5G3YA 2G76A 1BE8A 4BQRA 2WSBA 2YIDA 4PAWA 1M2OA 4QYTA 4W5OA 3SDBA 2NVWA 1CU1A 1WEKA 2EFJA 2JFZA 1AF4A 4GICA 1XX6A 2X2PA 4R2WA 3W5BA 2O2YA 2O8BB 2ZSJA 3NAGA 1TLTA 1O0SA 2UKDA 1FYXA 5KMGB 1KDRA 5AH0A 3DE4X 5LZ2A 1LTHR 2OEPA 2EYUA 2D06A 1N0VC 1UDXA 2C7GA 3AY3A 3JQPA 1YI0A 4JEMA 2BONA 1LK7A 4G0UA 3TB4A 1VRVA 1NW4A 2VUTA 2WPNA 4N03A 4JC5A 4DWOA 4E94A 4MOWA 2AJDA 1SRQA 5EAIA 3HO1A 3OIWA 3L82B 4KE6A 4J0DA 3TUJC 2CVHA 1RAIA 1QO0D 4DA9A 2QTAA 1AQNA 3JWJA 4MTCA 2IEIA 3SR0A 2C9MA 1T2FA 1WUIS 2Y4OA 4F4FA 1YI1A 4OHBA 1H65A 3LD9A 3LH5A 1CDDA 4U63A 4Q21A 5TJHA 3WK5A 2PCLA 4ND3A 3OOSA 4E11A 5K8TA 2J33A 2PRKA 4LFCB 1YZNA 1NG1A 3WMWA 4UTOA 4XWKA 4PWYA 2ODWA 5K4HA 2C88A 1H69A 3EXFA 2AMLA 4PNZA 2ZRIA 2FWMX 3PGXA 5GOZA 1NX6A 4IQ0A 3K4PA 3GFOA 1GPYA 2F1RA 2QE7D 2QMYA 3W3AD 4E88A 5EN4A 1N7IA 2DUUA 2W6PA 1FFAA 5IXJA 2BSXA 1Y3FE 2EOAA 2WM9B 2FWAA 4KVFA 4HAZA 4ALMA 4OLHA 3UIEA 4D8TA 6LDHA 3E9EA 1KYXA 2AX3A 5D8DA 1HX7A 1KRXA 2C03A 3B6KA 2EWMA 3TH5A 4TYYA 1G7RA 2IDZA 1QRUA 4F1KA 4ZFNA 3ROFA 4UEJA 2V65A 4URFA 3ZWCA 2JLQA 4D9GA 4EW1A 2PKXA 2A0XA 1CUEA 3CN7A 2JI4A 1RYMA 4MPDA 4N6OA 4E5SA 3KETA 3DOCA 1JBQA 1T8YA 3UUEA 2B8JA 3D5EA 4TTQA 3EWNA 4C7OB 3OUUA 5JDIA 1K4YA 4FONA 2HLHA 2YIVX 4ZQFA 3K4QA 3VTAA 3AIOA 1QYRA 1ISSA 3EGDB 4XIIA 5HS6A 5C5CA 4TMFA 1OGIA 2VSOA 2ZOSA 3WYNA 3ZOKA 1KPGA 4M46A 4NESA 4KNYA 1RYFA 2Q62A 5L9AA 4BMDA 3OTIA 3KYDB 2H9YA 1WKBA 2VH1A 2CMHA 3E6AA 3HU3A 3B3GA 4JR2A 4MGKR 3A3OA 3STYA 3W2FA 5HMLA 1NMQA 2TMYA 4RIGA 5AVSA 4U8GA 3DG9A 4R1LA 3H86A 1U7UA 3KOZA 4WVFA 1EGAA 1ZH6A 3PFFA 1XOIA 4FKMA 2H5LA 4LJ7A 3ZGLA 3CB2A 2W6OA 1CFZA 4PSVA 1N8TA 3AF0A 3DKKA 5B3JA 3FGOA 1QC5B 3H4TA 4IOKA 3WMEA 3HCFA 4PZCA 1GKLA 4I9NA 3ZXSA 3CRRA 2DY0A 5C34B 2V5UA 1P3DA 2I65A 2WE7A 1SBQA 1FW6A 1G9XA 2VRCD 3RC7A 4WACA 4WDQA 2XUGA 2SKDA 2HWWA 4MVJM 3SNHA 3HJCA 5HKKA 4CKZA 2OAP1 3F2IA 3FF4A 3K15A 3PVZA 5AK4A 3RLIA 2E55A 2F3SA 5CLLA 4P0QB 1PZFA 3PDIA 3K1AA 4JXJA 3WLRA 1I9GA 5CYPA 1V6SA 3OSZA 3IMFA 3T7CA 2QRMA 4TS9A 3WG9A 2AYZA 4JQSA 5H16A 5FA6A 3TEFA 5BPFA 2VQFB 2C92A 1ND5A 1E2UA 1KY5A 2P2YA 4R98A 3VO9A 3MEQA 4JJKA 4CLRB 9LDTA 3RGGA 5FL3A 4TGLA 4RK1A 2ZVQX 3GB9A 4EMUA 3KYIB 1ZNYA 1NHGA 2IZ6A 5EXSA 5B7GA 5HJ7A 5HTOA 3BICA 3NTXA 1M2NA 2ZK7A 4OJNA 5B3KA 1VMKA 3QZUA 3A04A 3I09A 5CGZA 1IN1A 3LL7A 4FFBA 2FMXA 3DZCA 3GJSA 3LCRA 1LA2A 1TZKA 1PCXA 1QE0A 4GU5A 1AD2A 4UDOA 3VISA 2ZIEA 2ACEA 2RARA 4MJXA 3WYFA 5JE8A 4ALJA 1IULA 2O1SA 1PQPA 1MVNA 1TFUA 3MMXA 4QUKA 5DT2A 3SPXA 3TEJA 4BO7A 3ZI0A 2WNHA 2GQ0A 3KUDA 5CDFA 3AKCA 8LDHA 3ZNNA 4ARCA 2QX4A 5FT9A 4S1OA 2QPOA 2WVAA 3ZU4A 1ZKMA 4AMVA 2H00A 4LDAA 3TIGA 1MV5A 3HCWA 1X8KA 1QG0A 2F17A 4MVJD 1VE9A 2JATA 2XNCA 4R9NA 1KAMA 1NULA 1YR9A 1W73A 1L1FA 3DMDA 2OBXA 1ZDMA 2OV6A 4EELA 1SG9A 1P6UA 4D02A 4B9EA 3PKZA 3MS2A 1XRMA 3T4PA 3UGQA 1IZZA 1NFRA 1J97A 1DIGA 1Q0SA 2P3LA 4I9UA 4YDRA 3PTZA 5HX7A 3AY0A 3AR6A 1X1EA 4IHJA 1YS1X 4M89A 2EWWA 4N8SA 5DYWA 3RM3A 3RHZA 1QH8A 5H70A 2E87A 2JCVA 5FLKA 1OFGA 2SCUB 1V8OA 3A6JA 5COQA 3FTFA 5CJJA 1Z4NA 2GBIA 4XM0A 2PUEA 2FZCA 3S29A 3TR6A 3VDMA 2PMWB 4WUTA 2OM2A 2YR0A 1QHFA 1RRPA 2JCBA 3LQKA 4N0QA 5HMMA 4BN0A 3WBJA 3ZLJA 2I55A 4DW8A 3JZFA 2L82A 3D0RA 4KH0A 1ZL0A 1AKUA 3V8QA 4E70A 1VPWA 2IEGA 3BHJA 3OM0A 3TINA 5AUPB 4OGLA 3DZGA 5AT1A 1X94A 4CM9A 1K75A 1L5FA 1O7JA 5BNWA 4IICA 5C7YA 4RACA 4ND8A 5FUBA 4D5GA 5U9CA 1W19A 2LCQA 1FVOA 5FULA 1N6PA 2AEJA 1Y6RA 3EC7A 4FD3A 2H29A 2FE4A 4PLCA 3ZH2A 4LBVA 4JBLA 5IRCD 1VG8A 1HNNA 4FYIA 3D4IA 1LBIA 3S7ZA 3HSYA 4ONEA 3AHIA 3QVMA 2BSAA 1ORRA 2CBGA 2RGGA 2W6JA 1T15A 3BYZA 4GRDA 4DLRA 1HDEA 1DJNA 1YR8A 3U19A 1C14A 4KYIB 1A50B 2QD2A 2QY9A 3IVGA 2CNBA 1PJBA 1E58A 4RJJA 5AVTA 1ZH4A 1XVTA 3HDJA 3OM1A 3RIHA 3VKVA 1JIJA 2EGUA 3DB2A 5F35A 2AGVA 3H13A 1Y7TA 2IUEA 3D7RA 3W9YA 4CM1A 2X3YA 2OQIA 3ORHA 5L3VA 4ETWA 4Q3OA 3QFRA 1OZHA 3I6QA 1JFVA 3HFJA 2JJQA 3CXUA 3VR2A 5LDDC 5CM2Z 3QELA 1UJ4A 4KDRA 1KI6B 5JG7A 2ZR8A 2QRNA 3G7UA 2AG5A 3NRCA 1PGPA 2I34A 1O6BA 5C8YA 3TWOA 5I01A 2PRYA 3RARA 1OIVA 3H16A 4KU4A 2GPYA 1CY2A 5H3LA 2V0CA 4P36A 1RZRD 3I01M 1WX1A 3M4NA 4E2WA 2WYWA 3KZVA 1XA0A 1KQ3A 4EG0A 4MI6A 3V3TA 2H07A 3BIXA 1D6SA 3ZY2A 2Q5OA 3D6UA 1ZOOA 5E1DA 4CM4A 1UAGA 1SD2A 3DE5X 5I9SA 4PO8A 4E4YA 2YWEA 1ZUNB 2WJAA 3P2KA 4D96A 1PN3A 3BM5A 2VDQB 3M1IA 1XYYA 1R0ZA 4G0NA 5A71A 1U0LA 5FLEX 3OJWA 3RC2A 3A6PC 2OD7A 4D9IA 5A04A 4PGHA 4XFDA 3G59A 3AC0A 2R8EA 4O2AF 1GNRA 4C2AA 1JLRA 1M2VB 1EWRA 2AZ4A 3IAM1 2BT4A 3LCUA 4E4RA 1YACA 3B1JA 3P9YA 4O4JB 2JAHA 1OLUB 2XTNA 1MC8A 1RP7A 4KR2A 2BPOA 1NAHA 4X7BA 3LO8A 4O4IA 1Z5UA 5C32A 3QXCA 1JBEA 1N92A 3W6OA 4M6WB 3WMGA 4IYRA 4DLVA 2GD2A 3KT6A 3O4RA 2RBGA 4FI3C 1QPBA 3FW1A 4WADA 1LFDB 1U6JA 3W8RA 2HMWA 1EDOA 4IUDS 2ZYAA 3H2JA 3I5AA 3KPWA 1O0CA 1P1HA 3FMVA 3ZK9A 121PA 1VXOA 3MK31 5K0FA 5FBQB 4RVOA 4W1PA 3ZD6A 1W52X 1ANKA 2FRVA 3PQ3A 4HMPA 2YXBA 4BLTA 3Q9UA 2QSJA 1MPXA 4J16C 1COWA 4I4NA 4UW9A 3Q3HA 4D26A 4DJTA 3K4HA 2BGKA 1WPGA 3BGWA 2C58A 4WERA 4ZT4A 4PFQA 3FKQA 3IP3A 2OHJA 1NFQA 5K1ZA 2QR3A 1ZBDA 1YQ9A 3B7WA 4HZIA 1EJ0A 4R31A 2BM9A 1WEHA 1G7CA 2J9FB 5FBZA 4H3VA 3TOZA 1ST2A 3NYIA 3VZPA 1MAUA 2L19A 5BSVA 2YCBA 4IKPA 4GE3A 2RSLA 5BN5B 3GG9A 4R0NA 4PYOA 3QLEA 2QUBA 3ZGZA 4N6NA 5IT5A 3Q5EA 2HSDA 3TRHA 2NPIA 5KBYA 4K9RA 3THSA 4BKQA 4UCFA 2FLVA 5BT8A 1QGUA 4IDDA 5AW2A 1ID8A 1NVGA 1YZQA 4D5EA 1M6WA 4WFQA 1LRJA 4GW3A 4MGHA 4F71A 3BCHA 5EQDA 3ZV5A 3TLGB 1GCAA 5KTKA 3IJEB 3KZ1E 3D1JA 3CVVA 1E9FA 1OC2A 5D87A 2NVOA 1UT8A 1MQSA 3MTEA 1T0PA 1O97D 3NHBA 1FSFA 4HQOA 4BMXA 1UDBA 3CG4A 1NUAA 3CJRA 1XZKA 4HAIA 3S2EA 3LUFA 3UHJA 4MVYA 3C8MA 1JHDA 4F85A 2Q3MA 4UEWA 1WMFA 3JQGB 4EHKA 4F3RA 1FVXA 2A3RA 1MT0A 3JARA 1XPJA 4TMWA 3EWAA 4G8CA 3T06B 2AS0A 2M32A 3K8ZA 3O84A 3Q3IA 3FDFA 5M7EA 5JYCA 3KKLA 1ADBA 1B7GO 4P5PA 5LJIA 2QTGA 3H5AA 3QF7A 3A0RB 1W9HA 5K8JB 3GJQA 2E1RA 3UT5A 3U80A 1ULUA 1HG0A 4UEKA 3WL3A 1NRIA 1GL3A 5AW8A 4NCNA 1NMSA 3JWHA 2VJYA 2PT7A 3QQPA 1IEQA 2FWRA 3AFHA 4Y9RA 5CU7A 4LC0A 2CNWD 4GUAA 4MVJP 2D0PB 2YWCA 3WBKA 1WP4A 1NSTA 3L7KA 3GU3A 1OFTA 1YJ5A 3E2PA 5AQEA 4EJMA 4BJHB 2OV8A 2P11A 4Q7LA 3GPLA 5J58A 3FMFA 3AIIA 5BQ5A 2ZIFA 3UA4A 1WJGA 5CVUA 3AR8A 4HG2A 1MA3A 4US0R 3UC9A 3L2OB 2NUTA 3IUSA 3G2KA 1R18A 2V1UA 3CF0A 1EZZA 3JQCA 1KBQA 1EB8A 5EVCA 2X4IA 3RRMA 3LOPA 5B1SA 3RYHB 3IBCA 2DY1A 2BF4A 1XZQA 2YBEA 3ZE7A 4AJKA 4DCVA 2VXCA 2KI5A 5K6AA 5KREA 1E6KA 1GSOA 2ZJYA 4OHPA 4X8OA 4X54A 1Z06A 2QZPA 2GZRA 4TLMB 2I7DA 4RXTA 2ZYRA 4IIYA 1WXFA 2RCNA 3WGZA 4EHDA 1N2SA 2D4AA 3A14A 2XUJA 3FBGA 3VKWA 5LU8A 3H6HA 3RUDA 4BBPA 2FG7C 2ORVA 4QQ8A 5CVTA 3OX1A 1L1RA 2J4DA 1DE0A 1T9KA 2JIRA 2P5YA 4XM2A 2E6KA 5E3IA 3TL3A 2GCGA 1GG9A 1JXMA 1N2EA 3ILXA 4E33A 2XYQA 2YFKA 3KAKA 2QMZA 3J81k 1GRQA 1H5NA 2UVPA 2DC1A 3O8BA 4L8WB 2WG0A 2WTUA 3V2UA 3HVIA 1UJ5A 2Q3HA 2BKLA 3NOVA 1B8UA 4MUGA 1X7HA 4ZYZA 2WMYA 1R4ZA 5DOVA 5CFNA 1I2ZA 3STXA 3KSBC 4ENVA 3F6SA 1IQRA 2GM9A 1E3LA 2D5LA 3P4UA 1FTNA 2CKDA 5BMVB 1I7QB 4Q9NA 1VIDA 3G88A 4L3VA 2JHCA 2QHXA 1F48A 4BVGA 1M2EA 2IC5A 1WQ3A 2GNPA 1Q22A 3OESA 3E1GA 1DNPA 3R7SA 4C4SA 2FE1A 3K2BA 2B4KA 1J42A 1Z47A 2R751 4FGWA 1H4QA 3AINA 4ARVA 3L92A 1NSFA 1VHTA 1Z4PX 4MZDA 4YJ2F 1QK5A 4IGKA 1CY6A 1X7YA 3QYFA 1LPPA 1J70A 2AVDA 5EMJA 4ZZ2A 6ADHA 3F6EX 5G4KA 4YMTA 3GNTA 1WR8A 3TSOA 2H31A 4N82A 3GDHA 3R3VA 5J2UF 4RTQA 1E6UA 4WECA 4YCAA 5G0SA 3WHKA 2WZCA 1W94A 2IELA 3V8RA 3HMQA 3W8NA 3QF4A 2DT8A 1CQIB 4FCTA 4IAOA 4BGIA 3KWFA 1Z15A 3IQEA 2RHHA 3M6LA 2KE5A 1KZ4A 4MULA 2BCJQ 4WLUA 2OA0A 4UDXX 2R00C 3T1OA 2ZJZA 3D0KA 5EL0A 1L5KA 1VSQA 3DBHA 1RWWA 2QTFA 1EWQA 3O31A 3ST7A 2FHSA 1VL8A 4X90A 3SG0A 1KAOA 4JC0A 4W1SA 2WG1A 4HR7A 4MPPA 3A11A 5FEMA 2OTCA 5J9FA 2IOFK 3PPVA 1NHWA 4ABTA 5GJVC 2QYOA 2EYQA 4NATA 3TLXA 1BGXT 5BSGA 4ROSA 1G20E 1ZQ9A 1QHHB 1PBNA 1RIFA 3EB9A 4MKHA 4DL9A 1HNXB 3BXXA 1D1TA 4TVOA 2FMKA 1RSZA 3SOPA 5U4XA 3DFMA 3V3KA 4EB8A 5K0ZA 3IUBA 1CP3A 5FHQA 1SZPA 2PL9A 2WJGA 1L4NA 1Y8QA 3G2QA 3KJXA 4PPQA 4XIGS 5F77A 2ZAIA 5H4GA 5ICCA 3QXXA 2ZS8A 2PZJA 2QNBA 5KX5F 1K4KA 1Z6PA 3AFIA 3HVHA 3OT1A 4WNCA 3RBXA 3ECAA 4C14A 1U8TA 3GROA 4RXUA 2ILTA 3FZGA 1U0JA 1NF3A 2GHIA 2V6FA 2CHUA 1HLPA 1YDMA 3DAOA 4LQCA 2QP3A 4I3GA 1LC0A 4Y8VA 2A59A 4OV6B 3HA7A 5JMOA 1TUGA 3FRJA 1GPWB 1YXMA 4KPUB 1NVXQ 5LYJA 3ZV3A 2PX0A 4B8ZA 3G2IA 1U2SA 2PH5A 5JCOA 1O03A 2VDNB 1P2TA 5F9MA 3V80A 2H2HA 3QUTA 4P32A 3GRCA 1N6OA 1XCGB 1MX3A 3ENVA 2B82A 3N0WA 4G1MB 4WT7A 3K0HA 5LPNA 3ZCQA 3WYAA 2VTBA 1WRBA 5AVJA 4CKBA 4B4WA 1QUFA 1DX9A 5EPOA 5K0SA 4GC9A 1LDEA 2C59A 3I9NA 4AVYA 4D9KA 1JB1A 4JGGA 3FR8A 4ZYXA 3PGLA 3U7JA 4DNOA 5IU6A 4UE3S 3PNLA 1RWOA 5E4JA 4BXOB 3AETB 1UZAA 2MSKA 3EXEB 4DMGA 2I6TA 3FMGA 4YCNA 1H8ED 5JCZA 1XVVA 3AOEA 3KS9A 4B34A 5LQAA 2GK3A 3GJYA 3FCUB 2E9SA 1BXGB 4LE2A 1P60A 1QTIA 2FRDC 2QMQA 3Q7EA 2VNKA 2AI3A 1DIRA 2HX1A 3UHPA 3E3LA 5FIUA 3C97A 4GPD1 1G5FA 5DO9A 4NYMQ 3OTQA 1NVKA 1JDZA 2IL1A 1S3GA 1EE1A 4I66A 3OJLA 4S1PA 3VX4A 1W87A 4YRLA 2OC4A 1AZWA 4DR5B 3ZJTA 1H05A 3DOEA 3ZDAA 3EK2A 3Q87B 4OGWA 4POAA 2I2DA 3W6PA 2YL2A 4FINA 1UF9A 2FLKA 1ML4A 4OSPA 4ZVQA 3V4OA 2C2ZA 4UPVA 3ONDA 5ALFA 1P2FA 3MCWA 2LE0A 1C0LA 1K2WA 2PBLA 2RONA 3I04A 3W2TA 4C7OA 1T3TA 2KW5A 4UNSA 2IXEA 1M7GA 1YIAA 3II6X 2WAXA 1KP2A 4TQ9A 4M2LA 3QENA 1URPA 2OKCA 1ECPA 3M7IA 1WQ4A 2PX8A 4UNIA 1ENYA 3EGDA 1QK3A 4KMRA 1GUZA 3QBJA 1J07A 5AW5A 1DBVO 4W7SA 1P1RA 2EKPA 2K5UA 1RQ7A 2DWPA 4BUJA 4TXJA 2BFAA 2WT4A 4ZI7B 5BUQA 3JATB 4E0BA 1M54A 2FFJA 1MB0A 1RD4A 2C3MA 2F8LA 2WAYA 1MOPA 4MW0A 3RFVA 2JFPA 4FYXA 3O74A 4JYPA 2NSDA 4KIFA 1W0CA 3IEXA 1VLVA 1Y7HA 1ZJYA 3AZQA 2XMDA 1PD1A 4M54A 1HPLA 5AUQA 3VPBA 4B2PA 1IBMB 1DIAA 2MSDB 1X7GA 5IWCA 1R0WA 5DNCA 1H6AA 4O4LB 2HHHB 2O1EA 3HCEA 3UWSA 1S4MA 3OLZA 1XMSA 4NV0A 4Q3DA 2JANA 1GEGA 1OU0A 4E12A 2JRCA 4HMQA 1NUSA 3WK8A 2CNKA 4KGDA 4F2HA 5LKAA 1NONA 4LXGA 3OICA 1BFKA 1OLSA 1LDBA 1GNLA 3GFGA 3QUBA 2NXNA 3T1VA 3TQQA 2RG7A 4MHTA 1U0TA 1P0FA 3M82A 1OWMA 3OQIA 1R9JA 5IKXA 1YBHA 1TF7A 1XQWA 3R5JA 4GX0A 2LKDA 2NUBA 2OBYA 4RH0A 2FQWA 3E5RA 2WVGA 3GLGB 3ZYCA 3K1AB 3F74A 2BGJA 5C5DA 4IDNA 1DKMA 1P7WA 4O2BB 3VSBA 4EHAA 1DTEA 2IPNA 3PDHA 2GN1A 1G8MA 3PNBA 5JVDB 3E23A 3BXOA 3GZJA 2O5EA 2PIDA 2QIOA 4MUMA 1KRHA 3SYMA 3T7DA 2I3ZA 1P29A 5KWVA 4OBEA 2J0UB 1YCGA 2O3TA 2J7PD 4LUCA 4YMHA 4N7RA 5BSEA 4JFAA 4K0KB 4BNVA 2QZ4A 1ZY2A 3KLPX 1L8QA 1JMKC 4HX2A 3TNYA 1BDMA 3A1SA 2WU8A 2VDUE 3ZE0B 2OOKA 3AR4A 2IBSA 3EEYA 2VBCA 4NK4A 4X7RA 1G4HA 1X1SA 2FN8A 4G6ZA 1NRJB 1W5AA 3G5TA 4L6AA 5BWLA 1KL7A 1VPLA 1WU8A 2FPKA 1XDUA 2GCPA 1NR5A 2N1BA 2QA5A 3Q2IA 4YQYA 2YOHA 2R9VA 2O2HA 3FRHA 4W9NA 2OR3A 1I0ZA 1NN3A 4Q05A 1GSHA 1L4BA 4NZOA 2E2WA 3N75A 5GINE 5EJAA 2CW5A 5CFZA 3A9RA 4QNNA 1YRWA 1ISRA 1GZHB 2AR9A 2Y77A 5B3JC 3UATA 2WJWA 1MAHA 1CF9A 3H6GA 1KMCA 1EBUA 4JJ8A 4IX9A 1RRFA 1Q0QA 2QQGA 2WE8A 1GFWA 3DB1A 3IPAA 4BUCA 3HCDA 3HWSA 2AG1A 3OIYA 4J0IA 3N76A 1X1QA 4I1OA 1RJWA 5F51A 3F9IA 1O0BA 4J0EA 5KNDH 2JIZD 4JN6B 2EFHB 5GJWC 4XH9B 2GXSA 5JSFA 1CY4A 4G86A 5I9BA 3SHTA 3HG7A 3TKAA 3CNHA 1RI5A 1FPMA 1YULA 3GFQA 3HBMA 1AGRA 3HVKA 4KRXA 4AF8A 3A2KA 1THZA 2VUUA 4D4KA 4NZZA 1CQJA 2TS1A 2W8BB 1ECJA 2H2WA 4EPVA 3IE1A 3UTCA 3EUEA 3TIFA 4RF4A 3PQDA 1II8A 4L0CA 2BZGA 3M4ZA 4RKYA 3CO5A 5LVAA 4Q4JA 2Y1KA 1A5BB 1ZAKA 1G8FA 1QFZA 1USIA 2FSUA 2VYNA 2EJCA 2Z3ZA 4C88A 3GLFB 2C4UA 1KI7A 3IOCA 1QONA 2PQ2A 3ISTA 4BGUA 4YMGA 2JD1A 3I0ZA 3AESB 3TPZA 5EI5A 3M9LA 5CMLA 3TLKA 2Y9PB 4F12A 1JWAB 3F6YA 3EQ6A 3I62A 3EXHA 3GEMA 3NW9A 1W2HA 3CNQS 3W2HA 3ANNA 1UXJA 4QUBA 4ZVTA 4HGZA 3ZDQA 4NARA 4DMHA 5HCNA 4UE2A 5JNWA 1MAWA 3P0RA 1L5MA 4JYAB 2X5NA 3C3MA 1LNZA 5A7GA 3HXQA 4WCFB 2ZRBA 2IH2A 3T7RA 4MCAA 4R2MA 2V7XA 2XCSB 4FIZA 4PBSA 2XRMA 4DAOA 2XAUA 3DDOA 2FR0A 5ALWA 1ODSA 4G4SP 1IZ0A 1Y4DE 1PFWA 1T4BA 4NCHA 2XXAA 3B52X 1Y3BE 1AGXA 2DUNA 1LGYA 2ODAA 1M74A 3CWQA 4L74A 1PT5A 2AJLI 2GF2A 4QDOA 4X1OA 4XUCA 4F0JA 1HNZB 5KTPA 3S2UA 1KY3A 2ABWA 3HK2A 4KMSA 1PR5A 1PFYA 4AYTA 4GZ5A 4HTAA 3WIUA 2F1JA 5K3CA 2H63A 1KE2A 1UBKS 1IOWA 2BFNA 4FKZA 3HKBB 1UP4A 4GX1A 4J0KA 4RZ2A 5DPMA 1OHHD 2NNLD 3SYNA 1EXVA 1WDWB 4ZODA 1XJ0A 3H2GA 1SKQA 2VXOA 3QEOA 3T3EA 4Z8YA 5IKEA 3VDRA 1VA4A 3O8NA 1F9AA 1YBMA 3WNDA 4C0KA 1SB9A 5IW8A 3BSSA 2V98A 2M6KA 2FA9A 3ID6C 4NAVA 5KHLB 4M9XA 3F7TA 3KC2A 3EIHA 3U56A 5CFRA 1Q0RA 3JVVA 4YMLA 4IR7A 1FY2A 3FFAA 1J2EA 4HJXA 3CF4A 1I6MA 1PFGA 1QQTA 2I4LA 1IN7A 1CLUA 3BE5A 3OWXA 4IIBA 4XSHA 3WYBA 4DMFA 2RHMA 4RIHA 1HY3A 1XNGA 2UYYA 3DKPA 3V42A 1MVOA 1KYWA 1Q17A 5AM5A 5DT9A 3T1HB 3LC7O 1VBMA 3AGPA 1HF3A 1TFRA 1XPRA 1XFDA 1ENOA 4I6GA 4BVKA 1LSOA 1CIJA 2NVBA 3WJ7A 2IA5A 1GVHA 1YUBA 3F3YA 4U9HS 1VDZA 3RJ9A 2DQ4A 1NVTA 5HRAA 1TYCA 4ZJUA 4R3NA 3CKYA 3GO4A 1X3LA 4I1SA 5F1PA 1W30A 4I8IA 5G40A 3NKLA 2AL7A 2ECQA 2TSYB 5KOIA 2XUAA 3AG5A 4O2AA 5CD9A 2IZZA 4YASA 2PWAA 4NENB 4CMJA 3LUCA 4IDPA 1I14A 1LTQA 1QRAA 4B76A 1NUQA 1W8IA 3P4XA 1QF9A 4I1UA 3UUGA 1YNSA 4P81A 2XNKA 4UBNA 5FO0A 4HAUA 4QBHA 3R76A 1LC3A 1WTAA 1CD5A 2QUJA 1MD9A 1PNOA 2XHZA 4D6XA 4QTXA 4FBGA 5AW7A 3WJ2A 1FTYA 1JYSA 1U8ZA 2P2LA 2MMCA 2RBEA 3DXYA 4WL0A 5A0TA 1U2ZA 3QVGA 1Q0UA 1E96A 4QBIA 3LP5A 4NZMA 4I1RA 3HJFA 3OC0A 4CCWA 1J7JA 4EVIA 4GO1A 3I5YA 5F98A 3PEEA 2QNIA 4BQPA 7ADHA 3GGJA 4FS3A 5GM1A 2DR2A 3IMCA 2FETA 1GU0A 1T1JA 3WLTA 1EDBA 2PV0A 1HH4A 1HORA 3BWMA 3CLTD 2EX4A 4KSBA 4Q24A 4MQ5A 1E4EB 2QLMA 3V9PA 1TD1A 4MRAA 4R1SA 4TV8B 4U6SA 3FZYA 4PTLA 4LF8B 1KDVA 3MWJA 1JG7A 5D1HA 5ARCA 2B9EA 3DHEA 3I8XA 1X86B 3IE2A 2XHEA 4LDNA 1NNSA 4DPMA 1P45A 1RAFA 2WZQA 2Z4TA 5JRJA 1F17A 4LBYA 3HB4X 4MROA 5T8KA 1UJBA 1BVUA 1SCNE 3HLTA 2PE5A 2OAGA 3QJYA 3BSYA 5EE9A 1RXCA 3MGAA 5FWYB 1VB5A 4ZVMA 2C5BA 3V4RA 1RWXA 1I33A 1Y1KE 1X9GA 2ZYUX 3PQCA 3PXEA 3H5RA 3RUFA 1EX7A 2Q1YA 3UICA 1DAFA 2UUBB 1F0PA 1L4GA 2IXDA 4X60A 3PE4A 2HYDA 3ZTTA 1QDEA 4M1YA 3L7AA 2PYZA 1KYZA 1KQGA 1XZFA 1M6HA 3AEUA 3PQ8A 5I45A 3P71T 1GG5A 3KOMA 4ND5A 1PTKA 5EERA 2D1TA 5EJ7A 4LOHA 4V24A 5ERYA 3QU7A 5FBHA 4QBTA 2QUHA 3R09A 2VIIA 5A6SB 3UJHA 4DQVA 5EXEA 2WG2A 3IAS1 5JAOA 2PSJA 3K8QA 1G3QA 4ZAWA 1IN4A 4CF5A 2GAOA 1IN5A 2JRLA 2VN8A 5DHAA 4YR7A 3P9IA 5HFJA 4AMZA 3PD7A 2O3JA 4NTZA 2DTDA 1F2UB 4B3DA 1SU8A 2JGKA 2GZHA 1QP0A 4C7KA 3BZUA 5E6SA 1BGVA 2NV2B 1XAGA 3DW1X 2NUTB 4PS1A 2R86A 3H7AA 1IBKB 1KKUA 3R9XB 1OYOA 1O6CA 5DXFA 4M1QA 4S2EA 3MNFA 1Z6AA 1HDYA 3R3JA 4KC0A 3UK2A 3VTFA 1FMTA 1HRDA 1TYDE 5AKXA 1KKMA 2YN4A 3R5KA 4RY2A 3USCS 5KQLA 2E3JA 3CCBA 1PT6A 1A4XA 4YRSA 1Q44A 2QTHA 4QRIA 1KBOA 1NDHA 2IPXA 3F4BA 5KWJA 1T3HA 1E3QA 1JQLB 3O03A 3P0EA 4RPIA 4DDHA 1DCMA 3QHQA 1XTBA 2F3PA 2X14A 2QT1A 3SXJA 2OXRA 1HM5A 2QMEA 4J3FA 4CQNA 4IVRA 5ALGA 2VT2A 4YRMA 3SVZA 4UMEA 1OXMA 3L9XA 2HSZA 4ZOLF 3DMGA 1JAIA 4OQNA 1YA4A 2QGNA 2PGXA 5I9IA 3W4JA 3AJRA 2Z6VA 2I3BA 3PIDA 3VDNB 2XXJA