1B0AA

5,10, methylene-tetrahydropholate dehydrogenase/cyclohydrolase from e coli.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
287
structure length
287
Chain Sequence
AAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNPASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDTLNADNTIDGILVQLPLPAGIDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVEYHDPQDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FOLD BIFUNCTIONAL PROTEIN)
publication title The crystal structure of a bacterial, bifunctional 5,10 methylene-tetrahydrofolate dehydrogenase/cyclohydrolase.
pubmed rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase,hydrolase
total genus 100
structure length 287
sequence length 287
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b0aA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1b0aA02
2CY0A 2E6UX 2WDZA 3WGYA 3VTFA 2OXIA 4BO1A 1VKOA 2JD0A 1V35A 4J1TA 4UVIA 3RU7A 3L6OO 3RFXA 3GVXA 4S1VA 3PYMA 1B8PA 4GI2A 3NT2A 5AVOA 4YRBA 5T64A 3INTA 5BSGA 1GUFA 2Y1GA 4RF3A 3TRIA 3HN2A 4GX1A 5I9LA 4PZDA 5CDYA 4L9RA 4XRGA 1LNQA 1T2FA 3HNPA 1UDBA 3IQDB 2VUUA 1ONPA 3QY9A 1Z75A 1XEAA 2BH9A 4D79A 1E5QA 1ZK2A 3MOGA 2CD9A 3D0OA 4IY1A 4MVJE 4AJHA 2O48X 3RKRA 2TMDA 4Z9FA 4AJIA 4BO7A 1C1DA 4BNLA 3OJFA 4IMPA 4LMPA 3AU8A 1E6WA 3HADA 5ES3A 2I6TA 2GRAA 4CLRA 3ONFA 4FSHA 3CINA 3DC2A 1CQJA 1PZEA 1Y9AA 1UAGA 4W82A 4RVGA 4Z9YA 4FJ1A 1A7KA 4I9NA 5KVVA 2NVBA 3MTJA 1XYGA 2OFPA 4O5OA 4ND2A 1MG0A 3GDFA 3Q9NA 5KJEA 1ID1A 1X1TA 1BVRA 2XAAA 5A02A 1P1KA 5L4NA 1EFKA 3E18A 4URFA 2GZ3A 3F9IA 5IJZA 1LQTA 3KSUA 2UUOA 4EJ0A 4FN4A 5G0WA 3W1VA 1JDJA 3PHGA 1GEGA 2OBNA 3LLSA 3QVOA 5ICMA 2POQX 1Z45A 4IS2A 4OKNA 2V6BA 1VL8A 3W8FA 4F3YA 1HL3A 4LSMA 4PG7A 4W99A 3D5QA 2AEFA 4ND1A 4B8ZA 4WASA 1JN0A 1LXCA 4OMUA 4R1TA 5L7YA 3ZU4A 4E5PA 3TOXA 2DAPA 1H9BA 2A35A 2O3JA 3I9OA 4I9HA 2A92A 4WOJA 2GUGA 1O0SA 2DM6A 2UUPA 3WSWA 1DIHA 2ZTLA 1GL3A 3K9QO 4L74A 1A5ZA 1XLTA 4B3JA 2Y1DA 1I10A 5JFOA 4C7KA 4EJ6A 1YJ8A 3AUUA 1Q7CA 4BO0A 2CMDA 3GVHA 5DBFA 3ZV4A 3ONDA 1RYDA 4HNGA 4CV2A 4OHUA 1EBFA 5KVSA 1BSVA 2PKRA 2Z5LA 1E1NA 3IDSA 1ZJZA 3LT2A 2VNSA 3U4CA 5C7LO 4XIYA 2BHLA 4BKQA 2AE2A 1X15A 4J7XA 1F06A 1IPEA 2NACA 1YXMA 2ZB8A 3P19A 2Q1TA 3U49A 2DBQA 3VVCA 3ETGA 5JCJA 2HRZA 4BNTA 3HZZA 4PLHA 4WCDA 4R3WA 3EUWA 3H9EO 4J1NA 4YT5A 1ZJYA 3ZWCA 1U8FO 2Q4EA 8LDHA 2NSDA 1H6CA 1QLHA 4M55A 1H6BA 3KO8A 5I7EA 3DO5A 4UVHA 3DZHA 4IDBA 5G4LA 4CMIB 4L73A 3AI2A 1ADGA 3HN7A 2O50A 3FSRA 3I4FA 1QYCA 3GAFA 1Y6JA 3S2FA 5HS4A 1I0ZA 4UUPA 4UULA 1JAXA 1K6JA 5CFZA 1DIBA 2O7SA 4YBZA 3OSUA 2V65A 3PK0A 3WB9A 4BO8A 4ZRMA 2G5CA 4XYMA 4WLNA 1FDVA 3HE3A 1ONNA 2C2YA 3ZU2A 3PJFA 4CQMA 4JCOA 4A0SA 2BFOA 3ZV3A 4WLOA 3OMLA 4OQZA 4Y8VA 3ANMA 3SJ7A 1EE2A 1YO6A 2CNBA 4KQWA 1QORA 1ZUD1 2HSDA 4R69A 3EW7A 3RJ9A 4F45A 1T2CA 3U9LA 5B1YA 4OOFA 3ZHZA 3PIDA 2VTEA 2FOIA 4JJGA 1ZSNA 2YFQA 1XU9A 2F1KA 2Y05A 1YH3A 2WWRA 1QRRA 3RU9A 1R0LA 2YW9A 2Y0CA 1PQWA 3PPIA 1NPTO 3NYWA 4IXWA 4II3A 1QMGA 4CMJA 1ZVMA 4IJUA 1PU2A 1E6EA 1P45A 2HK7A 1B3BA 3C7AA 4ZQBA 4E2ZA 3U5TA 3WGGA 3WMXA 1G6KA 2HRBA 3KYBA 4QO7A 3UW3A 1Z6ZA 2OOSA 1BGVA 1W4ZA 2IZZA 2YDYA 1HE3A 3ZWYA 4CM4B 3VPXA 4J43A 4ZD6A 5LDGA 2YJZA 4FC6A 3HJAA 4IGEA 3E8XA 4XQCA 3B70A 3MEQA 3RUFA 4K6FA 1PJBA 4DPMA 3W4IA 3ZZNA 3IUSA 3EVTA 1JLLA 3ITDA 3I52A 3ZWXA 2AQ8A 3PHHA 5T67A 4J6FA 3FF4A 1DOHA 4KMSA 1IULA 3JQBC 1A9YA 3NJ4A 5CHEA 5HS6A 3GMDA 3KBOA 4BO5A 3MJ4A 1A4UA 1EVJA 4CQMD 1QXSA 2Q45A 2EG9A 1P0FA 3FPLA 5IDXA 1U7TA 3GN1A 5L53A 2P4HX 1I2BA 1E77A 2VTDA 3TL3A 1OMOA 1IHYA 1R37A 2X9VA 4KDFA 3F5SA 4M86A 1LSJA 3DHNA 3TZCA 2P5YA 3B6ZA 1VLLA 4NBTA 3NUGA 2VHWA 4IDDA 3K92A 5EN4A 3DTTA 1U1IA 3AUSA 3UH1A 2FMUA 1DFIA 2OZPA 1SAYA 5JDIC 4CMKA 3D64A 1RM0A 3C7CB 4XB2A 3KLPX 4GMGA 3B1FA 4N5LA 1NNUA 1SB8A 3JYQA 3D1LA 3EZYA 3V1YA 3WYCA 5CG1A 1CWUA 4UUMA 4ZHSA 4DQVA 1XIVA 1UP7A 5EESA 4BGEA 4UAGA 1GR0A 5AYVA 1LLCA 2I76A 3EAGA 3KHUA 4YT2A 4U0JA 4FJ0A 1H2HA 1N1EA 3WFJA 4E33A 5CEFA 3KEQA 5THKA 3OIGA 3NKLA 5ENDA 3AWDA 1Q0LA 1UXKA 4GGPA 2HUNA 4J0FA 4TZTA 3AY6A 3GGOA 3S2GA 2IXBA 1CDOA 2DT5A 4U6SA 1ENOA 1E0DA 3E5MA 3CIFA 3V2GA 3H65A 3DOJA 4NZ9A 4K1LA 4OJNA 1D1TA 3E5RA 2HQ1A 4CMEA 2FHSA 1C3VA 3K31A 5B4VA 1YB4A 4BV8A 4O63O 3T4EA 5JBIA 4WLVA 3DMTA 3LYLA 2PZLA 4AJOA 2HAEA 4RF5A 3VHRA 2PKQO 4RJTA 4I5EA 4Q9NA 3TZHA 3GFBA 1IYZA 4QUKA 3GA0A 3UGKA 4I5GA 4BMNA 4HBGA 1DDOA 3U09A 2ZCUA 4UVEA 2J8ZA 3PJGA 3UVEA 5L7WA 3UXYA 1PJLA 1PX0A 2YV2A 3OH8A 4Q3NA 2G0TA 1LRKA 4PLYA 4J4BA 4XWYA 3LT4A 1DAOA 2OBYA 3ICCA 1NQ5A 3LT0A 4TRNA 3E9NA 5JSFA 1I3KA 4QECA 2EKPA 1FXSA 2EW8A 5CDUA 2C20A 4JJIA 4XGNA 3HB5X 3CPSA 1FDSA 3RBZA 2FR0A 1PQUA 4XYLA 1PJ3A 4NFHA 2G76A 4LRSB 2UYYA 2CVZA 4IS3A 2NVUA 4L8VA 1I2ZA 1CEQA 3WLFA 4WLFA 3JD0A 4MVJF 3ZNOA 4B4VA 4R41A 2RIRA 4GX2A 1V3TA 3F46A 1VJ0A 4LGVA 5DCUA 2ET6A 5LC1A 1MC5A 4B79A 4JROA 2UAGA 1KBZA 3PQDA 3QSGA 3GMSA 3VC7A 1N5DA 2ZQYA 2Z1NA 3PFWO 1MX3A 3UF0A 1RKXA 4TMFA 1OI7A 5BQFA 3EHEA 5B4TA 1UP6A 2Q2WA 3VPFA 4TSKA 1BXGA 3AJRA 4NBVA 4IQ8A 2P4QA 3I3OA 3EDMA 1R4NA 3ASUA 2B35A 3GRKA 3ZW8A 2DUUA 5BSHA 4W9NC 4GLLA 4ID9A 2X0NA 3GDGA 4JK3A 2GN6A 3MJVA 4BGIA 2VYNA 4GQAA 1EUZA 4ND3A 3DR3A 2QYSA 4AJEA 1TVEA 1SO8A 4MVJM 4R3NA 1B16A 1GY8A 4H15A 5DNAA 1X14A 4N18A 1GUYA 2EIHA 2PK3A 4NH4A 2O2SA 1Y8RB 1NVTA 2E4AA 5BR7A 4RPKA 4L4XA 4LK3A 2B83A 3ULKA 3OBBA 4ALKA 2BD0A 1BXGB 4NJOA 2DFDA 1GEEA 1M76A 4FW8A 1ISFA 3GUYA 3AUTA 1R4NB 4KQXA 1EVIA 4TRJA 4WEOA 5GMOA 1BHSA 2QW8A 4M49A 3KYDB 4UUOA 3RBVA 4JJFA 3ZHBA 3VPHA 4ZN6A 4MDHA 1E7YA 1EBUA 3INGA 2IDZA 3KYCA 4FPXA 4RPJA 1H6AA 1GD1O 3EYWA 4P38A 2E49A 4MKRA 3TN7A 3E48A 2NUAA 4YDRA 3TNLA 1Z74A 1GV0A 5A3JA 1ML3A 3GRPA 3BMOA 2C0CA 2A4KA 2J5RA 4ND4A 2AXQA 4NIMA 1C1XA 3QRWA 4BO4A 4LN1A 1GU7A 1U7HA 2OGUA 4B3IA 4CM1A 3OQBA 3BXXA 4DLBA 5IDWA 3K2BA 3Q2IA 1KVQA 3EK2A 4RDIA 3VDRA 3AY7A 4YB8A 3AW9A 3PTZA 1B8UA 4HFNA 4Q3DA 1PZHA 4TVOA 5T57A 1E92A 5U4QA 2V6GA 3A06A 2VHYA 3AFNA 4E2XA 2WD7B 4M8SA 3NDIA 1TT5B 4GGOA 1GYQA 1DHRA 4OSPA 4WGGA 4HFJA 4EDFA 1ZK4A 2QQ5A 4PLTA 3ONEA 3Q9UA 4XDYA 3KRTA 2WSBA 4HWKA 1NXQA 5FFFA 1C1XB 2X4GA 3AM4A 3QQPA 3ZGYA 1TT7A 1N92A 1U28A 1ZBQA 2D59A 4IGFA 4BNIA 1OAAA 2HO5A 5HWSA 1ULUA 1SNYA 2XF8A 1HDZA 2I9PA 1GV1A 1GCUA 2JFGA 2VZ9A 1XQ1A 2BI7A 3CXRA 2AMFA 4BL5A 4N54A 5TJ9A 1YE3A 2J3KA 1Q7BA 3H9GA 3TJRA 5IXYA 1LDBA 3D4NA 5JNLA 1KVTA 5I7SA 4Z0PA 4JQCA 4R4JA 4HX5A 2VZ0A 4AL4A 3FNEA 2RH4A 3FCOA 4CM9A 1AN9A 3DBRB 2J5KA 4FDAA 5IZ4A 4CLEA 4Z3KA 3WSVA 3MJTA 4ZQEA 3IOYA 1P44A 4DA9A 4DLLA 1ADFA 4G81A 3DFUA 2ZKLA 5AOVA 2CFCA 4R54A 3PFFA 3SEFA 4JNKA 4KZPA 4QFCA 5KKCA 1B7GO 5ER9A 2DPHA 4WPGA 4CM3A 5DOVA 3NGXA 4XEHA 5GZ1A 4NDNE 2J5QA 2R00C 3FR8A 3KLMX 4DRYA 1RM3A 3PWSA 4P4LA 1B2LA 2QX7A 3MJCA 2VYVA 4I5DA 3I1JA 4BO9A 3BA1A 4S3MA 3GEGA 3GN2A 4Q39A 3OF2A 1MUUA 4J0EA 1TB4A 2GN8A 3STHA 3CH6A 2HK8A 5KCZA 4DC0A 9LDBA 4CMHA 4ND5A 4Y67A 2ZTUA 2BELA 2PLAA 2Q50A 4B4UA 3E9MA 4E5YA 1IL0A 1EK6A 3M1LA 1B15A 1HSOA 3I5MA 4MP8A 4XJSA 3L4BC 4OXNA 1CRWG 2ZCVA 5K0ZA 1OC2A 4PN3A 4KUHA 3O38A 1DLIA 5TJHA 4YAIA 3A9WA 5GZ3A 4XR9A 2ZB4A 3FTNA 1TA4A 4BVAA 1KYQA 3OM9A 5F1PA 4CM9D 1CIVA 2Z95A 2D2IA 4XZ3A 2Q46A 5IAAA 5IF3A 1YS4A 2HU2A 4AJKA 3PYXA 4PFJA 2C5EA 2DBZA 1HDGO 3QIVA 4TVBA 3JQAB 4YJFB 2DLDA 2R2GA 1LLUA 5EINA 5G0SA 4HUJA 4OIMA 2BFAA 4YQZA 2ZJ1A 1DC6A 2H9IA 2VYVD 1ZK1A 1A72A 1NX6A 4KWHA 1IE3A 1YQXA 2NTJA 4ZJUA 3WGOA 2X5KO 3BHIA 1YL5A 4BO3A 1GQ2A 2Q4BA 1C0IA 3ADPA 3P2YA 5L3ZA 4OKIA 2W90A 3TZQA 3L9WA 4BB6A 3FHLA 3VTZA 4RF2A 1I01A 4KTTE 3NEPX 1ZW1A 3AK4A 4FCCA 4FC7A 4FFMA 3FRJA 3MJSA 4CLHA 1H5QA 1CYDA 2CDBA 3GFGA 1VSVA 1MA0A 2UVDA 4CUZA 3S2IA 4DYDA 8ADHA 2JD1A 2JKVA 4RPHA 1KY5A 5T8KC 1E7WA 2FZEA 2IEDA 1VRWA 3M2TA 1KVSA 3VH1A 1F8FA 1X13A 3GH3A 3NRCA 4CL3A 1LLQA 1T1SA 4NHEA 2PH5A 2B4RO 3ZWWA 3UCFA 3N58A 2C59A 2FY8A 3I6IA 5DBGA 1D3AA 4I9UA 1LSOA 3UCXA 1L7EA 4YAJA 3WNVA 3GHYA 3RBXA 4H16A 1IZ0A 1Y5RA 2B4TO 1JQBA 2EHDA 3JQBA 5JS6A 4AJLA 4D7AA 4BOYA 1H94A 1Y8QB 3V2HA 1HRDA 3GVCA 2Y1EA 4PLVA 1O94A 1QSGA 3I4CA 1QYDA 1H6DA 3IIEA 2J3JA 1E1KA 2HMTA 2YUTA 5A04A 3IUPA 2GCGA 4IQ0A 4BNUA 2BI8A 4EW6A 5A06A 1YL6A 3IAHA 3ETDA 1DFGA 3DZKA 3WXBA 5JDIA 1LTHR 4Q3CA 4CV3A 3FR7A 4KOAA 1ZK0A 2OHXA 2NVWA 1EFLA 3A28A 2VRCA 4DYVA 2EERA 1OC4A 5DBIA 4WNCA 4GLOA 5F5NA 2JHFA 2PA3A 1BW9B 4NQZA 4HADA 1YGYA 3OIDA 3ABIA 4OOEA 4J7UA 2ZATA 3JYNA 4WECA 2VWHA 3WLEA 4OM8A 3DZBA 3GDOA 4LCJA 4AVYA 1W73A 3BIOA 3ZDFA 3WWZA 5G2OA 2W8ZA 2Y1FA 3ZH2A 3RIHA 3RROA 3LF1A 1HDYA 1V6AA 2NQTA 2D3TA 1F14A 1KS9A 3AI3A 4E21A 3KM0A 2XPCA 4DUPA 3H6KA 1DJQA 1PR3A 3WMWA 4NU5A 5DCWA 2WYWA 4P4NA 5L40A 1CETA 2ILTA 3DAFA 5JAMA 4LVCA 3HG7A 3FN4A 4O59O 2NU6A 4DMMA 4CMIA 2IEBA 2NTNA 4CQLB 1ZO8A 4K6CA 4F6CA 1H9AA 1Q0HA 5AXCA 4BMSA 2J3IA 3SLGA 4DREA 5IN4A 2DKNA 1FJHA 1F0YA 5JYDA 3PHJA 2QRJA 1GZ3A 1JKFA 1ZXLA 1E7QA 5JDCC 5I9NA 4J3FA 1UR5A 3TFQA 2VRCD 2AQIA 4OAQA 4PLFA 3A14A 5AXAA 1OBFO 4BNJA 3SLKA 1P1FA 3UOGA 4DPLA 4D44A 1F8GA 1J5PA 2V7PA 1W8DA 4IDFA 3GF4A 4FJ2A 3ZV5A 1WPQA 3OA0A 4U8GA 5A05A 4G65A 5ITVA 3DONA 1E1LA 1PR9A 2H6EA 2P9CA 5BNFA 4MJLA 1VM6A 3TSCA 3DBLB 4HXYA 3C1TA 1U5CA 4E12A 2D5CA 3UN1A 5I8WA 1LA2A 5GY7A 1PEDA 4ROSA 4IIVA 4MVJH 1PWXA 1N1GA 4B7UA 4YYZA 2GZ1A 3FI9A 3OA2A 3L9XA 3EMKA 4C7JA 2BLLA 2YZ7A 5L45A 2IXAA 1N9GB 5JY6A 1HYGA 3GNQA 1FDUA 4GH5A 3G49A 3OFSA 5EL0A 3Q11A 1N7GA 4MP3A 1FK8A 4NK5A 4CM4A 5L95A 2Q2QA 2WD8A 4DBZA 2D4AA 5MDHA 1ARZA 2WE8A 4OL9A 4AJPA 1ZH8A 3EC7A 2A9FA 2Y0DA 3V2UA 1A7AA 3WYEA 1PWZA 1VPDA 2X86A 4HFMA 4WLUA 2PWZA 5L4LA 4W9NA 3ROMA 3I6QA 3CUKA 4E4YA 2OP0A 4ILKA 5JMWA 1DIRA 2VWGA 3R0IA 2FPIA 2VRBA 3U62A 4GVLA 1U9JA 1D8AA 1LRJA 1XA0A 1R4MB 4F46A 4B4WA 1PGOA 1PS8A 2LDBA 1PQPA 3ITKA 2UV8A 3G3EA 2W2KB 3PDUA 1R15A 3V1UA 5TSDA 5CG2A 2ZTVA 4PLWA 2VQ3A 1P1IA 1M2WA 4Z0HO 4AFNA 1QYVA 3VZPA 4KDEA 3LK7A 3HFSA 4RCVA 1AXGA 1Z82A 2I3GA 3OP4A 1GYRA 3JD2A 3L77A 2NQ8A 3MJEA 2C29D 5F5LA 3ROKA 3ZNQA 3NT5A 2H1SA 2E48A 2YHUA 3K5PA 3NTQA 3QV1A 4HKTA 1W0CA 2PTGA 2AG8A 2DU8A 3QVTA 2NWQA 4RGBA 5KKAA 4CM6A 4ITUA 1LJ8A 4FD3A 2Y1CA 4KWIA 3IJRA 4XQGA 1E3SA 2OUIA 4IPTA 1RJWA 1WNTA 3H4VA 3WS7A 1TEHA 2IZ1A 5KVCA 3FD8A 4E31A 5TC4A 4WLEA 2P91A 2PV7A 3FPCA 2Y67A 4N7RA 4NPCA 5DOZA 3NDRA 1MGOA 2WM3A 4WCFB 3RUEA 1HE2A 3F3SA 1MG5A 1BTOA 1JVSA 2FPPA 1GQQA 1KY4A 2Y66A 3ORFA 4E0BA 2VT2A 3ZWBA 3JQDA 1HWYA 3ZHYA 4IDGA 3GY0A 5JC1A 3E1KA 1CF2O 4ZVVA 2H5LA 7MDHA 4DIBA 5KTKA 4JLWA 1YOVB 1UH5A 4DWVA 1B14A 1HT0A 4MPDA 3X2FA 1NFRA 2JFFA 4BO6A 4BKOA 2G17A 3ST7A 3F1KA 4PCVA 1HF3A 4WEQA 2AHRA 3C3XA 5JPIA 4EITA 3GOHA 3BMNB 5DDIP 1Q7GA 1KC1A 3CMMA 4MINA 4O1MA 3ZHXA 1C0KA 4XJTA 5T6BA 3H8VA 3KB6A 2IYOA 3RASA 2EJWA 1XU7A 4JBGA 1O95A 1WAMA 3WICA 1ISJA 1XG5A 2JCXA 1D1SA 3LLVA 4Y6SA 3RWBA 1LC3A 3DZIA 3IKTA 2O4UX 4XIJA 1WWKA 2VOEA 4NJMB 2BGMA 5JLAA 5H81A 1E3WB 4YT4A 1A9ZA 4D45A 5T5QA 2F00A 2GN9A 3KEOA 1G1AA 4HP8A 3QP9A 3PYLA 3JQ8B 4NU6A 1XDWA 3ROQA 1W6UA 3C24A 3MZ0A 3QLJA 4J4TA 1IZ9A 2GPTA 5JO0A 1YVEI 5IFLA 3BMCB 2PD6A 2DBRA 4QT0A 1BWSA 4BGUA 1XWFA 1SCUA 2R00A 4XKJA 1MXHA 3DXFA 1FDWA 4ALMA 4RVHA 1NPYA 3LU1A 6LDHA 4INAA 4BIIA 2D0IA 2Q49A 4WOKA 4QFDA 2DVMA 3BMQB 2HMSA 4BB5A 3JCZA 3OIFA 4P22A 1GPJA 4MVJG 5A9SA 1YL7A 4RDHA 3TFOA 5IXSA 5CPBA 2PD3A 1O8CA 2D5AA 2X6TA 4D43A 1WXDA 1E3EA 1DC3A 1PJ4A 3RJ5A 1SMKA 3RI3A 3QWIA 4IZIA 3L4BA 4E3ZA 2GNAA 1IUKA 2PFGA 4PLCA 1EEHA 3DEYX 3ZN2A 1X7GA 3EY4A 3QJ5A 4LVUA 1E5LA 3W8DA 1Y8RA 4IDAA 3JQ9C 1PGPA 1AHIA 4XB1A 2C7GA 2EP5A 4WE3A 1BRMA 2P2SA 2ZYGA 4OO3A 1WZIA 1ZSVA 4W7HA 1P31A 5I9MA 3LSYA 3PVZA 4FGSA 4MO2A 2NNLD 4DVJA 3KYDA 1RWBA 1SOWA 1P1RA 2PNFA 2Y0EA 1C0PA 5TT1A 4FFLA 3Q3CA 2B5WA 2EWMA 3RC7A 5A9SB 1VC2A 3PDJA 2ZYDA 2DTEA 4RVUA 3HSKA 2I65A 3LC7O 2VCYA 1GCOA 2PH3A 3E03A 4B7CA 5KJFA 3W4KA 1K0UA 1K89A 4Y9DA 4BQRA 2FR1A 2EV9A 2OMEA 3C1AA 3EZLA 4JP3A 5JAZA 1X0XA 3CKYA 1GADO 4U5QA 1KOLA 4PVCA 3K73O 3PJEA 4U0KA 1DLJA 5ITWA 5TT0A 1FDTA 5FF9A 1DO8A 3I83A 2VWQA 4BNWA 1NVGA 1TXGA 1VL6A 1R0SA 2VN8A 4YAKA 4XRRA 1CERA 2ZJ0A 1YQDA 4XDZA 2PKQP 4WCFC 4J2HA 2V6FA 3IS3A 3NDJA 3RVDA 3VDQA 4CUKA 2FSSA 5HA5A 3K2EA 4QSMA 4U7WA 6ADHA 1EUCA 5DN9A 5EQDA 3NTRA 4CL8A 2I99A 2WD7A 4ZQHA 4PRLA 1HTBA 2PD4A 1U2DA 4YXFA 2HDHA 3V5NA 5T8KA 2YFHA 1I33A 5K9ZA 1TT5A 1U4OA 1KVRA 2IRWA 2JCYA 5KJCA 3GQVA 3CZMA 5L51A 4DLAA 1RPNA 5CDSA 1XR3A 1J0XO 2Q99A 5COBA 1JKIA 2XOXA 2ZB7A 1ZNQO 4XGIA 4GSKA 1H93A 1T24A 3Q1LA 4GBJA 4M1QA 1WDKA 2GASA 1ZEMA 4AJ4A 4BNVA 3TZ6A 3CTMA 4OXYA 3ENNA 2X23A 2JAPA 4LW8A 3RKUA 4DTIA 2W98A 3DAGA 4YEDA 2LDXA 4X54A 1LDGA 2WMDA 2X9NA 4GWGA 3BTUA 3H3FA 3H5NA 3FWZA 4CUJA 3DBRA 3A4VA 3PIIA 3S55A 3K8ZA 4E5NA 4BNNA 4A7PA 2PGJA 1E1MA 4CPDA 4J1SA 4M87A 1SPXA 5KIAA 3BHJA 2ZTMA 3CSDA 4BMVA 1L7DA 4ALIA 3PRJA 1KEVA 4RVDA 1BVUA 1E6UA 2OL4A 4O6VA 2J3HA 2WEKA 2C7VA 1AUPA 5EJ2A 5JXWA 1S7CA 3H7AA 2AW5A 2NLOA 3MOIA 5B37A 1WW8A 1ZFNA 1ISHA 1BMDA 3WFIA 2DBVO 4BNFA 3C85A 4D3FA 3JD1A 4Y98A 4CLDA 1O9BA 5KWEA 2QZZA 3BTVA 3DL2A 1OZAA 4GSLA 2AA3A 4B3HA 3WBBA 3AU9A 3SX2A 1ORRA 4EGFA 1E3JA 4A26A 1B3RA 3DOOA 1QYWA 3WQSB 3H5AA 1NASA 4R51A 4AG3A 1E3IA 4EJMA 3ZU3A 4D0RA 4FIZA 4FFOA 1D4FA 5AXDA 5JYEA 3I9JA 1I32A 2YHIA 1RYEA 2RCYA 1MB4A 3GVPA 3WTCA 2B5VA 5ENVA 3BHMA 4BO2A 2EGGA 5FYDA 3L0DA 1EQUA 1B8VA 5L4SA 3DZJA 3TDKA 2Y93A 3WQQA 3E82A 2WE7A 5KOIA 2O3UA 3TOZA 4DIOA 1UZLA 1C0LA 2G82A 1P0CA 1UAYA 1ZXBA 2GLXA 3ANNA 3OJOA 3JQAA 1YWGO 4IIUA 4YJFA 1VJ1A 4P8RA 4BKRA 1LI4A 1V3UA 4D41A 4DPKA 5JDCA 5CDGA 4IBOA 2GR9A 3VKVA 2P68A 3DWFA 3HFGA 1GZ4A 4BNYA 4DBVO 1GUZA 3AOEC 2FN7A 2Q1SA 2BGKA 2QG4A 2HCTA 3F6YA 5IN5A 4AJJA 4H7PA 4CODB 2BFMA 2YHIB 4JBHA 1PJCA 5ER6A 1QP8A 2HK9A 2O4CA 3KXDA 3OEYA 4L75A 5CDTA 2PGLA 5KNLA 1XHLA 4JP2A 1GTMA 2CDCA 3O4RA 1DRUA 1HZJA 3HDJA 4ESOA 3QE3A 5THQA 2B36A 3TWOA 3AY3A 4TZKA 2ZQZA 3RUCA 2BFPA 3R3SA 5CEEA 3PJDA 5HRUA 3BYZA 1I3NA 4IZHA 5EQFA 2RHCA 5C3MA 1VSUA 3QW2A 4I5FA 1M67A 1SB9A 5BT9A 2O3SA 2X1HA 3F4LA 1RM4A 1EDOA 3L6DA 5DP2A 3NX4A 4XD2A 3JQFC 4K26A 2ZB3A 4NG5A 4A03A 4CR6A 1QG6A 2AE1A 3QWFA 2WJPA 3JQAD 2YDXA 3S8MA 2PZMA 1X7HA 3TF5A 4UREA 4NFYA 1DEHA 3KOUA 2P5UA 3LDHA 1LQUA 3GNSA 1NR1A 3JQGB 2WTBA 1DBVO 2EF1A 5LCXA 1CQIA 3HB4X 5F1OA 9LDTA 3GVIA 1Y8QA 3DBHA 5CAEA 1YB1A 3R3JA 3D3EA 4BGVA 1JKJA 4YJHB 1LDNA 3G17A 3RUDA 4YVFA 4CV1A 1IHXA 4BNXA 3A1NA 3AFMA 5G4KB 3D4PA 2H63A 1O5IA 4MIOA 1L1FA 4RPLA 5F21A 1DJNA 4CMCA 3GG9A 2GF2A 1NM5A 4UEJA 5DF1A 5EERA 3D5TA 5TIIA 5DT9A 4RZIA 5K6AC 1G0NA 5A5EA 3PWZA 1GAEO 5H82A 5GZ6A 3RFTA 5U9CA 3V8BA 3IP1A 4EI2A 3OICA 3WR5A 1R12A 4J7CA 3GLQA 3GZNB 1PZGA 1ZK3A 2VUSA 3S1LA 1VKNA 4L4SA 1HDXA 3HDHA 2C82A 4R1SA 2R6JA 4ALJA 1LDMA 4K9DA 3RC9A 3DBHB 1BW9A 2DC1A 2NV6A 1VJTA 2Z1MA 3AM3A 4DQXA 4YAEA 2X0JA 3ON5A 1EZ4A 5JCXA 1KIFA 4NI5A 3ENKA 5JY1A 5A4DA 2DTDA 1JWBB 3JSAA 5BSFA 3SVTA 4MVJP 1OFGA 1R66A 1YBMA 3H5RA 1UDCA 2NTVA 4NNJA 3JD4A 1R6DA 4IINA 3HQ4O 1U3TA 4AJ1A 2EP7A 1P33A 2G1UA 4QXMA 4PVDA 1ENZA 1BXZA 1Z7EA 5TQVA 1EQ2A 1PGQA 5A1TA 1HDCA 3D3WA 2B4QA 1QV7A 2VNAA 4CQLA 1UZMA 4NR0A 2PZJA 3AOGA 2O7QA 1P1JA 3NT4A 4L0QA 3IC5A 3UFXA 1AHHA 1DC5A 1XSEA 4OH1A 1X7DA 4J49A 3FBGA 4XGKA 3DAPA 3H9UA 3PXXA 2IODA 4OYRA 3NAQA 1KEWA 4FS3A 1NFQA 1A4IA 1S6YA 4YR9A 1MFZA 1YBAA 1WDLA 3QVSA 4LRTB 4YT8A 3G1UA 3R1IA 3ZWMA 3BTOA 4J2OA 3DQPA 3GHHA 4XYGA 3PHIA 1ZSYA 4A2CA 2C07A 1C1DB 1GYPA 2FRDA 1VE9A 1BXKA 1ZCJA 2CZCA 2OP1A 1VL0A 5BNTA 1HLDA 4TRMA 1HLPA 2IE0A 1WZEA 1C14A 3DBLA 4FFRA 3T4XA 4CLRB 3D3WB 1OOEA 4ZICA 3H2ZA 1J49A 3QWBA 2QZ9A 4TWRA 5FI5A 1NFFA 1O6ZA 1QR6A 2GD1O 3WX0A 3ZWNA 3ADOA 3WJ7A 1ISMA 4ZA2A 1PIWA 3DOCA 3U3XA 1JVBA 3OJ0A 4ONEA 3VVBA 4EZBA 3OJEA 2DUWA 4PGFA 1N9GA 5JO9A 4GX0A 1LBEA 4N5NA 3TQHA 2JJYA 1DC4A 1PJTA 5C37A 4Z9XA 5TGDA 5A5FA 5J23A 3LZ6A 2BMAA 4IJKA 3WWYA 2VHVA 3WGZA 3S2EA 1ZZEA 4Q3EA 3HUDA 2QIOA 2GGSA 3IL2A 1ZKMA 3RAJA 1A71A 1HYHA 1T2AA 2AQHA 3LT1A 4CR7A 1YRLA 3IKVA 2VHZA 3MWDB 1JTVA 2VT3A 3OECA 1UP4A 3H2SA 1PJ2A 4XX0A 2HJSA 3G79A 3PI7A 1PJSA 4PG6A 1XGKA 1DSSG 2EKLA 2RAFA 3DHEA 3OHSX 4OXKA 4D42A 1I5RA 1AE1A 3F1LA 4DC1A 1ENYA 1R4MA 5B4UA 1R0KA 1HDRA 1PL6A 4CLOA 4NFSA 2QYTA 4R1NA 4RVFA 4ALLA 7ADHA 1I3LA 3CMCO 4IM7A 1IPFA 2W2KA 1QYXA 3GNTA 2I67A 1PL7A 3I23A 3UICA 4B4OA 1DPGA 4L76A 4CR8A 4Q3BA 3JQ9A 1QKIA 1ULSA 1GFSA 4PG4A 2C54A 3ZWAA 1NHWA 2P9GA 1I24A 1P1HA 2D1YA 2IYPA 3T7EA 4TRRA 4E13A 2X9GA 2OORA 3DTYA 3I9MA 3GG2A 5TNXA 4R1UA 4BHTA 4EEXA 3WGIA 4BV9A 1N8KA 1A27A 3QVWA 4BNHA 3HWRA 4J9VA 5I7VA 1QV6A 4GVXA 3O9ZA 4NBWA 3W6ZA 4MVJA 4UEOA 5FI3A 3M1AA 2B37A 4CLOB 4R68A 1K6IA 1NAIA 1Q2XA 2HKIA 2X0IA 4UUNA 3VH2A 3LVFO 3JYLA 5L9AA 4OQYA 4YACA 1P3DA 1LLDA 4G5HA 3GEDA 4YQYA 4JXKA 1SC6A 4FB5A 4YPOA 4RV9A 4I1IA 2EJVA 4YAGA 4E2WA 3JD3A 5IZCC 3BZUA 4FOOA 5G0TA 1ISIA 3R6DA 1MLDA 4ZU3A 5JCJD 2EW2A 2PY6A 2AG5A 3Q6IA 3GK3A 4GX5A 4PZCA 1M75A 2Y68A 4DIFA 1T25A 4LCEA 1MFPA 2JD2A 2X0RA 1NWHA 2UDPA 3B1JA 4WCFA 4RF4A 4Z0TA 4B7XA 5A03A 3EVNA 4LMRA 4ZQFA 1KETA 3W8EA 4GKVA 3FNHA 5DCYA 4YTEA 4W4TA 4B8WA 2VWPA 5KJ6A 4BS9A 2EGHA 3DMYA 4CQMB 4BNKA 1BDMA 2NU7A 3U4HA 3OQ1A 3W4JA 1YOVA 2PGDA 1NAHA 1HYEA 2BRUA 4IUYA 3P5SA 3ZNNA 4J4HA 1NHGA 3T7CA 4DQUA 4R9RA 1Y7TA 1GPDG 1LU9A 2X5OA 2YQ5A 3F4BA 4RORA 5TRTA 4A27A 5A9RA 1UXJA 2XXJA 3OJLA 3U4IA 2I5PO 2ZK7A 5AXBA 1ADCA 3BMNA 2CVOA 4MVJD 1JWAB 4JX8A 1XELA 1T4DA 4E5MA 3JQCA 1H0KA 2BKAA 1EVYA 1F12A 1U5AA 1PGNA 3ASVA 1MV8A 5JC8A 4E5KA 1MC4A 1PS9A 4MVJI 1NP3A 3C7DB 3RUIA 1V8BA 3SXPA 4UEKA 4YRAA 4J9UE 4EBFA 3RSHA 4CM5A 4R16A 3DDNA 4PLGA 4R9SA 4WJZA 1LSSA 4NJMA 1UXHA 3IP3A 1E3WA 3RCBA 1R16A 4DL9A 3INRA 3WYBA 1T2DA 2Y1OA 3VZSA 5LDHA 2GDZA 1FF9A 3Q2KA 4FGWA 3P2OA 1V9LA 2GO1A 4D3DA 4E6PA 1M6WA 3BAZA 3JQ8A 3H9QA 5HBRA 1GDHA 3NJ8A 4FBGA 2VUTA 4AICA 1YJQA 3VZRA 1T26A 2RBEA 5C7OO 1AGNA 4R5MA 3ICPA 4BNMA 4DGSA 3BMCA 4FOSA 5DULA 1Q1NA 1XKQA 3TL2A 3VOSA 3VAZA 5AQ1A 2GYYA 2D8AA 4XQ9A 3F47A 3JYPA 3LF2A 4EUFA 5BNIA 5COQA 4MP6A 5TX7A 2ZYAA 3ZWVA 3GT0A 1LDYA 4WK6A 4YRDA 5DZSA 2GSDA 3WBFA 1LC0A 1J4AA 1ZIDA 3PP8A 1U3VA 3PQEA 2VZ8A 1HETA 4ZQGA 3SJUA 2AEMA 4FR5A 1EVZA 2CUKA 3BMQA 4A5OA 3FBTA 3PZRA 4U6QA 4K28A 5A3VA 3ZV6A 2O3QA 1YQGA 3O8QA 1Y9EA 4W7IA 1XQ6A 3VH3A 4EYEA 2CF6A 3WIEA 2DFVA 2J6IA 4C4OA 2O2YA 4R01A 4I08A 1PL8A 1XCBA 1ZMTA 2PZKA 4GPD1 4NBRA 3KETA 3X2EA 3ANLA 4QEDA 5DP1A 1ADBA 5ILOA 3KVOA 1O89A 1U3UA 3EGOA 3JTMA 3N7UA 4PLPA 2X58A 3FTPA 2C2XA 3UKOA 4PLZA 3G0OA 3VPSA 1T4BA 4EEZA 4JGBA 1HEUA 1HKUA 3OQ6A 3O8QB 1UZNA 4XYBA 2NU8A 3WDSA 5U1PA 4Y6PA 5EIOA 2HMWA 1KC3A 3PLNA 3TPCA 1YKFA 3ZNPA 4PIVA 5CPFA 5F1KA 1U3WA 1DHTA 2AEJA 1HSZA 2YYYA 2IZ0A 3ZCXA 3AOEA 5CP8A 1HE4A 3WQRA 3W6UA 3UHAA 1X1EA 3AI1A 3ZWPA 3O26A 1NQOA 1BG6A 2JHGA 3KSZO 1IB6A 3DFZA 4WNIA 2VHXA 1ZEJA 3CE6A 3NV9A 1E7RA 2FPGA 4BQPA 1U2GA 1P9LA 2P9EA 3L07A 3SC4A 3GEMA 1NQAO 1I8TA 5ILGA 4D46A 3QWHA 5COAA 4W6ZA 3IJPA 3I9KA 4ZGWA 2C5AA 1EK5A 1NWCA 4MIEA 2WYUA 1LSUA 3VH4A 3L4SO 3H3JA 2HMUA 4PZEA 3GAZA 4RLHA 5IDYA 3M6IA 4YWJA 4EUEA 1H2BA 3U0BA 4TQGA 4DXHA 2Q3EA 1JU9A 1T2EA 3MTGA 1WP4A 4ALNA 1B26A 3JQFA 1ENPA 3K96A 3WGQA 4GL4A 3K6JA 2QRKA 4P4GA 4WUVA 5A9TA 3DZFA 5B12A 1PZFA 3KUXA 3WTBA 2B0JA 1Q0QA 2CF5A 4G2NA 1PSDA 3D7LA 2NVUB 5KJ1A 1KEUA 4CMAA 1DRVA 2B69A 3DZGA 4OSOA 4XQEA 2FWMX 1PTJA 4ZRNA 2EKQA 1J6UA 2W2LA 3GPDG 4J90A 3ZI0A 1WMBA 1WLYA 2HMVA 3HDQA 4QX6A 4E32A 4HNHA 1P74A 4JN6B 1UJMA 3SC6A 4QQRA 1YONA 1I30A 3F5QA 3JQEA 3AUAA 1KEPA 2QRLA 2Y99A 4F6LA 5K6AA 1YDWA 3B1KA 4Q3AA 4PG5A 1SZJG 2YQ4A 4BNZA 3AM5A 3FWNA 1DFHA 1WMAA 4EUHA 1SEPA 3VPGA 3FNGA 4IQGA 5EMHA 1HZZA 1LRLA 1V0JA 1ISGA 4NBUA 1PJQA 4NK4A 3NGLA 5JAIA 2X8LA 1NYTA 2W4QA 2NADA 5H83A 1ONOA 3O03A 2DPGA 1K6XA 4J1QA 4CM7A 1EE9A 3RC2A 5C7IO 1X0VA 2Q1UA 2DQ4A 1QLJA 1SEVA 3PHLA 3QHAA 4UVDA 3I9LA 2VYND 4CLXA 3KSDO 4DMLA 3UAGA 1HXHA 3GPIA 4MKXA 1T1RA 3ZW9A 1V3VA 1VI2A 2YV1A 4E2YA 4CJXA 2XXBA 2JCVA 4AJ2A 2BF7A 4I8XA 3GR6A 2EEZA 4OGWA 4YJDA 2W2LD 4TKLA 2NU9A 3B20A 4WKGA 2YY7A 3JQ7A 3K30A 1FMCA 1UXGA 5ADHA 3HHPA 4J16A 1SOVA 3WGHA 3C1OA 1NQTA 3KYCB 1NBOA 4MIYA 2Q2VA 5BSEA 3UUWA 4H3VA 2OO5A 2DTXA 1RM5A 2AQKA 3PZBA 2JFHA 4LSWA 1U4SA 4RZHA 3DHYA 3RQSA 1DAPA 1GQYA 4M89A 2O3RA 3ETEA 3FNFA 1KERA 1M66A 1LDEA 1U8XX 2X22A 3HDYA 5F3RA 4FFNA 4YCAA 1NPDA 3BMOB 1B0AA 1MXFA 3JV7A 1Z73A 3JQ6A 3ROPA 4D3SA 2CVQA 3LC1O 3QA9A 4II2A 5TS3A 1E3LA 3GGPA 4RPGA 4BUCA 4JIGA 1Z7BA 1ZMOA 1N2SA 3P7MA 1UXIA 4CMEC 4CMGA 1I2CA 4YJGA 1N7HA 3G1TA 3JQ7B 3LC2O 4Z6KA 3MWEB 1LEHA 2Q1WA 3M2PA 3DMTC 1NTOA 4PRKA 5JE8A 4RL6A 5I8ZA 2E82A 3OEWA 5JW6A 2WYVA 5IDQA 3KV3O 3OETA 1DXYA 2FSVA 1Y81A 1I3MA 1YBVA 4XCVA 3TZKA 3L6EA 4HV4A 1I36A 3GZ4A 5C5IA 4MKZA 1JW9B 5G0UA 3GGGA 2V6MA 4A10A 5HM8A 4GWKA 2FZWA 4Y6RA 3E9QA 3H9JA 3RUAA 4J91A 4CMBA 4PG8A 1JAYA 1CJCA 4TKMA 2I3AA 2GERA 2QHXA 1IOLA 4QTZA 4D0SA 3PWKA 3KTDA 2HJRA 3BTSA 4IMRA 3V1TC 3Q0EA 2JAHA 3E6AA 3KZVA 3PQFA 4MOWA 5ICSA 3PLRA 3PGJA 4KP7A 3WJAA 4HFRA 3WOHA 4YJGB 3RD5A 4O0LA 4IDEA 1EMDA 4XR4A 3VKUA 5JAQA 3WG9A 4CM8A 3MCVA 4TROA 4HY3A 5TF4A 4CV0A 1PGJA 1NR7A 1YB5A 3JYOA 4E30A 3C8MA 1P77A 4IJVA 4RVSA 1DIGA 3JQGA 1G0OA 1K3TA 4KUGA 3SBOA 4A73A 5IG2A 3QWAA 1K2WA 2EXXA 4FQ8A 1UUFA 1DIAA 1Y1PA 2TMGA 1EUDA 4L4RA 4JBIA 3UCEA 4QO8A 3I9NA 1WDMA 4YJHA 4RO0A 5EPOA 4BKPA 2NM0A 3WGTA 4IJWA 1E7MA 4RQTA 4IXTA 5KVQA 4GKBA 1Y5MA 3PEFA 5G4KA 3WIDA 4UVGA 3RC1A 5MGBA 5I7FA 3IMFA 2O3TA 1IY8A 3ZWOA 5L7TA 5HTOA 2GN4A 2PR2A 3WNQA 1SBYA 3RFVA 1AXEA 3RUHA 1DB3A 1YDEA 2I66A 4RLSA 4KUEA 2SCUA 4GMFA 2ZIZA 4CM8B 1E7SA 3GC6A 1MP0A 3D4OA 4XA8A 2X5JO 1K5HA 4M54A 4XYEA 3GZNA 4GAEA 2CSUA 4FFPA 2E37A 3GUCA 1EDZA 4BNGA 1HE5A 2FP4A 1TLTA 5CEJA 2GZ2A 2X7HA 1KVUA 1BDBA 2BGLA 1DRWA 3DB2A 3ZU5A 1NVMB 3QVXA 1M6HA 1LUAA 3CEAA 4N5MA 1D7OA 5FWNA 2FR8A 2YV3A 3PGXA 1WVGA 4LISA 4RQUA 3VZQA 2RHRA 2CDAA 1HDOA 5G0VA 4BKUA 3U4DA 4AJNA 4KTVE 4IDCA 2JL1A 1F17A 5TLSA 1TI7A 2HLPA 3CZRA 2A94A 3LQFA 1PS0A 1UDAA 5IZCA 3COSA 5FEUA 3DBVO 2VOJA 3N74A 4NMHA 4R5HA 4YA6A 3NTOA 1JA9A 5JMPA 4Z3DA 2RH8A 1LX6A 2O23A 1GZ6A
chains in the Genus database with same CATH superfamily
1UFKA 2CY0A 1TOAA 3OQNA 1QAMA 3WGYA 2OXIA 4BO1A 2G9UA 1KO7A 1V35A 1W47A 3RF7A 2QU7A 3LCRA 3RRZA 1DIOB 3WAGA 3GVXA 4S1VA 4H0CA 4BFVA 1VIAA 1B8PA 1O7JA 2FWAA 3NORA 4YO8A 3SS7X 3PC7A 4B33A 1K8QA 3L8DA 3A4MA 3E22A 1M0WA 4P92A 3INTA 1IEVA 1GUFA 1TJ3A 4JJ7A 3TRIA 3CX7A 1JF8A 2EFHB 2D3WA 4QYIA 3U60B 4PZDA 4ROTA 5H70A 3OX4A 3NFRA 5CDYA 1Q1AA 3A4YA 4LY6A 1AO0A 1N36B 4ISBA 2QTNA 4OU4A 2VP9A 3KS9A 4ZV9A 5B55A 2O2CA 4DLTA 2B6NA 1ZK2A 1EFUA 3D0OA 2GK3A 3M6WA 4IY1A 1ACMA 2WSMA 1PT9A 2WLSA 3TZEA 3W2HA 4AJHA 3K6SA 1USUA 4B83A 1RLIA 2R4UA 5SYNA 5JBQA 1JHMA 4YCMA 4TMWA 4LMPA 3IV9A 4OI4A 4V38A 4C6SA 1F1JA 3I64A 4EYQA 2CJWB 3G6KA 1G9TA 1YULA 2P4EA 2ZZKA 3LD9A 1HI9A 4LDAA 3NW9A 3C3JA 1QG4A 4FSHA 3THRA 1XRLA 4X61A 5E4JA 1KFBB 2Q3FA 3IAM6 2VJKA 2X2OA 1IIBA 3QE0A 4A8PA 2R6ZA 4QJ4A 5HE8A 3KPWA 3N28A 1A7KA 4B43A 4DIKA 1U8UA 1Y3IA 2NVBA 4KQEA 4QGGA 3MTJA 5KVVA 1Z17A 4OFZA 3LKDA 3IP9A 3B1XA 3K0AA 2PIDA 3KCQA 4F92B 5KJEA 2PS0A 1ID1A 4L4UA 2XB2A 2C3OA 1SVSA 2PA0A 2GBPA 1N5LA 5LLSA 4LNAA 2D62A 4KW7A 5HFJA 4DV4B 1U28C 2Q07A 4YMGA 3E18A 4L16A 4URFA 1XRPA 5KREA 2DOKA 5L4NA 3U2QA 2ZTHA 5IJZA 3KQMA 4MI6A 1UPUA 4JT2A 5D87A 5E9WA 3TMKA 1MOZA 3YASA 3ZHVA 3KSUA 5C1PA 5LQJA 4H2DA 4C5AA 3L05A 3CQ9A 4FN4A 2C7OA 3C98A 2CXPA 5IUJC 2OBNA 4IIJA 4BC1A 1JEAA 3T5MA 4Q7KA 2ADMA 2V6BA 1GGKA 4QRHA 3LFTA 5CJJA 1A9RA 5GJCA 3W8FA 3R3HA 4Y1EA 4LSMA 4MS1A 4W99A 3FFAA 4TUYB 3OZBA 3DDCA 3O8OA 4HVAA 2QTTA 1JN0A 1LXCA 3K72B 4OMUA 5L7YA 2Z09A 3ZU4A 4E5PA 1SH7A 3TOXA 5HR5A 2DAPA 4BQOA 3ZEIA 5CFLA 4M9XA 2FJUA 4IF4A 1BXRB 1NJSA 4EMSA 4O3MA 1XDSA 1E8DA 1J8VA 1LVGA 3NBAA 5E1OA 1QPZA 1G5PA 1GL3A 2A1UB 5J4LA 1A5ZA 4B3JA 1I10A 1PUJA 2XA1A 3N2GA 4C7KA 2YW2A 4EJ6A 3P9ZA 2UXDB 4U2DA 1AH2A 2J0UB 3LE8A 4X1IA 1XNJA 2NQ2C 1KDPA 5DBFA 1YGPA 5KNBA 4AKSA 4TV8B 4NNOA 4DLVA 4BY9E 3ONDA 2YJNA 3G2PA 3WLSA 1C7IA 2BEUB 3AF2A 1L1RA 3PL5A 4OHUA 4CV2A 1RQLA 3L8FA 4ZVLA 2XUQA 4PGMA 4GQIA 3IDSA 1E5VA 2HO4A 3BOSA 3U4CA 3AC0A 2WLTA 4JI6B 3L2OB 1XNHA 1AGPA 3CX8A 4CG3A 1KI4A 3AWIA 3JRNA 3QF4A 1TX4B 3KX2A 1SVUA 1IPEA 2NTYC 1IXZA 2G40A 3G2NA 3D4LA 5LZ8A 1EU1A 2G72A 4RZQA 1A50B 1UC9A 1D9XA 1XTKA 3LBAA 2GPJA 4MA4A 3KC2A 4MV5A 4ZYLA 1QC5B 4DCUA 1W25A 4EQ6B 3B13B 1MOPA 3VVCA 1W96A 1RAGA 2O8NA 1C41A 3KOYA 5JCJA 3TTXA 3FGZA 2XUZA 1XZ8A 2BR4A 2ICAA 1RWOA 4IXDA 1BDIA 2PYIA 1U1EA 3ISJA 3NONA 3KK0A 2Q4EA 3TIIA 3ZWCA 4QBHA 1QLHA 1X1DA 5ILQA 5I7EA 4MUBA 3SF8A 1IG3A 5BRNA 1KYZA 1HNXB 3QPWA 1SD2A 4HNQA 3CGGA 4CIAA 4KO2S 1JAHA 2H1VA 3IO3A 3AI2A 1ADGA 3ZUGA 1NNEA 5D7BA 1RP7A 3SJCA 4HZGA 2KM1A 3LKZA 2VDQB 4MQEB 5KNDH 4K9MA 1IU9A 1Y6JA 4MGEA 4Q1AA 4J03A 3TAXA 3UJ3X 4U02A 4UULA 4WERA 4A8HA 1JAXA 4HAUA 4QJ5A 5FWYA 1KPGA 4YQFA 2C2BA 4HATA 5HKOA 4NEGA 3PK0A 4JQZA 1VCMA 2SKDA 4G0PA 2QMOA 5KNBD 1VCNA 4ZRMA 2G5CA 4XYMA 3M82A 3AUJB 1J22A 3AGQA 2C2YA 9GPBA 3EULA 1XTJA 4CQMA 3RPEA 4NXNB 1KMMA 1G21A 2ECPA 2XUOA 4OQZA 2Z2JA 3SJ7A 4A6PA 2QDKA 2CNBA 1KY2A 1QORA 1ZUD1 3OURA 4OP1A 4PZLA 1AS3A 1T2CA 2P69A 2GBLC 4M46A 4F45A 2AC2A 3ZHZA 5B1YA 2VTEA 3NOXA 2R1VA 3AG6A 3GQBA 5JZOA 1VL5A 2F1KA 1I80A 3A32A 4DA6A 3RU9A 1I4DD 2UUAB 4QPCA 1QX4A 2IL1A 1U3CA 1W6RA 5B7NA 5EXPA 5ADWA 5DSZA 1RYYA 1UKZA 4OLAA 1NQWA 1MX1A 3HY6A 4LVOA 3D7KA 3QMVA 4RSRA 1XMJA 5JZVA 2P6MA 4UXHA 4KYIB 1P45A 1PV1A 2HK7A 3C7AA 4HN2A 1NYQA 4E2ZA 4GKKB 3WGGA 3WMXA 4AYWA 1WY5A 4KR2A 4CHGA 1MHTA 3G9XA 1JIXA 5J2TF 2X0EA 5JZ9A 1F0NA 2AMLA 3ECSA 4K8OA 1BGVA 2YDYA 3HYSA 4PQFA 4IO1A 4JI2B 3KZMA 4AKIA 1BOFA 1CV2A 2L69A 1L4FA 4C0QC 4J43A 4ZD6A 5LDGA 3M83A 3PTAA 3OE1A 1QQTA 3ICVA 4JBXA 3DEZA 5JAOA 2HSZA 3E8XA 1OREA 5HXAA 3IKLA 3SYKA 1PJBA 4BEBA 2HCBA 4KC0A 2Y4OA 4B3CA 3IUSA 2W42A 3KJGA 4YV0A 1JLLA 2GM5A 3ZWXA 1X80A 3PHHA 2K7FA 1GAXA 2A86A 2BGTA 2PKCA 3FF4A 2C04A 3GJ7A 3EPKA 2KMLA 1IULA 3KVYA 3OWOA 1S4MA 1SU6A 3GMDA 5HS6A 5AD1A 4CQMD 1JECA 1QXSA 2V74B 5LQMA 1Q0SA 4QDJA 3WY9A 3B51X 2FE4A 3K4HA 2QD5A 3CZPA 5E0KB 5DRTA 2QROA 3DVAB 2YXBA 1TMKA 5HKBA 1GNPA 3O9VA 4HNRA 4PYNA 3RVSA 1KWGA 4EP1A 2VTDA 1KEEA 3CT4A 3TL3A 5DHSA 1OMOA 3DVSX 4WH0A 3F5SA 4M86A 3TZCA 1UF9A 1NMZA 4GZMA 3DVQX 3H75A 4U7JA 5EHZA 4DLRA 5HW0A 5KYXA 1DNPA 4IFTA 4V0RA 4IDDA 3ZIUA 1L4MA 4EJSB 3K92A 4MV6A 5J47A 3TNYA 1QO7A 1KAMA 1SVOA 3DTTA 3KZOA 4GXNA 3WL7A 3AF4A 2TECE 3UH1A 3ZJ4A 2OZPA 2O19A 1VIMA 3B53X 2NO7A 2QM3A 1T8TA 1CS0B 5JDIC 1HE1C 3C7CB 3L0BA 1RI3A 1UBKS 4N5LA 1SB8A 1WEHA 1ZG3A 1QTIA 2V45A 3EVFA 1DPFA 3CVVA 1WB6A 5FOQA 1CWUA 4UUMA 5PNTA 1MVLA 4AZWA 4ZHSA 1LCIA 5JAPA 1UP7A 5EESA 2XD4A 1SVIA 5BR8B 5ALIA 1K9SA 1GVHA 2CN1A 2WFLB 2YZKA 2FWPA 3VPCA 5L6LB 3DGEC 1E59A 5LJLA 2AMYA 5THKA 2RC6A 3B3AA 4Q3LA 5ENDA 4F4HA 4JXZA 3AWDA 2HUNA 4TZTA 3KSRA 1KE1A 2D2EA 3DLIA 3JPYA 3GGOA 3KOWA 3UFBA 1UEJA 4G0UA 3V7WA 4U6SA 5BPHA 4UASA 3G5UA 3K2QA 3CIFA 3GL9A 1NY5A 2OUKA 3DOJA 3ADKA 4KQMA 3H1BA 1P0QA 1T0UA 3P9PA 2WHYA 4C2UA 4M0CA 2G88A 2FHSA 3QTTA 3K31A 5B4VA 1NW8A 4JDPA 1OH8A 3FVWA 1JUDA 3T4EA 3GFPA 3BFVA 1QE3A 3GT7A 5JBIA 4P4TA 1Z2CA 4WLVA 3DMTA 3LYLA 3MWJA 3RAFC 2G25A 1DCMA 2QQFA 4IIEA 3FSGA 4PC7A 5FI1B 1YA4A 1T10A 3UH0A 1GUAA 1TFUA 2CCKA 2CXXA 3G0BA 3VHRA 4LDNA 1E1RA 1IATA 5IKOA 4NAVA 1PHRA 3C97A 1ZNWA 3A05A 1G7TA 4Q9NA 4YCDA 1W0KA 1FFHA 3UGKA 3P9CA 5ESWA 3ZYCA 1MGPA 1DDOA 2JFVA 1BS1A 5C2JB 1PO7A 3ED5A 1M8JA 4HF7A 1WY7A 4UVEA 1N2CB 5L7WA 3PNVA 3U6KA 1YMVA 3MAJA 1PX0A 2YV2A 4BYMA 2EQBA 1HO3A 3AB3A 1TKCA 2ZDHA 3BICA 3FYTA 2G0TA 3O8DA 5REQA 3WP1B 4J4BA 1XCJA 3I12A 5K3SA 5GOZA 5CVCA 4FHCA 3RVPA 3EDCA 1DAOA 4JVMA 4C0JA 3RF6A 2J46A 2YV4A 1WSAA 4F5EA 3LHIA 4U2BA 1P2DA 3ZX4A 5JSFA 1I3KA 5KYKA 2VQFB 2YRWA 1HNZB 2E9SA 4JJIA 1R1DA 1WZNA 2Q5JA 1D2GA 3JZFA 1BA2A 3T15A 3CPSA 4Y1RB 2PWAA 1PQUA 4Q1DA 5EJ7A 2VAMA 4H6XA 4KH1A 2UYYA 2CXUA 1T6ZA 3BD8A 4L8VA 5DYYA 1CEQA 1RADA 2JIBA 3FWYA 3JD0A 1A1VA 3U4QA 1F0KA 4B4VA 5DCUA 1YU9A 1ORHA 4LGVA 4P53A 3C3MA 3CSSA 3HFJA 1MC5A 2F48A 4QQ8A 4XCXA 5AI0A 2REQA 3PQDA 4ENVA 3QSGA 5F7OA 1G2PA 2WKSA 1PI3A 4D8UA 1MX3A 1Q0ZA 3TLEA 3UF0A 3UZUA 1OI7A 4G97A 4LYDA 4E1AA 1E1RD 2Q2WA 5B4TA 4DILA 2C2WA 2FQ1A 2O9JA 3G7UA 3HP1A 5KQMA 1SCAA 5HGXA 3A6HA 1W0KD 3AJRA 3MLEA 4IIXA 4IQ8A 5CBPA 4EX7A 3V7FA 4MMZB 3ANYB 3N05A 1R4NA 3GRKA 3Q3IA 1V7QA 2QUHA 3VU0A 1EWVA 3TB4A 3PSHA 4R1QA 2ZIXB 2ZRMA 2X0NA 2GN6A 5HP4A 2G09A 4H77A 3WMFA 4MWEA 1PT6A 2FPRA 4ND3A 5D3QA 5IP5A 3ILSA 4QZVA 4GL2A 1XA4A 3IAFA 3KSMA 2QM8A 1YIOA 1J0EA 3HCRA 2IH2A 1CZUA 3WIUA 2W6PA 2IYTA 1NR5A 4M6WA 2ORWA 1B16A 3AF3A 4F3NA 4W5WA 4IGIA 4X97A 5DNAA 1X14A 4QEKA 1L5LA 2EIHA 2PK3A 2XX3A 4ND6A 4NH4A 3RNLA 2JIOA 1K7YA 4WBXC 4P7KA 5DGIA 2E4AA 3NZEA 4RPKA 4RX1A 1NLUA 5DMXA 4RTQA 4BASA 4FFSA 5A5GA 2ZEJA 3G89A 1D2HA 2GBCA 1ZA2A 4MX8A 3MXOA 3UA4A 3GFQA 5BT8A 3HJHA 1M2FA 4ZVMA 1ISFA 1O5TA 3R7FA 1AUOA 1UT6A 1EVIA 1P2TA 2D1RA 2H3EA 2IDMA 2X3FA 3NBYC 4HNSA 4TRJA 4M49A 3O5AA 5SZKB 4ZFNA 8ATCA 1YACA 1QU2A 4LHVA 1WVMA 1X87A 3KTOA 4UOQA 1ZISA 4MDHA 2AXNA 1EBUA 3INGA 5AVSA 4IHJB 5KYXB 3M49A 4U7PB 3P9SA 3BVPA 3OC6A 1TZJA 4HGPA 3VJKA 3CO5A 2H07A 5EZYF 1NJ5A 4V39A 4YDRA 2GTHA 2YHSA 5ALSA 1Z18A 5T7BA 3QG1A 3CVUA 2ZIFA 1PWEA 3KKMA 1U98A 5A3JA 3GLFA 1CQWA 2BM8A 1OYVA 1ZU4A 3TTWA 5HZMA 2R85A 2C0CA 1FS6A 1NUTA 2A4KA 2RC5A 3ICWA 4GS5A 2AXQA 3GWZA 1G2QA 4NS1A 5AQEA 5BUZA 3OTWA 1DAKA 1T0IA 3LUHA 4O4JA 1AKVA 3OQBA 4DLBA 4UBNA 2ZDGA 1Q12A 3R09A 4IV0A 2J7PA 3PFIA 3W90A 1KVQA 3QXCA 1TKRA 3NWOA 4IEIA 3TLYA 3W7AA 5TEVA 1MA3A 2DHQA 2E4UA 3FAZA 4NYMR 4QWWA 3MGCA 3E2MA 1E98A 1AOXA 2WIKA 4TVOA 3LQQA 3MWEA 5T57A 5JTUA 2WWFA 3M5DA 3K5IA 4RHXA 3QPAA 2V6GA 4UCFA 3AFNA 3BWDD 3ZXSA 1GG5A 2LIPA 1C3LA 1FTYA 2DUMA 2HWUA 1QDUA 4PANA 2E4YA 5AKGA 4ENSA 3NHJA 2AVNA 2B2CA 1TT5B 4IDPA 4ZRDA 3A3YA 4ZJZA 1NI4A 4OSPA 3VU9B 4XLZA 3QJYA 3ZCQA 1G19A 4ZMBA 1N7JA 5ALEA 1I4TD 4HFJA 1ZK4A 2OC9A 3BF7A 5EIFA 3ER9A 3RVBA 3A6PC 3K0CC 1VDZA 4OCZA 4X93A 1Z06A 3R6TA 2WSBA 3FB4A 3PR1A 5FFFA 1XZLA 1C1XB 2TSYB 1VL1A 3FFTA 3HJCA 3AM4A 2IOQA 3EVAA 4INJA 1ESEA 4JY7A 2EKZA 5ECWA 5HWSA 1ULUA 2XF8A 3HWSA 1Z68A 3EVGA 2OQIA 3ZU6A 2ASEA 1VP3A 4BL5A 4ISCA 1Q5PA 4N54A 4WX2B 4YV2A 4X45A 3CRNA 2C0PA 4HPXB 5E2IA 4ER5A 4KVGA 5AKZA 3D4NA 1GLVA 4F2WA 5JNLA 1KVTA 1Z4KA 2G4CA 2MCFA 1GSOA 1FSSA 2J7PD 1FFCA 1HLFA 4A16A 1CUBA 3FCOA 1JH8A 2J5KA 1KDOA 4M37A 2XBLA 4WT7A 4QPJC 1K6MA 3T7AA 3UKJA 4F71A 4RULA 4ZQEA 1P44A 5BV8A 1ADFA 5HKAA 4G81A 5AOVA 4B3BA 1L5WA 2CFCA 2VT6A 4JNKA 3CLTC 3N8HA 1B7GO 4PZ9A 2H8GA 3AB7A 1Z63A 4AROA 3JTEA 4QREA 5GZ1A 3KQNA 3MM4A 1AUQA 2J5QA 3FR8A 3KLMX 4QJ3A 1AY0A 3E3MA 3PWSA 4K8RB 2QX7A 3MJCA 3O7MA 2DLNA 2FE1A 2VYVA 3NBZC 2EFYA 2EQ5A 4J0QA 4Q39A 4YHBA 3SX4A 3STHA 3TQRA 1TB4A 2G6BA 5JXHA 3CH6A 5YASA 1E3MA 2XB8A 4HAVA 4PR3A 4KSBA 3GJ5A 4PSCA 2IU0A 3N5KA 2PLAA 1GKYA 1JNXX 3I8XA 3RRJA 3ADBA 3SSOA 2R66A 3EF1A 4HQLA 2P7IA 4LDQA 4Y2GA 2NUTB 1OQAA 1U2EA 1U8AA 4I14A 5LP6A 2G6TA 2OD7A 4K5QA 5DPMA 1ZCZA 1PSZA 3KUKA 4OMCA 1JLKA 3HI4A 3KU1A 4RKWA 2JLVA 3CFYA 4D4IA 3HUTA 1F0PA 2O5RA 2Q0XA 3A9WA 4Q19A 5HFAA 1XPJA 3FCSB 4V3BA 2IPXA 3I9V6 1TA4A 5F1PA 1D6JA 3SZGA 4UHJA 4HTFA 1RQGA 4L6IA 1CIVA 2Z95A 1A04A 1KK3A 1Z47A 2D2IA 2QR5A 2GSWA 1NY6A 2I7TA 3TZLA 4PFJA 1IXSB 2OHGA 4QIHA 3VDMA 1VKJA 3QBTA 2HR1A 1HDGO 2YIJA 1ODCA 5H9VA 2VP5A 3VNSA 4Z1MD 4ENPA 2R96A 5FJJA 2B2NA 1YVUA 4YJFB 2DLDA 4X92A 2HGZA 2ZS7A 3D8RA 3ZTYA 4WUTA 4EKNB 3DWEX 1NOKA 4EAQA 4R7TA 4MVXA 3U7FB 2OGTA 4YQZA 2ZJ1A 5TGZA 1DC6A 2VYVD 4IJQA 4F91B 1A72A 4OFBA 1SR8A 4KWEA 1WDTA 3TLXA 2I9KA 2YWHA 2NTJA 1IY0A 3MYRA 3BBPA 3BHIA 4AT1A 2IZ6A 4BO3A 1NP6A 3QKRA 1DJOA 1LW6E 1PFQA 2Q4BA 1U0FA 2WOJA 3PNOA 5BURA 3ZVMA 5L3ZA 3NAZA 4NCNA 5KSWB 1L4EA 1TJNA 2ENWA 4BB6A 1UBCA 1I01A 5TB5A 3OFNA 3AI7A 1IFXA 4BQNA 3NEPX 1ZW1A 3KJZA 2WG2A 1LFDB 4ODIA 4FC7A 4BX9A 1QKKA 4BVKA 4YR7A 3PEYA 1NVWQ 3PDHA 4D0NA 3BXHA 4YP0A 1QBKC 2F1IA 3K94A 5BV7A 4GM1A 5LQDA 1PR2A 1CYDA 1Z9BA 3KUDA 2IX9A 3FE2A 2CJWA 5IUKC 1VSVA 5IXJA 4CUZA 3QHQA 1VP9A 3PE3A 1W4CA 4LJAA 1KY5A 3KB1A 3PBKA 3QG5A 4D4LA 5IT0A 1JR4A 1SQ6A 1FZQA 1QIFA 4WTOA 1KVSA 3W2EA 4IKPA 4AO6A 1ZCFA 3U81A 5MFZA 4TVSA 3GH3A 1JEYB 1QCDA 3IP7A 4OJMX 4RY8A 1T1SA 1XCPA 4NHEA 2B4RO 3RBAA 1T9DA 2PXCA 4QXPA 3TQOA 3H6HA 3DL4A 4RBNA 5DBGA 4I4CA 2Y6VA 4UU1A 5CFMA 3UCXA 1G18A 2O8VA 4N7JA 3RBXA 2I2FA 1U6JA 4BRUA 1A9QA 4F9TA 4Z7QB 4GEGA 5AVXA 2EHDA 3CPEA 5ESDA 1MU0A 2HB6A 1Y4ZA 5L3VA 2PT6A 4GUDA 5IJ9B 4X1OA 4AJLA 5KYYB 2PBZA 2I2DA 1H94A 1Y8QB 1MCZA 5CAEB 3WL8A 4DIEA 1G8MA 1J42A 4K40A 4I19A 1JKJB 4BP3A 1P81A 4MPTA 1M7GA 1QSGA 2VJMB 3EGEA 3PEWA 1QYDA 2IP1A 3IIEA 1J8FA 4RWEA 3OFND 1E1KA 1Z8HA 2IYZA 2H2IA 3L0CA 3FZEA 2EJUA 4TUYA 2VH2A 2EFEB 1HTWA 5FJIA 3EQ6A 2GCGA 4IQ0A 4BNUA 2BI8A 3KKQA 3IMEA 4EW6A 5A04A 4A8JC 3NEJA 4I1YA 5IVDA 4EPXA 1BXRA 1C50A 1EEXB 1VPEA 2LKCA 2BOVA 2ZR9A 1DFGA 2JZOA 2HHAA 3HK2A 2JLZA 3GFVA 3OHMA 5LD2C 4MMYB 4Y6GB 2O8CB 3BQ9A 1G16A 1JDBB 3E9ZA 4HMQA 2OHXA 1EFLA 4G4SP 4HSEA 1C7ZA 2J0UA 4RVOA 2JJ8A 4Q37A 3HUFA 2ZR7A 3MF4A 3SD7A 1K6EA 5F5NA 4DT1B 5PGMA 2JHFA 2BEUA 3WYAA 4G0ZA 5LQUA 2NZVG 5CTAA 3ZXYA 1QFYA 2CVFA 2IUSA 3ND8A 1OI3A 5A9RA 3ABIA 3KPUA 3NATA 4KPYA 1Q0UA 3LY9A 4D9BA 1WZUA 1E5TA 2GRJA 3H4MA 3JYNA 3WLEA 1KP2A 4S12A 4G4GA 4AVYA 2INGX 3ZDFA 1SVNA 3ZH2A 3LPAA 1MH1A 2PX4A 1HDYA 1V6AA 2CLHB 1J39A 1QC5A 4OAPA 1QIGA 5DXFA 3PV0A 4EQ6A 2IV7A 1MC8A 4KN5A 3KM0A 4UPDA 4UUBA 4DUPA 4EL0A 4KI0A 1A1SA 5JD3A 1ISRA 5DCWA 2CV0A 1Z0AA 4P4NA 4ZI3A 4ZVRA 2COEA 5CM9C 2A5LA 1QH9A 3DAFA 2OFXA 1I2DA 4OQDA 2PT7A 3HG7A 3VSBA 3LPMA 2X41A 4WOCA 1Y6FA 1SUIA 4FWTA 4RE6A 4HTAA 4F6CA 4RD3A 1O1YA 1Q0HA 4J29A 1Q74A 1V48A 5JARA 3UFXB 4L4ZA 1FJHA 2HM7A 2FFJA 3P2MA 3PHJA 5AR1A 2QRJA 1MN6A 1ZXLA 2YN4A 1OV4A 5GM2A 2QTCA 1CR6A 1U8CB 1FYDA 1KYTA 3OY7A 5CDFE 1H2ZA 1IHPA 1XCLA 4M0FA 1U0BB 2L2QA 5KX5F 2FP3A 2WF5A 3D3JA 3A14A 5AXAA 5DU2A 4O0MA 1TLFA 2XRZA 2WKPA 1W5EA 4ID3A 1G8YA 2RJOA 3UOGA 3RFCA 2ZLBA 3AXTA 3A4TA 2FLWA 2OMKA 2OCLA 4F5DA 2XIJA 2VNKA 1WPQA 1P91A 3D6NB 4L8LA 1Z6QA 4JASB 5ITVA 3DONA 1OJLA 1E1LA 1U7UA 2P9CA 4MPJA 4XVQA 3WNCA 4MJLA 2W22A 5KYVA 4PE5B 2QX9A 1EINA 4TQUS 2H4XA 1U3FA 3KDAA 1U5CA 4HXYA 4ZO4A 5J1TB 4AWXA 4BIMA 4DV2B 3ZKWB 1QQAA 3FFBA 4MR7A 3FPJA 4ARCA 2FKNA 3MTIA 1PWXA 1MJ5A 1MO3A 2AXPA 3E3LA 2OCKA 3QVKA 3R3WA 4MVJH 4Q7JB 3V8VA 3HC7A 2ZUWA 2BV3A 4P2GA 5HIIA 2BF4A 2BLLA 1YMQA 4MYRA 3ZZTA 4B5LA 4AUNA 4WRRA 2B4KA 2AUMA 2JJQA 2OFFA 2P11A 4C29A 4U7GA 2YASA 4PXAA 4MS3B 5JY6A 3DJYA 3KJHA 1FDUA 3RVOA 5GADl 4C7OB 1SVKA 2JIQA 1E5DA 4RLFA 1JB1A 4OB6A 4MP3A 3VSDA 3RRXA 4BJ3A 2Q2QA 4DUGA 3AVXA 3W2FA 1NLYA 1ARZA 1ESDA 1ZRSA 1F2DA 2FK7A 1XWWA 2ZUSA 2BKUA 1R9JA 3ISVA 3LUKA 1K8XB 3FHOA 4AJPA 3PCTA 5AUNB 5I3ZA 3UK6A 3KR1A 5C0OE 1RIFA 2XB6A 1QIJA 2W11A 4E4TA 1O97C 2QRVB 3G85A 4RTSA 4RCZA 2PWZA 2GEKA 1H2WA 3B36A 5AW7A 5L4LA 3COPA 4PF1A 1YS2X 2RGCA 4EHLA 5E38A 3GOQA 4Y2JA 3QOYA 4OQMA 4HLQB 4XXHA 1XA0A 2XCSB 4NU0A 4G67A 2HJHA 3DVAA 1EDDA 3MB8A 3QBDA 1PGOA 2ZPTX 4MV3A 5AHRA 5EXEA 1EXDA 2Z1DA 4YO7A 2LDBA 4DJJA 2GDJA 4UW9A 3UOAB 5EKTA 2W2KB 1WQ4A 5KSYA 3PDUA 1R15A 3LQRA 2RAUA 5HFNA 3KQOA 4DIMA 2ZIAA 1RQ7A 3T41A 4HO1X 1TIBA 2PKYX 4WZBE 1RC0A 1CEXA 2IGTA 2ACEA 2ZWPA 2YY5A 4AQ7A 1N5JA 3I5AA 2P3LA 3NTLA 2X1LA 4P4SB 3TQFA 3BXGA 3T4UA 4CTMA 4DB2A 1P7PA 2QXUA 3LK7A 1J90A 2YYZA 1MORA 4HLCA 2ZUFA 3N8DA 3GLGB 2K6GA 1Z82A 3ZYZA 5BWLA 4CETA 4YUVA 5F5LA 2C29D 1O0CA 3BPSA 3ROKA 1BO6A 2Y2UA 3OPYB 3LY5A 3LOUA 4DUGD 4DTCA 2YHUA 1XMXA 3CR8A 1LNZA 3K5PA 3MILA 3NTQA 4GZ3A 1W0CA 1R74A 4HKTA 1WCYA 4V2IA 2H18A 5E0OA 1SA0B 2CJFA 3RFUA 2A67A 4MRVA 3TLAA 3ZXUB 3OQMA 4N3CA 2WFLA 2DU8A 2CJPA 4L5AA 4B47A 3NGMA 1WKCA 4RKFA 2FV8A 1BWRA 1XZCA 3DGFC 3L01A 4M7RA 4W8OA 4CM6A 4IX9A 4JLJA 2HNKA 3K3PA 2XTMA 1LJ8A 1LBIA 4FD3A 4QQNA 1Y34E 1FP6A 2OHOA 5T3YA 3EXEB 4I4NA 4K9NA 2AT1A 3IJRA 3RTEA 2EAUA 1KH3A 1SUPA 4H7EA 1LF5A 2X8WA 1WNTA 3ZGVA 3WS7A 1YT5A 3BX1A 5DE3A 3EGXA 3FD8A 5K3OA 2I80A 3Q85A 4N7RA 2DPLA 4NPCA 4H7DA 1IM8A 1UJ5A 2WM3A 2W00A 4LV8B 5EEHA 4EHFA 3F3SA 2MHCA 5JPDA 1BTOA 2Y66A 1E3TA 4E0BA 2PU7A 1YQWA 5G40A 1TCAA 3F7TA 3JQDA 4HWGA 4X85A 5HIJA 1PUXA 3ZHYA 5HQJA 2PMKA 2QVYX 5JC1A 1NP7A 1FNBA 3EG5A 2H1CA 3E1KA 1X2BA 2YN0A 3P0JA 2H5LA 1MB0A 3KSAC 2X3UA 1GILA 2P6RA 1YJCA 1NN3A 1YOVB 5EVJA 4G84A 4ZOAA 1B14A 1HT0A 3EXG2 3FYCA 1PDWA 3LT5A 2XGSA 4MPDA 2PAFA 3KFXA 3X2FA 4DUZB 4KRXA 3ST7A 1A4XA 1N2CA 2YWBA 3IPXA 2F90A 3GOHA 5DDIP 2PX8A 5JS2A 2GXUA 1C0KA 5JXGA 3IUMA 1IRIA 3IDQA 1RLOA 3QK7A 3H8VA 3HNRA 3KB6A 3OIYA 2FRDC 4XARA 2AZXA 3AKCA 2I6FA 1Z2OX 5CCEA 2C4KA 5ALVA 2EJWA 2HIGA 2WAMA 2EZ9A 4JBGA 3WICA 3TYXA 4K9SA 2JCXA 4IYRA 5A71A 2B20A 4WZ6A 1D1SA 1Z5PA 5J58A 4WSOA 3RAPR 1IHUA 3ELWA 1IB0A 4FCTA 3JARB 1QHXA 1SD5A 4MEAA 3FBWA 1N34B 4NWIA 4P2BA 5JLAA 1PR1A 1RRFA 1RS0A 4Y1RA 3OEHA 1A9ZA 3A1SA 4Z8YA 4D45A 1HTTA 1KGSA 2XWJI 1FYFA 3JQRA 4G63A 4H4DA 4DLYA 7GPBA 4PGGA 4HP8A 5C7YA 2I55A 1II8B 4L6CA 3HUEA 3K0EA 5DI9A 1GLGA 1P6QA 2CV1A 4KGVA 4U9HS 2D1SA 1JYEA 4IV5A 3QQ5A 5ECYA 1E9RA 1T8YA 3T0IA 1IWPB 1V5FA 2ZUUA 4QUGA 4RXMA 4K1XA 1BGXT 1R10A 3QMPA 5T4BA 1Z07A 1YVEI 3X1DA 3JVDA 2G70A 1Z34A 2XYPA 3EH2A 2CXTA 2DBRA 3G02A 4QT0A 5FPQA 3FUXA 1BWSA 5EE0A 1L7OA 1WXWA 3EEFA 5D7NA 4J76A 2PUHA 3PTLA 3RS4A 4C87A 2FK8A 3RU3A 2YC2C 3L8ZA 4FE7A 3IVMA 4C07A 2QSUA 1XD2B 1SZPA 2FPSA 3DXFA 3KLOA 1JHZA 5F9HA 3BHNA 4ALMA 1NVXQ 1DWQA 4RVHA 3S1AB 3STVA 4Z49A 4FXPA 5IASA 1QMPA 4ITRC 2XUIA 1WX1A 2AR7A 1I1HA 2AIRA 2C9YA 1LWNA 2D0IA 2GZHA 4BIIA 4EI8A 3GD7A 5P21A 2JRCA 3GT3A 4BGDA 2CXHA 3A7EA 4MVJG 5E2AA 3IALA 4AM8A 3P4XA 1NZJA 1M10A 4UOZA 1FTWA 1PK7A 2X6TA 5EYPB 4IWXA 3GCZA 3RR2A 4CDRA 2CMHA 2VJPA 2JIPA 3K9CA 3RI3A 3KXPA 4B6FA 4X91A 2GNAA 2H7CA 3DNMA 1C7RA 5TQ2B 3DEYX 4MLDA 3QJ5A 4K9KA 4DVGA 2FW0A 4GECA 4W5RA 3LLUA 3OEHD 3ZDYB 2XTNA 3HV0A 5AHWA 2HPVA 3TD9A 1L5NA 3FYDA 1A5TA 2EP5A 1V8ZA 1RAHA 2ZULA 2C5BA 3OMXA 1GPMA 2NUBA 3A31A 4TLMB 5BUCA 1ZSVA 4EFLA 1AD2A 1Z56C 3LSYA 3PVZA 4PX5A 4TTSA 4JUAA 1NU8A 4C21A 2NNLD 1SRQA 4O4IF 1YR3A 1PT8A 3RFFA 2XYQA 2ZJBA 1KEZA 5F9MA 3LL4A 2G08A 4B9AA 2NU8B 4D80A 1OXKB 3PDJA 1M2JA 3CBGA 3HSKA 4MJ7A 3UAYA 5LUAA 3LC7O 5ELLA 3O94A 2W6JD 5DHPA 4YCSA 3QUSA 1KIMA 1PKEA 5T4FA 1N5KA 2ECQA 2EV9A 3L7BA 4LDZA 5HQ3B 3CLKA 1XROA 4D26A 4LXTA 4N3NA 1CC1S 1Y4AE 2QOEA 4KXFB 1RI4A 3LYUA 3KQKA 3GEEA 3IDOA 4U5QA 1KOLA 5BN4A 4PVCA 2PJZA 4XOUA 4F9GA 1DLJA 3TXYA 2M9MA 1FLNA 1DO8A 1Y7LA 1P9RA 1YCFA 4K6KA 1JLRA 3NI2A 3GRVA 4LQCA 1TXGA 2VN8A 1ODSA 3H7IA 3AUFA 1CERA 2ZJ0A 3N0TA 2Z6UA 2MU1A 3NUQA 2PKQP 3RVDA 4GHWA 3K9FC 3IODA 2NXJA 4WD3A 4CUKA 1KQFA 5CX1A 5CA0B 1Y3CE 4QSMA 1OWPA 4EF4A 2O5EA 4R6XA 4CCWA 1R9NA 4TMXA 4CEJB 5AK4A 3NTRA 3AHFA 4NFLA 2I99A 3IAEA 4ZQHA 2R48A 2B30A 2WVGA 4FEAA 4XEUA 3R5FA 3V5NA 2VDLB 2YFHA 1QUEA 1FNSA 1TT5A 2YWRA 4TLDA 3C74A 3AUYA 1J8YF 2IRWA 3C14C 1FS5A 3T5CA 1HFKA 5KJCA 1I6LA 1QOPB 1W36C 1DJMA 5KUTA 4PQEA 5NLLA 4FZRA 3FF1A 2FRVA 3CZMA 3VO9A 1Y8ZA 5EXDA 1J20A 4DLAA 1FTGA 4G37A 3R20A 1NW6A 5CDSA 3CLSC 4G9BA 5EXXA 1QTRA 3AXSA 4RENA 5COBA 1JKIA 2XOXA 4C4RA 4JLBA 3CO0S 4TXJA 4KMMA 4BNVA 1T24A 1E79A 2GASA 4CF3A 1OH6A 2MIIA 3D8BA 3TZ6A 3AETB 1SOMA 4FYHA 3NP9A 4MW2A 1SIWA 3LQYA 5M5BA 1REQA 4NBSA 4QOJA 2AMVA 2E1PA 1E1CB 1U31A 3PQ6A 3MBKA 1IXYA 4W5HA 5IM4F 3H5OA 3Q0TA 4KDRA 5DHTA 3ZLTA 1UJ6A 2HJGA 1KO5A 4CWAA 2W98A 4LNUB 2BMEA 4X54A 1DQNA 1LDGA 3H17A 2WMDA 2X9NA 4KODA 1T1IA 1P1CA 4IQ4A 1AJEA 3BRQA 3H5NA 2KS6A 4ZCIA 2ZRAA 4A7PA 1FFAA 1O2DA 4J1SA 1KIAA 3AZPA 4XM0A 5J4YA 3RS0A 5KIAA 1T5OA 1EE1A 1VIDA 1JJVA 4B4KA 4GMKA 1H05A 3T7SA 3MERA 1M8GA 1TK2A 3VQTA 4DDMA 3FKSA 4F12A 2C7VA 1AUPA 5EJ2A 5IT4A 1TYBE 3SC3A 5E3JA 5B37A 1VLZA 4HQFA 4Z4IA 1WW8A 1X3SA 2J9FB 1OWLA 2ZE5A 2C9DA 2FZLA 1OXBB 3F7OA 2CDNA 4HEQA 4OA5A 3LVBA 2DBVO 4X66B 5C9ZA 5GPBA 3ES9A 1EWQA 4LRWA 1O9BA 1OLSB 4ZXFA 1NG9A 2XNCA 3AF6A 1X6VA 1JLHA 5HGJA 3QTLA 2XT9A 2Z2XA 3AZQA 3EPJA 2X3YA 1Z22A 2WM2A 3KXKA 3WBBA 1NW3A 5BMVF 5EJEA 1E79D 3K8QA 1ZVKA 4L5YA 1E3JA 2Q41A 4Q05A 3EZNA 5IHPA 3T3OA 2AHOA 3Q7RA 3CONA 3AYXB 3TQQA 4R51A 1XVLA 2VAPA 1DX4A 2CXRA 3QENA 3AF0A 4FIZA 1NYRA 2GX6A 1RJEA 3I9JA 3T0FA 1ZIPA 2C57A 2P2GA 1RYEA 4JJ6A 2CXNA 3FOAA 4NOMA 4D8XA 2ZSIA 4FFWA 2B5VA 2VBCA 2IELA 5ENVA 4MUFA 2F67A 4TZ6A 1R8JA 2EGGA 4ME6A 5FYDA 3ZCUA 4BO2A 3D8SA 1CUZA 5L4SA 2FWNA 3QPBA 3PC8C 2Q9CA 2IA5A 2OEPA 3PFBA 1G8PA 4EW2A 5B36A 4I4TA 4RZUA 1J33A 3GD5A 3BWBA 4L72A 1ZXBA 2O1SA 3QFRA 3U7QB 2GS9A 4PY2A 3SE0A 5MN6A 3V4FA 2QZSA 3I5UA 4HXEB 4YJFA 3FKSD 3HJFA 4BKRA 1E9EA 5JDCA 3WBKA 3A1EA 5CDGA 1UMCA 4IBOA 1UL1X 2GR9A 1VMAA 2BUAA 2Z8ZA 4DA4A 4EABA 2H4WA 3KWFA 1CY2A 2Q9BA 5DXJA 2BPOA 2ZI5A 3AOEC 1D6SA 3D0KA 1HURA 1FUIA 3I2HA 2QG4A 2ZCJA 2HCTA 2HSEA 1JHDA 1UQTA 3F6YA 2P2LA 4DJDC 4YRPA 5IN5A 2PCLA 4QTUB 4H7PA 5E8RA 4TT3A 4ZO8A 2JGNA 1A2OA 3I3SR 5CB4B 3OJXA 3OEYA 1PQ4A 1YCHA 2WINI 1E2LA 1PW7A 2GXAA 3R3UA 3WWDA 5KDOA 1XKXA 3FTEA 4KPGA 4DOMA 1MBZA 4JI1B 2P79A 5BSTA 1VHDA 2FSHA 1P8JA 2E0IA 3JZIA 2I1QA 2DR3A 2ZQZA 1RWKA 1JDZA 1HBJA 3PD1A 1L5HB 4C0LA 1FXWF 2BFPA 2OK7A 2QT0A 3R3SA 5IPFA 1R0WA 1V4BA 3EOBI 1SU8A 2RG1A 2NYAA 3DTNA 1RTKA 4FD2A 4UMDA 1EVLA 4BX0A 5HRUA 4FNAA 1L5SA 3VC1A 1W5TA 2Z3WA 2A0YA 2ZSJA 4CI0B 4W8GA 2NO4A 2O3SA 2ZE7A 5E6RB 4HUTA 1E2IA 2E4ZA 4ZI7B 5ED4A 1UINA 1KI3A 5B1HA 1ESNA 2QA5A 3ENZA 1LV8A 2V5UA 1X8LA 3E53A 2WHRA 3NX4A 2ZB3A 4NG5A 4RIIA 3VJMA 4BRWA 3OPQA 1JFVA 1TJYA 2ERXA 2R6HA 3RRFA 2WJPA 5AESA 4EPWA 2AZ4A 2PZMA 3A6EA 4QUHA 4UREA 3V8NA 3A11A 1ZM4A 2L0XA 1U8ZA 1VMIA 2P5UA 1ZZGA 3DOIA 3WYDA 1HR0B 3E8MA 1QQ6A 3FUUA