1B0AA

5,10, methylene-tetrahydropholate dehydrogenase/cyclohydrolase from e coli.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
287
structure length
287
Chain Sequence
AAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNPASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDTLNADNTIDGILVQLPLPAGIDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVEYHDPQDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a bacterial, bifunctional 5,10 methylene-tetrahydrofolate dehydrogenase/cyclohydrolase.
pubmed rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase,hydrolase
molecule keywords PROTEIN (FOLD BIFUNCTIONAL PROTEIN)
total genus 100
structure length 287
sequence length 287
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b0aA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1b0aA02
3AI1A 2PH5A 3EK2A 5KVQA 2VHZA 4HFJA 3PGXA 1NQOA 3VH4A 4CM1A 2Q1SA 5DP1A 4FB5A 5JY1A 5DCYA 1YL7A 2EGHA 2VHVA 3UN1A 1E5LA 5BSEA 3JQBC 2PD4A 2P4HX 3B20A 3D5TA 3F1KA 2J3HA 3AU9A 3QA9A 4OOEA 1XIVA 5H82A 5JC8A 3M1LA 4J90A 2DTXA 4R54A 3DFUA 2FPGA 1ISMA 1P74A 2DVMA 3WJAA 5A9RA 2EG9A 3UF0A 4AFNA 1B8VA 4PRLA 5JAQA 1WDLA 4F6CA 4IDDA 3PXXA 2VT3A 2BELA 2PZLA 4K6CA 1N1EA 2O2YA 2O3SA 1Y81A 1DIAA 3V8BA 3E9QA 3JQGB 1WXDA 4E13A 3S2FA 1IY8A 3AM5A 3DBHA 4GBJA 5IDQA 3PHJA 3DC2A 3EVTA 4BKUA 2Y99A 5DBIA 5IZ4A 1MXFA 4E5NA 4XA8A 5IN4A 3O03A 4H3VA 3GHHA 3AK4A 1W0CA 1LA2A 5A02A 5CG2A 2O48X 3JQFC 3DQPA 3KSDO 3B1KA 4YXFA 4Z6KA 3GHYA 2GZ3A 1SC6A 4W82A 3JSAA 3N58A 4IQ8A 1VSVA 2Y05A 4KUEA 1XHLA 2H1SA 4I8XA 2NVUB 3U0BA 5G0WA 4YRBA 4FJ0A 4WGGA 4Y6SA 3GQVA 1J5PA 4YA6A 3PRJA 2D2IA 3AFMA 3QVTA 3VAZA 3JYLA 1XU9A 4M49A 4FQ8A 3MEQA 1U8FO 4QQRA 3QWHA 4D3DA 2H63A 2Q2WA 5KKAA 3HDQA 1NVMB 5JNLA 3D4OA 4RVDA 4P4LA 3ANMA 4YJGA 1JW9B 1Y8RA 1Z45A 2I9PA 4UUMA 1Z75A 3HN7A 1K2WA 3HHPA 3ZHZA 1HDZA 1PJTA 2NQ8A 2O50A 1GD1O 1IPFA 3WMWA 2OMEA 4U5QA 3RC2A 3RC7A 3VH1A 3DXFA 4ALNA 3K9QO 3VKVA 3GG2A 4BO7A 5C7LO 1EQ2A 2VOEA 1H93A 3ZNPA 4HV4A 1OC2A 2W2LA 3L77A 4LCJA 4BV8A 1D1SA 5EQDA 5DOZA 3C1AA 4R1TA 1TA4A 1X0VA 3QSGA 4FFLA 4ZD6A 2X23A 5THQA 3AUSA 1HYGA 4MDHA 4WEQA 4MOWA 1R4NB 1WMAA 1GDHA 4TZTA 3KYDB 4CJXA 5F1PA 2ILTA 1UDAA 3MJEA 2AG8A 3VZRA 1BXGA 1L7DA 1C1DB 4ZGWA 1CJCA 4QFCA 3H3FA 1Y9EA 5EMHA 5AXAA 2P2SA 1XR3A 2DKNA 3OEYA 2EGGA 1R6DA 1GQQA 3GZNB 2P4QA 4FC6A 4GX0A 2UUPA 3Q3CA 4XGNA 1VM6A 4CM9A 1C0KA 3LK7A 3ZV5A 4EZBA 4A7PA 1XYGA 1ZSNA 5CDUA 1HL3A 3OJ0A 2DBQA 1ZK3A 4EUFA 4UUPA 2P9CA 3P19A 4E5KA 3OECA 2Y1GA 2FY8A 2ZATA 3RC9A 1CQIA 1B2LA 4MVJH 3KVOA 1Z82A 2CNBA 1JAXA 1TLTA 1DC3A 1OMOA 2G76A 3FNEA 3GPIA 2I6TA 3D3EA 3Q0EA 4WEOA 3JQDA 4RZHA 3X2FA 1I24A 1PGPA 4UVIA 1HDXA 3OQ6A 1B15A 1MG0A 3DHNA 1P77A 4CV1A 1EK5A 5JDIC 4JGBA 1CETA 5KTKA 4L73A 4CQLB 2Q46A 4NMHA 4CLHA 2D4AA 5JCXA 4BNHA 4FBGA 3S2EA 1ZKMA 1E7MA 1E1KA 3L0DA 3RSHA 1LC0A 4PLVA 4UEOA 1V3TA 1NQ5A 3AJRA 1GCOA 4B7UA 5L53A 3ZW9A 1B14A 1ONOA 2GF2A 2PV7A 4IQ0A 2PZJA 5IXYA 1XCBA 2P5YA 1UXHA 2VWHA 4NBTA 3ZU4A 2DBRA 4R5HA 1A9YA 1DSSG 1EFKA 1E7SA 1IHXA 3AM3A 5GZ6A 3OMLA 1Q0HA 1EVIA 1YONA 4G65A 4II3A 3VVCA 2WMDA 3NUGA 5CPBA 1TXGA 2YHIB 2DT5A 2FWMX 3WGOA 3LT1A 4NI5A 3EHEA 4TQGA 2JD0A 1IULA 2V6MA 1HETA 3CTMA 4KWHA 1DHRA 2EF1A 1ISIA 2VYND 3UOGA 1W4ZA 4EGFA 1NWCA 3GFGA 3TRIA 1WMBA 3W8FA 4BVAA 4E31A 4CLOA 1P0FA 1SB9A 3VH2A 2HMUA 1EMDA 3DBLA 4WUVA 1MG5A 3GOHA 1NFQA 1Z74A 2JCXA 3ADPA 4BO4A 1D7OA 3TF5A 1R0SA 1DFHA 3WYBA 4GKBA 1ZO8A 4RLHA 5A4DA 4HADA 2PKRA 1LQTA 2HAEA 5TRTA 1YDEA 1KIFA 1RM3A 4XGKA 2C2YA 5DP2A 1J49A 3QW2A 2X5OA 5GZ3A 4HUJA 3NT5A 4PZDA 5JS6A 2X0NA 3ZWYA 4IBOA 1E92A 4YACA 1R4NA 3H5AA 3QE3A 4E2YA 3ZU2A 2YUTA 5IJZA 3TDKA 4DREA 1YDWA 3ZHBA 2Q1UA 3ETEA 2Y67A 1VI2A 3OIDA 4CLOB 1LSSA 3LC7O 2NVBA 3Q9UA 1BDBA 3DZFA 1ZVMA 4NJMB 3WS7A 2PH3A 5DBFA 4Q3CA 2JD1A 1GZ6A 4YYZA 4K6FA 1C0IA 2GCGA 4QSMA 1PWXA 4RCVA 3WJ7A 3DZBA 3ONEA 1T2AA 3DO5A 3M2PA 1T1RA 3SXPA 3S1LA 3TOZA 1PSDA 3AWDA 3A28A 2IYPA 2YYYA 1I2CA 1U4SA 2Y1CA 1UDBA 3OA0A 2Z1NA 2ZYAA 4YQYA 2PLAA 3KZVA 2Y0CA 4MVJF 1GYPA 1A4IA 3DL2A 1VRWA 1Y5RA 2HKIA 2JL1A 4IZIA 2EXXA 3BHIA 4OIMA 1BSVA 4CLEA 3ZH2A 3WIDA 1F17A 3MWEB 3IP1A 1PGNA 1R4MB 4J9UE 4BNMA 4XYLA 4XR4A 1OC4A 1G1AA 4QX6A 4PG6A 3AUUA 4YT8A 4JQCA 3Q2KA 2I67A 1F12A 1DJQA 1N7GA 1TEHA 3FR8A 4FFMA 1LBEA 1PJSA 2CDBA 3RIHA 1HDOA 4OGWA 3IMFA 1MV8A 1R15A 3RU7A 4F6LA 2FSSA 4RQTA 3ZNQA 2X0RA 3HSKA 3MTGA 3C7CB 4RPGA 3W8EA 3WXBA 3ROKA 1EUZA 4OSOA 4AJKA 1YB1A 3HFGA 2D59A 3DBHB 1HZZA 1PJQA 2QRLA 2W98A 3AM4A 4D0SA 1ZK0A 1R16A 4EEZA 2C7VA 1RPNA 5B1YA 1K5HA 3GK3A 3IUSA 4P22A 4B4OA 4HBGA 2NTJA 3IIEA 1B8PA 3GVIA 3I3OA 5A05A 3GDGA 1KYQA 3W4IA 3H7AA 3JQ8A 3V1TC 4CL8A 3JQAD 2GASA 1DLIA 1E3LA 2X9NA 3K2BA 4GVXA 2FRDA 3K73O 2BRUA 3OIGA 4NNJA 4UVDA 4FFOA 1KOLA 2WDZA 3FWNA 1LX6A 5F5NA 4YRDA 2DPHA 4J0EA 2AE1A 3PFFA 1HE4A 4C4OA 4EI2A 1I8TA 3H3JA 1NR1A 1EK6A 2O3QA 4J6FA 2I99A 2E82A 4J7XA 3CZRA 2BGKA 1C3VA 3SEFA 1VSUA 1PZFA 3KYCA 4R4JA 3WOHA 3PLRA 1LTHR 3ON5A 1GEGA 3BMCB 2BFOA 3ONFA 3LQFA 3LSYA 1NVTA 4DRYA 1U1IA 3P5SA 4E2WA 2YQ4A 4LVCA 1U3VA 2GUGA 4CODB 4WLVA 2Q50A 4BHTA 5JDIA 2ET6A 1VKOA 1ZFNA 4KOAA 1MUUA 5I8ZA 1GZ4A 3K30A 3DMTC 4NU6A 4AG3A 3PDJA 5L7WA 3OQ1A 1MFPA 1GPJA 2UYYA 2W2LD 3WYEA 4INAA 4CUJA 4J16A 4EJ6A 1TI7A 4OKIA 4B79A 1KC1A 5IZCA 3H9JA 8LDHA 2HCTA 1GFSA 2G17A 4DYDA 2G5CA 2DLDA 1XELA 4MP3A 2DPGA 1F06A 5DNAA 5U1PA 1UZMA 1WW8A 4L75A 5KVSA 2EKPA 1BWSA 4XZ3A 3DWFA 4NPCA 2PKQO 3PQEA 4M55A 4B4UA 4OHUA 2OUIA 1C0PA 1YKFA 1IYZA 3QIVA 4UVHA 2Y0DA 4RVGA 2IRWA 1VL0A 6LDHA 1ML3A 1U3TA 2I3AA 3IKVA 5ICMA 5CFZA 1ENYA 4XIJA 3TZ6A 4A10A 4CM7A 2P9GA 4BL5A 4CMJA 4IGEA 2W2KB 1E6WA 3PZBA 4BUCA 3PK0A 3TNLA 1ID1A 3KEQA 5IDYA 5TC4A 1A71A 2ZB4A 3FCOA 5JO0A 3V2UA 3ENNA 1A5ZA 3MOGA 4MVJD 4IDGA 4BNZA 2R00A 1DAOA 1V6AA 5L51A 5CDGA 1P1HA 1PS8A 3WQRA 3ZWAA 4Y6PA 4R1NA 1JAYA 2EIHA 2JCVA 4DGSA 1X13A 2DFVA 2CUKA 3VZSA 2B5WA 4FFRA 1NQTA 3QVXA 1IOLA 3C1OA 1V3UA 2EEZA 1QLHA 1YS4A 3ZWXA 1DDOA 1K89A 1YO6A 5KJ6A 2JAPA 5ADHA 5K6AA 4MVJP 4DMMA 3EMKA 4NR0A 2A92A 5T67A 4E4YA 3VDQA 4RF2A 3JV7A 4PFJA 3ZHXA 4PLWA 4D43A 4IS2A 2D5CA 2JKVA 3HDYA 3BTUA 3GRPA 4IJKA 3BMQA 3OBBA 2O2SA 2GSDA 4IXWA 1GR0A 3GAFA 4XQ9A 3D5QA 1AE1A 1DEHA 4LMRA 4CR7A 1PR9A 3DAFA 3TZHA 2JJYA 1X7HA 4XEHA 1I30A 5HBRA 1KEVA 1NYTA 6ADHA 3DZIA 3D4PA 1V9LA 1EVZA 2C0CA 1J4AA 1HEUA 1PWZA 3BMNA 5KNLA 3U62A 4QFDA 4DQVA 4RPJA 4CM6A 1E1MA 4BNYA 4DPMA 1YVEI 2GZ1A 5F5LA 5JDCC 5DDIP 1ISFA 5I9MA 3HADA 1WNTA 4CMBA 4DQXA 2HJSA 5B4TA 1UXKA 5L4LA 1B0AA 4RF4A 1PZHA 2X0IA 2VZ0A 3JQ9A 3NYWA 4DLBA 1FJHA 3Q6IA 4Z9XA 3WR5A 5K0ZA 1BG6A 4J43A 4QEDA 3EAGA 4YT4A 1BXGB 3IJRA 4J1TA 5TLSA 5JMPA 1ISGA 2WYUA 4J1NA 4PLFA 2RH8A 4L4XA 4E32A 4LW8A 3FTPA 5MDHA 2HO5A 5FI5A 1H6DA 3BMOA 4PG5A 5KWEA 3EZYA 1PTJA 1U8XX 3KSZO 2BI7A 4QO8A 1H6AA 1A72A 2YHIA 3M2TA 4PCVA 1NPDA 1V3VA 1UXIA 4CMAA 3QLJA 3JYPA 1HE3A 5CDTA 1DB3A 5JDCA 2E4AA 1QV7A 5I7SA 2JHFA 2O3TA 1JVSA 3QJ5A 1U5AA 4FPXA 2DC1A 2D8AA 3WLFA 4BGVA 1ZUD1 2E48A 3BMCA 4GAEA 3UW3A 2B5VA 4L74A 1CRWG 3B70A 1CF2O 1U7HA 5EL0A 2FMUA 2CF6A 3Q9NA 5JAIA 1E6EA 2GZ2A 2V7PA 1ZXBA 1OI7A 1SPXA 1PGOA 5TT1A 1VC2A 3GN1A 3RFTA 4OJNA 2PD6A 5FWNA 1D3AA 4WCFA 3KLMX 5COQA 1X1TA 4MVJE 4NHEA 5C7IO 4M8SA 2POQX 4AJ2A 2C07A 3SLKA 2XOXA 1UAGA 3I5MA 1IL0A 1LSOA 3E9NA 1Q0QA 1DO8A 1HF3A 2YY7A 2YV1A 3FNFA 3JQ7A 4ALKA 4GMFA 5JC1A 3ZWVA 3E03A 5TQVA 1I3MA 2V6FA 4IDFA 1GV0A 1EBFA 1OOEA 2GO1A 5TNXA 3RUAA 3TOXA 2X58A 4OMUA 4BGEA 5KCZA 3ZDFA 4KQXA 2UV8A 3GVHA 4N5MA 4GH5A 5A9SB 4YAIA 3RQSA 3ONDA 1DAPA 4KDFA 2VWPA 1PJCA 3TSCA 5JCJD 4XB2A 3TN7A 1FDUA 2GLXA 1KEPA 3A9WA 3BMNB 3WGIA 1LDNA 1I2BA 2A94A 2FN7A 5JMWA 4MINA 1PJBA 4K28A 3GN2A 1R37A 3C7AA 3QWBA 5ES3A 5CDYA 2HMSA 1MGOA 5HWSA 2YZ7A 3JQAA 2TMDA 1LQUA 3ICCA 3WGTA 4ESOA 2Y0EA 1UDCA 1U9JA 4TRMA 3PGJA 4XGIA 4E2XA 1P1KA 2UAGA 1WVGA 5TF4A 4PZCA 4R1UA 1S7CA 5JAZA 1E3WA 2VYVD 3S2IA 2AQIA 2GN8A 4ZN6A 1T4DA 3DEYX 1N9GB 4TMFA 3WWZA 1DRVA 4YQZA 1Z6ZA 5EIOA 4RPHA 1SB8A 3VVBA 3WX0A 5IZCC 2LDXA 2NNLD 3HZZA 3MJCA 4IDEA 4CLRB 2BF7A 4WOJA 5T57A 2C29D 2ZJ1A 1LRKA 4TVOA 1ZCJA 2RBEA 3OIFA 2PTGA 3HWRA 1DBVO 4BV9A 2X8LA 4YJDA 4YAKA 4QTZA 2PNFA 3QHAA 1O6ZA 4CUZA 2ZYGA 3RUEA 3I6IA 1K6XA 2PZMA 1KY5A 1VL8A 3K6JA 3GEDA 3PFWO 2CDAA 3ROPA 1P1RA 1KC3A 4ND5A 3VTZA 3ORFA 3NDIA 1PGQA 4R51A 4FN4A 1B26A 3JQGA 4G2NA 4J4BA 4IDCA 3BYZA 4ZQGA 3ZV4A 3T7EA 1T2CA 4PLGA 4WLEA 1I5RA 3ASVA 3ZWNA 4ZRNA 1B8UA 1JA9A 4BO9A 1DHTA 2VHWA 1U28A 5TGDA 1T26A 4FOSA 3INRA 4XKJA 5F1OA 1BHSA 4M89A 3F47A 4MIOA 1SOVA 3ZV6A 2I76A 2HJRA 4ZQEA 4BO2A 2RHRA 2WD7B 4W99A 3KSUA 1HLDA 3CEAA 3BIOA 3OJEA 2IXBA 1TVEA 4BO0A 3C24A 3JTMA 4XDZA 4JBIA 2X9GA 2W2KA 4BKPA 4DMLA 1DIBA 4Z0HO 2E49A 2WEKA 1QMGA 3Q2IA 1CDOA 4RDIA 1GQYA 4IJWA 4ZICA 2WJPA 4E0BA 1TT7A 3O26A 2IZ0A 4L4RA 4I9NA 2VYNA 4D3SA 2V6BA 4XQEA 3S8MA 2DM6A 2A9FA 3QWAA 4O0LA 3WGHA 1QKIA 2YDYA 3G79A 5LDGA 5IDXA 3WBFA 4BNGA 1MXHA 3RUHA 5I7EA 1UR5A 3MCVA 3R6DA 2CF5A 3O9ZA 4IMPA 1PR3A 1I33A 3FF4A 2HLPA 1XDWA 2HDHA 1JWAB 5CAEA 4H7PA 3LVFO 4CV3A 2Q2QA 4I5GA 5DT9A 5BR7A 1MB4A 5TJ9A 3GGOA 2A35A 3FNGA 3NJ8A 3K5PA 2V65A 4RVSA 4AJEA 5IAAA 2QW8A 2VCYA 4HKTA 3EC7A 4BQPA 3NAQA 9LDBA 2JFGA 4TKMA 2CVQA 3A14A 3L9XA 2IODA 3BTOA 1C1DA 1BW9A 4CR6A 3R1IA 2OXIA 2YJZA 4DTIA 4DC0A 4NBVA 4BO3A 2NU7A 1D4FA 3OM9A 3T4EA 2IZZA 1Z7EA 2PGDA 3CSDA 2JAHA 1B7GO 4CQMB 3BHJA 3ITKA 4Q3AA 3RI3A 5KVVA 3FPCA 2BLLA 4Q3DA 1LJ8A 3OETA 2V6GA 3VH3A 1PL8A 4PLPA 1BVRA 2B35A 2ZIZA 2OOSA 1EVYA 2C2XA 3FNHA 4PIVA 1H94A 2EP5A 3WFIA 2GN9A 3I9KA 4KMSA 1DPGA 2QQ5A 2WYWA 4YT2A 1N7HA 4WK6A 3SJUA 4D42A 1ISHA 4XD2A 3I23A 1K6IA 1YWGO 2VTDA 3JQCA 3AOEA 4XDYA 3JYQA 3ANLA 3DFZA 1K6JA 2EW2A 3OQBA 4TVBA 1HDYA 3GUYA 3U4HA 3ETGA 4OL9A 4PLTA 2PZKA 3C3XA 4GX1A 2X9VA 3RWBA 4R41A 1ENPA 1DIGA 3GUCA 5L3ZA 3JYOA 1YBVA 4CM4A 1QYCA 5L9AA 4MIYA 5ITVA 1E5QA 4JXKA 4XYGA 3O8QA 2FSVA 4CMCA 2EERA 1H9AA 2YFHA 3F1LA 3LT2A 5BSFA 4AJLA 1NM5A 3E5RA 5KJCA 2BFMA 3G1UA 3NV9A 5AVOA 4Q39A 4R9RA 4GPD1 2Y1DA 2QG4A 4XJSA 3RU9A 2Y1FA 3H2ZA 4O5OA 3ZNOA 4GGPA 4ILKA 2ZQYA 1HTBA 3RAJA 3FSRA 3OJFA 2IDZA 2E6UX 1OAAA 2PGJA 4B7XA 2HUNA 5HM8A 1N9GA 1F8FA 4RLSA 3HB4X 2VZ8A 4ZQBA 2GN6A 1UP6A 2ZB8A 2DFDA 2HU2A 4O6VA 4TRNA 4B8ZA 1HXHA 2JFFA 3WNVA 2YQ5A 4CM4B 4MVJM 2I5PO 1VKNA 2VOJA 2OFPA 1B3BA 3MJVA 2CSUA 4FFNA 1KBZA 4DBVO 2Q49A 1H6CA 1UH5A 4FOOA 3UXYA 2WE8A 3CH6A 2FZEA 4U6SA 2X5JO 2WE7A 2ZTLA 3D7LA 4UEJA 1SOWA 5COAA 3ZWPA 5TIIA 1DXYA 2WD8A 4IDAA 5JSFA 3VDRA 4ZQFA 4Y6RA 1F0YA 2IE0A 4EJ0A 4WNCA 2QZZA 5AXCA 2BKAA 3V5NA 2VUSA 3NEPX 2R6JA 1SEPA 1DRUA 4N18A 4YDRA 5A9SA 5BNTA 1C1XB 4WLFA 2O23A 4F46A 1WPQA 5G4LA 3LF1A 2AW5A 4L76A 4QO7A 5MGBA 2B36A 4GQAA 3GC6A 3OP4A 4URFA 4W6ZA 1P33A 2VHXA 4JP3A 3E82A 1XU7A 4N54A 3U49A 2HMVA 3FI9A 3GLQA 3NKLA 2HSDA 4U8GA 4J2OA 4OQZA 3JD4A 4W4TA 1LXCA 4E33A 4WNIA 1F14A 1ZK1A 4C7JA 2EWMA 3PJGA 4TSKA 3Q11A 4LK3A 1ADBA 4IPTA 4YRAA 1WZEA 3E6AA 3LDHA 3D4NA 3H5NA 1J6UA 2OBNA 3HE3A 4KWIA 4YCAA 2VRBA 3I6QA 1TT5B 1QORA 3WGYA 2PR2A 3W1VA 4BB6A 4Z3KA 5K9ZA 1DFIA 1GPDG 3U4IA 4IDBA 4RPLA 1PJ4A 1JKIA 1CEQA 1JQBA 1YQXA 2Z5LA 4IINA 4NFSA 5BT9A 2W90A 3EGOA 4J0FA 4E6PA 5AYVA 4AJ4A 3PEFA 1M75A 3MJ4A 2D3TA 1R66A 3D3WA 4R68A 1YB5A 3KYBA 3KTDA 4KP7A 3A06A 2X0JA 2P9EA 1EQUA 5BSHA 3NDJA 3KHUA 1JU9A 1QYVA 4G5HA 3ZU5A 3K92A 1BXKA 1IE3A 2C54A 3H6KA 4RVUA 4BKRA 2FPPA 3EDMA 3FN4A 1ORRA 3GNTA 1QSGA 2HK8A 1QR6A 2HRBA 2PKQP 3TL2A 5JW6A 2I65A 1W73A 3U9LA 1H9BA 2PY6A 3IKTA 3ZWWA 3OHSX 4S1VA 2CZCA 3PHIA 5CEJA 1XQ6A 2WD7A 5CDSA 1RWBA 5B4UA 1Y7TA 3LF2A 5FEUA 4XYMA 1HWYA 4XWYA 4MPDA 3DTTA 5L95A 4HFRA 5EN4A 4HNGA 3NGLA 3WQSB 4L9RA 4L4SA 1HSOA 4K26A 1GUFA 1HDRA 3CZMA 3IDSA 2O4UX 4FCCA 4KZPA 3R3JA 4FR5A 2OORA 4XR9A 1UZNA 4BMNA 1VL6A 4NZ9A 3ZU3A 1ZEJA 4QT0A 4RGBA 4LISA 1Q7CA 2HRZA 3S2GA 1DC5A 4OOFA 4CL3A 1CQJA 1LRJA 3PQDA 1KVSA 2C5EA 2J3JA 2YV3A 4EYEA 3LLVA 1GQ2A 5ICSA 3KEOA 2IYOA 3G0OA 3VHRA 2YFQA 3G3EA 5L40A 4KUGA 1BVUA 3HDJA 3LC2O 4FS3A 3WGQA 1SMKA 4YAJA 3SLGA 1PQPA 2J5QA 5C7OO 4CM8A 5A1TA 1EDOA 1MC4A 4IY1A 4RPKA 1N2SA 1PZEA 1KVQA 3F3SA 4ZA2A 5HS6A 2OP0A 3AI3A 3FWZA 4NDNE 1NHWA 4UUOA 3GR6A 4BNWA 4TRJA 3CMMA 3PTZA 3E8XA 4EJMA 3BAZA 3R3SA 5C3MA 1K0UA 2AEMA 2NU6A 4XQGA 3OJLA 2YDXA 5BSGA 1V0JA 4GVLA 5DBGA 1E1LA 1HRDA 3B1JA 2Q2VA 3ASUA 5A5FA 1KS9A 1K3TA 3L4SO 4EW6A 3JQEA 5I9LA 2OP1A 4GWKA 4A26A 4KQWA 4YWJA 1XEAA 3UCXA 5COBA 2VNAA 4WKGA 1EUCA 5CP8A 2SCUA 4J1SA 2ZQZA 1U3WA 3LT0A 2OBYA 5ILOA 1P0CA 3W4KA 1DJNA 1GUZA 1Y5MA 2Q4BA 4NH4A 5H83A 3HDHA 2EW8A 3ZN2A 3GNSA 3BHMA 3JD1A 3OEWA 4QECA 3EW7A 5K6AC 3PZRA 5C5IA 2QX7A 2FZWA 2Y68A 3IC5A 2RHCA 5I7VA 5JXWA 3KETA 2FP4A 3RBZA 3UUWA 4UUNA 1X7GA 3GZNA 4YAGA 5AQ1A 2NTVA 3PWSA 1YGYA 4O59O 4ALLA 1NBOA 2G1UA 3C7DB 1YOVB 5CEEA 5AOVA 4H15A 1O9BA 4NBWA 3WGGA 4RF5A 4E5MA 3WIEA 1U5CA 2VQ3A 4TZKA 3AY6A 3VPXA 3W6UA 1Q7GA 1I36A 1WLYA 3DZKA 1NX6A 4YVFA 3JQ9C 1E1NA 1H2BA 1NHGA 3C8MA 3ICPA 4ID9A 2ZB7A 4NFHA 1T2DA 5G0UA 5LCXA 1HT0A 4LCEA 3SJ7A 2VNSA 3KRTA 4RVHA 4IIUA 4BNUA 3B1FA 5T5QA 3ZHYA 3E9MA 1U2GA 5FFFA 4PG7A 1W8DA 3H9UA 1M67A 3QY9A 4J4HA 1JVBA 2WYVA 1YL5A 1C14A 1XG5A 2R2GA 3PWZA 4PRKA 5EPOA 4OXYA 3PWKA 3PVZA 2W4QA 2XXJA 4N7RA 2FOIA 2YV2A 4FSHA 1E77A 4HWKA 4BOYA 3JD3A 3Q1LA 3PIDA 4IQGA 3FPLA 3AUTA 4CMIA 1E3IA 3I52A 4J1QA 1QV6A 2CFCA 3DAPA 4S3MA 1P44A 1WDMA 5G0VA 5B12A 3BTSA 4ZVVA 2JFHA 1PJ3A 4B4VA 4EDFA 3RKUA 1ZK2A 2BGMA 2QIOA 4WOKA 1JKFA 2YHUA 4WECA 4M1QA 2VWQA 1G0OA 2UVDA 2W8ZA 4XYEA 1RM5A 4ZJUA 1GY8A 3PJFA 4GGOA 4ND3A 1ZEMA 4W9NC 1E3EA 3UFXA 5F21A 4BQRA 5H81A 4JBHA 1XSEA 1GL3A 1R4MA 5I7FA 4BNIA 1I3LA 3A1NA 1DC4A 4KTVE 1M76A 4E5YA 3GVPA 2FPIA 3N74A 4U0KA 4II2A 4GWGA 1A27A 2NUAA 5KJ1A 4PVDA 1RYEA 1EE9A 3DBRA 2JCYA 4Q3EA 2AE2A 3D0OA 3DBLB 4BO8A 3ST7A 4A2CA 1KETA 1WDKA 1H2HA 5JY6A 1VJ1A 3RFXA 4CMGA 1VPDA 3BMQB 3KUXA 3FTNA 1IB6A 1EDZA 1M6WA 3LU1A 4OSPA 2X4GA 3H65A 3AUAA 1P1IA 9LDTA 2QRJA 4DYVA 2RAFA 4DVJA 3ETDA 2VYVA 3CINA 3G1TA 2P5UA 2DBVO 1PS9A 5AXDA 4GLOA 1E0DA 3DHYA 1HDCA 1KVUA 2EKQA 3KV3O 3HFSA 2Z95A 1NTOA 1Z73A 2DAPA 4MKRA 3NT2A 5JYEA 1YJQA 1OBFO 4ZU3A 2VWGA 3GT0A 2B4QA 4DC1A 3DB2A 2BHLA 4OKNA 1ENOA 1PL7A 1VLLA 4LGVA 4WLOA 5ILGA 4PG8A 4ND4A 5IF3A 4MP8A 5L7YA 1N5DA 2A4KA 2VT2A 1PJ2A 1VJTA 4OQYA 4FIZA 4OAQA 5DZSA 3WFJA 5BQFA 4YT5A 3DMTA 1G6KA 4UREA 2AQ8A 4N5NA 2DU8A 2NACA 1HSZA 2AEJA 1SZJG 4B4WA 3L6OO 4KTTE 1KY4A 4YPOA 1H5QA 2O3RA 2D5AA 1X0XA 1EE2A 4GKVA 1TT5A 1JLLA 4BO6A 5EINA 4DLLA 3KOUA 1I0ZA 2HK7A 2NQTA 4I5DA 5G4KB 5AXBA 2IZ1A 4RDHA 3ULKA 5GY7A 1PQWA 4BNNA 3DOOA 3VKUA 3DOJA 4ALJA 3W6ZA 1LUAA 1T4BA 2J5KA 1LI4A 4A0SA 1AN9A 1T1SA 2XXBA 3PJEA 3T7CA 1LDEA 2VZ9A 4YJFB 7ADHA 4ONEA 3RC1A 3U4CA 4JJGA 3MOIA 3WLEA 1LDMA 4CLDA 3GA0A 4CV0A 4MVJG 1T2FA 4D44A 3IOYA 4WCFC 4HNHA 1WP4A 1KEWA 2Q1WA 4AL4A 3ZGYA 4CMKA 4R3WA 1XWFA 4J4TA 1H0KA 1YBAA 4BNKA 1R0LA 2B4TO 1H6BA 1X1EA 3BA1A 1ADGA 2B0JA 1VE9A 1EBUA 4PLHA 4PVCA 1EVJA 4B3JA 4B3IA 3KBOA 4HFNA 1Q2XA 2UDPA 1LC3A 4R1SA 1UP4A 3O8QB 3V2HA 4BKOA 4A5OA 1E6UA 4J7CA 4CM3A 5L45A 4CPDA 4CMIB 4KDEA 2HK9A 1U4OA 4IUYA 3COSA 4FW8A 4JN6B 1YE3A 4IJVA 2NVUA 4D3FA 3KB6A 2HQ1A 2OO5A 1ULSA 3GVCA 4L0QA 2ZTVA 4AICA 1WAMA 3SC4A 2ZB3A 3WSVA 1P31A 4DPLA 1NWHA 2ZTUA 3CIFA 2FR0A 2Q4EA 4OM8A 1P1FA 4I1IA 4MKZA 2ZCVA 4RZIA 4OH1A 3PIIA 1NQAO 4N5LA 1IZ9A 2HMWA 4DIFA 2CMDA 1ULUA 3TZKA 2WWRA 1PL6A 2BI8A 2FR1A 2PGLA 2DUUA 1HKUA 1AXGA 1HDGO 1IHYA 1ZH8A 3LZ6A 3UVEA 5A3JA 4Y67A 2OHXA 1GADO 1PIWA 1MP0A 5KKCA 2J5RA 1ZBQA 4ALIA 3DTYA 5J23A 1A7KA 1ARZA 4A73A 4J9VA 1AHIA 1Y1PA 3JD0A 3RCBA 3NX4A 3PPIA 3GPDG 4H16A 5IDWA 4YBZA 2C20A 3C85A 4HXYA 1ZSYA 2PA3A 4R16A 4WASA 4EITA 1GV1A 1X15A 4O63O 1PZGA 4BNTA 2Q1TA 3MJSA 3DMYA 2C59A 1C0LA 4NK4A 1B3RA 4P38A 1QYWA 1DLJA 4YTEA 5ER6A 3AY3A 3NGXA 1ZJYA 3WSWA 3SVTA 3T4XA 1JWBB 1MLDA 2IEDA 4AJHA 3GEGA 4NFYA 1U3UA 3C1TA 1XGKA 3NTQA 4MO2A 2E37A 3TZCA 3GMDA 4I5EA 1IUKA 2DTDA 5G2OA 4RQUA 4XYBA 1T25A 1JKJA 1I3NA 2AXQA 3GVXA 3TJRA 3BZUA 3EZLA 1I3KA 5EESA 5F1KA 4CR8A 3UKOA 1BRMA 1AXEA 4M54A 1NXQA 3CKYA 1E7WA 2CD9A 3GMSA 4XJTA 4CM9D 2UUOA 2VHYA 3L6DA 4U0JA 4JBGA 5A06A 1HYEA 2CDCA 3BMOB 4CQLA 5HTOA 3GF4A 3P7MA 4M87A 4U6QA 5A03A 1I10A 2O3UA 4Q9NA 4TRRA 3NTRA 3HJAA 3VC7A 1QYXA 2X5KO 5B37A 1AUPA 1C1XA 1S6YA 1W6UA 3FHLA 3UCEA 1OZAA 1LLCA 3F5SA 4CV2A 1UXJA 1LLDA 4AJ1A 1XLTA 4W7HA 4NQZA 4FD3A 1UZLA 4DL9A 2EHDA 4HY3A 1GTMA 1LLUA 4CMEC 3IQDB 3K8ZA 3P2YA 5GZ1A 4XRRA 3PQFA 4P4GA 4R9SA 3WGZA 3IP3A 3KYDA 3UHAA 3JCZA 3QRWA 4ND1A 5G4KA 4AJJA 4LSMA 2GNAA 4D45A 2VRCD 1U7TA 2QYTA 2ZCUA 1NPTO 2ZYDA 5DN9A 4MJLA 3FBTA 3PI7A 7MDHA 1PJLA 4QUKA 1DRWA 3ZZNA 4XQCA 3STHA 4RORA 3RBXA 1LRLA 4HX5A 3RD5A 1L7EA 3EYWA 3GGPA 3OA2A 2OL4A 3UH1A 4E2ZA 2JD2A 4DPKA 2F1KA 3WBBA 3ZI0A 4NK5A 3DHEA 5T64A 1ZMOA 5FYDA 4IS3A 4WLNA 1IPEA 3JD2A 3PYMA 4J3FA 4JROA 4LRSB 4PGFA 5JAMA 3L6EA 4BB5A 2B37A 3MJTA 4A03A 3I1JA 4D0RA 1JTVA 3EY4A 1UUFA 2AEFA 2GERA 4XCVA 1CERA 5EQFA 2NLOA 2YW9A 5TSDA 3GDFA 3ZNNA 4OO3A 3MZ0A 2Y1EA 5LDHA 3DBVO 1CIVA 5IXSA 3RUIA 3LC1O 2AQHA 4AJOA 4ZHSA 1HZJA 5A5EA 3VZQA 3PLNA 1A9ZA 2G82A 3GNQA 1Y8QB 3DONA 3H2SA 4BKQA 3DBRB 1I2ZA 2OGUA 1P9LA 4MKXA 4DLAA 2GRAA 2NSDA 4D46A 4RL6A 2D1YA 2D0IA 3BXXA 3CMCO 2GPTA 4AVYA 4FJ1A 4PLCA 1EUDA 4NJOA 5G0SA 5CG1A 3JQBA 1E3WB 3JQFA 4G81A 4WCDA 3H4VA 1RJWA 5A9TA 1U2DA 4BO1A 1AHHA 1JDJA 5G0TA 4E5PA 3I9JA 1Y8QA 4B8WA 2F00A 3O38A 1RM0A 3WDSA 3S55A 4WE3A 4Z0PA 4Z0TA 4ZQHA 5ITWA 3H9GA 3U3XA 1GCUA 4UEKA 4K9DA 5ENVA 2DUWA 5JE8A 1QRRA 4W7IA 3GFBA 1ZW1A 1QLJA 4R5MA 4BGIA 1HE5A 8ADHA 3VPGA 4BMVA 1ZXLA 2X22A 1N1GA 1Y8RB 3WQQA 2H6EA 4MVJI 3DAGA 1BGVA 3K96A 1F8GA 1SNYA 2IXAA 4R01A 1SAYA 3TZQA 3VTFA 3U09A 3HUDA 4CUKA 5DCUA 4BNFA 3D64A 1ZJZA 5JFOA 1DC6A 3W8DA 5C37A 1OFGA 4JIGA 5KIAA 3EUWA 5B4VA 1B16A 2QYSA 4FJ2A 4IGFA 4BNLA 4P8RA 1TB4A 1E7QA 4JJFA 3TFOA 2C82A 3VPHA 2Y66A 4Z3DA 3P2OA 1ZIDA 3I9OA 2ZJ0A 4NG5A 1E7RA 3DR3A 3WMXA 4BNJA 3GZ4A 4WPGA 2AHRA 1BDMA 3WICA 1KVRA 3KM0A 2PFGA 1N92A 3WTBA 3WTCA 3U5TA 2CVOA 2IEBA 5KJFA 4GLLA 3I4CA 1VJ0A 4PLYA 3SC6A 1YJ8A 3SX2A 2VTEA 3MWDB 4J7UA 3NJ4A 1N8KA 2VUUA 4BO5A 2NU8A 4BNVA 3WWYA 5TX7A 3NTOA 1ISJA 1ONNA 4PG4A 4MVJA 5TJHA 1R12A 3KYCB 4OXKA 2NVWA 3R0IA 3L4BC 1WZIA 1CYDA 3TFQA 5L4NA 5BNFA 2H5LA 3VPSA 2Q99A 4DIOA 3KXDA 4FC7A 5TT0A 3ADOA 3WYCA 4Q3NA 2O7SA 2P68A 3CXRA 4U7WA 3FD8A 1YQGA 1P1JA 4UULA 3ZCXA 1Y6JA 1Q0LA 4YJHB 2GD1O 5ENDA 1O5IA 4ITUA 5HRUA 5U9CA 4PN3A 3E1KA 4ND2A 1UXGA 3L07A 5FI3A 1A4UA 5CEFA 4NU5A 1GEEA 4CM5A 5DCWA 1NP3A 1YRLA 5F3RA 1NAIA 1NR7A 1LU9A 3AI2A 2ZK7A 2WSBA 1V8BA 4CQMA 2QRKA 4OXNA 1NVGA 1YBMA 5CHEA 3ITDA 3NDRA 3RJ5A 3I83A 1QP8A 4GSLA 4Y98A 3AFNA 1GYRA 3WG9A 1A7AA 5I8WA 1XQ1A 2NU9A 4IXTA 1GAEO 4QXMA 3K2EA 1GUYA 2G0TA 3OFSA 4IZHA 5DOVA 4DUPA 3GEMA 2B4RO 3RFVA 2CVZA 4K1LA 3D3WB 3CPSA 4AJNA 2J3IA 1E3JA 4ALMA 1GZ3A 3ROQA 3GGGA 4DA9A 1IZ0A 3H9QA 5T8KC 3AU8A 3V1UA 4AJIA 1DIHA 2RCYA 3QV1A 3ZW8A 3DOCA 4D79A 1ZK4A 4GL4A 3RKRA 1BMDA 1E3SA 1PU2A 1LDYA 1ONPA 4M86A 1RM4A 3FBGA 1FXSA 4YEDA 3ZWMA 4D7AA 3H9EO 3ENKA 1SEVA 4J49A 3MTJA 3QP9A 2HMTA 4JK3A 4E30A 2GDZA 3HNPA 4EUEA 2J3KA 1Q1NA 1HLPA 1EZ4A 3PDUA 3E48A 5KJEA 5LC1A 1PQUA 1UAYA 2I3GA 3L4BA 4I9HA 5JYDA 3KO8A 3VPFA 4DWVA 1PGJA 1O89A 4XB1A 2C5AA 4NBRA 1I01A 4O1MA 3PHGA 1FDSA 3PHLA 2BGLA 4LMPA 4F3YA 4NBUA 1P45A 3CE6A 1LSUA 2P91A 4YB8A 2ZTMA 3K31A 1AGNA 4Z9FA 3WNQA 3I9NA 1MC5A 3JQAB 1FF9A 1D1TA 3E18A 4PLZA 5IG2A 3RUCA 4JNKA 4TWRA 4DQUA 2X6TA 2DBZA 4NIMA 1G0NA 2AG5A 4WJZA 1ADFA 3JQ6A 3JYNA 3QWIA 3QVOA 1SCUA 1V35A 5JCJA 3ZWOA 1CWUA 1ZZEA 3OICA 1E7YA 5HA5A 1EEHA 4BNXA 4L8VA 4PZEA 4BS9A 2BH9A 3UICA 1PX0A 3DZGA 5L4SA 3OSUA 2DTEA 1T24A 5L7TA 3V2GA 3IS3A 3RVDA 3RROA 3FR7A 3BTVA 2Z1MA 3D1LA 3FRJA 5JPIA 3VZPA 5EJ2A 3QWFA 4UAGA 1O0SA 4B7CA 3M6IA 4CLRA 1KERA 1YL6A 3M1AA 1NFRA 3NT4A 3PYLA 2BFPA 4E12A 1FDVA 3UAGA 4Y9DA 3OH8A 2VUTA 3QVWA 2GGSA 2O7QA 2VRCA 1X7DA 4XIYA 4GX5A 2FHSA 2GR9A 2EV9A 3ABIA 3DZHA 4IIVA 4KUHA 1ADCA 1DOHA 4FGWA 3G49A 4FDAA 4RVFA 3A4VA 3N7UA 4CMHA 1T2EA 3G17A 4TROA 4E3ZA 2RH4A 4JX8A 4RV9A 3ZWBA 2BD0A 4J2HA 2B69A 2O4CA 1NASA 2EJVA 3PHHA 4F45A 4XX0A 3HG7A 2R00C 3AOGA 3OJOA 4BMSA 2AA3A 2X7HA 1SBYA 4I08A 3GH3A 2NTNA 3GAZA 2EKLA 4RF3A 2TMGA 4GSKA 3O4RA 4YR9A 4BGUA 4MIEA 5DULA 3I9LA 2NWQA 4JJIA 4EUHA 3VOSA 3GG9A 4Q3BA 4CLXA 1FDTA 1I32A 1XA0A 3LT4A 3HN2A 5GMOA 5I9NA 2Q3EA 3NRCA 3L9WA 1XKQA 4EBFA 1BTOA 2H9IA 1YOVA 1LDGA 3ANNA 3ROMA 1M6HA 3KLPX 5EERA 3ZWCA 2EJWA 1M66A 3E5MA 3TPCA 4I9UA 2C7GA 4YJHA 2PWZA 4RO0A 4GX2A 2RIRA 3GDOA 3AOEC 1MA0A 1Q7BA 1YQDA 1RKXA 2EP7A 2QHXA 2ZKLA 3OF2A 1O94A 4BIIA 4LN1A 1RYDA 4ZRMA 3INGA 4W9NA 4WCFB 4YAEA 3H5RA 4RJTA 4B3HA 4YJFA 1EFLA 2WM3A 2XF8A 5IFLA 3RASA 1D8AA 1YH3A 1O8CA 1P3DA 1QYDA 4UVEA 3AW9A 4DIBA 3GY0A 4IMRA 4Y8VA 3IL2A 1LSJA 3IJPA 3JQ7B 1KVTA 2JHGA 4R3NA 5BNIA 2O3JA 3F6YA 4CQMD 4I5FA 4MP6A 3AY7A 5DF1A 1ENZA 5ER9A 3TQHA 4WLUA 2CY0A 3V1YA 4DBZA 1NAHA 1O95A 4LSWA 1JN0A 2GN4A 3HB5X 4YJGB 2AQKA 4P4NA 1NNUA 4GMGA 4CMEA 5U4QA 1L1FA 1NFFA 4GI2A 5FF9A 1GYQA 2BMAA 1MX3A 1BXZA 4IM7A 5A04A 4J91A 2BFAA 5THKA 4NJMA 3JQ8B 5JLAA 3INTA 1GU7A 4LVUA 5CPFA 4Z9YA 5KOIA 1YXMA 2Y1OA 3GRKA 1SO8A 4CM8B 3I4FA 1R0KA 1Z7BA 1ZNQO 1WWKA 3ZV3A 1QG6A 4C7KA 4HFMA 2NADA 4XRGA 3SBOA 3PP8A 5IN5A 3UGKA 2AMFA 1ZMTA 1FMCA 5A3VA 3PJDA 3RUFA 1X14A 3RJ9A 5HS4A 1PEDA 3DZJA 2PK3A 4D41A 2PD3A 2VN8A 1DFGA 3RUDA 3H8VA 3F46A 2LDBA 3F9IA 4FGSA 1ZSVA 1UP7A 4EEXA 2J8ZA 4TKLA 1LNQA 1YB4A 2X86A 3LLSA 4FFPA 2Q45A 3QQPA 3F4BA 3PYXA 1FDWA 4DXHA 4LRTB 3IUPA 1HE2A 3U4DA 3W4JA 4OYRA 5T8KA 1FK8A 2NM0A 4AJPA 1LDBA 4HP8A 2B83A 1BW9B 5T6BA 3CUKA 2OZPA 3I9MA 3X2EA 4R69A 3QVSA 4IJUA 3HQ4O 3RBVA 1LLQA 2XPCA 4UVGA 2Y93A 1J0XO 3WB9A 2I66A 1QXSA 2X1HA 4E21A 1NPYA 2QZ9A 4JP2A 5TS3A 3F4LA 3DDNA 4JLWA 5JO9A 4A27A 1HYHA 2XAAA 5JBIA 2DQ4A 2WTBA 1PS0A 1UJMA 2GYYA 4JCOA 1M2WA 3LYLA 3TL3A 2J6IA 3TWOA 5KVCA 2FR8A 1DIRA 1LEHA 1KEUA 1Y9AA 3EVNA 4ROSA 3IAHA 1MFZA 3UCFA 2NV6A 3F5QA 4X54A 3B6ZA
chains in the Genus database with same CATH superfamily
2CGEA 1HNZB 2PH5A 4NEGA 5KVQA 3HJFA 1QIGA 2J7PA 5DH9A 1NQOA 1VIMA 2JB9A 3VH4A 3Q0IA 5TMEA 2PBFA 4JVMA 3Q87B 2EATA 1RBMA 2PWYA 2EGHA 1NW5A 1RAAA 1PJ8A 1Z4LA 2FKAA 4NBNA 3OKPA 3LHSA 1CJBA 2V7XA 2PRYA 3D5TA 2CLHB 2ETVA 2J3HA 3F1KA 5BV2P 4F93B 1ZN7A 1KMQA 3FYSA 3QU2A 4JC4A 1JQDA 2PLNA 4DOMA 1YZNA 1OZFA 1SUSA 4AYWA 5F9HA 3IEMA 2XMQA 2P1DA 2DTXA 4US1R 4H6VA 3N8GA 1BNCA 2FPGA 1YUBA 3BL6A 4C6TB 5FNZA 1V41E 1IK6A 2QN9A 1SBTA 2EG9A 3D6VA 1KZYC 2IYEA 3WJAA 4IIXA 4AFNA 1B8VA 2CJYA 4EGCB 1BOOA 2V7VA 1Y1LA 4L6IA 5JAQA 1D0VA 5ECGC 1UAAA 1QRAA 5CYFA 4Q15A 4AJ9A 2PZLA 1RI1A 1N1EA 2O3SA 2WP8J 4PYKA 4PQYA 3WLKX 1Y81A 3CW9A 3C70A 4W5WA 3VR4H 2B7LA 4OB7A 4UMEA 3NHJA 4XASA 3TSYA 1HX7A 3DWEX 1IY8A 5L3SA 4BKUA 3DC2A 1VRCA 1XJCA 1CDDA 5IZ4A 2GD2A 1MXFA 1QWOA 3MIIA 2QPOA 3I64A 1D2MA 5AJHA 5IN4A 5JADA 3O03A 2HV8A 4HAWA 2WP0A 2VQSA 1Q0SA 3PDIB 4V0RA 2H11A 3NHBA 2O48X 3BWVA 5DO9A 1SVWA 3DQPA 3JQFC 2YY6A 4M76B 4OHFA 5FA5A 1GZSA 3N58A 4IQ8A 4Q9AA 3W2TA 1NF8A 2R79A 4FZVA 1E6KA 4C2BA 4ZVLA 2NVUB 1Z47A 4Y6SA 4Q4HA 1HFKA 1J5PA 4YJ2A 4XFKA 1SURA 2IOQA 1S8AA 3PRJA 1W85B 4N01A 4KFRA 4DRZA 1JJIA 2HUPA 4MR9B 2I6QA 3WRXC 4BYGA 3WVNA 1QE0A 3UGQA 1P2BA 3CVOA 3QWHA 2BUAA 1YRWA 4QQRA 3ZK7A 3G5UA 4D3DA 2YKGA 4MGYR 3HDQA 1QHSA 1GUBA 2O6HA 4RVDA 4UBNA 4P4LA 3ANMA 2CL0X 5H0IA 3ZJ5A 2ZYSA 1E8MA 4CU5A 1DJMA 3Q5EA 3EN0A 1ZLYA 4OQEA 3T0FA 4D0NA 4D92A 1QGAA 2HMYB 2P9FA 1HDZA 4LXGA 3HYLA 4BY9E 4KR9A 1NBEA 1YCHA 4U5QA 3WHKA 4ALNA 2BC9A 2AKYA 2IHZA 1QPGA 2BJHA 2P11A 3EDRA 3KEMA 3FKQA 4JLSA 5ADUS 3GG2A 2IDKA 4Q01A 3U19A 1GFZA 2H2WA 5SICE 3DVQX 3EXG2 3LX8A 2GPBA 3T9BA 1OC2A 3V33A 3CKLA 4D1YA 3RJZA 1RWVA 5DOZA 1NG1A 1RXYA 1UJ2A 3FAKA 4M7PA 4RAQA 3V1LA 4OIFA 2XQGA 1OSNA 4YJ3F 4ZD6A 2X23A 4MQEA 1KI3A 1E0KA 2IUUA 1HYGA 5JAOA 2WU4A 4MDHA 1NT2A 2RGCA 4WEQA 4MOWA 1R4NB 1CLUA 4KLCA 4TZTA 5LYJF 4BZWA 5BW4A 4BC0A 3K0BA 1UDAA 2AG8A 4BASA 3D7KA 1FNCA 1RQGA 3SC2B 4IWNA 2ES4A 1VL5A 5HR5A 1CJCA 4I9GA 1DAEA 3JQRA 2VFAA 1TEXA 2DKNA 2EGGA 4UJ5A 1TK2A 1FBTA 4FC6A 2P4QA 4HDRB 2F6RA 1HT1E 4FYWA 3RRXA 5BVGB 2X40A 3Q8WA 3ZV5A 1IN5A 1A95A 1GTJ1 3RARA 4H3SA 4JY7A 2YVAA 4LXTA 3SS7X 3QYAA 1XZJA 5FBKA 1AUVA 4GF5A 1Q0RA 2IV2X 3VV2A 1GLVA 2G71A 1Q74A 1BWRA 1ZK3A 4NZYA 4U7DA 2UYCA 1EI9A 3AEQB 4UUPA 2JS7A 1KMCA 1S5PA 4XX1A 2CT8A 4E5KA 2F62A 2WSSD 2FY8A 2ZATA 1WOMA 1N77A 4EFDA 1NDQA 4MVJH 4ZMRA 3STWA 3KVOA 3V8EA 3ZHVA 1HFWA 3HBAA 2RB4A 2R8XA 5KC9A 1BIFA 2G76A 3EIOA 3O3MB 5IJWA 3U31A 3SKVA 4AZSA 5HZMA 3FLBA 4DDHA 3SHFA 1CFJA 1I7PA 4N5IX 3OQ6A 2RAPA 2XRFA 3QVJA 4JGBA 5KTKA 6CHYA 2XUJA 4L73A 5BQ5A 3RVLA 4Q4LA 3VUEA 2JZOA 4CLHA 5L6LB 2D4AA 1G59A 1FMTA 3HLTA 1MIOB 2BEKA 2CFRA 2ID9A 1BGXT 4FBGA 2JJ2A 2XWBF 3SR0A 4CN9A 3IBYA 3Q8LA 1E9EA 4KKXB 2V97A 3DKRA 2X14A 3B7PA 3BVPA 1HYQA 3ES9A 1V3TA 4UEOA 3R7SA 3P96A 4H6WA 5L53A 4B6FA 2JVIA 5FP0A 4G07A 3OCWA 2GWHA 1EP9A 3R7NA 4JC8A 1E2NA 1G20A 3ZCQA 1VKRA 1M5UA 4TVSA 2P5YA 2ZYHA 3ZD6A 1WM1A 1H2YA 3QUQA 2IPOA 3CN7A 4WFQA 3FMOB 1DSSG 2HV9A 1XXHA 2WKWA 2VA8A 5GZ6A 3OMLA 3VJMA 1EVIA 1YONA 3R9XB 3B1XA 3ELWA 5CPBA 4DAOA 1NXSA 2EKBA 2YHIB 5EAIA 3WIVA 2DT5A 1E99A 2JFOA 3EOAI 3HJUA 5J2UF 1HE1C 3HRKA 1TD9A 3CZ4A 1BCSB 3KTAB 3PB3A 3WGOA 3CUSA 2AHOA 3EHEA 2V6MA 3LGXA 2GXAA 1QONA 3VKWA 1X9GA 4K5QA 3LP8A 4QBTA 3ZCSA 4M9SA 4DBLE 1W4ZA 2AN3A 2HEGA 3L40A 1NWCA 4BVAA 4OM7A 2WTUA 3W8FA 1CSEE 1YA4A 1EK0A 5ALNA 3ZQUA 2ARKA 4CLOA 1EMDA 4RV5A 2OO7A 4RHFA 4EB6B 2PBLA 3BXPA 1A8HA 1U31A 1NFQA 5E6UB 4DHWA 4BO4A 5KVAA 4G23A 4LE0A 3QIAA 4D0LB 2NZVG 3HBNA 1G63A 2PKRA 2ZE6A 4HADA 4JQOA 4QOJA 2NUBA 4IOLA 1YDEA 4ITVA 1Z7WA 1KIFA 5AUOB 1PVVA 2JGEA 3H5IA 1CDZA 1OWNA 1SXJA 1ISRA 2BR4A 1G5RA 2C2YA 3TO5A 5GZ3A 2VDNB 3ZD8A 3W3AH 2G77B 2GFQA 3N07A 1V1RB 5E3JA 3H5AA 2IXGA 2WSMA 1PW7A 3HDTA 3QE3A 5IJZA 1AK1A 1T9BA 3HYNA 3O8OB 3OTWA 3PR2B 5HF8A 4FYJA 2J3EA 2Q1UA 3QU9A 3ETEA 4GC9A 1VI2A 4WKOA 5IAJA 4UM7A 3X1YA 1LSSA 3GELA 1JKXA 1BDBA 1J2YA 4FYHA 5DBEX 1ZVMA 4NJMB 1T36B 5KNBD 3S99A 1L7AA 5DBFA 5TQ2B 5E6UA 3WS7A 3L7AA 5LQJA 5HDQA 1ZH2A 4ZTUB 1JFFB 1K0FA 1R8QA 2GXSA 3NBQA 1URPA 1C0IA 4ZODA 1UT6A 3SF0A 4D25A 5G40A 2CYAA 3WE7A 3JR7A 2FGJA 4RCVA 3DZBA 3VGPA 4A6PA 2FEXA 3EC1A 3DO5A 1RAEA 3FNQA 1H05A 2XUZA 1QFJA 2ZVQX 3LPAA 3DOEA 1XEWY 3M2PA 2V58A 3SXPA 1FY2A 3HO8A 1V5WA 4FDVA 1PSDA 4EO7A 3IAEA 1A2QA 1TUIA 2REQB 4PV7A 3ND6A 2ZDHA 1GL6A 3LD9A 1Y5IA 3JPWA 1EXVA 1Z4NA 4Z7NB 4FS8A 1IN6A 1TTHA 2XB9A 4YQYA 2QRQA 3KEGA 3GJSA 2Y0CA 4HLDA 1FUYB 3UA3A 1X1QA 4IZIA 2EXXA 2VCEA 1BSVA 3SHVA 2AJBA 3WMGA 3UWOA 2Y0PA 1UBMS 2WIGA 1P61B 3ND7A 2XMPA 3URKA 2I3ZA 1PGNA 5DHSA 4WOBA 3WYNA 3KUDA 1G1AA 3SXUA 3Q2KA 4IX1A 5EKDA 2I67A 4D3ZA 4MRRA 1TEHA 4FFMA 4A91A 1SVMA 3RS5A 3PFBA 4KIWA 4PRYA 3ZZ0A 2CDBA 5J4HA 3K4HA 1HDOA 3NR2A 3VPAA 2WIDA 2Q07A 3C3YA 2WTEA 4IJQA 4M9QA 2OD7A 2UYOA 3PFGA 4NENB 4WZZA 3R7WA 4B84A 3GRCA 3BPSA 4Z9AA 3ZNQA 4R6XA 3OF3A 4L50A 4LSZA 2D74A 4RPGA 1EUZA 2RAUA 1RJEA 3R8FA 1YB1A 3HFGA 3Q7SA 1C29B 1ZRHA 1COZA 2D1FA 3AESA 1T8PA 2QRLA 2W98A 2HT1A 1UC4B 2CE2X 3D8NA 2CK3A 1FUEA 2XGOA 2P27A 1S2MA 3HLKA 1WBJB 3NO4A 5DSXA 5EGNA 5EP1A 3ZKWA 4RTQA 3D8TA 1RPNA 4BEBA 1WSWA 1WULS 2HFJA 5AKLA 1K5HA 1HDIA 5B1YA 2HN9A 4EJSA 4U7HA 4DW8A 2PTHA 3W04A 2QZ4A 1OX4A 4P22A 2RHDA 3OE1A 4FOLA 3L1JA 2NTJA 3TX2A 3ZQJA 5JXHA 1MZPA 1SWVA 1B8PA 4U3JA 3Q3IA 1JXOA 2WKPA 4N1AA 2L2QA 4ZARA 1BQ4A 4J94A 1W4LA 3JQ8A 1P60A 1NJ5A 1IQPA 2AC7A 2FLVA 4QQ8A 5JU6A 2O14A 2PZFA 3F5FA 4HQOA 1CUZA 3A6HA 3K2BA 3OKCA 4OEHA 4NNJA 1U5BA 4UVDA 3ZQKA 4FFOA 3RYTC 2RFLA 3LOPA 5DYGA 1J0DA 4LNUA 3WNZA 4EI2A 4R71A 1EIWA 1DUIA 4C4OA 1FE8A 3BQMB 2GXQA 2WHRA 3CG0A 3EWSA 4PWYA 1K27A 4J7XA 3CZRA 5K6TA 1OX5A 5DWQA 2IE8A 1VSUA 4R4JA 4PIPA 5EXPA 1Y9DA 4QQKA 2YYZA 2FPGB 5ARCA 5ALPA 3BMCB 3C43A 1SU6A 4P7FA 4EM6A 5DYTA 2BFOA 3LQFA 2R2AA 4LYJA 5E1OA 3P5SA 3R5HA 3LDAA 1XNQB 1SZDA 1U3VA 2XYPA 1W48A 2A9PA 3ZV7A 3BQ9A 1NNEA 3ZEAA 1QG4A 4DR1B 1R9NA 4BHTA 2P4EA 4LJYA 1R5JA 1QNLA 4ZQCB 4YMGA 2J9FB 1VKOA 1ZFNA 4IW3B 4JQYA 4LJ7A 4QGAA 5I8ZA 3WQBA 3DEJA 1D4OA 1X7ZB 2BFEB 2HJVA 3H8WA 4ND6A 2GARA 1LWOA 4JJ8A 4NU6A 3SXJA 3LRXA 821PA 3PDJA 4B4KA 4UEWA 4BMDA 4LRXA 5J4YA 2W2LD 3GEIA 1BQ3A 4INAA 3SJBA 1WUHS 3LPDA 1JHAA 3D4BA 3T7KA 3Q85A 5SYNA 3I3SR 4QTXA 1GM5A 3WRYC 3H9JA 2G17A 3OLXA 3OSZA 4DYDA 4MP3A 1IIRA 2DPGA 3ZJ4A 1YHNA 4DIDA 5J40A 1KPIA 1W85A 3DW3X 3PXUA 4QREA 4CIBA 2BBWA 5KVSA 3MM4A 3OPNA 1SKMA 4KCGA 2CBZA 2XNHA 4Q4HB 3O4IA 3IDFA 2DPLA 2YCBA 1IRXA 2PQ2A 3UWKA 3ELYA 2ZB2A 3KBBA 3SMQA 4MXDA 4OB8A 4QU0A 4TZ6A 4GD3Q 2PE5A 2PKEA 2V0CA 2BE7A 2YY5A 3MGKA 4Y2PA 2G8LA 5D86A 2I3AA 3IKVA 3QHQA 4M1EA 1LWNA 1ENYA 2ZAMA 4XIJA 4YH1A 4BRWA 2P9GA 2P2DA 1JBEA 2MMGA 2JAOA 1WV0A 3COZA 3PR3A 4FYMA 4EKYA 4MUNA 4QM7A 3DAOA 1OLUA 2B78A 3BDAA 1O97C 1FVHA 3PK0A 2C96A 3QEMB 5JQGF 3KEQA 1A71A 2HCJB 2Q5LA 1KDRA 2BDTA 2ECPA 1XEWX 2BFBB 2HIHA 5JO0A 3BE5A 1JT2A 1XD9A 3PFHA 4B47A 4LWOA 3TBFA 5AJZA 3MMSA 2ZRCA 1GOTA 5LZ7A 2HWUA 3WQRA 3EH2A 1PJRA 3S0JA 3ZWAA 4Y6PA 2Y3IA 5AKHA 2R60A 2RD2A 2QTGA 1W19A 4R8MA 3ZDRA 2C2BA 1FNBA 1MVOA 2JI6A 4HNAA 1FFXA 2OT3B 2P35A 2FK7A 1WEHA 3QXJA 2CVPA 1T3GA 2OGWA 4HGNA 2V74B 3C1OA 1Y7IA 3N9IA 3NBAA 1LF5A 3GJ5A 4I4NA 1CYEA 4PNHA 3DKIA 3SIPA 4OQPA 4BPBA 3H1EA 1D0IA 5KJ6A 4FT4A 2JAPA 1C7RA 4DMMA 3EMKA 4NR0A 1H8ED 1M34E 1MGPA 1SY7A 1Z22A 2BKVA 2HIMA 5T67A 4RF2A 1UBOS 2BSAA 2R6DA 3HEMA 3ZDAA 5AVWA 4D43A 3S29A 4WFKA 3OESA 4PXYA 3HDYA 2H1VA 3A58B 1FYEA 2M6RA 3GRPA 4UNQA 5KWIA 4CI9A 2VQDA 3H7IA 4DCPA 2WWYA 2JFYA 2VL7A 3N2KA 4OJKA 5EYPB 2QAGB 3U81A 1SCIA 2HRQA 4F4CA 2PEYA 2YRWA 4JOBA 4MUHA 1DEHA 4BQQA 3P2KA 5LXTF 3OLWA 3PX3A 4CR7A 3TLGB 2NU9B 2WSIA 4MH0R 5H5JA 4CHTA 4WXPA 1CJSA 4XEHA 5HBRA 1TYEB 5FOWA 5EJ6A 3LIPA 1T2NA 1BRTA 5K8TA 3HPRA 1V9LA 1W36C 2C0CA 1J4AA 3E8SA 3G2OA 5LQDA 2W43A 4Y1RA 1F5NA 3D5EA 2QOEA 2SCUB 1USUA 1VOTA 1JPJA 1SCAA 4FFBA 3PF8A 1YVEI 2GZ1A 4LYDA 1WL8A 5JDCC 1JZSA 5CM2Z 2DBYA 2EL9A 4AY3A 4RHCA 4ARAA 5JJLA 1UT8A 4ABYA 3IVCA 4RENA 4CMBA 1CV2A 1AZSC 3IQZA 3MMXA 4RIGA 2GHQA 1UXKA 3CRVA 4TN5A 2G1JA 3PR1A 4QDUA 5F78A 1UFRA 3VISA 5A6SB 3HXQA 1HL7A 3CW8X 1JLLB 5FO1A 2O1WA 2VZ0A 4EABA 5B3AA 3JQ9A 1XCLA 1KR2A 5LB4A 1FJHA 1N3IA 5AESA 4QEDA 2GCIA 4MV8A 1BCRA 3SC2A 1FSZA 2KBEA 2QSZA 4J1TA 4J1NA 2HRDA 4JELA 2RH8A 4L4XA 3EPPA 3RH0A 4J75A 2HO5A 2DWQA 1PLKA 1Q1QA 2OKGA 5FI5A 3V3TA 4ZVUA 3ZGLA 4LHYA 2B9EA 1EZZA 5EOVA 2HQBA 1PTJA 1GG9A 1OCEA 2ONKA 4FXPA 3HP1A 4QO8A 1YULA 4UDOA 2D5IA 2O8CB 3F97A 4R98A 4CMAA 2H51A 3V7WA 3QLJA 2CXOA 2LCFA 1HE3A 2ZJ6A 5EPEA 5CDTA 1IXRC 4AY2A 3SJCA 1N6RA 4X7BA 2QEQA 1ESNA 4UBIA 1GRVA 3FRIA 5GV7A 3RYFA 2J46A 4EQ6B 5I7SA 2B25A 4KX3A 2JHFA 1BD4A 4F85A 3QXHA 5JJBA 5GP1A 1LVHA 1VIAA 4EHKA 1K8RA 1EFHA 2D8AA 3WP1B 3MWKA 4BGVA 2SKCA 4XSHA 4BNDA 1X19A 1Q20A 5CBKA 2CNLA 1PVDA 3FLEA 4EY5A 1CRWG 1QZZA 3B70A 4XUCA 1XJ0A 2QMUA 3LVBA 4HAUA 5B5SA 3ZLJA 1Y1RA 2ZRQA 2IXDA 5EL0A 4AP6A 1VFNA 1OWOA 2J9XB 3D7NA 3THXB 4IEFB 2QY9A 4HRVA 5EJ7A 5DW0A 3K8QA 1GA4A 1ZOOA 3HJHA 1DXHA 4GE0A 2V7PA 3LTEA 3NVMB 4O33A 1VG0B 1OI7A 1SPXA 4TOIA 3EZ2A 4M9ZA 3SBDA 4K03A 4OJNA 1FLDA 3VXKA 2I78A 1QZXA 4DWJA 4F4HA 1E98A 1T3SA 2RGEA 2LE0A 2VF8A 4AJ2A 2H4YA 3CO0S 1BJKA 1RAIA 2O52A 1W52X 1UIRA 5MN6A 1LSOA 1XRNA 4LOLA 4RGYA 3E9NA 1DAMA 1PWEA 3RTGA 5DJ5A 3KAJA 3B60A 3I4LA 4MGZR 1J25A 2FX2A 2C98A 2JGMA 4C5CA 3BFVA 5JC1A 4OF4A 5TQVA 1I3MA 2GO1A 3U09A 3RUAA 2X58A 1P75A 4QFMA 3ZDFA 4KQXA 3C6YA 2UV8A 4TKUB 1OA1A 5A9SB 4XJXA 4YAIA 4WIAA 4BFUA 1DAPA 3ZYZA 2CBGA 5ULLA 1KXZA 3KSBC 1MIHA 2J5XA 4TPKA 5EQTA 1UBLS 4EHLA 5KDOA 2O8NA 1Z5OA 1OH8A 3UA4A 2R85A 2BSQA 3IHWA 4XX0B 4YCBA 2CFIA 1X7WB 4AP9A 1WHSB 1I2BA 2HGZA 2VPPA 2FN7A 3O3OB 4GLBA 5CX1A 3G9QA 2QORA 3B9QA 5ALJA 5JMWA 1GTRA 4K28A 1G9XA 2ODNA 3GIDA 1AKQA 3IKLA 5ES3A 5J5VA 1B0UA 2YNMC 3ZHOA 4G84A 3RR2A 3FDJA 2Q29A 1A9XA 2YZ7A 5B1IA 4UHBA 3HWSA 3ZE7A 5D1NA 5F7XA 2VBGA 4OFBA 2QM3A 3O93A 4E2XA 1NRWA 2CHFA 3E9CA 1Q0UA 1SIUA 3AF0A 3HO6A 4P82A 4R1UA 2VYVD 4RZXA 1D2AA 2GN8A 3DL4A 5AD1A 3OFND 1P91A 4KBYA 3ZTTA 1WJGA 5FADA 3DEYX 1THGA 4M21A 3HJGA 3GH1A 1BYUA 3GUZA 1QVAA 1X7YB 3TSWA 2VJNA 1XRLA 3VVBA 3WX0A 2GJAA 3HJBA 4OA5A 2WB4A 4WWHA 2LDXA 3HZZA 4H9GA 5DXFA 3GLGA 4C6SA 4Z8YA 1ZAYA 1MZVA 1XLTC 5CT5A 3RT1A 5DGCA 1CULC 5AM4A 2ZJ1A 1E4YA 1LRKA 4OHBA 2ISSD 1OYOA 2RC6A 2R1TA 1XPRA 1RHJA 2GO7A 1DBVO 1FS5A 4YJDA 2I4OA 3IUBA 3VV3A 4ESEA 3UB2A 1C3EA 3A4IA 4FUQA 4UAVA 3BK1A 3R4CA 4NXMB 4U63A 3V42A 4YV0A 1O6ZA 4PBTA 1N5IA 1TTQB 1RRMA 1XN1A 2ZDGA 4EARA 1T8YA 2MSKA 1EGAA 1UBSB 2GB4A 3NDIA 1PGQA 1XTZA 5LZ9A 1IDOA 2DWOA 1NN3A 4PAOA 3FB1A 4FX5A 3LE8A 5FYQA 4AKEA 1NVDA 4IDCA 1GPYA 4PZAA 4ZQGA 1YK0A 4N6NA 4WLEA 4U7FA 4A16A 4YGYA 3ZWNA 2W6NA 1JA9A 1M33A 1NJ8A 3CISA 5TGDA 1AD2A 3UHOA 5DGHA 4DG8A 4ZK2A 4FOSA 1AKVA 4W8OA 1Z5ZA 3FDXA 4IZ6A 3AVTA 4UFPA 4Z1OA 3LDUA 3F47A 2GPNA 2XYHA 2AN9A 3CW2A 4BO2A 4AP5A 4D99A 4B9EA 5CB0A 3BE8A 1SH7A 4MUAA 3CNEA 2VJPA 2XA9A 3OTGA 1KRHA 1ETHA 4B74A 1DZIA 4ZV7A 2M9MA 3JTMA 4HPJB 2UXCB 1N8SA 1LBQA 5AIAA 5EZSA 2ERXA 4PYLA 4DMLA 5FBLB 1W581 2E49A 3UC5A 3ICEA 2QTNA 3QBVA 4LF9B 1ZL2A 3INNA 2PZEA 2QTWB 1OLSA 3LUAA 2H06A 3OFJA 1YR8A 1VCIA 5BN3B 3SZGA 2WJPA 4ZICA 1FP2A 2I3DA 2J30A 3BK2A 3URMA 3M49A 4DWOA 2ZIEA 1QKKA 2IZ0A 4I9NA 3WKBA 1E2EA 1J5XA 2Y1LA 4KU4A 4XQEA 2DM6A 3S8MA 4UU0A 2CNOA 5JMOA 1KSFX 3IBSA 3BXGA 1IMOA 2C3PA 2B0CA 3G79A 2LV8A 5LDGA 3PCRB 3CWZA 4LRYA 3WBFA 2DFPA 4RTPA 1FLVA 1MXHA 1VPVA 1ZH4A 5I7EA 1YZYA 3MCVA 1G8GA 3N8IA 3O9ZA 3QA3E 3R6DA 4W1PA 4W63A 1PR3A 2HF8A 4ZAZA 5FORA 5FQNA 3ILSA 1OBVA 2PKCA 2V7EA 5FBRB 1UBRS 4H7PA 5B64A 1P81A 3E9DA 3I1IA 3LVFO 4MYHA 4PSUA 4PWZA 4Q21A 4ENSA 1MB4A 5C81A 2FWNA 3O4JA 2H17A 3FNIA 4JH0A 4MUIA 4CKEB 4S04A 3IVMA 4YRQA 3FNGA 3NIGB 4BDTA 1OFUX 4AJEA 3L7LA 4MQ5A 3TLKA 4RFVA 4C76A 2C1ZA 2VCYA 3MWLA 4I4LA 4P4UA 1BCSA 3L05A 4XARA 3RVKA 3GU3A 3WDKA 3NAQA 3EBOA 3WOVA 5IBRA 4QGBA 4U7GA 2A7QA 2CVQA 4TKMA 4W9MC 4S2EA 1BW9A 3S8YA 1NVVR 1KI6A 4YCCA 1L4YA 2YJZA 2JCGA 1K8XB 4DC0A 4RQAA 3T4EA 5MFPA 2JRCA 2EIXA 1OXKB 1UPFA 2JEYA 2JAHA 1B7GO 2AI1A 2PGDA 1E32A 2VKQA 2YWBA 4CQMB 5KVVA 4G5FA 4Q3DA 4XWWA 1LJ8A 4W5QA 3VH3A 4KE6A 2B35A 4W5TA 4URUR 4OB6A 4Q48A 4RMNA 1YNSA 3OZSA 4IIDA 4WBSA 1J2UA 1ZGAA 3IPYA 1FDIA 4XLTA 1KJIA 2O2EA 4MLDA 4CEHB 3RYIB 4YT2A 4Y1GA 2FWBA 3LK6A 4LFCB 1JMKC 1N7HA 3SJUA 4XD2A 1GPUA 1KF0A 3I23A 5EP3A 3L0IB 4J07A 1K6IA 3K0SA 2VTDA 3DH0A 2XSZA 3KJQA 1A88A 2O8FB 5CA1F 4M7WA 2G1PA 5EVJA 4L8WB 2GAJA 3A37A 3JYQA 1BA3A 2ZSIA 3O9VA 4X1YA 5L8VA 4JV5B 3OQBA 4GQBA 2F1IA 3JRXA 4NV0A 5I7OA 2E1RA 3ETGA 4OL9A 2PZKA 4BFVA 1WSAA 4TX1A 1ENPA 1DIGA 1N3BA 4BFSA 2WVJA 4P5EA 2NU8B 1YZTA 4CM4A 1ZMRA 1JALA 4G9GA 4M1YA 4RMJA 3WGLA 4D8VA 4XYGA 3N2NA 3O8QA 4TTSA 5CVDA 3HVIA 4CMCA 1NBMA 2EERA 2I2FA 2NQ2C 4HDSA 1NYQA 2GILA 5K0LA 3THXA 4GPD1 5KUTA 2ODBA 3FIJA 3UMRA 3OTQA 5E7JA 4GGPA 4MHOA 2JGDA 2ZM5A 3RAJA 1N9KA 3FSRA 3OJFA 5D7NA 2PGJA 4WK4B 4B7XA 5CA1A 2HUNA 4PYQA 1F8FA 2H00A 4JBLA 4RLSA 1SCDA 2A67A 3BWMA 4C4SA 3UT5A 5A4JA 3UHFA 2ONJA 5CFRA 5KYXB 2ENUA 4F8EA 1DAGA 5JH7F 3JAWB 2XJ9A 4TRNA 2ZI9A 4R0MA 3WQHA 5ITSA 3QTBA 4L8YA 2HDNB 2YQ5A 2WPDA 4OFWA 2GVDC 2I5PO 3WISA 4MYUA 4X1IB 1XAIA 3MJVA 1KDTA 1H6CA 5E9AA 1UMCA 3UXYA 5IMSA 4GRIA 1RE0A 2WE7A 3D7LA 4LXUA 1SOWA 3T38A 3DO6A 2DR0A 3Q3GE 5COAA 5AI4A 5C1IA 4HH3C 3D02A 3OE5A 3W78A 2IEYA 1DXYA 4BQOA 1DL5A 1Q16A 3H11A 3NB0A 1ECPA 3P9PA 1WW2A 1JEOA 1V2GA 3VDRA 4ZQFA 4Y6RA 3KWFA 5IBQA 3KVYA 5FJIA 1WUKS 3GLKA 3E35A 4UU7A 1V7CA 3ITEA 1VPTA 4XUEA 3AVYA 1KYYA 2XTNA 3JASA 2QM0A 1KZ1A 3CEJA 1TCBA 2VUSA 3K7EA 3P2IA 2R6JA 1SEPA 2VBFA 4GOXA 5CVCA 3ASYA 3WLMA 2OWEA 2HM7A 2ZJ2A 1I1HA 1Q7RA 4RH1A 5K3AA 4L76A 4C43A 5MGBA 5DBOA 1QAMA 2B36A 3AEKA 3GC6A 2P6UA 4W6ZA 5EIBD 1P33A 4C20A 3IHKA 4M0EA 1TJYA 1XU7A 2WWWA 1M2JA 3U49A 5B6PA 3V8NA 5BSKA 2ICAA 1OX4B 1XVAA 3NKLA 3UAZA 5JBQA 1E2IA 2HSDA 4X24A 4MI9A 3OWHA 2XMDA 4BN0A 1H4VB 2Z57A 4MQBA 1D6MA 1PR4A 1XMSA 1ZCZA 4M0MA 4GOKA 2P7IA 4IDQA 1VXOA 2HX1A 4E33A 2PJUA 3M4NA 3UHPA 1F14A 1ZK1A 3HBMA 5EMMA 2ODEA 3JW8A 3VDMA 2O7NA 4TSKA 1DO2A 2VHEA 4LYAA 4DC9A 3FCSB 4AXXA 3B38A 1WZEA 5LPNA 2FMKA 4C7VA 2C9YA 3GV0A 4WY2A 2OBNA 4P0QB 2WM9B 1L5VA 2AT1A 4EG4A 1O08A 1OU4A 2IYSA 4Y6OA 1YFZA 2PR2A 1DKPA 4Z3KA 3STTA 3G68A 5K9ZA 3U4IA 5CCBA 4R81A 4OXIA 3RPEA 1GNPA 2OZLA 4LCBA 2AR7A 3PWTA 4HEJA 5F23A 4LWQA 1CEQA 3OEEA 1YQXA 1W1IA 1Z35A 3A3PA 3EGOA 4J0FA 2LCIA 3UXMA 5AYVA 3FMFA 3KFLA 3W3AA 2DSNA 2QTFA 1Z12A 5I6DA 1KRWA 3INYA 4UCQA 3CNOA 1FTYA 3A06A 3M6FA 4UUQA 4XTRA 3P9RA 3SDBA 2IV3A 3TYXA 3NDJA 4AKHA 3KHUA 3NBFA 3DLCA 4F96A 1F7VA 2YWCA 4G5HA 2D6FA 3A1FA 4M38A 2G67A 1C9NA 1TCVA 3H6KA 3BREA 4BKRA 3KXKA 3EDMA 4O4HB 4OYHA 1ULBA 4EHBA 3OOHA 5GOTA 1JHVA 2VVTA 4F2GA 3I58A 2XUDA 2NZJA 3M5PA 1EAMA 1XRMA 2I65A 1NF2A 2RBGA 3U9LA 4IIHA 1H9BA 1GNTA 1YASA 1Z56C 3MELA 1XFAA 2HU7A 3DFKA 3OQIA 4TTPA 1FL9A 3RU3A 3IKTA 1R8YA 4IJ6A 3BDVA 2NZUG 3GCWA 4K3UA 4CKCB 2CWDA 4TYMA 2WD7A 3P4UA 3KQWA 4RKEA 5AK6A 5AM1A 1Y7TA 5B4UA 3P2JA 3KK0A 3NG1A 4JMPA 2A9OA 3SC3A 4XYMA 1T5DX 3M6WA 4YRRA 2QNIA 3PUKA 4MPDA 4OFZA 4TUYB 4YP9A 3SX0A 2P9ZA 1M8GA 5DVZA 2J0UB 3ZTYA 4D5EA 5L95A 3KV1A 4MB2A 6PFKA 4LNAA 2PQ6A 3B1YA 2ZUVA 4J0JA 3VTKA 3MT7A 5A7GA 3WQSB 3MTBA 1GRQA 3PI6A 5CXUA 4W1RA 2BM8A 2PL1A 3P45A 4G4SP 1HDRA 4PTLA 3CZMA 5DTMA 4CG0A 1FFBA 1RWMA 2XQFA 1J7KA 1QIDA 1NDUA 2R7AA 3R3JA 1WXWA 3M0EA 1VYVA 4AZVA 4BMNA 2OORA 2CJWA 2FP3A 3H2HA 1E0AA 3L18A 1RZRA 4NZ9A 3ZU3A 4DY6A 3NIFB 3UEOA 4LISA 1UL1X 3G5LA 2X1LA 4UZFA 3SFTA 3CCCA 3FG9A 4KN6A 2ZS9A 1CQJA 1XZNA 2IITA 4C22A 1LRJA 1KVSA 4EYEA 1Q3KA 1JLKA 1IWBB 2B8EA 4G5XA 4CW7A 3AIMA 2IYOA 3I2KA 3GZTB 3VVMA 2YFQA 2QQGA 1CTQA 2VP2A 4QHYA 5BW6B 1KWKA 3KVRA 4F3RA 3WGQA 1RRVA 4M1OA 1E5TA 2J0QA 1BX3A 1OI2A 1PQPA 4GG1A 2ZAYA 5KBYA 6NULA 4Z4GA 4CM8A 2AEEA 5A1TA 1MO5A 4HUQA 4Q7MB 3TNFA 5JQGA 2B1IA 4KN5A 4ARCA 3WGKA 2V98A 1BA2A 4OHXA 4RPKA 4YRIA 5B6JA 5JCZA 4QAJA 1Z0SA 5GONF 1PZEA 1FFCA 3NHUA 1NQUA 1VMEA 2X2OA 1E79A 1B43A 3PITA 1HC7A 1G8PA 4FMDF 1JDBC 1G7RA 4KPFC 4N03A 5CA1B 3AI3A 5LDDC 3G9ZA 4WBNA 4UUOA 1XTIA 5BUZA 1DKOA 1R00A 2XOKD 3CMMA 3AFHA 1ESCA 4KYVA 5ADVA 4MWGA 4CCSA 3BAZA 3SLRA 3U1VA 5GVSA 1BVHA 5C3MA 2GDJA 1BAPA 4QM6A 4EEZA 4Z4FA 1UIMA 3MHPA 4GVLA 4UHFA 3QLUC 4GDFA 2QVCA 4NECA 3ASUA 2ZETA 3HY3A 2FFRA 3T7IA 5A5FA 7AT1A 1S3IA 3L4SO 5LUAA 1YI1A 3ASZA 2PYIA 4EJFA 3CV3A 4GWKA 3WSTA 4JLBA 1DAFA 1J70A 1Y89A 3HFJA 4MRPA 5EUQB 2XYGA 1XKLA 3UCXA 4WKGA 3QE4A 5A4IS 4OHZA 1EUCA 1WD5A 5CP8A 4HNTA 4AY6A 1QH9A 4MR7A 1ZPDA 3P52A 2REBA 1U3WA 4IJ5A 4IOJA 1GZUA 3II6X 1D03A 1G3QA 3IEXA 2H2HA 1QK4A 3GRRA 3PBKA 3PUYA 4YRJA 4D8XA 3GNSA 3U16A 5K6AC 5C5IA 3BSSA 1TTPB 5BV1A 2Y68A 4U02A 2RHCA 2PZAA 3ANTA 1ZQ1A 2NYRA 3RBZA 3KQMA 4O2AB 3UUWA 4UUNA 5I7VA 3MLEA 3KETA 5FX2A 2FRVA 1FP6A 4LF8B 3LVRE 1RMYA 3EX7C 2NTVA 3PWSA 3F96A 3RE1A 2FPXA 2YASA 2ZAGA 3CO5A 3WLJA 3GX1A 4ALLA 4CF7A 4ZYYA 1YMUA 3UWSA 2G1UA 1ZBDA 2ZE7A 3AL3A 1YOVB 1BS2A 1QCDA 3C7DB 1E2GA 3CRRA 2G5GX 1N0VC 1ZXXA 3HH8A 4JB0A 4QGHA 3JXEA 3GLGE 4JJ4A 4E22A 2QJWA 2V4UA 1JFSA 2SHKA 2ZIXB 4ZGBA 4QDOA 1ULZA 3PLAE 3AY6A 5KNDH 3G0HA 1C80A 3W6UA 4IRUB 4IIGA 4MA4A 2AOTB 5EMLA 5AM3A 1C7EA 4ND7A 1H2BA 1W5EA 3C8MA 2YN0A 4JL5A 3NW9A 3NRJA 3PGA1 2W48A 3L8HA 3P8ZA 3JY6A 1CEEA 1QZUA 3NM4A 1BX0A 4TS1A 3TDMA 5T5QA 3ZHYA 3KOMA 4RFLA 4MEJA 3E9MA 2Z5GA 3COJA 5AKIA 1HKHA 1W8DA 1M67A 2IXTA 3H9UA 5IK2D 2MHCA 3NNDA 1O54A 3NIWA 4EPYA 1JVBA 1YTLA 1YL5A 3VR4A 1MR3F 1QGZA 3KLOA 4HPWA 4I7EA 4LECA 2LUOA 3C3EA 1RRKA 4Y0VA 4AULA 1J2JA 5KSOA 2ZBUA 3PWKA 4N7RA 4YJKA 5KNCH 2FOIA 2YV2A 4IH4A 3BQNB 4FSHA 2LNDA 1Z6TA 3JD3A 1P1CA 2YNMA 1Z5UA 3HVJA 3KJGA 4M53A 5ENZA 3FPLA 3T94A 3M83A 2KSQA 4YCLA 1CRPA 1T9KA 3I52A 5FPTA 3CVVA 1JHOA 2CFCA 5G0VA 1AQLA 2H1IA 4JEHA 3BTSA 3NEAA 4MW9A 4QHSA 4CTOA 1N5JA 1P7PA 4B4VA 1OT3A 3G0BA 3O0TA 4FNMA 4PCAA 1ZKDA 3O8BA 2BGMA 2GLTA 2QIOA 2ZSHA 1A76A 3BFPA 3R6GA 4WECA 5AHOA 2R7LA 4M1QA 2P62A 4LDRA 2UVDA 3E7WA 2N1MA 4XPZA 1IY2A 4XYEA 3M3DA 1RM5A 3T3MB 2PO5A 4RKYA 1ZJWA 1SVOA 1E3EA 2ONCA 2CJPA 4BQRA 3ID6C 1SIWA 4KXFB 2IWHA 4HN9A 3K16A 2K5UA 3C97A 4JBHA 4P54A 2Z5FA 1XSEA 1KSGA 1R4MA 4BB0A 1QK3A 4BNIA 2BFFA 2DFTA 2G9QA 4AT1A 5I7FA 5KSZA 3RF6A 1DCTA 3THOA 3HZHA 5E6SB 3N74A 4PC7A 5DTEA 1Q1ZA 3VKGA 3VI3B 3PGMA 5JAHA 5K3EA 5KJ1A 1JU3A 3MLAA 1WTAA 3OWXA 2QJOA 1FSSA 3IAAA 2X0FA 2QVXX 4DNQA 1E9FA 1CY2A 1EX1A 2XIJA 4LJ9A 4PANA 3PX7A 3ST7A 1ZD4A 1VI6A 4A2CA 4R9VA 5JY6A 2HCRA 2E5FA 1C4OA 2IX9A 4Y2SA 1SQFA 3TCXB 3AQ4A 4JNCA 1VPDA 3W2GA 4D26A 5AVQA 1YZQA 1Q91A 2H85A 2V1XA 3OMXA 3NZEA 2DFKB 3LU1A 2X4GA 4Q1BA 3AUAA 2Z1DA 2PUJA 1R9JA 3ETDA 3CINA 1IXSB 2N75A 2P5UA 4YXWD 5JZSA 4X91A 1RJDA 3IELA 4E5UA 2CXUA 2QAGA 1ABFA 1Z08A 1Z33A 4D8WA 4E5DA 5EXXA 2CSXA 3NV7A 5EIFA 4ZCLA 1M3SA 5GIPE 5A3SA 2Z95A 2IU6A 1VP9A 1U8ZA 2IDMA 4MQ6A 3NT2A 2JI8A 3ETHA 1YJQA 4G56A 1CQWA 4IDPA 1VTKA 4G0PA 4QNMA 3T5CA 3GT0A 1JH9A 2B4QA 3L0BA 5A4FS 3U4AA 1Q0PA 3DB2A 3VYUB 1PV1A 5FJJA 5F7JA 1ENOA 1PL7A 1VLLA 1AS3A 3LIIA 2JFVA 1JTFA 4PG8A 1RPTA 2OWDA 3R5KA 4MP8A 3MJRA 1N5DA 5JMTA 1G4UR 4GBED 3UY4A 2W11A 1GRRA 1PJ2A 2VT2A 2G04A 3NRBA 4KVFA 3OPVA 4MW6A 4OQYA 1NMEA 3PDCA 4QELA 3VC3A 4OAQA 3WWPA 4URWR 3TRKA 1MAAA 5DK6A 2XKKA 4GXQA 2DHEA 1T8TA 3DUFB 3ANSA 3VQTA 3G82C 2F1RA 3UGJA 5IASA 2ZM6B 4CEIB 2WSLA 2DU8A 5BN4B 2NACA 4Q03A 2WFLB 1KYVA 1HSZA 3DOUA 2XVXA 3ISTA 3AEQA 2AEJA 4ACAA 4G25A 1GG2A 1G8YA 1SZJG 3L6OO 1KY4A 4H7JA 4YPOA 1GCGA