1B0HA

Oligo-peptide binding protein complexed with lysyl-napthylalanyl-lysine
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 192
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b0hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b0hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b0hA02
3TPAA 1H43A 1O63A 2I3WA 3G3FA 3IOUA 4G68C 2DOJA 4Q0CA 3QUJA 4KYSA 5FHNA 3K6UA 4F22A 3ZS6A 4POXA 5DT6A 2Z8DA 2ONKE 3I3VA 3V89B 3PPNA 1IEJA 1RYOA 1B4HA 2AL5A 1URSA 4ECFA 3OENA 4QRZA 4N13A 3MUQA 5LOMA 3RNNA 3FXRA 3KOTA 3IB1A 3UA8A 3UP9A 3SESA 1N7WA 5DYHA 3W15C 5AA4A 4RK2A 5EHSA 4Z0IA 3T96B 3Q25A 3K00A 2XX7A 1RKMA 3K6VA 1FQAA 1B5IA 1MXUA 3OSQA 3EHSA 4ELQA 3O97A 2UVGA 3EN3A 1NNTA 3CFXA 4FORA 4LZ8A 1OVTA 2Y7KA 3VV5A 4NF8B 1HSJA 3O6IA 5DEXA 2XXXA 5TPAB 5ELVA 5CMCA 1IIWA 1NNPA 4POWA 4XKQA 4EXLA 4U4SA 1H76A 3BKIB 1BKAA 4BDNA 1O7TA 3TTNA 4R6YA 3OXNA 3RYBA 4FAJA 2QS3A 4X1DA 3OOAA 4NF4A 2Q2CA 3IJXB 1JVYA 5J1DA 4WEDA 3VXCA 2I4CA 1MXYA 5FTHA 1LB8A 2DWAA 3TTKA 5A5XA 3MP1A 4HCYA 1AOVA 4EQ9A 2ZYNA 3VXBA 1NH7A 1A99A 4RPOA 3IOVA 5K2XA 2B3FA 3FVGA 2D5WA 4IO4A 4JSOA 1B3EA 4ESXA 3TDJA 2OCUA 4KYDA 3PUWE 4GVOA 3TCHA 4F39A 2P2AA 2NWJA 2KLFA 1CB6A 3ONMA 4YKIA 3EHTA 1PEBA 4O3BA 1B6HA 4R9GA 3BFUA 1MDP1 2VOZA 4KCDA 1OQGA 2DS9A 2UVJA 1JETA 3F11A 4R73A 3U8QA 3TODA 2B3BA 1S7YA 5FHMA 4HS7A 1FTLA 1B3GA 2XXIA 1RYXA 1B46A 1SVXB 4TQUQ 1VE4A 1A55A 4M1VA 1GGGA 2V3UA 4ZS9A 4O3CA 1FTKA 3WAEA 4R6HA 3O2AA 4NF6A 1B1XA 3T9HB 3DM0A 3IORA 2Z22A 4GOTA 4F3GA 4R74A 4GRKA 3EPEA 2ESNA 1LFGA 3FASA 4F2QA 4YAHX 1B0LA 5AA4B 1LCFA 4THIA 3I5OA 3VVDA 2ZNTA 3N6UA 3QK6A 2F35A 3TFLA 4DE8A 4I1DA 3CG3A 4RK9A 2WKYA 2DQVA 5I2NB 3RQTA 4OENA 3K1NA 1FQEA 3MW0A 4QFLA 3N26A 3V8XB 3FIRA 1IUDA 1Y3PA 4H67A 2FNCA 4MH5A 1MQHA 3C35A 3TMGA 4IB2A 4QHQA 2UYEA 2V3TA 4F2OA 3OEMA 2AYSA 3EHUA 1IZ1A 5H8QA 1P1UA 4YB5A 2RINA 2F78A 3CRBA 1NFTA 5DVIA 1FCKA 1DPPA 4AB5A 3A09A 2XXWA 2WOKA 4GXSB 1SQYA 2Q9TA 3RN8A 2HAVA 2B4MA 4YICA 3PMXA 2Y7IA 4GFRA 4YB6A 4U1OA 4F3PA 5A5XB 1MG1A 2RKMA 3H6UA 2PT1A 1XS5A 3WAFA 2FA7A 4F18A 3MP8A 3PGFA 1IXIA 3I6VA 4FJPA 1EZ9A 5DTBA 3RY3A 2V93A 3G3KA 1DMBA 1JW5A 1EH3A 3MP6A 3IO4A 3THIA 4N07A 1YTVA 4Q5TA 1MPBA 3JYRA 2F6PA 3S4UA 5L9OA 3H3GA 2QS1A 4BLAA 1ANFA 1SW2A 2DVCA 3CHGA 1MXVA 3MZ1A 3SEYA 4R9FA 2RC9A 1MY0A 3PUYE 3PUZE 3PD9A 3HCQA 3AXFA 1S9TA 3VDFA 3QIMA 2NUVA 3OO6A 1DTGA 3H06B 3LSWA 3Q27A 1PB9A 2AL4A 2XXVA 1M5CA 1QVSA 3CI8A 3FVKA 4X1BA 1R1NA 4GL8A 3U94A 1FQDA 3RLFE 2D21A 4NF6B 4Q8RA 2W7YA 1MDQA 2THIA 3O29A 2O68A 1I6AA 1MM7A 4UACA 3ZKLA 3TTMA 3LSLA 3LSFB 2GRVA 4FEDA 1KWHA 2DWIA 2M8CA 4OFLA 4IY5A 3K1PA 4ELPA 1F9BA 1B0HA 1FW0A 4TLLB 1A40A 2RCAA 4FATA 2VD2A 4QF9A 4DLDA 4DZ1A 4LVQA 4NMYA 2VP1A 4WEPA 3FXUA 4PQJA 2XXHA 4H5GA 1OVBA 2DE2A 1D9VA 1TXFA 4ZEKA 2DE4A 2QSXA 4KFQA 3M3KA 1MM6A 3G3IA 3MJNA 3PUVE 1XT8A 3SEVA 3M3FA 5H8QB 4BDRA 1R9LA 4ESWA 3QYTA 1B1HA 4G8NA 2REGA 3FTOA 2X7QA 3LR1A 4TOZA 5AA1A 3H4ZA 3MAMA 1M5BA 4N6PA 2GH9A 1LAHE 1NH8A 3ODBA 2ONRA 5HPQA 1LFIA 3HPIA 4H5FA 1LCTA 1DPEA 4H0WA 3LBSA 1Y3NA 3VVEA 3FD3A 4NWCA 4GQOA 4F29A 5CBRA 3TTLA 1FQCA 4UA8A 1FTMA 2HFBA 3E9XA 3IJOB 4MBPA 1DTZA 2XXTA 1Y9UA 1URDA 3UK4A 1B5JA 3PUXE 4NTLA 5CM6A 4DXCA 3HSTA 1I6BA 5TP9A 2E1SA 4FECA 3UIFA 3FXQA 1IXGA 3A3CA 2HXWA 1IITA 4XTCQ 3T22A 2A5TB 1A7LA 3U92A 3RGYA 5EHMA 3PPOA 4F3SA 4I62A 3TAJA 4R72A 2CZLA 4OEUA 5L9SA 1B7HA 2F97A 4KHZE 1SW1A 3G3HA 1ZBMA 4DCYA 3DRJA 2Z8EA 5F1QA 4R2BA 2OJTA 3OO8A 1MRPA 3B6TA 1POTA 3UGWA 1MY2A 5I2NA 1PBPA 3Q28A 2XD3A 4EUOA 1B3HA 5K2YA 1QUKA 4EDPA 2DYXA 3GBBA 4H1XA 2HQ0A 1WVJA 3IOTA 4NWDA 4XXUA 4YB7A 2B4LA 5IKBA 4X9TA 3K1MA 3TCGA 4GF8A 3PV0E 5I59B 1SI1A 3VFJA 5FTIA 5I2KB 4BDOA 3PMVA 3BFTA 1GVCA 5EYFA 2DXYA 3MQ9A 4PFTA 3FV1A 4QSCA 3OMBA 5CRYA 1LBCA 4JWOA 1Y20A 5DVFA 3K6WA 2DSFA 2O7UA 2XXUA 1H45A 1VR5A 1LAGE 1AL3A 3MVXA 4RYAA 2PX1A 1OLCA 1N0TA 4BDQA 3SDFA 5CBSA 2WOLA 3RYAA 2QMWA 4LUBA 3IOWA 2Q2AA 5H8HA 3O28A 1US5A 1MPCA 4RA1A 4MLQA 3RT8A 4PETA 3C4MA 1NNKA 4OESA 1UTHA 1USYE 5I56B 2OK2A 3DP6A 1P1WA 5FHOA 3B6WA 1WDNA 1N76A 3W9VA 1N7XA 2HEUA 1SBPA 2V3QA 1XVYA 1N04A 1ATGA 1MQIA 1MY4A 4ZDMA 3H6TA 1AIVA 4F31B 1XC1A 1ZMGA 3FUZA 2ANJA 2F5XA 3DP8A 2VHAA 4ZZEA 1B52A 3S2VA 4ZE9A 2QS2A 3MVZA 5CMKA 1LBBA 5CMBA 3C32A 3KGCA 3B6QA 3L6HA 5TP9B 4GIZA 3C31A 3K6XA 4BDLA 4E0XA 1A8FA 4H8IA 3E4RA 1FQFA 4PFUA 2R9JA 5AA2A 1B58A 2PBWA 2REJA 5ISUA 3TQLA 5I58A 1MH3A 5TU0A 4DXBA 4WKMA 2Y7PA 4OZ9A 4LQ2A 4YKJA 2I0BA 1I6QA 1MY1A 1LAFE 4XKRA 4OMBA 3L6GA 3D4GA 1OMPA 1OIBA 4JXIA 3K2DA 4EXKA 3CSBA 2QMXA 4XKNA 4ELRA 2RC7A 4JBZA 2GFEA 3P7IA 5JEIA 2OLBA 4JWYA 1A8EA 2LAOA 4G77A 3CIJA 3B7DA 1FTOA 3VLWA 5L9MA 2O7IA 4BDMA 2X26A 4LZ7A 3H7MA 1GR2A 1B40A 4G8MA 3HO7A 2VD3A 2I48A 3MWBA 2X7PA 4LZ5A 2D3IA 1Y4CA 3VLVA 4RNSA 5H8FA 4IO7A 4U2RA 2H25A 1Z7NE 3FVNA 3ILUB 2RF1A 4JSDA 3OEKA 3SEXA 4WXJA 1MS7A 4LQ5A 1LAXA 2ALUA 2AIXA 3SKPA 3QUFA 2Q88A 2FYIA 3MZBA 3HN0A 3C33A 3BBRA 3UN6A 2HCAA 4IY6A 2VGQA 1M5DA 3IK6B 1P1QA 4MLVA 1MXXA 1VSOA 4GLIA 4EQBA 4ZEBA 5H8HB 2H4IA 3ECRA 1M5EA 4KQPA 1UTBA 1UTHB 1USYH 3H6WA 3SETA 3OO7A 2F7CA 2A5TA 3TKDA 3KEIA 3SERA 1MY3A 2QPQA 3U93A 2QS4A 1MXZA 2F7AA 2XXYA 2UVHA 1MPDA 3FV2A 4FEBA 1T0KA 4GXAA 3C34A 4G8HA 5I57A 4U22A 3D4CA 4QSDA 3PMWA 3PPRA 3PAMA 1NKXA 3O9PA 1JEVA 4Z7EA 2RC8A 4AQ4A 3C9HA 1ZJLA 3JV9A 2DP8A 2O69A 4OETA 4IO2A 2ZNSA 3IX1A 4I8CA 1D9YA 1Y1ZA 2ZXTA 5AA2B 5I58B 1D3KA 5I59A 1P99A 3TELA 4DXUA 1JEUA 1JW4A 4MF3A 5I2KA 1PDAA 1URGA 4IO3A 3USDA 4F19A 2OZZA 3KN7A 2CMOA 2I4BA 1Y4TA 2GHBA 4KCCA 4LA9A 1Y1MA 2ZYOA 4TLMB 2DWJA 2F6GA 1JW1A 4FE8A 2Q8JA 4IGTA 3KFMA 3DRFA 1HSLA 1BP5A 1B32A 4K3FA 1MQGA 4C1TA 1OLAA 2A5SA 2PMSA 3A3UA 2F7BA 1FTJA 4IO6A 3K02A 2HAUA 3C36A 4H65A 3GXAA 3MPKA 2XHDA 5I56A 4RXLA 4LATA 3R6UA 4P0GA 3TYHA 3R7XA 3T66A 2P1SA 5H8FB 2PT2A 5JTYA 4IO5A 1LSTA 1H44A 3DELB 3FJ7A 3S9MC 3KN8A 4GL0A 2YJPA 1D4NA 1WODA 1XOCA 1YAEA 4YKKA 3K01A 3JZJA 2HZLA 1EZOA 4QSEA 3U72A 2V25A 2O84X 2O51A 1B3LA 2DWHA 4KPTA 3VE1B 4XIGQ 4H8JA 1B4ZA 4DDDA 2XXQA 3V83A 1TWYA 1QUJA 4AB6A 3HHFA 4OQOA 1P1OA 1UTBB 4ELOA 1YCJA 5BWJA 2I49A 1A54A 4OTEA 2Y84A 1B3FA 4ZECA 2B65A 2I3VA 4GWOA 1B9JA 3HV1A 4QFOA 5L8DA 4NF5A 3IO6A 5BUUA 4YZZA 3DP4A 3GLBA 2I58A 3CG1A 4G68A 3TUSA 1SD3A 3PU5A 2HZKA 4PFWA 5I57B 3G7WA 1N3XA 3QXMA 5DVJA 1Q1KA 3OD7A 3RPWA 4U4XA 3N94A 3T9XB 1QKAA 1FQBA 2XX8A 3CSGA 4YMBA 4R75A 2YPNA 4YMAA 5HM4B 4M4GA 4U1ZA 1II5A 1PB7A 1Q35A 1Z7ME 4OVJA 5KCJA 2H5YA 1JVXA 4C0RA 4QFKA 3OELA 1R6ZA 2OBGA 3KOSA 4ZEDA 2NVUB 5F7VA 4DIGA 1I69A 1LLSA 2QJEA 1B5HA 4OXVA 3EQ1A 4O3AA 4OFOA 3T9VA 3O6GA 1R9QA 1PB8A 4JDFA 3OO9A 3O66A 2ABHA 5KDTA 3E13X 2Z8FA 4FIMA 1SI0A 2OWSA 2XXRA 3GBAA 5ITPA 1SYIA 4RY1A 1UIUA 4KI0E 1LB9A 2GHAA 2Z23A 3LSXA 3S9LC 3QSLA 1MQDA 3MPLA 4ZEIA 1JNFA 4ND9A 2F8DA 1XVXA 4KR5A 3CVGA 1H3DA 3EF7A 2E0SA 1NNFA 5JTYB 3M3LA 5B7DA 2R6GE 4U23A 1SDXA 2NOOA 3FJGA 3IB0A 3R26A 5ICTA 3PPQA 1GTKA 3UORA 1AH5A 4HTGA 3MVYA 2QRYA 2G93A 1VFEA 3KJTA 4KYEA 3M8UA 1SYHA 4PP0A 3IAZA 3RT6B 3T93B 3U1OA 5I84A 2YLNA 1B7UA 2UXAA 4ZEFA 1P1NA 5IAIA 2UVIA 4ZZAA 3N6TA 2Y7WA 3RUMA 2OWTA 3T9UA 1US4A 2Q89A 1UIVA 4ISUA 4NF5B 3GZGA 5JK4A 3V5AA 3CFZA 3TTRA 3K4UA 3FATA 4G68B 4P11A 3K0VA 2H9BA 3QAXA 3O6PA 3IB2A 2V84A 5B70A 1DOTA 1B05A 3N5LA 2H98A 1BIYA 3MZ9A 3KJ7A 3FJMA 2QL3A 1LFHA 2DXRA 1J1NA 2BJJX 3LC8A 5AA3A 5CMMA 3ILTB 3ZKKA 3CR9A 3LVUA 1YPNA 5KCJB 1LGBC 1BLFA 4MFIA 3CFLA 3HHGA 4X48A 2NXOA 1M5FA 3MBPA 5DEXB 4G4PA 5CC2A 1ZKBA 4EF1A 1VFDA 1BTJA 4NE4A 4U21A 2I0CA 1SW4A 2O1MA 4P0IA 4KD5A 1TFAA 4PFYA 2F36A 4XKPA 3KSJA 4NF4B 3DLNA 3G3GA 3PPPA 1MH4A 4NEDA 1QJMA 5KDTB 3LUYA 1EU8A 1MXWA 2XD2A 4F1YA 1TT1A 4OEVA 3KZGA 5ITOA 1SW5A 3TZAA 4EQ7A 1N84A 3MVWA 3Q29A 5H8NA 1QULA 3OSRA 3S9NC 1ZIUA 2IEEA 3W9WA 1QW0A 4DCXA 1B51A 5HBCA 5KZTA 4C1UA 1GV8A 1UQWA 2UYFA 4QFPA 3VVFA 1ZU0A 4H6DA 2RCBA 3SEWA 4QFNA 1B7ZA 3DRGA 2PYYA 4LP2B 1L5TA 1PBQA 4OERA 2G29A 4HW8A 3TCFA 2ZYKA 4G2ZA 4R6KA 3Q26A 3DRIA 1PC3A 4OHNA 5ICQA 2ZMBA 1XHYA 4LONB 3MC2A 3FGSA 3VLUA 1CE2A 1B2HA 1JQFA 1POY1 1MQJA 4EF2A 1DSNA 2WOPA 3TEPA 3FVOA 4F3BA 5M2VA 2P0SA 5H8SA 4NF8A 1IXHA 4RJZA 1NL5A 1AMFA 3O6HA 2Y7RA 5TPAA 2ZYMA 3H03A 2ONSA 1Y3QA 2DVZA 5CI5A 3RTFB 1QUIA 3DRKA 1ZLQA 4YU0A 2ZNUA 3KBRA 4I9DA 4OWDA 2I6EA 5AE4A 1S50A 3DRHA 2PVUA 3PD8A 1OQHA 1IQ7A 1QKBA 4L17A 1ZTYA 4OFJA 3TQWA 4OYVA 3FZVA 1N3WA 2O6AA 4GD5A 3KG2A 3RTWB 4JB7A 4F1UA 1IXCA 2F34A 3H6VA 4HCWA 3G3JA 2R71A 4F1VA 5AA2D 4PE5B 1HSEA 1NMUA 3IL1B 2DE3A 1TFDA 1O64A 3KN3A 3IR1A 3E3KA 3S9EA 1EZPA 2XX9A 4YKPA 4R2FA 4ONYA 4ZE8A 1ELJA 2O1LA 4IGRA 4Q30B 3KSXA 4JWXA 3ZSFA 4E0WA 3SEUA 2IA4A 2H99A 2XXPA 4RPNA 5H8NB
chains in the Genus database with same CATH superfamily
3TPAA 1H43A 4PAFA 1O63A 2I3WA 3G3FA 3IOUA 4G68C 2DOJA 4Q0CA 3SZPA 3QUJA 4KYSA 5FHNA 3NOHA 3K6UA 4F22A 3ZS6A 4POXA 5DT6A 2Z8DA 1LEVA 2ONKE 3T0JA 3I3VA 5EQ7A 3V89B 2XWIA 3PPNA 5IZ3A 1IEJA 1RYOA 1B4HA 2AL5A 1URSA 4ECFA 3OENA 4QRZA 4N13A 1NUWA 3MUQA 5LOMA 2L5VA 3RNNA 3FXRA 3KOTA 3IB1A 3UA8A 3SESA 3UP9A 1N7WA 5DYHA 3W15C 5IZZA 2KQZA 5AA4A 4RK2A 5EHSA 4Z0IA 3T96B 3Q25A 3K00A 2XX7A 1RKMA 3K6VA 1FQAA 1B5IA 1FBGA 1MXUA 1FPBA 1FTAA 3OSQA 2VPOA 3EHSA 4ELQA 3O97A 2UVGA 3EN3A 1NNTA 3CFXA 4FORA 4LZ8A 1OVTA 2Y7KA 3VV5A 2KR0A 4XFEA 4P56A 4NF8B 3FXBA 4H46A 4PGNA 1HSJA 3O6IA 4PBQA 5DEXA 2XXXA 5TPAB 5ELVA 5CMCA 4MX6A 1IIWA 1NNPA 4POWA 4XKQA 4EXLA 4U4SA 1H76A 3BKIB 1BKAA 4BDNA 1NI9A 1O7TA 3TTNA 3QMFA 4R6YA 4MAGA 3OXNA 3RYBA 4FAJA 2QS3A 4NF4A 3OOAA 4X1DA 2Q2CA 3IJXB 1CNQA 1JVYA 5J1DA 4WEDA 1NV5A 3VXCA 2QFLA 2I4CA 1MXYA 5FTHA 1LB8A 2DWAA 3TTKA 5A5XA 3MP1A 4HCYA 1AOVA 4EQ9A 4GWWA 1QGXA 2ZYNA 3VXBA 1NH7A 1A99A 1XI6A 4RPOA 3IOVA 5I7IA 5K2XA 2B3FA 3FVGA 2D5WA 4IO4A 4JSOA 2QVUA 1B3EA 4ESXA 3TDJA 2OCUA 4KYDA 3PUWE 4P8BA 4GVOA 3TCHA 4GWUA 4F39A 2P2AA 3HFUA 2NWJA 2KLFA 1CB6A 3RPLA 3ONMA 4YKIA 1LBYA 3EHTA 5EQ9A 1PEBA 3ROJA 4O3BA 1B6HA 4R9GA 3BFUA 1MDP1 2VOZA 4KCDA 1OQGA 2DS9A 1NV6A 4O7MA 2UVJA 1JETA 3F11A 4R73A 2Y5KA 3U8QA 3TODA 2B3BA 2PFYA 1S7YA 5FHMA 4HS7A 1FTLA 4HE2A 1B3GA 2XXIA 1RYXA 1K9ZA 1B46A 1SVXB 4TQUQ 4N81A 1VE4A 1A55A 4M1VA 1GGGA 2V3UA 4ZS9A 4PFIA 4O3CA 1FTKA 5LDZA 4GWYA 5IZ3B 3WAEA 4NAPA 4R6HA 3O2AA 4NF6A 1B1XA 3T9HB 3DM0A 3IORA 2Z22A 4GOTA 1FPIA 4F3GA 1LBVA 4R74A 4GRKA 3EPEA 2FIXA 2ESNA 1LFGA 1RDYA 3FASA 4F2QA 2HPGA 4YAHX 1B0LA 5AA4B 3MSTA 1LCFA 4THIA 3I5OA 3VVDA 2ZNTA 3N6UA 3QK6A 2F35A 3TFLA 4IR8A 4DE8A 4I1DA 3CG3A 4RK9A 2WKYA 2JJKA 4JVDA 4KXPA 2DQVA 5I2NB 3RQTA 1FJ9A 4OENA 3K1NA 1FQEA 3MW0A 4QFLA 3N26A 3V8XB 3FIRA 1IUDA 1Y3PA 4OA4A 4H67A 2FNCA 4MH5A 1MQHA 3C35A 4GX3A 4IB2A 4MHFA 4QHQA 3TMGA 2UYEA 1FPGA 2R8TA 1FBFA 2V3TA 4F2OA 5EQAA 3OEMA 2AYSA 1VDWA 3EHUA 1IZ1A 5H8QA 1P1UA 4YB5A 1NV4A 2RINA 2F78A 3CRBA 1NFTA 3MYUA 5DVIA 1FCKA 1DPPA 4AB5A 3A09A 2XXWA 2WOKA 4GXSB 1SQYA 2Q9TA 3RN8A 2HAVA 4I3EA 2B4MA 4YICA 3PMXA 2Y7IA 4GFRA 4YB6A 4U1OA 4F3PA 5A5XB 1MG1A 2RKMA 4N6KA 3H6UA 2PT1A 1XS5A 4N6DA 3WAFA 3KBZA 2FA7A 4F18A 3MP8A 3PGFA 1IXIA 3I6VA 4FJPA 1EZ9A 5DTBA 3RY3A 2V93A 3G3KA 1DMBA 2OWZA 1JW5A 1EH3A 3MP6A 3IO4A 3THIA 2PFZA 1YYZA 4N07A 1YTVA 4Q5TA 1MPBA 3RPLB 3JYRA 2F6PA 3S4UA 5L9OA 3H3GA 2QS1A 4PGPA 4BLAA 1ANFA 1SW2A 2DVCA 3CHGA 1MXVA 3MZ1A 3SEYA 4R9FA 2RC9A 1MY0A 3PUYE 3PUZE 2WYKA 3PD9A 3HCQA 1FBPA 3AXFA 1S9TA 3VDFA 3QIMA 2NUVA 3OO6A 1DTGA 3H06B 3LSWA 3Q27A 1PB9A 2AL4A 2XXVA 1M5CA 1QVSA 3CI8A 3FVKA 2DDKA 4LN5A 4X1BA 1R1NA 4GL8A 3U94A 1FQDA 3RLFE 1NV1A 3E79A 2D21A 4NF6B 4Q8RA 2W7YA 1MDQA 2THIA 3O29A 2O68A 1I6AA 3EKIA 1MM7A 4UACA 3ZKLA 3TTMA 4X04A 3LSLA 3LSFB 2GRVA 4FEDA 1KWHA 2DWIA 1FPDA 2M8CA 4PC9A 4HE0A 4OFLA 4GWZA 4IY5A 3K1PA 4ELPA 1F9BA 4QXDA 1B0HA 1FW0A 4TLLB 1A40A 2OX3A 2RCAA 4FATA 4MNIA 2VD2A 4QF9A 2XXKA 4DLDA 4DZ1A 1NUXA 4LVQA 4NMYA 2Q8MA 2VP1A 4WEPA 3FXUA 4PQJA 2XA5A 2XXHA 2VPNA 4H5GA 1OVBA 2DE2A 1D9VA 4AS5A 1TXFA 4ZEKA 2DE4A 2QSXA 4KFQA 3M3KA 1MM6A 3G3IA 3MJNA 3PUVE 1KA1A 1XT8A 3SEVA 3M3FA 2FHYA 5H8QB 4BDRA 1R9LA 4ESWA 3QYTA 1B1HA 4G8NA 4HE1A 2REGA 3FTOA 2X7QA 3LR1A 4TOZA 5AA1A 3H4ZA 3MAMA 1M5BA 4N6PA 2GH9A 1LAHE 1NH8A 2CEYA 4GWSA 3ODBA 2ONRA 5HPQA 1IMDA 1LFIA 3HPIA 4H5FA 1LCTA 1DPEA 4H0WA 3LBSA 1Y3NA 3VVEA 3FD3A 4NWCA 4GQOA 4F29A 5CBRA 3TTLA 1FQCA 2ZZWA 4DI3D 4UA8A 1FTMA 2HFBA 3E9XA 1NV7A 1FBDA 3IJOB 4MBPA 1DTZA 2XXTA 1Y9UA 4P47A 1URDA 3UK4A 1B5JA 3PUXE 4NTLA 5CM6A 4XEQA 4DXCA 3HSTA 4PAKA 1I6BA 2XWVA 5TP9A 3FBPA 2E1SA 4FECA 3UIFA 3FXQA 4I3YA 5A5LA 1IXGA 3A3CA 2HXWA 1FJ6A 1IITA 4XTCQ 3T22A 2A5TB 1A7LA 3U92A 3RGYA 5EHMA 3PPOA 4I62A 4F3SA 3TAJA 4R72A 2CZLA 4OEUA 5L9SA 1B7HA 2F97A 4KHZE 1SW1A 3G3HA 1ZBMA 4DCYA 3DRJA 2Z8EA 5F1QA 2OJTA 3OO8A 4R2BA 1MRPA 3B6TA 1POTA 3UGWA 1MY2A 5I2NA 1PBPA 3Q28A 2XD3A 4EUOA 1B3HA 3E78A 5K2YA 1QUKA 4EDPA 2DYXA 1IMCA 3GBBA 4H1XA 2HQ0A 1WVJA 3IOTA 4NWDA 4XXUA 4YB7A 2B4LA 5IKBA 4X9TA 2WBDA 3K1MA 3TCGA 4GF8A 3PV0E 3B50A 5I59B 4NQ8A 3ISPA 1SI1A 3VFJA 5FTIA 5I2KB 4BDOA 3PMVA 3BFTA 1RDXA 1GVCA 5EYFA 2DXYA 3MQ9A 4PFTA 3FV1A 4QSCA 1NV3A 3OMBA 5CRYA 1LBCA 2CZIA 4JWOA 1Y20A 5DVFA 3K6WA 2DSFA 2O7UA 2XXUA 1H45A 1VR5A 1LAGE 1AL3A 3D1RA 3MVXA 4RYAA 2PX1A 1OLCA 1N0TA 4BDQA 4PFRA 3SDFA 2WOLA 3RYAA 5CBSA 4OVRA 2QMWA 4LUBA 3IOWA 4NG7A 2Q2AA 5H8HA 3O28A 1US5A 1MPCA 4RA1A 4MLQA 3RT8A 4PETA 3C4MA 4OESA 1NNKA 1UTHA 1USYE 4MNPA 5I56B 1NV2A 2OK2A 5ET6A 3DP6A 1P1WA 4GX4A 5FHOA 3B6WA 1WDNA 1N76A 3W9VA 1N7XA 2HEUA 1SBPA 5ET8A 2V3QA 4MEVA 1XVYA 1N04A 1ATGA 1KZ8A 1MQIA 5DW8A 1MY4A 4ZDMA 3H6TA 3GYYA 1AIVA 4F31B 1XC1A 5LTCA 1ZMGA 3FUZA 2ANJA 2F5XA 3DP8A 2VHAA 2MKZA 4ZZEA 4N17A 1B52A 3S2VA 4ZE9A 2QS2A 3MVZA 5CMKA 1LBBA 5CMBA 3C32A 1FBHA 3KGCA 3B6QA 3L6HA 5TP9B 4GIZA 3C31A 1DK4A 3K6XA 4BDLA 4X8RA 4E0XA 1A8FA 4H8IA 1FBEA 3E4RA 1FQFA 4PFUA 2R9JA 1EYJA 5AA2A 1B58A 2PBWA 2REJA 5ISUA 3TQLA 5I58A 1MH3A 2Q74A 2CZKA 5TU0A 1FPFA 4DXBA 4WKMA 2Y7PA 4OZ9A 2WBBA 2ZZXA 4LQ2A 4YKJA 2I0BA 1I6QA 1MY1A 1LAFE 4XKRA 4OMBA 3L6GA 3D4GA 1OMPA 1OIBA 4JXIA 3K2DA 4EXKA 3CSBA 4PBHA 2CZHA 2QMXA 4XKNA 4ELRA 5T3JA 2RC7A 4JBZA 2GFEA 4PFBA 3P7IA 5JEIA 2OLBA 4JWYA 5FBPA 1A8EA 2LAOA 4G77A 2QVVA 3B7DA 3CIJA 1FTOA 3VLWA 5L9MA 2O7IA 4BDMA 2X26A 4LZ7A 3H7MA 1GR2A 1B40A 4G8MA 3HO7A 2VD3A 2I48A 5I5PA 3MWBA 4O94A 2X7PA 4LZ5A 2D3IA 1Y4CA 3VLVA 4RNSA 5H8FA 4IO7A 4U2RA 4N8GA 2H25A 1Z7NE 3FVNA 3ILUB 2RF1A 4JSDA 3OEKA 1NUYA 3SEXA 4WXJA 1MS7A 4LQ5A 2QVRA 4H45A 1FPEA 1LAXA 1FPLA 2ALUA 3U65A 2AIXA 3SKPA 3QUFA 2Q88A 4MMPA 2FYIA 3MZBA 3HN0A 3C33A 3BBRA 3UN6A 2HCAA 4IY6A 2VGQA 1M5DA 3IK6B 4PF6A 1P1QA 4MLVA 1MXXA 1VSOA 4GLIA 4EQBA 4ZEBA 5H8HB 3IFAA 2H4IA 3ECRA 4NGUA 1EYIA 4OVQA 1M5EA 4KQPA 1UTBA 1UTHB 1USYH 3H6WA 3SETA 3OO7A 2F7CA 5EQ8A 4I40A 3RYDA 2A5TA 3TKDA 3KEIA 3SERA 1MY3A 2QPQA 3U93A 2QS4A 1MXZA 2Y5LA 2F7AA 2XXYA 2UVHA 1MPDA 4MCOA 3FV2A 4FEBA 1T0KA 4UABA 4GXAA 3C34A 4G8HA 4FBPA 5I57A 4U22A 3D4CA 4QSDA 3PMWA 3PPRA 3PAMA 1NKXA 4N91A 3O9PA 1JEVA 4Z7EA 2RC8A 4AQ4A 3C9HA 1ZJLA 3A29A 3JV9A 2DP8A 2O69A 4OETA 4IO2A 2ZNSA 3IX1A 4I8CA 1D9YA 4PDHA 1Y1ZA 2ZXTA 1RDZA 5AA2B 5I58B 1D3KA 5I59A 1P99A 3TELA 4DXUA 4OANA 1JEUA 1JW4A 4MF3A 5I2KA 1PDAA 1URGA 4IO3A 2XWOA 3USDA 4F19A 2OZZA 3KN7A 1D9QA 2CMOA 2I4BA 1Y4TA 2GHBA 4KCCA 4LA9A 1Y1MA 2ZYOA 4TLMB 2DWJA 2F6GA 1JW1A 4FE8A 5EYHA 2Q8JA 4IGTA 2XWKA 3KFMA 3DRFA 5IGAA 1HSLA 5IZ1A 1BP5A 1B32A 4K3FA 1MQGA 4C1TA 1OLAA 2A5SA 2PMSA 3A3UA 2F7BA 4N8YA 1FTJA 4IO6A 3K02A 2HAUA 3C36A 4H65A 3GXAA 3MPKA 2VT5A 4PAIA 2XHDA 4GBWA 5I56A 4RXLA 2F3DA 4LATA 3R6UA 4P0GA 3TYHA 3R7XA 3T66A 2P1SA 5H8FB 2PT2A 5JTYA 4IO5A 1LSTA 1IMAA 1H44A 3DELB 3FJ7A 4O8MA 3S9MC 3KN8A 4GL0A 4P1LA 2YJPA 1D4NA 1WODA 1XOCA 1YAEA 4YKKA 3K01A 3JZJA 2HZLA 1EZOA 4QSEA 3U72A 2V25A 2O84X 2O51A 1B3LA 2DWHA 4KPTA 3VE1B 4MNCA 4XIGQ 4H8JA 1B4ZA 4DDDA 2XXQA 3V83A 1TWYA 1QUJA 4AB6A 3HHFA 4OQOA 1P1OA 1UTBB 4ELOA 5J16A 1YCJA 5BWJA 2I49A 1A54A 4OTEA 2Y84A 1B3FA 4ZECA 2B65A 2I3VA 4GWOA 1B9JA 3HV1A 4QFOA 5L8DA 4NF5A 3IO6A 5BUUA 4YZZA 3DP4A 3GLBA 2I58A 3CG1A 4G68A 3TUSA 2P3NA 1SD3A 3PU5A 2HZKA 4PFWA 5I57B 3G7WA 4JVIA 1N3XA 4OVSA 3QXMA 5DVJA 1Q1KA 3OD7A 3RPWA 4U4XA 3N94A 3T9XB 1QKAA 1FQBA 2XX8A 3CSGA 2V4CA 4YMBA 2BJIA 4R75A 2YPNA 4YMAA 1FPJA 5HM4B 4M4GA 4U1ZA 1II5A 1PB7A 1Q35A 1Z7ME 4OVJA 5KCJA 2H5YA 4MJOA 1BK4A 1JVXA 4C0RA 4QFKA 3OELA 1R6ZA 2OBGA 1K9YA 3KOSA 4ZEDA 2NVUB 5F7VA 4DIGA 1I69A 1LLSA 2QJEA 1B5HA 4OXVA 3EQ1A 4O3AA 5ET5A 4OFOA 3T9VA 3O6GA 1R9QA 1PB8A 4JDFA 3T1BA 3OO9A 3O66A 2ABHA 1YZ0A 5KDTA 4AS4A 3E13X 2Z8FA 4FIMA 1SI0A 2OWSA 2XXRA 3GBAA 5ITPA 1SYIA 4RY1A 1UIUA 3KC0A 4KI0E 1LB9A 2GHAA 1FRPA 2Z23A 3LSXA 3S9LC 3QSLA 1MQDA 3MPLA 4ZEIA 1JNFA 4ND9A 1INPA 2F8DA 5I3SA 1XVXA 5EYGA 4KR5A 3CVGA 1H3DA 2WYPA 1LBZA 3EF7A 2WX9A 2E0SA 1NNFA 5JTYB 3M3LA 2GQ1A 5B7DA 2R6GE 4U23A 1SDXA 2NOOA 3FJGA 2HHMA 3IB0A 3R26A 5ICTA 1IMBA 4PE3A 3PPQA 1GTKA 3UORA 2FBPA 1AH5A 4HTGA 3MVYA 1IMEA 2QRYA 2G93A 1VFEA 3KJTA 4KYEA 3M8UA 1SYHA 4PP0A 3IAZA 3RT6B 3T93B 3U1OA 5I84A 2YLNA 1B7UA 2UXAA 4ZEFA 1P1NA 5IAIA 2UVIA 1KA0A 4ZZAA 3N6TA 2Y7WA 3RUMA 2OWTA 3T9UA 1US4A 2Q89A 1UIVA 4ISUA 4P9KA 1LBXA 4NF5B 3GZGA 5JK4A 3B8BA 2HXRA 3V5AA 3CFZA 3TTRA 3K4UA 3FATA 4G68B 4OVPA 1AWBA 4P11A 3K0VA 2ZZVA 2H9BA 3QAXA 3O6PA 3IB2A 2V84A 5B70A 1DOTA 1B05A 3N5LA 2H98A 1BIYA 3MZ9A 4GWXA 3KJ7A 5ET7A 3FJMA 2QL3A 1LFHA 2DXRA 5ESYA 1J1NA 1SPIA 2BJJX 3LC8A 5AA3A 5CMMA 3ILTB 4N15A 3ZKKA 3CR9A 3LVUA 1LBWA 1YPNA 5KCJB 1LGBC 1BLFA 4MFIA 3CFLA 3HHGA 4X48A 2NXOA 1M5FA 3MBPA 4PCDA 4GBVA 5DEXB 1EYKA 4G4PA 5CC2A 4O7IA 1ZKBA 4EF1A 1VFDA 1BTJA 4NE4A 4U21A 2I0CA 1SW4A 2O1MA 4P0IA 4KD5A 1TFAA 4PFYA 2F36A 4XKPA 3KSJA 4NF4B 3DLNA 3G3GA 3PPPA 1MH4A 2WEFA 4NEDA 1QJMA 5KDTB 1G0IA 3LUYA 1EU8A 1MXWA 2XD2A 4F1YA 1TT1A 4OEVA 3KZGA 4DI4B 5ITOA 1FBCA 1SW5A 3TZAA 1N84A 4EQ7A 3MVWA 3Q29A 5H8NA 1QULA 3OSRA 3S9NC 1ZIUA 2IEEA 3W9WA 1QW0A 4DCXA 1B51A 5HBCA 5KZTA 4C1UA 1GV8A 1UQWA 2UYFA 4QFPA 3VVFA 1ZU0A 4H6DA 2RCBA 3SEWA 3BIHA 4P3LA 4QFNA 1B7ZA 3DRGA 2PYYA 4LP2B 1L5TA 1PBQA 4OERA 2G29A 5IM2A 4HW8A 2PCRA 3TCFA 2ZYKA 5F24A 4G2ZA 4R6KA 3Q26A 4PDDA 3DRIA 1PC3A 4OHNA 5ICQA 2ZMBA 1XHYA 3KC1A 4LONB 3MC2A 3FGSA 1IMFA 3VLUA 3LUZA 1DBZA 4HXVA 4JVCA 1CE2A 1B2HA 1JQFA 4NHBA 1POY1 1MQJA 4EF2A 1Q9DA 4PTKA 1DSNA 2WOPA 3TEPA 3FVOA 4F3BA 1DCUA 5M2VA 1G0HA 2P0SA 5H8SA 4NF8A 1IXHA 2P3VA 1NV0A 4RJZA 1NL5A 1AMFA 3O6HA 2Y7RA 5TPAA 2ZYMA 3H03A 4P1EA 2ONSA 1Y3QA 2DVZA 5CI5A 1FSAA 3RTFB 1NUZA 3DRKA 1QUIA 1ZLQA 4YU0A 2ZNUA 3KBRA 4I9DA 4OWDA 4N4UA 2I6EA 5AE4A 1S50A 4NF0A 3DRHA 2PVUA 3PD8A 1OQHA 1IQ7A 1QKBA 4L17A 3PTYA 2FIEA 1ZTYA 4OFJA 4PF8A 3TQWA 4OYVA 2F3BA 4GX6A 1JP4A 3FZVA 2FVZA 1N3WA 2O6AA 4GD5A 3KG2A 4OVTA 3RTWB 4JB7A 4F1UA 1IXCA 2F34A 2CEXA 3H6VA 3BIGA 4HCWA 3G3JA 2R71A 3LV0A 4NN3A 4F1VA 5AA2D 4PE5B 1HSEA 1NMUA 3IL1B 2DE3A 1TFDA 1YXIA 1O64A 3KN3A 3IR1A 3E3KA 3S9EA 1EZPA 2XX9A 1FPKA 4YKPA 4R2FA 4ONYA 4MIJA 4ZE8A 1ELJA 2O1LA 4IGRA 4Q30B 3KSXA 4JWXA 3ZSFA 4E0WA 4NX1A 3SEUA 3IFCA 4QBAA 4G61A 2IA4A 4XF5A 2H99A 2XXPA 4RPNA 5H8NB
chains in the Genus database with same CATH topology
3TPAA 1H43A 1O63A 2I3WA 3G3FA 3IOUA 4G68C 2DOJA 4Q0CA 3QUJA 4KYSA 5FHNA 3K6UA 4F22A 3ZS6A 4POXA 5DT6A 2Z8DA 2ONKE 3I3VA 3V89B 3PPNA 1IEJA 1RYOA 1B4HA 2AL5A 1URSA 4ECFA 3OENA 4QRZA 4N13A 3MUQA 5LOMA 3RNNA 3FXRA 3KOTA 3IB1A 3UA8A 3UP9A 3SESA 1N7WA 5DYHA 3W15C 5AA4A 4RK2A 5EHSA 4Z0IA 3T96B 3Q25A 3K00A 2XX7A 1RKMA 3K6VA 1FQAA 1B5IA 1MXUA 3OSQA 3EHSA 4ELQA 3O97A 2UVGA 3EN3A 1NNTA 3CFXA 4FORA 4LZ8A 1OVTA 2Y7KA 3VV5A 4NF8B 1HSJA 3O6IA 5DEXA 2XXXA 5TPAB 5ELVA 5CMCA 1IIWA 1NNPA 4POWA 4XKQA 4EXLA 4U4SA 1H76A 3BKIB 1BKAA 4BDNA 1O7TA 3TTNA 4R6YA 3OXNA 3RYBA 4FAJA 2QS3A 4X1DA 3OOAA 4NF4A 2Q2CA 3IJXB 1JVYA 5J1DA 4WEDA 3VXCA 2I4CA 1MXYA 5FTHA 1LB8A 2DWAA 3TTKA 5A5XA 3MP1A 4HCYA 1AOVA 4EQ9A 2ZYNA 3VXBA 1NH7A 1A99A 4RPOA 3IOVA 5K2XA 2B3FA 3FVGA 2D5WA 4IO4A 4JSOA 1B3EA 4ESXA 3TDJA 2OCUA 4KYDA 3PUWE 4GVOA 3TCHA 4F39A 2P2AA 2NWJA 2KLFA 1CB6A 3ONMA 4YKIA 3EHTA 1PEBA 4O3BA 1B6HA 4R9GA 3BFUA 1MDP1 2VOZA 4KCDA 1OQGA 2DS9A 2UVJA 1JETA 3F11A 4R73A 3U8QA 3TODA 2B3BA 1S7YA 5FHMA 4HS7A 1FTLA 1B3GA 2XXIA 1RYXA 1B46A 1SVXB 4TQUQ 1VE4A 1A55A 4M1VA 1GGGA 2V3UA 4ZS9A 4O3CA 1FTKA 3WAEA 4R6HA 3O2AA 4NF6A 1B1XA 3T9HB 3DM0A 3IORA 2Z22A 4GOTA 4F3GA 4R74A 4GRKA 3EPEA 2ESNA 1LFGA 3FASA 4F2QA 4YAHX 1B0LA 5AA4B 1LCFA 4THIA 3I5OA 3VVDA 2ZNTA 3N6UA 3QK6A 2F35A 3TFLA 4DE8A 4I1DA 3CG3A 4RK9A 2WKYA 2DQVA 5I2NB 3RQTA 4OENA 3K1NA 1FQEA 3MW0A 4QFLA 3N26A 3V8XB 3FIRA 1IUDA 1Y3PA 4H67A 2FNCA 4MH5A 1MQHA 3C35A 3TMGA 4IB2A 4QHQA 2UYEA 2V3TA 4F2OA 3OEMA 2AYSA 3EHUA 1IZ1A 5H8QA 1P1UA 4YB5A 2RINA 2F78A 3CRBA 1NFTA 5DVIA 1FCKA 1DPPA 4AB5A 3A09A 2XXWA 2WOKA 4GXSB 1SQYA 2Q9TA 3RN8A 2HAVA 2B4MA 4YICA 3PMXA 2Y7IA 4GFRA 4YB6A 4U1OA 4F3PA 5A5XB 1MG1A 2RKMA 3H6UA 2PT1A 1XS5A 3WAFA 2FA7A 4F18A 3MP8A 3PGFA 1IXIA 3I6VA 4FJPA 1EZ9A 5DTBA 3RY3A 2V93A 3G3KA 1DMBA 1JW5A 1EH3A 3MP6A 3IO4A 3THIA 4N07A 1YTVA 4Q5TA 1MPBA 3JYRA 2F6PA 3S4UA 5L9OA 3H3GA 2QS1A 4BLAA 1ANFA 1SW2A 2DVCA 3CHGA 1MXVA 3MZ1A 3SEYA 4R9FA 2RC9A 1MY0A 3PUYE 3PUZE 3PD9A 3HCQA 3AXFA 1S9TA 3VDFA 3QIMA 2NUVA 3OO6A 1DTGA 3H06B 3LSWA 3Q27A 1PB9A 2AL4A 2XXVA 1M5CA 1QVSA 3CI8A 3FVKA 4X1BA 1R1NA 4GL8A 3U94A 1FQDA 3RLFE 2D21A 4NF6B 4Q8RA 2W7YA 1MDQA 2THIA 3O29A 2O68A 1I6AA 1MM7A 4UACA 3ZKLA 3TTMA 3LSLA 3LSFB 2GRVA 4FEDA 1KWHA 2DWIA 2M8CA 4OFLA 4IY5A 3K1PA 4ELPA 1F9BA 1B0HA 1FW0A 4TLLB 1A40A 2RCAA 4FATA 2VD2A 4QF9A 4DLDA 4DZ1A 4LVQA 4NMYA 2VP1A 4WEPA 3FXUA 4PQJA 2XXHA 4H5GA 1OVBA 2DE2A 1D9VA 1TXFA 4ZEKA 2DE4A 2QSXA 4KFQA 3M3KA 1MM6A 3G3IA 3MJNA 3PUVE 1XT8A 3SEVA 3M3FA 5H8QB 4BDRA 1R9LA 4ESWA 3QYTA 1B1HA 4G8NA 2REGA 3FTOA 2X7QA 3LR1A 4TOZA 5AA1A 3H4ZA 3MAMA 1M5BA 4N6PA 2GH9A 1LAHE 1NH8A 3ODBA 2ONRA 5HPQA 1LFIA 3HPIA 4H5FA 1LCTA 1DPEA 4H0WA 3LBSA 1Y3NA 3VVEA 3FD3A 4NWCA 4GQOA 4F29A 5CBRA 3TTLA 1FQCA 4UA8A 1FTMA 2HFBA 3E9XA 3IJOB 4MBPA 1DTZA 2XXTA 1Y9UA 1URDA 3UK4A 1B5JA 3PUXE 4NTLA 5CM6A 4DXCA 3HSTA 1I6BA 5TP9A 2E1SA 4FECA 3UIFA 3FXQA 1IXGA 3A3CA 2HXWA 1IITA 4XTCQ 3T22A 2A5TB 1A7LA 3U92A 3RGYA 5EHMA 3PPOA 4F3SA 4I62A 3TAJA 4R72A 2CZLA 4OEUA 5L9SA 1B7HA 2F97A 4KHZE 1SW1A 3G3HA 1ZBMA 4DCYA 3DRJA 2Z8EA 5F1QA 4R2BA 2OJTA 3OO8A 1MRPA 3B6TA 1POTA 3UGWA 1MY2A 5I2NA 1PBPA 3Q28A 2XD3A 4EUOA 1B3HA 5K2YA 1QUKA 4EDPA 2DYXA 3GBBA 4H1XA 2HQ0A 1WVJA 3IOTA 4NWDA 4XXUA 4YB7A 2B4LA 5IKBA 4X9TA 3K1MA 3TCGA 4GF8A 3PV0E 5I59B 1SI1A 3VFJA 5FTIA 5I2KB 4BDOA 3PMVA 3BFTA 1GVCA 5EYFA 2DXYA 3MQ9A 4PFTA 3FV1A 4QSCA 3OMBA 5CRYA 1LBCA 4JWOA 1Y20A 5DVFA 3K6WA 2DSFA 2O7UA 2XXUA 1H45A 1VR5A 1LAGE 1AL3A 3MVXA 4RYAA 2PX1A 1OLCA 1N0TA 4BDQA 3SDFA 5CBSA 2WOLA 3RYAA 2QMWA 4LUBA 3IOWA 2Q2AA 5H8HA 3O28A 1US5A 1MPCA 4RA1A 4MLQA 3RT8A 4PETA 3C4MA 1NNKA 4OESA 1UTHA 1USYE 5I56B 2OK2A 3DP6A 1P1WA 5FHOA 3B6WA 1WDNA 1N76A 3W9VA 1N7XA 2HEUA 1SBPA 2V3QA 1XVYA 1N04A 1ATGA 1MQIA 1MY4A 4ZDMA 3H6TA 1AIVA 4F31B 1XC1A 1ZMGA 3FUZA 2ANJA 2F5XA 3DP8A 2VHAA 4ZZEA 1B52A 3S2VA 4ZE9A 2QS2A 3MVZA 5CMKA 1LBBA 5CMBA 3C32A 3KGCA 3B6QA 3L6HA 5TP9B 4GIZA 3C31A 3K6XA 4BDLA 4E0XA 1A8FA 4H8IA 3E4RA 1FQFA 4PFUA 2R9JA 5AA2A 1B58A 2PBWA 2REJA 5ISUA 3TQLA 5I58A 1MH3A 5TU0A 4DXBA 4WKMA 2Y7PA 4OZ9A 4LQ2A 4YKJA 2I0BA 1I6QA 1MY1A 1LAFE 4XKRA 4OMBA 3L6GA 3D4GA 1OMPA 1OIBA 4JXIA 3K2DA 4EXKA 3CSBA 2QMXA 4XKNA 4ELRA 2RC7A 4JBZA 2GFEA 3P7IA 5JEIA 2OLBA 4JWYA 1A8EA 2LAOA 4G77A 3CIJA 3B7DA 1FTOA 3VLWA 5L9MA 2O7IA 4BDMA 2X26A 4LZ7A 3H7MA 1GR2A 1B40A 4G8MA 3HO7A 2VD3A 2I48A 3MWBA 2X7PA 4LZ5A 2D3IA 1Y4CA 3VLVA 4RNSA 5H8FA 4IO7A 4U2RA 2H25A 1Z7NE 3FVNA 3ILUB 2RF1A 4JSDA 3OEKA 3SEXA 4WXJA 1MS7A 4LQ5A 1LAXA 2ALUA 2AIXA 3SKPA 3QUFA 2Q88A 2FYIA 3MZBA 3HN0A 3C33A 3BBRA 3UN6A 2HCAA 4IY6A 2VGQA 1M5DA 3IK6B 1P1QA 4MLVA 1MXXA 1VSOA 4GLIA 4EQBA 4ZEBA 5H8HB 2H4IA 3ECRA 1M5EA 4KQPA 1UTBA 1UTHB 1USYH 3H6WA 3SETA 3OO7A 2F7CA 2A5TA 3TKDA 3KEIA 3SERA 1MY3A 2QPQA 3U93A 2QS4A 1MXZA 2F7AA 2XXYA 2UVHA 1MPDA 3FV2A 4FEBA 1T0KA 4GXAA 3C34A 4G8HA 5I57A 4U22A 3D4CA 4QSDA 3PMWA 3PPRA 3PAMA 1NKXA 3O9PA 1JEVA 4Z7EA 2RC8A 4AQ4A 3C9HA 1ZJLA 3JV9A 2DP8A 2O69A 4OETA 4IO2A 2ZNSA 3IX1A 4I8CA 1D9YA 1Y1ZA 2ZXTA 5AA2B 5I58B 1D3KA 5I59A 1P99A 3TELA 4DXUA 1JEUA 1JW4A 4MF3A 5I2KA 1PDAA 1URGA 4IO3A 3USDA 4F19A 2OZZA 3KN7A 2CMOA 2I4BA 1Y4TA 2GHBA 4KCCA 4LA9A 1Y1MA 2ZYOA 4TLMB 2DWJA 2F6GA 1JW1A 4FE8A 2Q8JA 4IGTA 3KFMA 3DRFA 1HSLA 1BP5A 1B32A 4K3FA 1MQGA 4C1TA 1OLAA 2A5SA 2PMSA 3A3UA 2F7BA 1FTJA 4IO6A 3K02A 2HAUA 3C36A 4H65A 3GXAA 3MPKA 2XHDA 5I56A 4RXLA 4LATA 3R6UA 4P0GA 3TYHA 3R7XA 3T66A 2P1SA 5H8FB 2PT2A 5JTYA 4IO5A 1LSTA 1H44A 3DELB 3FJ7A 3S9MC 3KN8A 4GL0A 2YJPA 1D4NA 1WODA 1XOCA 1YAEA 4YKKA 3K01A 3JZJA 2HZLA 1EZOA 4QSEA 3U72A 2V25A 2O84X 2O51A 1B3LA 2DWHA 4KPTA 3VE1B 4XIGQ 4H8JA 1B4ZA 4DDDA 2XXQA 3V83A 1TWYA 1QUJA 4AB6A 3HHFA 4OQOA 1P1OA 1UTBB 4ELOA 1YCJA 5BWJA 2I49A 1A54A 4OTEA 2Y84A 1B3FA 4ZECA 2B65A 2I3VA 4GWOA 1B9JA 3HV1A 4QFOA 5L8DA 4NF5A 3IO6A 5BUUA 4YZZA 3DP4A 3GLBA 2I58A 3CG1A 4G68A 3TUSA 1SD3A 3PU5A 2HZKA 4PFWA 5I57B 3G7WA 1N3XA 3QXMA 5DVJA 1Q1KA 3OD7A 3RPWA 4U4XA 3N94A 3T9XB 1QKAA 1FQBA 2XX8A 3CSGA 4YMBA 4R75A 2YPNA 4YMAA 5HM4B 4M4GA 4U1ZA 1II5A 1PB7A 1Q35A 1Z7ME 4OVJA 5KCJA 2H5YA 1JVXA 4C0RA 4QFKA 3OELA 1R6ZA 2OBGA 3KOSA 4ZEDA 2NVUB 5F7VA 4DIGA 1I69A 1LLSA 2QJEA 1B5HA 4OXVA 3EQ1A 4O3AA 4OFOA 3T9VA 3O6GA 1R9QA 1PB8A 4JDFA 3OO9A 3O66A 2ABHA 5KDTA 3E13X 2Z8FA 4FIMA 1SI0A 2OWSA 2XXRA 3GBAA 5ITPA 1SYIA 4RY1A 1UIUA 4KI0E 1LB9A 2GHAA 2Z23A 3LSXA 3S9LC 3QSLA 1MQDA 3MPLA 4ZEIA 1JNFA 4ND9A 2F8DA 1XVXA 4KR5A 3CVGA 1H3DA 3EF7A 2E0SA 1NNFA 5JTYB 3M3LA 5B7DA 2R6GE 4U23A 1SDXA 2NOOA 3FJGA 3IB0A 3R26A 5ICTA 3PPQA 1GTKA 3UORA 1AH5A 4HTGA 3MVYA 2QRYA 2G93A 1VFEA 3KJTA 4KYEA 3M8UA 1SYHA 4PP0A 3IAZA 3RT6B 3T93B 3U1OA 5I84A 2YLNA 1B7UA 2UXAA 4ZEFA 1P1NA 5IAIA 2UVIA 4ZZAA 3N6TA 2Y7WA 3RUMA 2OWTA 3T9UA 1US4A 2Q89A 1UIVA 4ISUA 4NF5B 3GZGA 5JK4A 3V5AA 3CFZA 3TTRA 3K4UA 3FATA 4G68B 4P11A 3K0VA 2H9BA 3QAXA 3O6PA 3IB2A 2V84A 5B70A 1DOTA 1B05A 3N5LA 2H98A 1BIYA 3MZ9A 3KJ7A 3FJMA 2QL3A 1LFHA 2DXRA 1J1NA 2BJJX 3LC8A 5AA3A 5CMMA 3ILTB 3ZKKA 3CR9A 3LVUA 1YPNA 5KCJB 1LGBC 1BLFA 4MFIA 3CFLA 3HHGA 4X48A 2NXOA 1M5FA 3MBPA 5DEXB 4G4PA 5CC2A 1ZKBA 4EF1A 1VFDA 1BTJA 4NE4A 4U21A 2I0CA 1SW4A 2O1MA 4P0IA 4KD5A 1TFAA 4PFYA 2F36A 4XKPA 3KSJA 4NF4B 3DLNA 3G3GA 3PPPA 1MH4A 4NEDA 1QJMA 5KDTB 3LUYA 1EU8A 1MXWA 2XD2A 4F1YA 1TT1A 4OEVA 3KZGA 5ITOA 1SW5A 3TZAA 4EQ7A 1N84A 3MVWA 3Q29A 5H8NA 1QULA 3OSRA 3S9NC 1ZIUA 2IEEA 3W9WA 1QW0A 4DCXA 1B51A 5HBCA 5KZTA 4C1UA 1GV8A 1UQWA 2UYFA 4QFPA 3VVFA 1ZU0A 4H6DA 2RCBA 3SEWA 4QFNA 1B7ZA 3DRGA 2PYYA 4LP2B 1L5TA 1PBQA 4OERA 2G29A 4HW8A 3TCFA 2ZYKA 4G2ZA 4R6KA 3Q26A 3DRIA 1PC3A 4OHNA 5ICQA 2ZMBA 1XHYA 4LONB 3MC2A 3FGSA 3VLUA 1CE2A 1B2HA 1JQFA 1POY1 1MQJA 4EF2A 1DSNA 2WOPA 3TEPA 3FVOA 4F3BA 5M2VA 2P0SA 5H8SA 4NF8A 1IXHA 4RJZA 1NL5A 1AMFA 3O6HA 2Y7RA 5TPAA 2ZYMA 3H03A 2ONSA 1Y3QA 2DVZA 5CI5A 3RTFB 1QUIA 3DRKA 1ZLQA 4YU0A 2ZNUA 3KBRA 4I9DA 4OWDA 2I6EA 5AE4A 1S50A 3DRHA 2PVUA 3PD8A 1OQHA 1IQ7A 1QKBA 4L17A 1ZTYA 4OFJA 3TQWA 4OYVA 3FZVA 1N3WA 2O6AA 4GD5A 3KG2A 3RTWB 4JB7A 4F1UA 1IXCA 2F34A 3H6VA 4HCWA 3G3JA 2R71A 4F1VA 5AA2D 4PE5B 1HSEA 1NMUA 3IL1B 2DE3A 1TFDA 1O64A 3KN3A 3IR1A 3E3KA 3S9EA 1EZPA 2XX9A 4YKPA 4R2FA 4ONYA 4ZE8A 1ELJA 2O1LA 4IGRA 4Q30B 3KSXA 4JWXA 3ZSFA 4E0WA 3SEUA 2IA4A 2H99A 2XXPA 4RPNA 5H8NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TPA A;  1H43 A;  1O63 A;  2I3W A;  3G3F A;  3IOU A;  4G68 C;  2DOJ A;  4Q0C A;  3QUJ A;  4KYS A;  5FHN A;  3K6U A;  4F22 A;  3ZS6 A;  4POX A;  5DT6 A;  2Z8D A;  2ONK E;  3I3V A;  3V89 B;  3PPN A;  1IEJ A;  1RYO A;  1B4H A;  2AL5 A;  1URS A;  4ECF A;  3OEN A;  4QRZ A;  4N13 A;  3MUQ A;  5LOM A;  3RNN A;  3FXR A;  3KOT A;  3IB1 A;  3UA8 A;  3UP9 A;  3SES A;  1N7W A;  5DYH A;  3W15 C;  5AA4 A;  4RK2 A;  5EHS A;  4Z0I A;  3T96 B;  3Q25 A;  3K00 A;  2XX7 A;  1RKM A;  3K6V A;  1FQA A;  1B5I A;  1MXU A;  3OSQ A;  3EHS A;  4ELQ A;  3O97 A;  2UVG A;  3EN3 A;  1NNT A;  3CFX A;  4FOR A;  4LZ8 A;  1OVT A;  2Y7K A;  3VV5 A;  4NF8 B;  1HSJ A;  3O6I A;  5DEX A;  2XXX A;  5TPA B;  5ELV A;  5CMC A;  1IIW A;  1NNP A;  4POW A;  4XKQ A;  4EXL A;  4U4S A;  1H76 A;  3BKI B;  1BKA A;  4BDN A;  1O7T A;  3TTN A;  4R6Y A;  3OXN A;  3RYB A;  4FAJ A;  2QS3 A;  4X1D A;  3OOA A;  4NF4 A;  2Q2C A;  3IJX B;  1JVY A;  5J1D A;  4WED A;  3VXC A;  2I4C A;  1MXY A;  5FTH A;  1LB8 A;  2DWA A;  3TTK A;  5A5X A;  3MP1 A;  4HCY A;  1AOV A;  4EQ9 A;  2ZYN A;  3VXB A;  1NH7 A;  1A99 A;  4RPO A;  3IOV A;  5K2X A;  2B3F A;  3FVG A;  2D5W A;  4IO4 A;  4JSO A;  1B3E A;  4ESX A;  3TDJ A;  2OCU A;  4KYD A;  3PUW E;  4GVO A;  3TCH A;  4F39 A;  2P2A A;  2NWJ A;  2KLF A;  1CB6 A;  3ONM A;  4YKI A;  3EHT A;  1PEB A;  4O3B A;  1B6H A;  4R9G A;  3BFU A;  1MDP 1;  2VOZ A;  4KCD A;  1OQG A;  2DS9 A;  2UVJ A;  1JET A;  3F11 A;  4R73 A;  3U8Q A;  3TOD A;  2B3B A;  1S7Y A;  5FHM A;  4HS7 A;  1FTL A;  1B3G A;  2XXI A;  1RYX A;  1B46 A;  1SVX B;  4TQU Q;  1VE4 A;  1A55 A;  4M1V A;  1GGG A;  2V3U A;  4ZS9 A;  4O3C A;  1FTK A;  3WAE A;  4R6H A;  3O2A A;  4NF6 A;  1B1X A;  3T9H B;  3DM0 A;  3IOR A;  2Z22 A;  4GOT A;  4F3G A;  4R74 A;  4GRK A;  3EPE A;  2ESN A;  1LFG A;  3FAS A;  4F2Q A;  4YAH X;  1B0L A;  5AA4 B;  1LCF A;  4THI A;  3I5O A;  3VVD A;  2ZNT A;  3N6U A;  3QK6 A;  2F35 A;  3TFL A;  4DE8 A;  4I1D A;  3CG3 A;  4RK9 A;  2WKY A;  2DQV A;  5I2N B;  3RQT A;  4OEN A;  3K1N A;  1FQE A;  3MW0 A;  4QFL A;  3N26 A;  3V8X B;  3FIR A;  1IUD A;  1Y3P A;  4H67 A;  2FNC A;  4MH5 A;  1MQH A;  3C35 A;  3TMG A;  4IB2 A;  4QHQ A;  2UYE A;  2V3T A;  4F2O A;  3OEM A;  2AYS A;  3EHU A;  1IZ1 A;  5H8Q A;  1P1U A;  4YB5 A;  2RIN A;  2F78 A;  3CRB A;  1NFT A;  5DVI A;  1FCK A;  1DPP A;  4AB5 A;  3A09 A;  2XXW A;  2WOK A;  4GXS B;  1SQY A;  2Q9T A;  3RN8 A;  2HAV A;  2B4M A;  4YIC A;  3PMX A;  2Y7I A;  4GFR A;  4YB6 A;  4U1O A;  4F3P A;  5A5X B;  1MG1 A;  2RKM A;  3H6U A;  2PT1 A;  1XS5 A;  3WAF A;  2FA7 A;  4F18 A;  3MP8 A;  3PGF A;  1IXI A;  3I6V A;  4FJP A;  1EZ9 A;  5DTB A;  3RY3 A;  2V93 A;  3G3K A;  1DMB A;  1JW5 A;  1EH3 A;  3MP6 A;  3IO4 A;  3THI A;  4N07 A;  1YTV A;  4Q5T A;  1MPB A;  3JYR A;  2F6P A;  3S4U A;  5L9O A;  3H3G A;  2QS1 A;  4BLA A;  1ANF A;  1SW2 A;  2DVC A;  3CHG A;  1MXV A;  3MZ1 A;  3SEY A;  4R9F A;  2RC9 A;  1MY0 A;  3PUY E;  3PUZ E;  3PD9 A;  3HCQ A;  3AXF A;  1S9T A;  3VDF A;  3QIM A;  2NUV A;  3OO6 A;  1DTG A;  3H06 B;  3LSW A;  3Q27 A;  1PB9 A;  2AL4 A;  2XXV A;  1M5C A;  1QVS A;  3CI8 A;  3FVK A;  4X1B A;  1R1N A;  4GL8 A;  3U94 A;  1FQD A;  3RLF E;  2D21 A;  4NF6 B;  4Q8R A;  2W7Y A;  1MDQ A;  2THI A;  3O29 A;  2O68 A;  1I6A A;  1MM7 A;  4UAC A;  3ZKL A;  3TTM A;  3LSL A;  3LSF B;  2GRV A;  4FED A;  1KWH A;  2DWI A;  2M8C A;  4OFL A;  4IY5 A;  3K1P A;  4ELP A;  1F9B A;  1B0H A;  1FW0 A;  4TLL B;  1A40 A;  2RCA A;  4FAT A;  2VD2 A;  4QF9 A;  4DLD A;  4DZ1 A;  4LVQ A;  4NMY A;  2VP1 A;  4WEP A;  3FXU A;  4PQJ A;  2XXH A;  4H5G A;  1OVB A;  2DE2 A;  1D9V A;  1TXF A;  4ZEK A;  2DE4 A;  2QSX A;  4KFQ A;  3M3K A;  1MM6 A;  3G3I A;  3MJN A;  3PUV E;  1XT8 A;  3SEV A;  3M3F A;  5H8Q B;  4BDR A;  1R9L A;  4ESW A;  3QYT A;  1B1H A;  4G8N A;  2REG A;  3FTO A;  2X7Q A;  3LR1 A;  4TOZ A;  5AA1 A;  3H4Z A;  3MAM A;  1M5B A;  4N6P A;  2GH9 A;  1LAH E;  1NH8 A;  3ODB A;  2ONR A;  5HPQ A;  1LFI A;  3HPI A;  4H5F A;  1LCT A;  1DPE A;  4H0W A;  3LBS A;  1Y3N A;  3VVE A;  3FD3 A;  4NWC A;  4GQO A;  4F29 A;  5CBR A;  3TTL A;  1FQC A;  4UA8 A;  1FTM A;  2HFB A;  3E9X A;  3IJO B;  4MBP A;  1DTZ A;  2XXT A;  1Y9U A;  1URD A;  3UK4 A;  1B5J A;  3PUX E;  4NTL A;  5CM6 A;  4DXC A;  3HST A;  1I6B A;  5TP9 A;  2E1S A;  4FEC A;  3UIF A;  3FXQ A;  1IXG A;  3A3C A;  2HXW A;  1IIT A;  4XTC Q;  3T22 A;  2A5T B;  1A7L A;  3U92 A;  3RGY A;  5EHM A;  3PPO A;  4F3S A;  4I62 A;  3TAJ A;  4R72 A;  2CZL A;  4OEU A;  5L9S A;  1B7H A;  2F97 A;  4KHZ E;  1SW1 A;  3G3H A;  1ZBM A;  4DCY A;  3DRJ A;  2Z8E A;  5F1Q A;  4R2B A;  2OJT A;  3OO8 A;  1MRP A;  3B6T A;  1POT A;  3UGW A;  1MY2 A;  5I2N A;  1PBP A;  3Q28 A;  2XD3 A;  4EUO A;  1B3H A;  5K2Y A;  1QUK A;  4EDP A;  2DYX A;  3GBB A;  4H1X A;  2HQ0 A;  1WVJ A;  3IOT A;  4NWD A;  4XXU A;  4YB7 A;  2B4L A;  5IKB A;  4X9T A;  3K1M A;  3TCG A;  4GF8 A;  3PV0 E;  5I59 B;  1SI1 A;  3VFJ A;  5FTI A;  5I2K B;  4BDO A;  3PMV A;  3BFT A;  1GVC A;  5EYF A;  2DXY A;  3MQ9 A;  4PFT A;  3FV1 A;  4QSC A;  3OMB A;  5CRY A;  1LBC A;  4JWO A;  1Y20 A;  5DVF A;  3K6W A;  2DSF A;  2O7U A;  2XXU A;  1H45 A;  1VR5 A;  1LAG E;  1AL3 A;  3MVX A;  4RYA A;  2PX1 A;  1OLC A;  1N0T A;  4BDQ A;  3SDF A;  5CBS A;  2WOL A;  3RYA A;  2QMW A;  4LUB A;  3IOW A;  2Q2A A;  5H8H A;  3O28 A;  1US5 A;  1MPC A;  4RA1 A;  4MLQ A;  3RT8 A;  4PET A;  3C4M A;  1NNK A;  4OES A;  1UTH A;  1USY E;  5I56 B;  2OK2 A;  3DP6 A;  1P1W A;  5FHO A;  3B6W A;  1WDN A;  1N76 A;  3W9V A;  1N7X A;  2HEU A;  1SBP A;  2V3Q A;  1XVY A;  1N04 A;  1ATG A;  1MQI A;  1MY4 A;  4ZDM A;  3H6T A;  1AIV A;  4F31 B;  1XC1 A;  1ZMG A;  3FUZ A;  2ANJ A;  2F5X A;  3DP8 A;  2VHA A;  4ZZE A;  1B52 A;  3S2V A;  4ZE9 A;  2QS2 A;  3MVZ A;  5CMK A;  1LBB A;  5CMB A;  3C32 A;  3KGC A;  3B6Q A;  3L6H A;  5TP9 B;  4GIZ A;  3C31 A;  3K6X A;  4BDL A;  4E0X A;  1A8F A;  4H8I A;  3E4R A;  1FQF A;  4PFU A;  2R9J A;  5AA2 A;  1B58 A;  2PBW A;  2REJ A;  5ISU A;  3TQL A;  5I58 A;  1MH3 A;  5TU0 A;  4DXB A;  4WKM A;  2Y7P A;  4OZ9 A;  4LQ2 A;  4YKJ A;  2I0B A;  1I6Q A;  1MY1 A;  1LAF E;  4XKR A;  4OMB A;  3L6G A;  3D4G A;  1OMP A;  1OIB A;  4JXI A;  3K2D A;  4EXK A;  3CSB A;  2QMX A;  4XKN A;  4ELR A;  2RC7 A;  4JBZ A;  2GFE A;  3P7I A;  5JEI A;  2OLB A;  4JWY A;  1A8E A;  2LAO A;  4G77 A;  3CIJ A;  3B7D A;  1FTO A;  3VLW A;  5L9M A;  2O7I A;  4BDM A;  2X26 A;  4LZ7 A;  3H7M A;  1GR2 A;  1B40 A;  4G8M A;  3HO7 A;  2VD3 A;  2I48 A;  3MWB A;  2X7P A;  4LZ5 A;  2D3I A;  1Y4C A;  3VLV A;  4RNS A;  5H8F A;  4IO7 A;  4U2R A;  2H25 A;  1Z7N E;  3FVN A;  3ILU B;  2RF1 A;  4JSD A;  3OEK A;  3SEX A;  4WXJ A;  1MS7 A;  4LQ5 A;  1LAX A;  2ALU A;  2AIX A;  3SKP A;  3QUF A;  2Q88 A;  2FYI A;  3MZB A;  3HN0 A;  3C33 A;  3BBR A;  3UN6 A;  2HCA A;  4IY6 A;  2VGQ A;  1M5D A;  3IK6 B;  1P1Q A;  4MLV A;  1MXX A;  1VSO A;  4GLI A;  4EQB A;  4ZEB A;  5H8H B;  2H4I A;  3ECR A;  1M5E A;  4KQP A;  1UTB A;  1UTH B;  1USY H;  3H6W A;  3SET A;  3OO7 A;  2F7C A;  2A5T A;  3TKD A;  3KEI A;  3SER A;  1MY3 A;  2QPQ A;  3U93 A;  2QS4 A;  1MXZ A;  2F7A A;  2XXY A;  2UVH A;  1MPD A;  3FV2 A;  4FEB A;  1T0K A;  4GXA A;  3C34 A;  4G8H A;  5I57 A;  4U22 A;  3D4C A;  4QSD A;  3PMW A;  3PPR A;  3PAM A;  1NKX A;  3O9P A;  1JEV A;  4Z7E A;  2RC8 A;  4AQ4 A;  3C9H A;  1ZJL A;  3JV9 A;  2DP8 A;  2O69 A;  4OET A;  4IO2 A;  2ZNS A;  3IX1 A;  4I8C A;  1D9Y A;  1Y1Z A;  2ZXT A;  5AA2 B;  5I58 B;  1D3K A;  5I59 A;  1P99 A;  3TEL A;  4DXU A;  1JEU A;  1JW4 A;  4MF3 A;  5I2K A;  1PDA A;  1URG A;  4IO3 A;  3USD A;  4F19 A;  2OZZ A;  3KN7 A;  2CMO A;  2I4B A;  1Y4T A;  2GHB A;  4KCC A;  4LA9 A;  1Y1M A;  2ZYO A;  4TLM B;  2DWJ A;  2F6G A;  1JW1 A;  4FE8 A;  2Q8J A;  4IGT A;  3KFM A;  3DRF A;  1HSL A;  1BP5 A;  1B32 A;  4K3F A;  1MQG A;  4C1T A;  1OLA A;  2A5S A;  2PMS A;  3A3U A;  2F7B A;  1FTJ A;  4IO6 A;  3K02 A;  2HAU A;  3C36 A;  4H65 A;  3GXA A;  3MPK A;  2XHD A;  5I56 A;  4RXL A;  4LAT A;  3R6U A;  4P0G A;  3TYH A;  3R7X A;  3T66 A;  2P1S A;  5H8F B;  2PT2 A;  5JTY A;  4IO5 A;  1LST A;  1H44 A;  3DEL B;  3FJ7 A;  3S9M C;  3KN8 A;  4GL0 A;  2YJP A;  1D4N A;  1WOD A;  1XOC A;  1YAE A;  4YKK A;  3K01 A;  3JZJ A;  2HZL A;  1EZO A;  4QSE A;  3U72 A;  2V25 A;  2O84 X;  2O51 A;  1B3L A;  2DWH A;  4KPT A;  3VE1 B;  4XIG Q;  4H8J A;  1B4Z A;  4DDD A;  2XXQ A;  3V83 A;  1TWY A;  1QUJ A;  4AB6 A;  3HHF A;  4OQO A;  1P1O A;  1UTB B;  4ELO A;  1YCJ A;  5BWJ A;  2I49 A;  1A54 A;  4OTE A;  2Y84 A;  1B3F A;  4ZEC A;  2B65 A;  2I3V A;  4GWO A;  1B9J A;  3HV1 A;  4QFO A;  5L8D A;  4NF5 A;  3IO6 A;  5BUU A;  4YZZ A;  3DP4 A;  3GLB A;  2I58 A;  3CG1 A;  4G68 A;  3TUS A;  1SD3 A;  3PU5 A;  2HZK A;  4PFW A;  5I57 B;  3G7W A;  1N3X A;  3QXM A;  5DVJ A;  1Q1K A;  3OD7 A;  3RPW A;  4U4X A;  3N94 A;  3T9X B;  1QKA A;  1FQB A;  2XX8 A;  3CSG A;  4YMB A;  4R75 A;  2YPN A;  4YMA A;  5HM4 B;  4M4G A;  4U1Z A;  1II5 A;  1PB7 A;  1Q35 A;  1Z7M E;  4OVJ A;  5KCJ A;  2H5Y A;  1JVX A;  4C0R A;  4QFK A;  3OEL A;  1R6Z A;  2OBG A;  3KOS A;  4ZED A;  2NVU B;  5F7V A;  4DIG A;  1I69 A;  1LLS A;  2QJE A;  1B5H A;  4OXV A;  3EQ1 A;  4O3A A;  4OFO A;  3T9V A;  3O6G A;  1R9Q A;  1PB8 A;  4JDF A;  3OO9 A;  3O66 A;  2ABH A;  5KDT A;  3E13 X;  2Z8F A;  4FIM A;  1SI0 A;  2OWS A;  2XXR A;  3GBA A;  5ITP A;  1SYI A;  4RY1 A;  1UIU A;  4KI0 E;  1LB9 A;  2GHA A;  2Z23 A;  3LSX A;  3S9L C;  3QSL A;  1MQD A;  3MPL A;  4ZEI A;  1JNF A;  4ND9 A;  2F8D A;  1XVX A;  4KR5 A;  3CVG A;  1H3D A;  3EF7 A;  2E0S A;  1NNF A;  5JTY B;  3M3L A;  5B7D A;  2R6G E;  4U23 A;  1SDX A;  2NOO A;  3FJG A;  3IB0 A;  3R26 A;  5ICT A;  3PPQ A;  1GTK A;  3UOR A;  1AH5 A;  4HTG A;  3MVY A;  2QRY A;  2G93 A;  1VFE A;  3KJT A;  4KYE A;  3M8U A;  1SYH A;  4PP0 A;  3IAZ A;  3RT6 B;  3T93 B;  3U1O A;  5I84 A;  2YLN A;  1B7U A;  2UXA A;  4ZEF A;  1P1N A;  5IAI A;  2UVI A;  4ZZA A;  3N6T A;  2Y7W A;  3RUM A;  2OWT A;  3T9U A;  1US4 A;  2Q89 A;  1UIV A;  4ISU A;  4NF5 B;  3GZG A;  5JK4 A;  3V5A A;  3CFZ A;  3TTR A;  3K4U A;  3FAT A;  4G68 B;  4P11 A;  3K0V A;  2H9B A;  3QAX A;  3O6P A;  3IB2 A;  2V84 A;  5B70 A;  1DOT A;  1B05 A;  3N5L A;  2H98 A;  1BIY A;  3MZ9 A;  3KJ7 A;  3FJM A;  2QL3 A;  1LFH A;  2DXR A;  1J1N A;  2BJJ X;  3LC8 A;  5AA3 A;  5CMM A;  3ILT B;  3ZKK A;  3CR9 A;  3LVU A;  1YPN A;  5KCJ B;  1LGB C;  1BLF A;  4MFI A;  3CFL A;  3HHG A;  4X48 A;  2NXO A;  1M5F A;  3MBP A;  5DEX B;  4G4P A;  5CC2 A;  1ZKB A;  4EF1 A;  1VFD A;  1BTJ A;  4NE4 A;  4U21 A;  2I0C A;  1SW4 A;  2O1M A;  4P0I A;  4KD5 A;  1TFA A;  4PFY A;  2F36 A;  4XKP A;  3KSJ A;  4NF4 B;  3DLN A;  3G3G A;  3PPP A;  1MH4 A;  4NED A;  1QJM A;  5KDT B;  3LUY A;  1EU8 A;  1MXW A;  2XD2 A;  4F1Y A;  1TT1 A;  4OEV A;  3KZG A;  5ITO A;  1SW5 A;  3TZA A;  4EQ7 A;  1N84 A;  3MVW A;  3Q29 A;  5H8N A;  1QUL A;  3OSR A;  3S9N C;  1ZIU A;  2IEE A;  3W9W A;  1QW0 A;  4DCX A;  1B51 A;  5HBC A;  5KZT A;  4C1U A;  1GV8 A;  1UQW A;  2UYF A;  4QFP A;  3VVF A;  1ZU0 A;  4H6D A;  2RCB A;  3SEW A;  4QFN A;  1B7Z A;  3DRG A;  2PYY A;  4LP2 B;  1L5T A;  1PBQ A;  4OER A;  2G29 A;  4HW8 A;  3TCF A;  2ZYK A;  4G2Z A;  4R6K A;  3Q26 A;  3DRI A;  1PC3 A;  4OHN A;  5ICQ A;  2ZMB A;  1XHY A;  4LON B;  3MC2 A;  3FGS A;  3VLU A;  1CE2 A;  1B2H A;  1JQF A;  1POY 1;  1MQJ A;  4EF2 A;  1DSN A;  2WOP A;  3TEP A;  3FVO A;  4F3B A;  5M2V A;  2P0S A;  5H8S A;  4NF8 A;  1IXH A;  4RJZ A;  1NL5 A;  1AMF A;  3O6H A;  2Y7R A;  5TPA A;  2ZYM A;  3H03 A;  2ONS A;  1Y3Q A;  2DVZ A;  5CI5 A;  3RTF B;  1QUI A;  3DRK A;  1ZLQ A;  4YU0 A;  2ZNU A;  3KBR A;  4I9D A;  4OWD A;  2I6E A;  5AE4 A;  1S50 A;  3DRH A;  2PVU A;  3PD8 A;  1OQH A;  1IQ7 A;  1QKB A;  4L17 A;  1ZTY A;  4OFJ A;  3TQW A;  4OYV A;  3FZV A;  1N3W A;  2O6A A;  4GD5 A;  3KG2 A;  3RTW B;  4JB7 A;  4F1U A;  1IXC A;  2F34 A;  3H6V A;  4HCW A;  3G3J A;  2R71 A;  4F1V A;  5AA2 D;  4PE5 B;  1HSE A;  1NMU A;  3IL1 B;  2DE3 A;  1TFD A;  1O64 A;  3KN3 A;  3IR1 A;  3E3K A;  3S9E A;  1EZP A;  2XX9 A;  4YKP A;  4R2F A;  4ONY A;  4ZE8 A;  1ELJ A;  2O1L A;  4IGR A;  4Q30 B;  3KSX A;  4JWX A;  3ZSF A;  4E0W A;  3SEU A;  2IA4 A;  2H99 A;  2XXP A;  4RPN A;  5H8N B; 
#chains in the Genus database with same CATH topology
 3TPA A;  1H43 A;  4PAF A;  1O63 A;  2I3W A;  3G3F A;  3IOU A;  4G68 C;  2DOJ A;  4Q0C A;  3SZP A;  3QUJ A;  4KYS A;  5FHN A;  3NOH A;  3K6U A;  4F22 A;  3ZS6 A;  4POX A;  5DT6 A;  2Z8D A;  1LEV A;  2ONK E;  3T0J A;  3I3V A;  5EQ7 A;  3V89 B;  2XWI A;  3PPN A;  5IZ3 A;  1IEJ A;  1RYO A;  1B4H A;  2AL5 A;  1URS A;  4ECF A;  3OEN A;  4QRZ A;  4N13 A;  1NUW A;  3MUQ A;  5LOM A;  2L5V A;  3RNN A;  3FXR A;  3KOT A;  3IB1 A;  3UA8 A;  3SES A;  3UP9 A;  1N7W A;  5DYH A;  3W15 C;  5IZZ A;  2KQZ A;  5AA4 A;  4RK2 A;  5EHS A;  4Z0I A;  3T96 B;  3Q25 A;  3K00 A;  2XX7 A;  1RKM A;  3K6V A;  1FQA A;  1B5I A;  1FBG A;  1MXU A;  1FPB A;  1FTA A;  3OSQ A;  2VPO A;  3EHS A;  4ELQ A;  3O97 A;  2UVG A;  3EN3 A;  1NNT A;  3CFX A;  4FOR A;  4LZ8 A;  1OVT A;  2Y7K A;  3VV5 A;  2KR0 A;  4XFE A;  4P56 A;  4NF8 B;  3FXB A;  4H46 A;  4PGN A;  1HSJ A;  3O6I A;  4PBQ A;  5DEX A;  2XXX A;  5TPA B;  5ELV A;  5CMC A;  4MX6 A;  1IIW A;  1NNP A;  4POW A;  4XKQ A;  4EXL A;  4U4S A;  1H76 A;  3BKI B;  1BKA A;  4BDN A;  1NI9 A;  1O7T A;  3TTN A;  3QMF A;  4R6Y A;  4MAG A;  3OXN A;  3RYB A;  4FAJ A;  2QS3 A;  4NF4 A;  3OOA A;  4X1D A;  2Q2C A;  3IJX B;  1CNQ A;  1JVY A;  5J1D A;  4WED A;  1NV5 A;  3VXC A;  2QFL A;  2I4C A;  1MXY A;  5FTH A;  1LB8 A;  2DWA A;  3TTK A;  5A5X A;  3MP1 A;  4HCY A;  1AOV A;  4EQ9 A;  4GWW A;  1QGX A;  2ZYN A;  3VXB A;  1NH7 A;  1A99 A;  1XI6 A;  4RPO A;  3IOV A;  5I7I A;  5K2X A;  2B3F A;  3FVG A;  2D5W A;  4IO4 A;  4JSO A;  2QVU A;  1B3E A;  4ESX A;  3TDJ A;  2OCU A;  4KYD A;  3PUW E;  4P8B A;  4GVO A;  3TCH A;  4GWU A;  4F39 A;  2P2A A;  3HFU A;  2NWJ A;  2KLF A;  1CB6 A;  3RPL A;  3ONM A;  4YKI A;  1LBY A;  3EHT A;  5EQ9 A;  1PEB A;  3ROJ A;  4O3B A;  1B6H A;  4R9G A;  3BFU A;  1MDP 1;  2VOZ A;  4KCD A;  1OQG A;  2DS9 A;  1NV6 A;  4O7M A;  2UVJ A;  1JET A;  3F11 A;  4R73 A;  2Y5K A;  3U8Q A;  3TOD A;  2B3B A;  2PFY A;  1S7Y A;  5FHM A;  4HS7 A;  1FTL A;  4HE2 A;  1B3G A;  2XXI A;  1RYX A;  1K9Z A;  1B46 A;  1SVX B;  4TQU Q;  4N81 A;  1VE4 A;  1A55 A;  4M1V A;  1GGG A;  2V3U A;  4ZS9 A;  4PFI A;  4O3C A;  1FTK A;  5LDZ A;  4GWY A;  5IZ3 B;  3WAE A;  4NAP A;  4R6H A;  3O2A A;  4NF6 A;  1B1X A;  3T9H B;  3DM0 A;  3IOR A;  2Z22 A;  4GOT A;  1FPI A;  4F3G A;  1LBV A;  4R74 A;  4GRK A;  3EPE A;  2FIX A;  2ESN A;  1LFG A;  1RDY A;  3FAS A;  4F2Q A;  2HPG A;  4YAH X;  1B0L A;  5AA4 B;  3MST A;  1LCF A;  4THI A;  3I5O A;  3VVD A;  2ZNT A;  3N6U A;  3QK6 A;  2F35 A;  3TFL A;  4IR8 A;  4DE8 A;  4I1D A;  3CG3 A;  4RK9 A;  2WKY A;  2JJK A;  4JVD A;  4KXP A;  2DQV A;  5I2N B;  3RQT A;  1FJ9 A;  4OEN A;  3K1N A;  1FQE A;  3MW0 A;  4QFL A;  3N26 A;  3V8X B;  3FIR A;  1IUD A;  1Y3P A;  4OA4 A;  4H67 A;  2FNC A;  4MH5 A;  1MQH A;  3C35 A;  4GX3 A;  4IB2 A;  4MHF A;  4QHQ A;  3TMG A;  2UYE A;  1FPG A;  2R8T A;  1FBF A;  2V3T A;  4F2O A;  5EQA A;  3OEM A;  2AYS A;  1VDW A;  3EHU A;  1IZ1 A;  5H8Q A;  1P1U A;  4YB5 A;  1NV4 A;  2RIN A;  2F78 A;  3CRB A;  1NFT A;  3MYU A;  5DVI A;  1FCK A;  1DPP A;  4AB5 A;  3A09 A;  2XXW A;  2WOK A;  4GXS B;  1SQY A;  2Q9T A;  3RN8 A;  2HAV A;  4I3E A;  2B4M A;  4YIC A;  3PMX A;  2Y7I A;  4GFR A;  4YB6 A;  4U1O A;  4F3P A;  5A5X B;  1MG1 A;  2RKM A;  4N6K A;  3H6U A;  2PT1 A;  1XS5 A;  4N6D A;  3WAF A;  3KBZ A;  2FA7 A;  4F18 A;  3MP8 A;  3PGF A;  1IXI A;  3I6V A;  4FJP A;  1EZ9 A;  5DTB A;  3RY3 A;  2V93 A;  3G3K A;  1DMB A;  2OWZ A;  1JW5 A;  1EH3 A;  3MP6 A;  3IO4 A;  3THI A;  2PFZ A;  1YYZ A;  4N07 A;  1YTV A;  4Q5T A;  1MPB A;  3RPL B;  3JYR A;  2F6P A;  3S4U A;  5L9O A;  3H3G A;  2QS1 A;  4PGP A;  4BLA A;  1ANF A;  1SW2 A;  2DVC A;  3CHG A;  1MXV A;  3MZ1 A;  3SEY A;  4R9F A;  2RC9 A;  1MY0 A;  3PUY E;  3PUZ E;  2WYK A;  3PD9 A;  3HCQ A;  1FBP A;  3AXF A;  1S9T A;  3VDF A;  3QIM A;  2NUV A;  3OO6 A;  1DTG A;  3H06 B;  3LSW A;  3Q27 A;  1PB9 A;  2AL4 A;  2XXV A;  1M5C A;  1QVS A;  3CI8 A;  3FVK A;  2DDK A;  4LN5 A;  4X1B A;  1R1N A;  4GL8 A;  3U94 A;  1FQD A;  3RLF E;  1NV1 A;  3E79 A;  2D21 A;  4NF6 B;  4Q8R A;  2W7Y A;  1MDQ A;  2THI A;  3O29 A;  2O68 A;  1I6A A;  3EKI A;  1MM7 A;  4UAC A;  3ZKL A;  3TTM A;  4X04 A;  3LSL A;  3LSF B;  2GRV A;  4FED A;  1KWH A;  2DWI A;  1FPD A;  2M8C A;  4PC9 A;  4HE0 A;  4OFL A;  4GWZ A;  4IY5 A;  3K1P A;  4ELP A;  1F9B A;  4QXD A;  1B0H A;  1FW0 A;  4TLL B;  1A40 A;  2OX3 A;  2RCA A;  4FAT A;  4MNI A;  2VD2 A;  4QF9 A;  2XXK A;  4DLD A;  4DZ1 A;  1NUX A;  4LVQ A;  4NMY A;  2Q8M A;  2VP1 A;  4WEP A;  3FXU A;  4PQJ A;  2XA5 A;  2XXH A;  2VPN A;  4H5G A;  1OVB A;  2DE2 A;  1D9V A;  4AS5 A;  1TXF A;  4ZEK A;  2DE4 A;  2QSX A;  4KFQ A;  3M3K A;  1MM6 A;  3G3I A;  3MJN A;  3PUV E;  1KA1 A;  1XT8 A;  3SEV A;  3M3F A;  2FHY A;  5H8Q B;  4BDR A;  1R9L A;  4ESW A;  3QYT A;  1B1H A;  4G8N A;  4HE1 A;  2REG A;  3FTO A;  2X7Q A;  3LR1 A;  4TOZ A;  5AA1 A;  3H4Z A;  3MAM A;  1M5B A;  4N6P A;  2GH9 A;  1LAH E;  1NH8 A;  2CEY A;  4GWS A;  3ODB A;  2ONR A;  5HPQ A;  1IMD A;  1LFI A;  3HPI A;  4H5F A;  1LCT A;  1DPE A;  4H0W A;  3LBS A;  1Y3N A;  3VVE A;  3FD3 A;  4NWC A;  4GQO A;  4F29 A;  5CBR A;  3TTL A;  1FQC A;  2ZZW A;  4DI3 D;  4UA8 A;  1FTM A;  2HFB A;  3E9X A;  1NV7 A;  1FBD A;  3IJO B;  4MBP A;  1DTZ A;  2XXT A;  1Y9U A;  4P47 A;  1URD A;  3UK4 A;  1B5J A;  3PUX E;  4NTL A;  5CM6 A;  4XEQ A;  4DXC A;  3HST A;  4PAK A;  1I6B A;  2XWV A;  5TP9 A;  3FBP A;  2E1S A;  4FEC A;  3UIF A;  3FXQ A;  4I3Y A;  5A5L A;  1IXG A;  3A3C A;  2HXW A;  1FJ6 A;  1IIT A;  4XTC Q;  3T22 A;  2A5T B;  1A7L A;  3U92 A;  3RGY A;  5EHM A;  3PPO A;  4I62 A;  4F3S A;  3TAJ A;  4R72 A;  2CZL A;  4OEU A;  5L9S A;  1B7H A;  2F97 A;  4KHZ E;  1SW1 A;  3G3H A;  1ZBM A;  4DCY A;  3DRJ A;  2Z8E A;  5F1Q A;  2OJT A;  3OO8 A;  4R2B A;  1MRP A;  3B6T A;  1POT A;  3UGW A;  1MY2 A;  5I2N A;  1PBP A;  3Q28 A;  2XD3 A;  4EUO A;  1B3H A;  3E78 A;  5K2Y A;  1QUK A;  4EDP A;  2DYX A;  1IMC A;  3GBB A;  4H1X A;  2HQ0 A;  1WVJ A;  3IOT A;  4NWD A;  4XXU A;  4YB7 A;  2B4L A;  5IKB A;  4X9T A;  2WBD A;  3K1M A;  3TCG A;  4GF8 A;  3PV0 E;  3B50 A;  5I59 B;  4NQ8 A;  3ISP A;  1SI1 A;  3VFJ A;  5FTI A;  5I2K B;  4BDO A;  3PMV A;  3BFT A;  1RDX A;  1GVC A;  5EYF A;  2DXY A;  3MQ9 A;  4PFT A;  3FV1 A;  4QSC A;  1NV3 A;  3OMB A;  5CRY A;  1LBC A;  2CZI A;  4JWO A;  1Y20 A;  5DVF A;  3K6W A;  2DSF A;  2O7U A;  2XXU A;  1H45 A;  1VR5 A;  1LAG E;  1AL3 A;  3D1R A;  3MVX A;  4RYA A;  2PX1 A;  1OLC A;  1N0T A;  4BDQ A;  4PFR A;  3SDF A;  2WOL A;  3RYA A;  5CBS A;  4OVR A;  2QMW A;  4LUB A;  3IOW A;  4NG7 A;  2Q2A A;  5H8H A;  3O28 A;  1US5 A;  1MPC A;  4RA1 A;  4MLQ A;  3RT8 A;  4PET A;  3C4M A;  4OES A;  1NNK A;  1UTH A;  1USY E;  4MNP A;  5I56 B;  1NV2 A;  2OK2 A;  5ET6 A;  3DP6 A;  1P1W A;  4GX4 A;  5FHO A;  3B6W A;  1WDN A;  1N76 A;  3W9V A;  1N7X A;  2HEU A;  1SBP A;  5ET8 A;  2V3Q A;  4MEV A;  1XVY A;  1N04 A;  1ATG A;  1KZ8 A;  1MQI A;  5DW8 A;  1MY4 A;  4ZDM A;  3H6T A;  3GYY A;  1AIV A;  4F31 B;  1XC1 A;  5LTC A;  1ZMG A;  3FUZ A;  2ANJ A;  2F5X A;  3DP8 A;  2VHA A;  2MKZ A;  4ZZE A;  4N17 A;  1B52 A;  3S2V A;  4ZE9 A;  2QS2 A;  3MVZ A;  5CMK A;  1LBB A;  5CMB A;  3C32 A;  1FBH A;  3KGC A;  3B6Q A;  3L6H A;  5TP9 B;  4GIZ A;  3C31 A;  1DK4 A;  3K6X A;  4BDL A;  4X8R A;  4E0X A;  1A8F A;  4H8I A;  1FBE A;  3E4R A;  1FQF A;  4PFU A;  2R9J A;  1EYJ A;  5AA2 A;  1B58 A;  2PBW A;  2REJ A;  5ISU A;  3TQL A;  5I58 A;  1MH3 A;  2Q74 A;  2CZK A;  5TU0 A;  1FPF A;  4DXB A;  4WKM A;  2Y7P A;  4OZ9 A;  2WBB A;  2ZZX A;  4LQ2 A;  4YKJ A;  2I0B A;  1I6Q A;  1MY1 A;  1LAF E;  4XKR A;  4OMB A;  3L6G A;  3D4G A;  1OMP A;  1OIB A;  4JXI A;  3K2D A;  4EXK A;  3CSB A;  4PBH A;  2CZH A;  2QMX A;  4XKN A;  4ELR A;  5T3J A;  2RC7 A;  4JBZ A;  2GFE A;  4PFB A;  3P7I A;  5JEI A;  2OLB A;  4JWY A;  5FBP A;  1A8E A;  2LAO A;  4G77 A;  2QVV A;  3B7D A;  3CIJ A;  1FTO A;  3VLW A;  5L9M A;  2O7I A;  4BDM A;  2X26 A;  4LZ7 A;  3H7M A;  1GR2 A;  1B40 A;  4G8M A;  3HO7 A;  2VD3 A;  2I48 A;  5I5P A;  3MWB A;  4O94 A;  2X7P A;  4LZ5 A;  2D3I A;  1Y4C A;  3VLV A;  4RNS A;  5H8F A;  4IO7 A;  4U2R A;  4N8G A;  2H25 A;  1Z7N E;  3FVN A;  3ILU B;  2RF1 A;  4JSD A;  3OEK A;  1NUY A;  3SEX A;  4WXJ A;  1MS7 A;  4LQ5 A;  2QVR A;  4H45 A;  1FPE A;  1LAX A;  1FPL A;  2ALU A;  3U65 A;  2AIX A;  3SKP A;  3QUF A;  2Q88 A;  4MMP A;  2FYI A;  3MZB A;  3HN0 A;  3C33 A;  3BBR A;  3UN6 A;  2HCA A;  4IY6 A;  2VGQ A;  1M5D A;  3IK6 B;  4PF6 A;  1P1Q A;  4MLV A;  1MXX A;  1VSO A;  4GLI A;  4EQB A;  4ZEB A;  5H8H B;  3IFA A;  2H4I A;  3ECR A;  4NGU A;  1EYI A;  4OVQ A;  1M5E A;  4KQP A;  1UTB A;  1UTH B;  1USY H;  3H6W A;  3SET A;  3OO7 A;  2F7C A;  5EQ8 A;  4I40 A;  3RYD A;  2A5T A;  3TKD A;  3KEI A;  3SER A;  1MY3 A;  2QPQ A;  3U93 A;  2QS4 A;  1MXZ A;  2Y5L A;  2F7A A;  2XXY A;  2UVH A;  1MPD A;  4MCO A;  3FV2 A;  4FEB A;  1T0K A;  4UAB A;  4GXA A;  3C34 A;  4G8H A;  4FBP A;  5I57 A;  4U22 A;  3D4C A;  4QSD A;  3PMW A;  3PPR A;  3PAM A;  1NKX A;  4N91 A;  3O9P A;  1JEV A;  4Z7E A;  2RC8 A;  4AQ4 A;  3C9H A;  1ZJL A;  3A29 A;  3JV9 A;  2DP8 A;  2O69 A;  4OET A;  4IO2 A;  2ZNS A;  3IX1 A;  4I8C A;  1D9Y A;  4PDH A;  1Y1Z A;  2ZXT A;  1RDZ A;  5AA2 B;  5I58 B;  1D3K A;  5I59 A;  1P99 A;  3TEL A;  4DXU A;  4OAN A;  1JEU A;  1JW4 A;  4MF3 A;  5I2K A;  1PDA A;  1URG A;  4IO3 A;  2XWO A;  3USD A;  4F19 A;  2OZZ A;  3KN7 A;  1D9Q A;  2CMO A;  2I4B A;  1Y4T A;  2GHB A;  4KCC A;  4LA9 A;  1Y1M A;  2ZYO A;  4TLM B;  2DWJ A;  2F6G A;  1JW1 A;  4FE8 A;  5EYH A;  2Q8J A;  4IGT A;  2XWK A;  3KFM A;  3DRF A;  5IGA A;  1HSL A;  5IZ1 A;  1BP5 A;  1B32 A;  4K3F A;  1MQG A;  4C1T A;  1OLA A;  2A5S A;  2PMS A;  3A3U A;  2F7B A;  4N8Y A;  1FTJ A;  4IO6 A;  3K02 A;  2HAU A;  3C36 A;  4H65 A;  3GXA A;  3MPK A;  2VT5 A;  4PAI A;  2XHD A;  4GBW A;  5I56 A;  4RXL A;  2F3D A;  4LAT A;  3R6U A;  4P0G A;  3TYH A;  3R7X A;  3T66 A;  2P1S A;  5H8F B;  2PT2 A;  5JTY A;  4IO5 A;  1LST A;  1IMA A;  1H44 A;  3DEL B;  3FJ7 A;  4O8M A;  3S9M C;  3KN8 A;  4GL0 A;  4P1L A;  2YJP A;  1D4N A;  1WOD A;  1XOC A;  1YAE A;  4YKK A;  3K01 A;  3JZJ A;  2HZL A;  1EZO A;  4QSE A;  3U72 A;  2V25 A;  2O84 X;  2O51 A;  1B3L A;  2DWH A;  4KPT A;  3VE1 B;  4MNC A;  4XIG Q;  4H8J A;  1B4Z A;  4DDD A;  2XXQ A;  3V83 A;  1TWY A;  1QUJ A;  4AB6 A;  3HHF A;  4OQO A;  1P1O A;  1UTB B;  4ELO A;  5J16 A;  1YCJ A;  5BWJ A;  2I49 A;  1A54 A;  4OTE A;  2Y84 A;  1B3F A;  4ZEC A;  2B65 A;  2I3V A;  4GWO A;  1B9J A;  3HV1 A;  4QFO A;  5L8D A;  4NF5 A;  3IO6 A;  5BUU A;  4YZZ A;  3DP4 A;  3GLB A;  2I58 A;  3CG1 A;  4G68 A;  3TUS A;  2P3N A;  1SD3 A;  3PU5 A;  2HZK A;  4PFW A;  5I57 B;  3G7W A;  4JVI A;  1N3X A;  4OVS A;  3QXM A;  5DVJ A;  1Q1K A;  3OD7 A;  3RPW A;  4U4X A;  3N94 A;  3T9X B;  1QKA A;  1FQB A;  2XX8 A;  3CSG A;  2V4C A;  4YMB A;  2BJI A;  4R75 A;  2YPN A;  4YMA A;  1FPJ A;  5HM4 B;  4M4G A;  4U1Z A;  1II5 A;  1PB7 A;  1Q35 A;  1Z7M E;  4OVJ A;  5KCJ A;  2H5Y A;  4MJO A;  1BK4 A;  1JVX A;  4C0R A;  4QFK A;  3OEL A;  1R6Z A;  2OBG A;  1K9Y A;  3KOS A;  4ZED A;  2NVU B;  5F7V A;  4DIG A;  1I69 A;  1LLS A;  2QJE A;  1B5H A;  4OXV A;  3EQ1 A;  4O3A A;  5ET5 A;  4OFO A;  3T9V A;  3O6G A;  1R9Q A;  1PB8 A;  4JDF A;  3T1B A;  3OO9 A;  3O66 A;  2ABH A;  1YZ0 A;  5KDT A;  4AS4 A;  3E13 X;  2Z8F A;  4FIM A;  1SI0 A;  2OWS A;  2XXR A;  3GBA A;  5ITP A;  1SYI A;  4RY1 A;  1UIU A;  3KC0 A;  4KI0 E;  1LB9 A;  2GHA A;  1FRP A;  2Z23 A;  3LSX A;  3S9L C;  3QSL A;  1MQD A;  3MPL A;  4ZEI A;  1JNF A;  4ND9 A;  1INP A;  2F8D A;  5I3S A;  1XVX A;  5EYG A;  4KR5 A;  3CVG A;  1H3D A;  2WYP A;  1LBZ A;  3EF7 A;  2WX9 A;  2E0S A;  1NNF A;  5JTY B;  3M3L A;  2GQ1 A;  5B7D A;  2R6G E;  4U23 A;  1SDX A;  2NOO A;  3FJG A;  2HHM A;  3IB0 A;  3R26 A;  5ICT A;  1IMB A;  4PE3 A;  3PPQ A;  1GTK A;  3UOR A;  2FBP A;  1AH5 A;  4HTG A;  3MVY A;  1IME A;  2QRY A;  2G93 A;  1VFE A;  3KJT A;  4KYE A;  3M8U A;  1SYH A;  4PP0 A;  3IAZ A;  3RT6 B;  3T93 B;  3U1O A;  5I84 A;  2YLN A;  1B7U A;  2UXA A;  4ZEF A;  1P1N A;  5IAI A;  2UVI A;  1KA0 A;  4ZZA A;  3N6T A;  2Y7W A;  3RUM A;  2OWT A;  3T9U A;  1US4 A;  2Q89 A;  1UIV A;  4ISU A;  4P9K A;  1LBX A;  4NF5 B;  3GZG A;  5JK4 A;  3B8B A;  2HXR A;  3V5A A;  3CFZ A;  3TTR A;  3K4U A;  3FAT A;  4G68 B;  4OVP A;  1AWB A;  4P11 A;  3K0V A;  2ZZV A;  2H9B A;  3QAX A;  3O6P A;  3IB2 A;  2V84 A;  5B70 A;  1DOT A;  1B05 A;  3N5L A;  2H98 A;  1BIY A;  3MZ9 A;  4GWX A;  3KJ7 A;  5ET7 A;  3FJM A;  2QL3 A;  1LFH A;  2DXR A;  5ESY A;  1J1N A;  1SPI A;  2BJJ X;  3LC8 A;  5AA3 A;  5CMM A;  3ILT B;  4N15 A;  3ZKK A;  3CR9 A;  3LVU A;  1LBW A;  1YPN A;  5KCJ B;  1LGB C;  1BLF A;  4MFI A;  3CFL A;  3HHG A;  4X48 A;  2NXO A;  1M5F A;  3MBP A;  4PCD A;  4GBV A;  5DEX B;  1EYK A;  4G4P A;  5CC2 A;  4O7I A;  1ZKB A;  4EF1 A;  1VFD A;  1BTJ A;  4NE4 A;  4U21 A;  2I0C A;  1SW4 A;  2O1M A;  4P0I A;  4KD5 A;  1TFA A;  4PFY A;  2F36 A;  4XKP A;  3KSJ A;  4NF4 B;  3DLN A;  3G3G A;  3PPP A;  1MH4 A;  2WEF A;  4NED A;  1QJM A;  5KDT B;  1G0I A;  3LUY A;  1EU8 A;  1MXW A;  2XD2 A;  4F1Y A;  1TT1 A;  4OEV A;  3KZG A;  4DI4 B;  5ITO A;  1FBC A;  1SW5 A;  3TZA A;  1N84 A;  4EQ7 A;  3MVW A;  3Q29 A;  5H8N A;  1QUL A;  3OSR A;  3S9N C;  1ZIU A;  2IEE A;  3W9W A;  1QW0 A;  4DCX A;  1B51 A;  5HBC A;  5KZT A;  4C1U A;  1GV8 A;  1UQW A;  2UYF A;  4QFP A;  3VVF A;  1ZU0 A;  4H6D A;  2RCB A;  3SEW A;  3BIH A;  4P3L A;  4QFN A;  1B7Z A;  3DRG A;  2PYY A;  4LP2 B;  1L5T A;  1PBQ A;  4OER A;  2G29 A;  5IM2 A;  4HW8 A;  2PCR A;  3TCF A;  2ZYK A;  5F24 A;  4G2Z A;  4R6K A;  3Q26 A;  4PDD A;  3DRI A;  1PC3 A;  4OHN A;  5ICQ A;  2ZMB A;  1XHY A;  3KC1 A;  4LON B;  3MC2 A;  3FGS A;  1IMF A;  3VLU A;  3LUZ A;  1DBZ A;  4HXV A;  4JVC A;  1CE2 A;  1B2H A;  1JQF A;  4NHB A;  1POY 1;  1MQJ A;  4EF2 A;  1Q9D A;  4PTK A;  1DSN A;  2WOP A;  3TEP A;  3FVO A;  4F3B A;  1DCU A;  5M2V A;  1G0H A;  2P0S A;  5H8S A;  4NF8 A;  1IXH A;  2P3V A;  1NV0 A;  4RJZ A;  1NL5 A;  1AMF A;  3O6H A;  2Y7R A;  5TPA A;  2ZYM A;  3H03 A;  4P1E A;  2ONS A;  1Y3Q A;  2DVZ A;  5CI5 A;  1FSA A;  3RTF B;  1NUZ A;  3DRK A;  1QUI A;  1ZLQ A;  4YU0 A;  2ZNU A;  3KBR A;  4I9D A;  4OWD A;  4N4U A;  2I6E A;  5AE4 A;  1S50 A;  4NF0 A;  3DRH A;  2PVU A;  3PD8 A;  1OQH A;  1IQ7 A;  1QKB A;  4L17 A;  3PTY A;  2FIE A;  1ZTY A;  4OFJ A;  4PF8 A;  3TQW A;  4OYV A;  2F3B A;  4GX6 A;  1JP4 A;  3FZV A;  2FVZ A;  1N3W A;  2O6A A;  4GD5 A;  3KG2 A;  4OVT A;  3RTW B;  4JB7 A;  4F1U A;  1IXC A;  2F34 A;  2CEX A;  3H6V A;  3BIG A;  4HCW A;  3G3J A;  2R71 A;  3LV0 A;  4NN3 A;  4F1V A;  5AA2 D;  4PE5 B;  1HSE A;  1NMU A;  3IL1 B;  2DE3 A;  1TFD A;  1YXI A;  1O64 A;  3KN3 A;  3IR1 A;  3E3K A;  3S9E A;  1EZP A;  2XX9 A;  1FPK A;  4YKP A;  4R2F A;  4ONY A;  4MIJ A;  4ZE8 A;  1ELJ A;  2O1L A;  4IGR A;  4Q30 B;  3KSX A;  4JWX A;  3ZSF A;  4E0W A;  4NX1 A;  3SEU A;  3IFC A;  4QBA A;  4G61 A;  2IA4 A;  4XF5 A;  2H99 A;  2XXP A;  4RPN A;  5H8N B; 
#chains in the Genus database with same CATH homology
 3TPA A;  1H43 A;  1O63 A;  2I3W A;  3G3F A;  3IOU A;  4G68 C;  2DOJ A;  4Q0C A;  3QUJ A;  4KYS A;  5FHN A;  3K6U A;  4F22 A;  3ZS6 A;  4POX A;  5DT6 A;  2Z8D A;  2ONK E;  3I3V A;  3V89 B;  3PPN A;  1IEJ A;  1RYO A;  1B4H A;  2AL5 A;  1URS A;  4ECF A;  3OEN A;  4QRZ A;  4N13 A;  3MUQ A;  5LOM A;  3RNN A;  3FXR A;  3KOT A;  3IB1 A;  3UA8 A;  3UP9 A;  3SES A;  1N7W A;  5DYH A;  3W15 C;  5AA4 A;  4RK2 A;  5EHS A;  4Z0I A;  3T96 B;  3Q25 A;  3K00 A;  2XX7 A;  1RKM A;  3K6V A;  1FQA A;  1B5I A;  1MXU A;  3OSQ A;  3EHS A;  4ELQ A;  3O97 A;  2UVG A;  3EN3 A;  1NNT A;  3CFX A;  4FOR A;  4LZ8 A;  1OVT A;  2Y7K A;  3VV5 A;  4NF8 B;  1HSJ A;  3O6I A;  5DEX A;  2XXX A;  5TPA B;  5ELV A;  5CMC A;  1IIW A;  1NNP A;  4POW A;  4XKQ A;  4EXL A;  4U4S A;  1H76 A;  3BKI B;  1BKA A;  4BDN A;  1O7T A;  3TTN A;  4R6Y A;  3OXN A;  3RYB A;  4FAJ A;  2QS3 A;  4X1D A;  3OOA A;  4NF4 A;  2Q2C A;  3IJX B;  1JVY A;  5J1D A;  4WED A;  3VXC A;  2I4C A;  1MXY A;  5FTH A;  1LB8 A;  2DWA A;  3TTK A;  5A5X A;  3MP1 A;  4HCY A;  1AOV A;  4EQ9 A;  2ZYN A;  3VXB A;  1NH7 A;  1A99 A;  4RPO A;  3IOV A;  5K2X A;  2B3F A;  3FVG A;  2D5W A;  4IO4 A;  4JSO A;  1B3E A;  4ESX A;  3TDJ A;  2OCU A;  4KYD A;  3PUW E;  4GVO A;  3TCH A;  4F39 A;  2P2A A;  2NWJ A;  2KLF A;  1CB6 A;  3ONM A;  4YKI A;  3EHT A;  1PEB A;  4O3B A;  1B6H A;  4R9G A;  3BFU A;  1MDP 1;  2VOZ A;  4KCD A;  1OQG A;  2DS9 A;  2UVJ A;  1JET A;  3F11 A;  4R73 A;  3U8Q A;  3TOD A;  2B3B A;  1S7Y A;  5FHM A;  4HS7 A;  1FTL A;  1B3G A;  2XXI A;  1RYX A;  1B46 A;  1SVX B;  4TQU Q;  1VE4 A;  1A55 A;  4M1V A;  1GGG A;  2V3U A;  4ZS9 A;  4O3C A;  1FTK A;  3WAE A;  4R6H A;  3O2A A;  4NF6 A;  1B1X A;  3T9H B;  3DM0 A;  3IOR A;  2Z22 A;  4GOT A;  4F3G A;  4R74 A;  4GRK A;  3EPE A;  2ESN A;  1LFG A;  3FAS A;  4F2Q A;  4YAH X;  1B0L A;  5AA4 B;  1LCF A;  4THI A;  3I5O A;  3VVD A;  2ZNT A;  3N6U A;  3QK6 A;  2F35 A;  3TFL A;  4DE8 A;  4I1D A;  3CG3 A;  4RK9 A;  2WKY A;  2DQV A;  5I2N B;  3RQT A;  4OEN A;  3K1N A;  1FQE A;  3MW0 A;  4QFL A;  3N26 A;  3V8X B;  3FIR A;  1IUD A;  1Y3P A;  4H67 A;  2FNC A;  4MH5 A;  1MQH A;  3C35 A;  3TMG A;  4IB2 A;  4QHQ A;  2UYE A;  2V3T A;  4F2O A;  3OEM A;  2AYS A;  3EHU A;  1IZ1 A;  5H8Q A;  1P1U A;  4YB5 A;  2RIN A;  2F78 A;  3CRB A;  1NFT A;  5DVI A;  1FCK A;  1DPP A;  4AB5 A;  3A09 A;  2XXW A;  2WOK A;  4GXS B;  1SQY A;  2Q9T A;  3RN8 A;  2HAV A;  2B4M A;  4YIC A;  3PMX A;  2Y7I A;  4GFR A;  4YB6 A;  4U1O A;  4F3P A;  5A5X B;  1MG1 A;  2RKM A;  3H6U A;  2PT1 A;  1XS5 A;  3WAF A;  2FA7 A;  4F18 A;  3MP8 A;  3PGF A;  1IXI A;  3I6V A;  4FJP A;  1EZ9 A;  5DTB A;  3RY3 A;  2V93 A;  3G3K A;  1DMB A;  1JW5 A;  1EH3 A;  3MP6 A;  3IO4 A;  3THI A;  4N07 A;  1YTV A;  4Q5T A;  1MPB A;  3JYR A;  2F6P A;  3S4U A;  5L9O A;  3H3G A;  2QS1 A;  4BLA A;  1ANF A;  1SW2 A;  2DVC A;  3CHG A;  1MXV A;  3MZ1 A;  3SEY A;  4R9F A;  2RC9 A;  1MY0 A;  3PUY E;  3PUZ E;  3PD9 A;  3HCQ A;  3AXF A;  1S9T A;  3VDF A;  3QIM A;  2NUV A;  3OO6 A;  1DTG A;  3H06 B;  3LSW A;  3Q27 A;  1PB9 A;  2AL4 A;  2XXV A;  1M5C A;  1QVS A;  3CI8 A;  3FVK A;  4X1B A;  1R1N A;  4GL8 A;  3U94 A;  1FQD A;  3RLF E;  2D21 A;  4NF6 B;  4Q8R A;  2W7Y A;  1MDQ A;  2THI A;  3O29 A;  2O68 A;  1I6A A;  1MM7 A;  4UAC A;  3ZKL A;  3TTM A;  3LSL A;  3LSF B;  2GRV A;  4FED A;  1KWH A;  2DWI A;  2M8C A;  4OFL A;  4IY5 A;  3K1P A;  4ELP A;  1F9B A;  1B0H A;  1FW0 A;  4TLL B;  1A40 A;  2RCA A;  4FAT A;  2VD2 A;  4QF9 A;  4DLD A;  4DZ1 A;  4LVQ A;  4NMY A;  2VP1 A;  4WEP A;  3FXU A;  4PQJ A;  2XXH A;  4H5G A;  1OVB A;  2DE2 A;  1D9V A;  1TXF A;  4ZEK A;  2DE4 A;  2QSX A;  4KFQ A;  3M3K A;  1MM6 A;  3G3I A;  3MJN A;  3PUV E;  1XT8 A;  3SEV A;  3M3F A;  5H8Q B;  4BDR A;  1R9L A;  4ESW A;  3QYT A;  1B1H A;  4G8N A;  2REG A;  3FTO A;  2X7Q A;  3LR1 A;  4TOZ A;  5AA1 A;  3H4Z A;  3MAM A;  1M5B A;  4N6P A;  2GH9 A;  1LAH E;  1NH8 A;  3ODB A;  2ONR A;  5HPQ A;  1LFI A;  3HPI A;  4H5F A;  1LCT A;  1DPE A;  4H0W A;  3LBS A;  1Y3N A;  3VVE A;  3FD3 A;  4NWC A;  4GQO A;  4F29 A;  5CBR A;  3TTL A;  1FQC A;  4UA8 A;  1FTM A;  2HFB A;  3E9X A;  3IJO B;  4MBP A;  1DTZ A;  2XXT A;  1Y9U A;  1URD A;  3UK4 A;  1B5J A;  3PUX E;  4NTL A;  5CM6 A;  4DXC A;  3HST A;  1I6B A;  5TP9 A;  2E1S A;  4FEC A;  3UIF A;  3FXQ A;  1IXG A;  3A3C A;  2HXW A;  1IIT A;  4XTC Q;  3T22 A;  2A5T B;  1A7L A;  3U92 A;  3RGY A;  5EHM A;  3PPO A;  4F3S A;  4I62 A;  3TAJ A;  4R72 A;  2CZL A;  4OEU A;  5L9S A;  1B7H A;  2F97 A;  4KHZ E;  1SW1 A;  3G3H A;  1ZBM A;  4DCY A;  3DRJ A;  2Z8E A;  5F1Q A;  4R2B A;  2OJT A;  3OO8 A;  1MRP A;  3B6T A;  1POT A;  3UGW A;  1MY2 A;  5I2N A;  1PBP A;  3Q28 A;  2XD3 A;  4EUO A;  1B3H A;  5K2Y A;  1QUK A;  4EDP A;  2DYX A;  3GBB A;  4H1X A;  2HQ0 A;  1WVJ A;  3IOT A;  4NWD A;  4XXU A;  4YB7 A;  2B4L A;  5IKB A;  4X9T A;  3K1M A;  3TCG A;  4GF8 A;  3PV0 E;  5I59 B;  1SI1 A;  3VFJ A;  5FTI A;  5I2K B;  4BDO A;  3PMV A;  3BFT A;  1GVC A;  5EYF A;  2DXY A;  3MQ9 A;  4PFT A;  3FV1 A;  4QSC A;  3OMB A;  5CRY A;  1LBC A;  4JWO A;  1Y20 A;  5DVF A;  3K6W A;  2DSF A;  2O7U A;  2XXU A;  1H45 A;  1VR5 A;  1LAG E;  1AL3 A;  3MVX A;  4RYA A;  2PX1 A;  1OLC A;  1N0T A;  4BDQ A;  3SDF A;  5CBS A;  2WOL A;  3RYA A;  2QMW A;  4LUB A;  3IOW A;  2Q2A A;  5H8H A;  3O28 A;  1US5 A;  1MPC A;  4RA1 A;  4MLQ A;  3RT8 A;  4PET A;  3C4M A;  1NNK A;  4OES A;  1UTH A;  1USY E;  5I56 B;  2OK2 A;  3DP6 A;  1P1W A;  5FHO A;  3B6W A;  1WDN A;  1N76 A;  3W9V A;  1N7X A;  2HEU A;  1SBP A;  2V3Q A;  1XVY A;  1N04 A;  1ATG A;  1MQI A;  1MY4 A;  4ZDM A;  3H6T A;  1AIV A;  4F31 B;  1XC1 A;  1ZMG A;  3FUZ A;  2ANJ A;  2F5X A;  3DP8 A;  2VHA A;  4ZZE A;  1B52 A;  3S2V A;  4ZE9 A;  2QS2 A;  3MVZ A;  5CMK A;  1LBB A;  5CMB A;  3C32 A;  3KGC A;  3B6Q A;  3L6H A;  5TP9 B;  4GIZ A;  3C31 A;  3K6X A;  4BDL A;  4E0X A;  1A8F A;  4H8I A;  3E4R A;  1FQF A;  4PFU A;  2R9J A;  5AA2 A;  1B58 A;  2PBW A;  2REJ A;  5ISU A;  3TQL A;  5I58 A;  1MH3 A;  5TU0 A;  4DXB A;  4WKM A;  2Y7P A;  4OZ9 A;  4LQ2 A;  4YKJ A;  2I0B A;  1I6Q A;  1MY1 A;  1LAF E;  4XKR A;  4OMB A;  3L6G A;  3D4G A;  1OMP A;  1OIB A;  4JXI A;  3K2D A;  4EXK A;  3CSB A;  2QMX A;  4XKN A;  4ELR A;  2RC7 A;  4JBZ A;  2GFE A;  3P7I A;  5JEI A;  2OLB A;  4JWY A;  1A8E A;  2LAO A;  4G77 A;  3CIJ A;  3B7D A;  1FTO A;  3VLW A;  5L9M A;  2O7I A;  4BDM A;  2X26 A;  4LZ7 A;  3H7M A;  1GR2 A;  1B40 A;  4G8M A;  3HO7 A;  2VD3 A;  2I48 A;  3MWB A;  2X7P A;  4LZ5 A;  2D3I A;  1Y4C A;  3VLV A;  4RNS A;  5H8F A;  4IO7 A;  4U2R A;  2H25 A;  1Z7N E;  3FVN A;  3ILU B;  2RF1 A;  4JSD A;  3OEK A;  3SEX A;  4WXJ A;  1MS7 A;  4LQ5 A;  1LAX A;  2ALU A;  2AIX A;  3SKP A;  3QUF A;  2Q88 A;  2FYI A;  3MZB A;  3HN0 A;  3C33 A;  3BBR A;  3UN6 A;  2HCA A;  4IY6 A;  2VGQ A;  1M5D A;  3IK6 B;  1P1Q A;  4MLV A;  1MXX A;  1VSO A;  4GLI A;  4EQB A;  4ZEB A;  5H8H B;  2H4I A;  3ECR A;  1M5E A;  4KQP A;  1UTB A;  1UTH B;  1USY H;  3H6W A;  3SET A;  3OO7 A;  2F7C A;  2A5T A;  3TKD A;  3KEI A;  3SER A;  1MY3 A;  2QPQ A;  3U93 A;  2QS4 A;  1MXZ A;  2F7A A;  2XXY A;  2UVH A;  1MPD A;  3FV2 A;  4FEB A;  1T0K A;  4GXA A;  3C34 A;  4G8H A;  5I57 A;  4U22 A;  3D4C A;  4QSD A;  3PMW A;  3PPR A;  3PAM A;  1NKX A;  3O9P A;  1JEV A;  4Z7E A;  2RC8 A;  4AQ4 A;  3C9H A;  1ZJL A;  3JV9 A;  2DP8 A;  2O69 A;  4OET A;  4IO2 A;  2ZNS A;  3IX1 A;  4I8C A;  1D9Y A;  1Y1Z A;  2ZXT A;  5AA2 B;  5I58 B;  1D3K A;  5I59 A;  1P99 A;  3TEL A;  4DXU A;  1JEU A;  1JW4 A;  4MF3 A;  5I2K A;  1PDA A;  1URG A;  4IO3 A;  3USD A;  4F19 A;  2OZZ A;  3KN7 A;  2CMO A;  2I4B A;  1Y4T A;  2GHB A;  4KCC A;  4LA9 A;  1Y1M A;  2ZYO A;  4TLM B;  2DWJ A;  2F6G A;  1JW1 A;  4FE8 A;  2Q8J A;  4IGT A;  3KFM A;  3DRF A;  1HSL A;  1BP5 A;  1B32 A;  4K3F A;  1MQG A;  4C1T A;  1OLA A;  2A5S A;  2PMS A;  3A3U A;  2F7B A;  1FTJ A;  4IO6 A;  3K02 A;  2HAU A;  3C36 A;  4H65 A;  3GXA A;  3MPK A;  2XHD A;  5I56 A;  4RXL A;  4LAT A;  3R6U A;  4P0G A;  3TYH A;  3R7X A;  3T66 A;  2P1S A;  5H8F B;  2PT2 A;  5JTY A;  4IO5 A;  1LST A;  1H44 A;  3DEL B;  3FJ7 A;  3S9M C;  3KN8 A;  4GL0 A;  2YJP A;  1D4N A;  1WOD A;  1XOC A;  1YAE A;  4YKK A;  3K01 A;  3JZJ A;  2HZL A;  1EZO A;  4QSE A;  3U72 A;  2V25 A;  2O84 X;  2O51 A;  1B3L A;  2DWH A;  4KPT A;  3VE1 B;  4XIG Q;  4H8J A;  1B4Z A;  4DDD A;  2XXQ A;  3V83 A;  1TWY A;  1QUJ A;  4AB6 A;  3HHF A;  4OQO A;  1P1O A;  1UTB B;  4ELO A;  1YCJ A;  5BWJ A;  2I49 A;  1A54 A;  4OTE A;  2Y84 A;  1B3F A;  4ZEC A;  2B65 A;  2I3V A;  4GWO A;  1B9J A;  3HV1 A;  4QFO A;  5L8D A;  4NF5 A;  3IO6 A;  5BUU A;  4YZZ A;  3DP4 A;  3GLB A;  2I58 A;  3CG1 A;  4G68 A;  3TUS A;  1SD3 A;  3PU5 A;  2HZK A;  4PFW A;  5I57 B;  3G7W A;  1N3X A;  3QXM A;  5DVJ A;  1Q1K A;  3OD7 A;  3RPW A;  4U4X A;  3N94 A;  3T9X B;  1QKA A;  1FQB A;  2XX8 A;  3CSG A;  4YMB A;  4R75 A;  2YPN A;  4YMA A;  5HM4 B;  4M4G A;  4U1Z A;  1II5 A;  1PB7 A;  1Q35 A;  1Z7M E;  4OVJ A;  5KCJ A;  2H5Y A;  1JVX A;  4C0R A;  4QFK A;  3OEL A;  1R6Z A;  2OBG A;  3KOS A;  4ZED A;  2NVU B;  5F7V A;  4DIG A;  1I69 A;  1LLS A;  2QJE A;  1B5H A;  4OXV A;  3EQ1 A;  4O3A A;  4OFO A;  3T9V A;  3O6G A;  1R9Q A;  1PB8 A;  4JDF A;  3OO9 A;  3O66 A;  2ABH A;  5KDT A;  3E13 X;  2Z8F A;  4FIM A;  1SI0 A;  2OWS A;  2XXR A;  3GBA A;  5ITP A;  1SYI A;  4RY1 A;  1UIU A;  4KI0 E;  1LB9 A;  2GHA A;  2Z23 A;  3LSX A;  3S9L C;  3QSL A;  1MQD A;  3MPL A;  4ZEI A;  1JNF A;  4ND9 A;  2F8D A;  1XVX A;  4KR5 A;  3CVG A;  1H3D A;  3EF7 A;  2E0S A;  1NNF A;  5JTY B;  3M3L A;  5B7D A;  2R6G E;  4U23 A;  1SDX A;  2NOO A;  3FJG A;  3IB0 A;  3R26 A;  5ICT A;  3PPQ A;  1GTK A;  3UOR A;  1AH5 A;  4HTG A;  3MVY A;  2QRY A;  2G93 A;  1VFE A;  3KJT A;  4KYE A;  3M8U A;  1SYH A;  4PP0 A;  3IAZ A;  3RT6 B;  3T93 B;  3U1O A;  5I84 A;  2YLN A;  1B7U A;  2UXA A;  4ZEF A;  1P1N A;  5IAI A;  2UVI A;  4ZZA A;  3N6T A;  2Y7W A;  3RUM A;  2OWT A;  3T9U A;  1US4 A;  2Q89 A;  1UIV A;  4ISU A;  4NF5 B;  3GZG A;  5JK4 A;  3V5A A;  3CFZ A;  3TTR A;  3K4U A;  3FAT A;  4G68 B;  4P11 A;  3K0V A;  2H9B A;  3QAX A;  3O6P A;  3IB2 A;  2V84 A;  5B70 A;  1DOT A;  1B05 A;  3N5L A;  2H98 A;  1BIY A;  3MZ9 A;  3KJ7 A;  3FJM A;  2QL3 A;  1LFH A;  2DXR A;  1J1N A;  2BJJ X;  3LC8 A;  5AA3 A;  5CMM A;  3ILT B;  3ZKK A;  3CR9 A;  3LVU A;  1YPN A;  5KCJ B;  1LGB C;  1BLF A;  4MFI A;  3CFL A;  3HHG A;  4X48 A;  2NXO A;  1M5F A;  3MBP A;  5DEX B;  4G4P A;  5CC2 A;  1ZKB A;  4EF1 A;  1VFD A;  1BTJ A;  4NE4 A;  4U21 A;  2I0C A;  1SW4 A;  2O1M A;  4P0I A;  4KD5 A;  1TFA A;  4PFY A;  2F36 A;  4XKP A;  3KSJ A;  4NF4 B;  3DLN A;  3G3G A;  3PPP A;  1MH4 A;  4NED A;  1QJM A;  5KDT B;  3LUY A;  1EU8 A;  1MXW A;  2XD2 A;  4F1Y A;  1TT1 A;  4OEV A;  3KZG A;  5ITO A;  1SW5 A;  3TZA A;  4EQ7 A;  1N84 A;  3MVW A;  3Q29 A;  5H8N A;  1QUL A;  3OSR A;  3S9N C;  1ZIU A;  2IEE A;  3W9W A;  1QW0 A;  4DCX A;  1B51 A;  5HBC A;  5KZT A;  4C1U A;  1GV8 A;  1UQW A;  2UYF A;  4QFP A;  3VVF A;  1ZU0 A;  4H6D A;  2RCB A;  3SEW A;  4QFN A;  1B7Z A;  3DRG A;  2PYY A;  4LP2 B;  1L5T A;  1PBQ A;  4OER A;  2G29 A;  4HW8 A;  3TCF A;  2ZYK A;  4G2Z A;  4R6K A;  3Q26 A;  3DRI A;  1PC3 A;  4OHN A;  5ICQ A;  2ZMB A;  1XHY A;  4LON B;  3MC2 A;  3FGS A;  3VLU A;  1CE2 A;  1B2H A;  1JQF A;  1POY 1;  1MQJ A;  4EF2 A;  1DSN A;  2WOP A;  3TEP A;  3FVO A;  4F3B A;  5M2V A;  2P0S A;  5H8S A;  4NF8 A;  1IXH A;  4RJZ A;  1NL5 A;  1AMF A;  3O6H A;  2Y7R A;  5TPA A;  2ZYM A;  3H03 A;  2ONS A;  1Y3Q A;  2DVZ A;  5CI5 A;  3RTF B;  1QUI A;  3DRK A;  1ZLQ A;  4YU0 A;  2ZNU A;  3KBR A;  4I9D A;  4OWD A;  2I6E A;  5AE4 A;  1S50 A;  3DRH A;  2PVU A;  3PD8 A;  1OQH A;  1IQ7 A;  1QKB A;  4L17 A;  1ZTY A;  4OFJ A;  3TQW A;  4OYV A;  3FZV A;  1N3W A;  2O6A A;  4GD5 A;  3KG2 A;  3RTW B;  4JB7 A;  4F1U A;  1IXC A;  2F34 A;  3H6V A;  4HCW A;  3G3J A;  2R71 A;  4F1V A;  5AA2 D;  4PE5 B;  1HSE A;  1NMU A;  3IL1 B;  2DE3 A;  1TFD A;  1O64 A;  3KN3 A;  3IR1 A;  3E3K A;  3S9E A;  1EZP A;  2XX9 A;  4YKP A;  4R2F A;  4ONY A;  4ZE8 A;  1ELJ A;  2O1L A;  4IGR A;  4Q30 B;  3KSX A;  4JWX A;  3ZSF A;  4E0W A;  3SEU A;  2IA4 A;  2H99 A;  2XXP A;  4RPN A;  5H8N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...