1B0UA

Atp-binding subunit of the histidine permease from salmonella typhimurium
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
NKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQSPRLQQFLKGSLKKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding subunit of an ABC transporter.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transport protein
molecule keywords HISTIDINE PERMEASE
total genus 90
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 1998-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1b0uA00
3UKDA 5DISB 3K0CA 3KUCA 2XTZA 2ZI9A 3BXZA 2XTNA 2HCBA 4IXNA 4A6XA 2ZU6A 4TMKA 1NSFA 3KFXA 3KKMA 1T5IA 5FPYA 2PJRA 2W2VA 3GLHA 3K70D 2GK7A 1TUIA 2XX3A 1GP2A 3TAUA 1VCNA 1G3MA 3EZ9A 4N0EA 5TDHA 1E96A 1V43A 2VH5R 5IHPA 2A5YB 4U02A 3DMDA 1AM4D 2NMVA 2J7PA 1D5CA 1LNZA 3QKRB 3H1TA 2BEKA 1PJRA 2XJ9A 1ELOA 3T1VA 3SBDA 4HUQB 5AUPB 3RS3A 1KZ7B 3AUYA 2ZVPX 4NL4H 1QVRA 1W2HA 2F3RA 3TW4A 2ZUBA 1EFUA 2EFHB 2FU5C 3SFZA 4AK9A 4C0AC 2ZYWX 4TSFD 3U6KA 5FUWA 1XPOA 2QAGC 3EZ6A 4PC3A 1NG9A 3G0HA 1Z06A 3THOA 4O0MA 4NCIA 4D2IA 5JBQA 4B6FA 5JHGB 4P3YA 4S2EA 5TB5A 5CITA 2OZEA 4EJSB 1P60A 1E2LA 2ZRHA 1XU4A 2ZE6A 3A1VA 4PZZA 2IYLD 3QXJA 2GWHA 5FOTA 2XNDA 4YC7A 5E3HA 3N70A 4K8OA 3TNFA 5J4LA 4UXHA 2AK3A 4D0LB 5KTYA 3OIYA 1KI7A 4UNSA 2CCJA 3FPAA 3AF3A 2IS1A 4AG5A 4URWR 4YMSA 1BH2A 3OE7A 2IYZA 2QQEA 2ZSFA 1FUKA 1J8MF 3LXXA 2VL7A 4C4PA 3GLIE 3FMFA 3DEFA 2QP9X 1ZIOA 3ADBA 4EPWA 3BH6A 1IY2A 3K0AA 2VP9A 2DY1A 4A4DA 4LJ5A 4C30A 1DEKA 3C15C 4NYIR 4DZZA 2E1RA 1N6PA 2B7BA 4PPNA 2OLJA 2JIZA 5G3YA 4QJ3A 2O8CB 1MABB 2IT1A 2EW1A 2QL6A 4OI4A 1R8SA 3H2YA 4KVAA 3FTQA 4GI7A 3RVBA 2IEZA 3BOSA 1Z0DA 4QGAA 1E4VA 2E9SA 2BV3A 4LJYA 3T5DA 2FEOA 2F43B 2WAYA 1M7GA 1Z83A 2OBMA 2QE7A 2GXSA 1NN0A 3SDZA 1R10A 2Y8EA 1KO4A 2D7CA 1UKEA 2YZ2A 4GL2A 1P2SA 1NLZA 2A7QA 5FOWA 5SZKB 3T15A 1QZXA 2PCJA 5AWFC 2YC4C 2ZRPA 5KNDA 1QHSA 2ERYA 3AEZA 2ZSEA 4NH0A 1KI6B 3IHWA 2VSOA 1HE8B 4KO8A 2R6DA 3NC1C 1EK0A 4GMXA 3AVXA 1FTSA 2AL7A 3RRNA 1UKVY 1GL6A 1LS1A 2O8FA 4L5BA 2BHRA 2PCLA 3K9HA 3THWB 4M1WA 1W36C 1YZUA 4HEJA 4Q66C 1MOZA 3RC8A 5F2EA 3QKTA 3Q8XB 1J2JA 3TRFA 1PZNA 2DFLA 3K0FB 2FG5A 2CHGA 1E0AA 2VP6A 3BERA 4GP6A 2CNWD 3RWMB 5K8TA 1X3SA 3HP1A 1KSJA 4POAA 3RAPR 3KKQA 4Q21A 2F55A 1HY3A 2QQ0A 4JL8A 1YQTA 5ELXA 5EXPA 2ZPTX 4ZKEA 2B21A 2WSSA 1ZIPA 3UK6A 4LYFA 5B57C 3HJNA 4A2PA 2G88A 3W3ZB 2O8DB 3IEUA 2G3YA 2ZRLA 3EWAA 5AR1A 1QHIA 1TAGA 1X86B 3VHXA 5B64A 2J87A 3C4JA 1OXSC 3VX3A 1XZQA 1EX6A 2QEQA 1UM8A 3SOPA 4WVFA 2JLWA 2IS6A 1FQJA 3ZD6A 3N2EA 1J70A 3H0KA 5DSZA 3VNUA 1UBFA 2V3CC 4ZO4A 5SZIA 1A5TA 3EWSA 5JEEA 1OHHA 3PUVA 3THWA 4CIDA 2RGGA 2DHRA 2BCJQ 2G6BA 3SR0A 4Q9LA 1Z0AA 3HDTA 2IF2A 1HA3A 2QP3A 3FE2A 1WXQA 1UKZA 1U81A 1ZM7A 2J45A 1GFIA 2H18A 1XD2A 3LAWA 1XJCA 1R0WA 4LHWA 3NBYC 3E70C 4Q9JA 4KHZA 4B34A 5F98A 2XNSA 2QG6A 2NGRA 4NHOA 2ODEA 3GLFA 3BE4A 1CS4C 3W6NA 5JWRA 3OE7D 4KCGA 4Q4HA 5HR5A 3H4MA 1Q12A 4PPQA 2BMEA 2IL1A 2NO1A 2OUKA 4JMPA 4LY6A 3SEAA 4HLQB 2D74A 2FE4A 4B48A 2YHSA 1AZTA 3CPHA 3U3KA 3P32A 1F6BA 2K5UA 1N5LA 2BC9A 4OL0A 4US1R 2ZJBA 1Q1BA 2OV2A 2ZI6A 3AV0B 5HCIA 1NMXA 1GAJA 2PX0A 5B2ZA 4ESHA 1Y63A 5IK2A 2F1IA 2AKAB 1N0WA 1P4SA 3PUZA 4HI0E 5FTMA 4M4SA 2YWEA 2VHQA 3ZYCA 1CF4A 1P62B 2QY9A 4WOPA 5JECA 2JIZD 2QTFA 3LWNA 3RS7A 3CRMA 4XVRA 1ZNYA 3P4XA 2REXB 3B1ZA 4O2LA 3FMPB 1VG8A 1FMLA 4O25A 3W90A 2Q3FA 2V9PA 1II9A 2CE2X 2ZU0C 1KO5A 3I3SR 1AKEA 4AURA 1NNEA 2A5DA 2XSZD 2NO0A 4LJ9A 2B92A 3NH6A 3LDAA 2O8CA 4PAQA 4C2TA 3SHWA 4F7WA 3AF1A 2J1LA 3H86A 3I1FA 2ODNA 4Z8XA 1M7BA 1KI9A 4M9QA 3U44A 1QHGA 2GZDA 3CRVA 1ZRHA 4LHZA 2AWOA 1F2TA 1FX0A 3KUDA 4ABYA 1CKEA 1GDDA 2QENA 4Q48A 4Q1EA 3RWOA 1VCOA 4DSNA 1QDEA 2OLKA 3TIFA 1OB2A 1G8HA 3TSWA 3GLFB 2CL6X 3HU1A 1R7RA 4ZKDA 2ZI5A 4PQYA 4B75A 4JLNA 5LD2B 1F3OA 4DB2A 2IYWA 4XIGS 2QRNA 4PO1A 4R98A 2J59A 2ZJOA 3QXSA 4MUAA 3SS8A 2RH5A 2GAAA 2GEVA 2ZRDA 4G5SA 1WRBA 5FPSA 4Q4JB 3CBQA 5DNYB 3AGPA 4G5QA 1W0JA 4BPBA 2J0QA 1VG0B 4ZIRB 4MGZR 2H57A 3EC2A 3GLHE 2GF9A 3KQHA 1OIVA 4FI3C 4JIMA 3LXRA 4HLCA 2WV9A 2CBZA 4NCNA 3B1VA 2WVJA 1SVMA 2YC2C 5JJLA 1L2TA 1Z5ZA 1N0VC 1W2GA 4LPSA 1KNQA 5EE5B 2PMKA 2OCYC 1DARA 4DLZA 3MRSA 2TMKA 4BFWA 4Q5IA 5EP3A 4PR0A 2W83A 4ZV4A 1FOEB 1Q3TA 3VR5A 1SXJB 4PHHA 2GESA 1XEWY 2C96A 3AVPA 1SVIA 4AKEA 3DM5A 3LX5A 2QM8A 2VO1A 3SJBA 1XDBA 2WSMA 3DO6A 3P26A 2H17A 4V0MA 2W6JD 1VYVA 4XWOA 3GJ8A 3QKSB 4PAMA 1CJMA 4DWJA 1PLLA 2NQ2C 3QPWA 5G41A 2CLSA 1AA9A 3W9YA 1TPZA 5IDVA 1HH4A 4EAQA 1M2OB 4OK6A 4LHYA 4RZXA 2FGJA 4B74A 5CDFE 1E6CA 4LZZA 3CW2A 2P6NA 3WP1B 5HCNA 4PO9A 1RVDA 3AP3A 5FR2A 4Q1BA 2ZJ5A 3KJHA 3GEIA 2JGNA 3SI7A 4OHWA 5EE3A 5JEDA 1OYWA 4NDZA 4WAUA 3ICQB 1QRAA 3RDPA 1IHUA 4BQSA 2ZRNA 3U44B 2AD1A 1OV4A 3MD0A 4HB2A 4ZDIA 3QF4A 4ITRC 1XX6A 4X8OA 3WHKA 4TL7A 2OM2A 4OQLA 1G8FA 1E0SA 2RMKA 4KBGA 5EE9A 2IYRA 1E0JA 1U8AA 1Q1QA 4JLOA 1N5JA 3U5ZB 1LW7A 1KI2A 3L0OA 1UBCA 1NLYA 1G41A 2AWNA 2D06A 3NKVA 4IEIA 4JT4A 3U60B 1Z6TA 5P21A 4C0JA 4A2WA 3BFVA 3I8SA 1T91A 1RRFA 1XXHB 1QHYA 3A4LA 3SC3A 1ZVQA 3VR6A 2JASA 4HAYA 1OXTA 1WB9A 2JAQA 2N46A 1QF9A 2GJSA 4LHVA 2A2ZA 4ZPXA 1IM2A 1X8LA 3IBYA 5DYIA 2WOOA 4D4KA 3L43A 1XMJA 3FFBA 4NU0A 4WA7A 3VMFA 1ZD1A 2HYIC 3BB1A 4JJZA 4KLZA 3DL0A 5TY0A 4Q7LA 3A58B 4JBWA 3GLHB 4DSTA 3FWYA 5JLJA 3M0EA 4I81A 4DBLC 2PZFA 4DDVA 5LD2C 1MO3A 3NHBA 4CEIA 4LBWA 3U4QB 4PHFA 3LX8A 1Z47A 2ZRIA 1KAOA 4TLEA 4UNQA 2GEDA 3TR5A 4D80A 1T3SA 1OKKA 1T6NA 5AUOB 2A5GA 4KSBA 3X1ZA 4A0GA 3PJRA 3PFIA 2R6FA 4JZKA 3GQBA 2IYTA 3VU9A 4W5HA 1S4QA 1ZNZA 4MKHA 3M1IA 2IF0A 2WWXA 4F4CA 1KKMA 2RKOA 3AKDA 3IPXA 1Y3AA 4URYR 2CE7A 4BLQA 521PA 4EDHA 1Q3HA 1YZQA 4QJ5A 1DAFA 4E03A 2VEDA 1W4AA 1QHNA 4EFLA 2ZUDA 1DOAA 1Z6YA 1F2UA 4BFSA 3G5UA 2ZYUX 4E5UA 3DOEA 3GFOA 1T9HA 1XWIA 3TSOA 2XXAB 2F6RA 4M1YA 4RSGA 8OHMA 5A4JA 4CVNA 3TQCA 5FL3A 4FMDF 5AJYA 4LC1A 5JI2E 1UJ2A 5FR1A 1OIXA 5AK0A 2BJVA 1QVAA 3QVVA 3U3MA 5A5GA 2QUZA 2HXSA 5LB4A 1P9RA 2REOA 5DE3A 3LLUA 1CR2A 2DFKB 4PAOA 4C9BA 3SQWA 3EA0A 2B6HA 2OSBA 3TGPA 2PT7A 2C8VA 2SHKA 2ZJAA 3CR7A 3U7HB 1VPLA 1T5LA 4L15A 3ADCA 3PITA 1SVWA 2VHJA 3EAQA 4Q01A 2WZQA 5KPJA 1W1WA 2JA1A 3TBKA 4WZBE 4YQFA 2G0NA 3VR4A 1GILA 4KODA 1ONBA 3KB1A 1KJWA 4I99A 2OFOA 4BECA 1KDTA 1LF5A 1JR6A 3QG5A 3MSXA 4IXMA 1JJVA 4WW0A 1N6NA 3T1OA 2WM9B 2ATXA 2VP0A 2F43A 5BYJA 1OPXA 1YR6A 2WJYA 3D6TB 3QQ5A 1KTVA 4L9SA 3KX2A 4AYTA 1A7JA 3FHOA 4A82A 4OQXA 4C0QC 1LVGA 5F9FA 3F0TA 4PTLA 4G1UC 2UVQA 1VIYA 2GJ8A 1OFHA 3I92A 3HU3A 5AJWA 4EFNA 1XTKA 4TYPA 2QPTA 4FN5A 5D3MA 1XMSA 2Z4RA 3K0EA 4RFSB 4DEXA 2E87A 5KDOA 1SVKA 3BRWD 5CDFA 3KB2A 4KVGA 4M0LA 2QT0A 5DYGA 3AVUA 3MWJA 4BFUA 3W8RA 2XJ4A 2RGNC 2LKCA 4F38A 2WMOB 3EARA 2AXPA 2BOVA 1U94A 3CZPA 1F2UB 2ZQ5A 2G0TA 1Z3IX 1PUJA 4PZLA 2QAGA 1FNMA 2ZR7A 1UF9A 3T35A 4HB0A 1OH8A 1WF3A 5G3ZA 3F8TA 1COWA 4AD8A 1R2QA 1PUIA 2BIFA 2QMHA 5IK2D 4FINA 1T3HA 3M6AA 4OQMA 4OI2A 4Q9IA 3TH5A 2Z5FA 1TU3A 4JL6A 4IRUB 1K5GA 3CKLA 1I4LD 2FV8A 3C14C 4KFSA 4F93B 3L8YA 3SHFA 2I1QA 2JJ1D 2ZYTX 1RRPA 3EZ2A 4GOXA 4LJ4A 1E9FA 2R6CA 5IRCD 1HQCA 5JZVA 1G9XA 1R5NA 5FPKA 1DE0A 4KBFA 4NYJR 3UWOA 1JEEA 3Q5DA 2NO7A 5JSZA 4JYBA 4AWXA 2UZ3A 4EPXA 1GRRA 3AVOA 3B7GA 3UG7A 3A4NA 3K9LA 2AN9A 3RS0A 1TADA 2KB0A 3LO5A 2G9NA 2FN4A 3QG1A 5E95A 4M1OA 3QF4B 4JLPA 1P9WA 2G1JA 1NF3A 1IY1A 1KI3A 4UJ5A 4B33A 4HYYA 2WPDA 4WXRA 1N0UA 4UXIA 1DG3A 2CHQA 1T3LA 3GD7A 4LHXA 1E2JA 3AH8A 3LLMA 1NY6A 2RHDA 1B0UA 1OH5A 1GTVA 1ZUIA 4V03A 1XD9A 3WHLA 2FF7A 3I5XA 2BMJA 4TZ0A 3CH4B 3PCRB 4I1SA 4XOIA 4I4LA 4I1OA 3PV0A 2FA9A 2RHMA 3AKYA 3CO5A 3IEVA 4I1UA 4M1SA 3DOFA 1NP6A 5GJWC 4D82A 2R65A 2ZRAA 3LQRA 4FCVA 5CJPA 3O8RA 3BORA 3L0IB 1HEIA 1GM5A 2QSYA 1FNNA 2ZS9A 3D3QA 4Q18A 1W7AA 3AP1A 1XTJA 1II0A 1N3BA 1DPFA 2WKQA 1OKKD 3G82C 1U0JA 4AI6A 2JJ2A 3L2OB 1BS1A 4QNRA 5DHAA 3WRYC 1DAKA 1U98A 3HU2A 4Q00A 3S1AB 1EFTA 1YU9A 4BEBA 4C7OA 4A9AA 1JI0A 2RGNA 1HURA 1N6HA 2WIBA 4PXAA 3OIWA 1EXMA 3IIJA 3L82B 3QJYA 3I61A 3CF6R 2O8BB 2W6JA 5KNBA 3R7WA 4B73A 4OJKA 1JAIA 3FYHA 1NIPA 1UEIA 2AHOA 1JR3A 2ZRBA 1G16A 3LV8A 4OK5A 4YDSA 3TVTA 4PHGA 1YZNA 4XTRA 2VF7A 2D2EA 2W58A 1OXUA 2J9RA 3WNCA 3WBJA 5EZ6B 1E0KA 1G7TA 4PO8A 2VIIA 3PEYA 5AJVB 4NYMR 2CMKA 5DH9A 1GVNB 4IVPA 4TMZA 3THXA 5BYKA 5KSOA 3WRXC 2H1LA 2PJZA 3ADDA 4P0TA 1Q1EA 2R6GA 4GNKA 5JI3E 5DI3B 5G53C 1FZQA 5E4FA 2W0MA 1C1YA 4DEYA 4G0NA 4ESVA 4GT1A 3BWDD 1OT3A 4QBHA 1E9EA 2QORA 3CF0A 3KKNA 4C0BA 1OFIA 1NVXQ 5FTNA 2QE7D 2VHCA 5E7IA 4P4TA 3ASZA 3GEEA 1G5TA 2REBA 2GZAA 3QY0A 1YRAA 1U99A 5EZ5A 3EX7C 4GMDA 2ZE5A 1P2TA 1EESA 2RGAA 1D9ZA 1WMSA 3KXLA 3PR1A 3SJCA 1VHLA 5CLQA 1NI3A 2OFXA 3GCGA 4DIEA 1S2MA 4B32A 1Q1ZA 5GJCA 3HWSA 4P4SB 3B1WA 3CIOA 1RYFA 4LC0A 1RRGA 1KO7A 4IKEA 1GRNA 1WP9A 1NBME 2W0SA 5FBWB 1DADA 4Q1FA 2D2FA 1RYHA 4DCTA 1VMAA 4NYJQ 2JLUA 3EPLA 3LA6A 3W3AA 3B1YA 4MKFA 2DWOA 4TYNA 1E9DA 2NOAA 3NH9A 4PSVA 1E2MA 4IW3B 1RC8A 1YVDA 3ZVRA 4HB4A 2WOJA 4G5GA 2P0EA 3RYTC 5FBVB 1NIJA 5HZHA 4EPVA 5GADl 4YMWA 3AKCA 2R6AA 4FD2A 3U7EB 3Q85A 4QHTA 2YNMA 3IO5A 3K70C 3C8UA 1Z08A 3B85A 3SYKA 4B3DA 4EKDA 3QXHA 4A92A 2IYVA 1WBDA 1GNQA 1SVOA 2XEXA 4LV8B 1E99A 3NC0C 3WYGA 2N1BA 3RLFA 4M1KA 1G21E 2V54A 1AQYA 1TQ2A 2F1HA 3FMIA 3CRRA 2WIAA 2QM7A 3NDPA 1CRPA 4TSFA 1XZPA 1W46A 1UADA 4F92B 3FHCB 2WPDD 1SULA 1G8GA 4M8NE 4M21A 2QT1A 3DKVA 4QGHA 4QJ4A 3W5JA 3B82A 1A2KC 1KO8A 2GRJA 4EJSC 3VKGA 4GOKA 1FW6A 2IXGA 3O8BA 4FWIB 3FB4A 4DJTA 3T34A 4OHVA 5JWOA 1MO4A 1PLJA 2NIPA 2HXYA 4ACAA 2BEJA 1KK1A 2FJUA 2O0KA 1EFRA 3DVLA 5EQTA 2BBTA 2CDNA 3CZQA 4L9WA 1ZM3A 3A37A 1IOZA 4YDHB 2ZRFA 1FPMA 1GOTA 1AN0A 4AKIA 4Q03A 1G5RA 4JT2A 4TWZA 4Y0AA 4TYWA 3AP2A 1Z0IA 1IN6A 5AUQA 5DI3A 2AX4A 5FL7D 1HYQA 4U7DA 1I4TD 3REGA 1GNPA 3AF0A 4CW7A 4A8JB 1XMIA 3ICEA 2PEZA 2VHTA 3ZJYA 3BGWA 2WBLC 2BM0A 4FMDB 2H8KA 4BLTA 3I4LA 2CXXA 2AR7A 2CLDX 4LK2A 1U2RA 5KDDA 2QBYB 3I62A 2RGBA 4OYHA 1HUQA 2QAJA 3PUWA 4X8LA 4GOJA 5EP4A 2YYZA 4BLPA 1BIFA 2KJQA 4J0QA 4M9XA 2PLRA 1W47A 4NZYA 2Z83A 3IKJA 3W6OA 1RW4A 4DDUA 4B2IA 3LBHA 4HDQB 4TL8A 4BLRA 4CEIB 2XSZA 2ZI3A 3UMSA 4Q19A 3B13B 4TYQA 4LJAA 4UNNA 1ZINA 5H8WA 3GLIA 3ETLA 4XTCS 1ZCAA 2Q9BA 4FMCF 1Z6XA 3C41J 3WNBA 3AVVA 2XITA 2QTHA 3QENA 4W9MC 3NG1A 1IN7A 1ZW6A 4A15A 3QXCA 3KJEA 5SZHB 4BFVA 1FFHA 3B78A 1P5ZB 3GFPA 1OW3B 1US8A 3HR7A 4HAXA 4O2RA 4Q7JB 5K8IA 1D2EA 3JZMA 4FCWA 3EC1A 3IQWA 2P5SA 1G3IA 4F91B 1TX4B 3A1WA 2IYUA 3OF5A 1G8PA 4RCZA 3ADKA 4JS0A 1EGAA 4OHXA 2XGJA 4UXJA 4WXPA 2C03A 5FUXA 4EQ6A 5FTKA 1KMQA 5C2JB 2YWFA 4QKQA 1XTQA 3OESA 2ZR0A 4US2R 2MSCB 1EFCA 1RFLA 1VDZA 5EXXA 3QIAA 4HUTA 3E2IA 1JECA 4N3NA 2WKRA 1ZD9A 5UKDA 1XEFA 1P75A 1DAMA 4Q7MB 1XF9A 1RIFA 1OXXK 1XD2B 2Z6VA 1P3JA 2WAXA 1HQYE 3ONWA 2G83A 1BOFA 1G4AE 4S35A 1RJ9B 1L4UA 2ZJ2A 5EUMA 4DRZA 3TUIC 1AGPA 1FMJA 2HF8A 2QGZA 1YZTA 3ND9A 4LJ8A 5CLLA 4LOAA 5BXQC 5EXSA 2Z4SA 3U3RA 1PV4A 1FQKA 4AYWA 5IF9A 2QGNA 3CM0A 3EIHA 1Z22A 2ERXA 1U90A 1O3YA 2JDID 4BGDA 1JEDA 3PIRA 3QNUA 2RGDA 4ZDKA 1E2QA 1K8RA 4B3CA 3NEYA 3V4FA 3B9PA 4L8GA 1S8FA 3UG6A 2X77A 5JFGA 2ZI7A 4NMMA 1VYUA 2GVDC 3TUZC 3TW8B 5CIQA 5J5CA 3MMPA 4B76A 4OQNA 4X8HA 4B3BA 1IXSB 1BKDR 1G3UA 2FEMA 1ZUNB 4G5RA 1P2UA 1TQ4A 3U61B 4PC1A 2EYQA 1ZUHA 2VHUA 2YJTD 3Q9LA 5JS8A 3LH5A 2B7CA 4PQRA 2J5XA 1U8YA 4XVUA 4MGYR 1TF2A 2EFCB 3OAAD 1P6XA 4LRWA 4Q7KA 5KSZA 1S0UA 2R62A 4JLDA 4OHZA 1IAQA 1S96A 1S9DA 4RKEA 4V0NA 1FL9A 3X1WA 5K8LA 1ZYUA 1E32A 1IJFA 3DZDA 4CRWB 1AGRA 1CJUC 3CH5A 2FSIA 1II8B 2RGXA 1OLOA 2HT6A 2ANBA 4DLWA 2L0XA 2MMCA 2BBWA 2WHXA 4IOJA 1SHZA 4R9UC 4A2QA 3EA5A 4EPRA 1KI6A 2VP4A 2FZLA 2JCSA 4Z54A 5AJXA 1ZC4A 3P1JA 1Q57A 2GK6A 1ETUA 2KE5A 4C0HA 1UBEA 3VTKA 1QG4A 3K53A 4YMTA 5HE8A 3SJAA 4Q1DA 2LKDA 4WZ6A 3UATA 4DLTA 2KWIA 3FKQA 1YZGA 2MMGA 2GNOA 3TK1A 3EPKA 1OXVA 4JSYA 2NPIA 1X1SA 2GJ9A 1NN1A 2ZR9A 2CL7X 4LYAA 2BKEA 3I73A 5JSZB 5LPNA 4TQUS 3R7WB 1KDRA 2A30A 4CDGA 2WWIA 5AJZA 3LD9A 4R2HA 4MYUA 1F2TB 5KSPA 4BRWA 2AXNA 4ZCLA 2ZEJA 3TE6A 3IGFA 4Z8YA 4URVR 3FOZA 2I1VB 2D3WA 3UMFA 1XRJA 5SZJA 4YMVA 4AIIA 5C18A 4OI0A 3WBKA 1T0JB 2Z0MA 1G64A 3R20A 3FFAA 1WCV1 3LW7A 4ARZB 5FI1B 3NBFA 1S9HA 2QSZA 1R0ZA 2XOKD 2ZXUA 6Q21A 4JVLA 2GVZC 1V5WA 1FUUA 1UBGA 1VTKA 3VNVA 3FKSD 3AUXA 1M1YE 1JNYA 1Z6AA 4JLAA 5FPHA 4FXPA 5BN5A 2GEUA 2EFGA 2A5JA 5L3QB 1DTSA 1KHTA 1Q0UA 4D0NA 3CUEF 4XVQA 5FUYA 3V9PA 2VA8A 3OEEA 1G20E 2A5FA 1F5NA 4K81B 2V55B 4IVRA 4QHYA 1AIPA 1BO6A 5CM9C 4NCKA 4HATA 3EASA 2GTPA 4HB3A 4DDTA 2FNAA 3RANA 3A1TA 5J4KA 1ZJ6A 2O8BA 4QM7A 1UPTA 1P73A 1WE2A 3GLIB 3IIMA 4V0ME 1E2EA 3FKSA 4C2UA 1E1RA 1Z28A 2ZRMA 4IJMA 5IT5A 1WDTA 3RRZA 1T8UA 4MGKR 1SKQA 1ZM9A 2OILA 4K46A 1SZPA 2Q21A 2J7KA 4FMCB 5J47A 2ZTSA 2EFDB 2QU8A 1YR9A 4M2LA 1SVLA 4L4UA 4DHEA 4HDOB 2J0UA 4TN1A 4LV6A 4XSHA 4EFMA 1CR4A 2BM1A 4C0LA 2Q3MA 3B9QA 3CNNA 1QHHA 2WMNB 3D7MA 1E2NA 4CEHB 4PSAA 4KSCA 3AQ4A 1N5KA 3KL4A 4RFVA 3K0AB 2FZ4A 1W4CA 2QZ4A 3BS4A 3K9NA 1E79D 3WMGA 4B71A 4QM6A 1NL3A 4JBXA 5EUQB 4GFDA 1G1MA 2AFIE 1FTNA 4EPTA 5GJBA 2JLVA 3A1SA 2NO9A 1FP7A 3Q5EA 5FUVA 1CRQA 5LB2A 3QBTA 5JMTA 4TLDA 2IHBA 4BEJA 1WBBA 1CR0A 1US8B 2FDCA 5FBRB 3Q7PA 1OE0A 5D3QA 3BIFA 1DVRA 1HV8A 2FPKA 3B8HA 2V1UA 1TEXA 2JJ2D 2ZYVX 3X1DA 4Q9HA 5JCPA 5E7JA 3SYNA 3GLFE 3R9IA 4C0KA 1J99A 3CX8A 1JQLB 1KJYA 1W0JD 5C4MA 1VCIA 1DBSA 1SHKA 2BWJA 4D6PA 4EQ6B 1J7KA 1UDXA 4NYIQ 3EPHA 1WA5A 4PC2A 3W8NA 4QG7A 4KAXA 3GJXC 2FWRA 1KGDA 3EG5A 4MGIR 4NBSA 1G17A 1SKYE 2DWPA 2IUUA 1MH1A 1FX0B 3EIQA 1QHHB 2EFEB 1X8KA 4G5OA 4RCYA 3LVQE 1E79A 3NIBA 5DI9A 2ZETA 5M04A 3VKWA 4G3XA 1AS0A 1OFTA 5FL7A 5BN3A 3THYA 4CEJB 4I1VA 3O8CA 4EIWA 1OYYA 3MWKA 5FBQB 1MRNA 2UKDA 3K70B 2HV8A 2V1XA 2C95A 2RAPA 1L8QA 2ZJ8A 2P67A 3K09C 2J0SA 3CX7A 2BBOA 1Z2AA 3ZH9B 2PH1A 1GWNA 2A78A 4H9GA 4IOMA 1CBUA 2ZS8A 4CEHA 2IUSA 5JJKA 3BB3A 3I8XA 2IYQA 3IBGA 2GF0A 2ZREA 2NPFA 2ONJA 2J46A 4JLKA 4M1MA 1M7HA 4Q47A 1OH6A 4N1AA 2ZSDA 1ZCBA 1DO2A 4P32A 2JLYA 4JLVA 3FDIA 3ZZTA 1P9NA 3LNCA 2IYYA 2ZROA 1N25A 4KLNA 2VYFA 3R9XA 2VTKA 3ZQ6A 3DZ8A 4MYCA 2XXAA 2W6IA 3GLGE 3T12A 1P2VA 1M34E 2P2LA 3MCAA 3PQCA 4A8JA 5B30A 1NBMA 4TZ6A 4OBEA 2F9LA 2GCPA 4NTZA 2P5TB 3IILA 3K1JA 1I2MA 1JAHA 4LBZA 3HYTA 3SNHA 4MQBA 2BMFA 3OHMA 4JLJA 4FIDA 2ODBA 4RVCA 1XJ0A 3EXAA 4Q4HB 1AKYA 3TSZA 4LCBA 2A9KA 1XCMA 3VX4A 4R71A 1DAGA 1XXHA 1A2BA 5H70A 2HUPA 3ZQJA 2EYUA 4YXWD 4N0DA 1VKJA 3SU8A 2BJWA 2FPLA 2YINC 4R7ZA 1IQPA 1G18A 2OESA 3WYAA 2QMOA 1Z07A 2ASEA 1YZKA 1XFAA 5KPDA 1CIPA 1TQ6A 1YZLA 2JJ1A 2J0VA 4RZUA 2O8EB 1YJ5A 3REFA 1SGWA 2HCJB 2J3EA 5GVRA 3THYB 3ZVMA 4RJLA 1VHTA 1G7CA 2H7VA 2I3BA 3GLGA 2IX3A 1GKYA 4BFZA 1GKUB 2EU8A 2H16A 4RZ3A 4TMWA 4BUJA 3UPUA 3SBEA 3RSLA 2FFAA 2XZPA 4OI1A 4TYYA 5DLQC 3QKSA 3WP0A 3U4QA 2ZSAA 3QSYA 1CULC 1NMYA 2AD5A 3RRYA 3PG5A 4PSKA 3TQFA 1ZNWA 3UXMA 1E4YA 2ZRCA 4HZUB 2HYDA 5TV2A 4MRNA 3PEVA 2KSQA 4US0R 5L3SB 1YHNA 3T5GA 1CEEA 1K5DA 2JLXA 3X2SA 5CIWA 3K8YA 3RC3A 3ASYA 3PUYA 1ESNA 3BH0A 3MAAC 3KFVA 4TT3A 3KDSE 4LGMA 4LJ6A 4LBVA 1UDWA 1XEXB 4JKIA 4NYMQ 4TTRA 2PX3A 4TMVA 4V0OA 4ARZA 4LJ7A 4RFSA 4RD2A 3R9WA 3GJ3A 2J41A 3GFTA 2GBLA 2ORWA 3O8DA 4KFUA 3F3YA 1Z63A 1G19A 3UANA 1JR3D 4ASUA 2O8FB 2RB4A 4W5JA 4URZR 3NBXX 4PQFA 2GJKA 3DKPA 3OAAA 3VU9B 821PA 4JKYA 3C7KA 2FPMA 5DIFA 5H1YA 1TQDA 2GXQA 4DDWA 1IXZA 4MDFA 4DXAA 1KJZA 1MABA 3LFUA 721PA 4B43A 4DLUA 2IUTA 2YV5A 3UMRA 1R5OA 2WTUA 1R6BX 1H8EA 4B3FX 1KK2A 1YRBA 3X1YA 2C99A 2GA8A 1H8HA 3OFNA 3OEHD 3TAHA 2ZRKA 1KI8A 1GUAA 4JJKA 2DR3A 1ZMXA 1E9RA 1XJQA 4XSGA 1JALA 1ZM2A 2OXCA 4BRUA 4A0RA 2O8EA 2DCUA 3QE0A 4KYIB 2W00A 4LUCA 4LYJA 2HDNB 3PENA 3KTAB 1HT2E 4PANA 1XBTA 2OE2A 1JPJA 4B6EA 1RRCA 1AS2A 4PPFA 2VRWA 4QBFA 1DAIA 3AF4A 1ZP6A 3PVSA 4LDJA 2EVWX 2V8OA 3FVQA 1XPUA 1AJEA 4P4UA 3K0SA 1G6OA 2P65A 5TMPA 1IONA 3LBNA 3VHLB 4GSYA 4DSUA 3CX6A 3EZ7A 4ZDJA 2WJVA 5TVKA 2O8DA 4AKGA 1DS6A 3MFYA 2WWGA 5FTLA 1Z0JA 1W5TA 2ZVQX 1XTSA 4R2IA 3KJIA 3BJIC 4HZIA 4LSGA 5KUTA 1U0LA 3PUXA 2W6ID 3GJ6A 2QNRA 3OIVA 5DHFA 3AM1A 4MITA 2ZUCA 4NP6A 2X19A 2HF9A 4DB4A 1S3SA 1N2CE 1N6IA 4CEJA 2XB2A 3SN6A 1SXJA 3WMEA 3R8CA 4U5XA 5KHOC 2GCNA 1KIMA 2CEAA 1LY1A 2ZJYA 2VF8A 1R4AA 2O5VA 4QC2A 2CK3D 4LPKA 4NCJA 1Q20A 4ON9A 5L3VA 2C04A 2MSDB 4IVQA 4IDHA 3NWJA 3TMKA 1IN8A 1Z0FA 1H65A 2B8WA 2YKGA 1ESMA 1X6VA 2ZANA 2ZRGA 3BAFA 2X2EA 4KV9A 2OHFA 4W7SA 4Z51A 5GJVC 5L3RA 1KAGA 2RGEA 4LWZA 4TLBA 3QEOA 4KITB 3P20A 5FOSA 2WWWA 2F1JA 2QMUA 4QGFA 2JLSA 2YVUA 1QG2A 1NN3A 4V0LA 2VP2A 1N5IA 4QFMA 4KYUA 2CK3A 2FSHA 2WJIA 3PXGA 3V00A 1JBKA 4ASUD 2OAQ1 3QI2A 4D81A 2QPAA 5D3MB 3VKHA 4KXFB 1KDOA 3EIEA 2GCOA 2IHYA 2IYXA 4CT5A 2EWWA 1M6NA 3Q72A 4TMXA 3C5HA 4B44A 1JPNA 4Q4AB 1EG7A 1W4BA 2N42A 2JLRA 1S1MA 2C2HA 3MG9A 1KSFX 1B23P 1LB1B 1GL7A 1IN5A 3U7FB 2R2AA 2V6JA 3WXMA 2GXAA 2C98A 5J4HA 2PL3A 3U7GA 2ZAMA 3GEHA 4BFTA 1C4OA 5TXGA 1E9SA 3BB4A 2O0JA 1RKBA 5FH9A 3BD9A 3I5YA 3KQNA 2FMXA 4H1VA 4Z1MA 5JRJA 1MKYA 3Q7QA 3EPJA 3BBPA 5G40A 1VIAA 3NEJA 2R8RA 1MR3F 1CTQA 4MKGA 1JQJC 2KBEA 1G5PA 5CM8B 4Q1CA 3EZFA 2Q9CA 4OKSA 4TT3D 4ACBA 5KOYA 4II7A 4P33A 4DLSA 1Z2CA 1IBRA 3L0SA 1F60A 2ZRJA 1NVWQ 4UKDA 1R8QA 3VFDA 4CF7A 4RD3A 3WY9A 1E2GA 3C5CA 2F7SA 5K8UA 1AS3A 3JZAA 1EX7A 1Z8FA 1XCGB 3KQKA 1E2DA 1TMKA 1EWQA 2YOGA 1VYTA 2WWFA 2WWYA 4OQFA 1J90A 1PLKA 2AK2A 3S1AA 4JLBA 4YMUA 1S1CA 1E1QD 4NONA 3FMOB 4TLCA 1G291 3KQLA 3A6PC 3K9GA 1ZU4A 5CYOA 1IJEA 4EUNA 4GDFA 2QRZA 2FFBA 3ZZUA 1TL7C 1KK3A 4ZCIA 5EP1A 2X1VA 4LBYA 4YXWA 3CB4A 4IDNA 1NBMD 1A82A 2OCBA 5B58C 4LYHA 2Z43A 1XTRA 1X1RA 2IA5A 1OIWA 4QGGA 1SQ5A 3SE0A 2XOKA 1SXJD 1YR7A 4BZXA 3PEUA 4PPGA 2ECKA 4DLRA 3ZVLA 1CJKC 5FI0B 4AY2A 2CNWA 3I32A 4HLUC 2XTMA 3W6PA 3AB3A 4IOKA 5FTJA 3TVDA 3MJRA 4UNPA 3OIUA 4IFEA 1G3RA 4MRSA 2XZOA 5FOXA 1E9CA 3JVUA 3AVYA 3QOFA 3CF2A 2IS4A 4TQ9A 1GIAA 2FH5B 3CNOA 4PX9A 3TLXA 2C5LA 4KU4A 3AF2A 2WWHA 4JL5A 3CRQA 1CU1A 3LRPA 1NG1A 3GJ4A 5TARA 3BFKA 2OEPA 4D4LA 4AKHA 3KKOA 4PZYA 1KYIA 2ZJZA 1TEVA 2CLCX 1W49A 4HAWA 4JBYA 3AGQA 3N5CA 1BYUA 2ZS7A 5L8VA 3DMNA 3THXB 4M9SA 1W36B 1E2FA 3MJHA 2P6UA 2C77A 3C16C 3DM9B 1E1RD 2F9MA 3N2IA 4IHQA 3SQXA 1UKYA 4C7OB 4DLYA 4UNRA 4GPTA 5HKKA 4PC6A 3QPVA 4DCSA 5LDDC 1XEWX 5J4VA 4KFTA 3LBIA 2IC5A 4KI0A 5JS7A 1UAAA 4HLDA 3LVRE 5HPYB 4QBIA 2QTVB 1E69A 1Q22A 1K6MA 2DFNA 3KTAA 5EP2A 4DSOA 2DBYA 1XNJA 2NO6A 1P61B 1SXJC 1ZBDA 3DHWC 4C0SA 4MYTA 1O87A 5CB6A 2X8AA 3QF7A 3E5HA 2H5EA 2QROA 3GJ0A 1U9IC 1W48A 4H1UA 3U2QA 4KJZA 4RD0A 1GSIA 1W0KD 4ZI2A 1JXOA 5GVSA 3B1XA 1D2NA 2FGKA 5CB8A 4C3ZA 4ZDWA 2NTYC 4B2PA 1GNRA 1GL9B 2GAOA 3JVVA 4RD1A 4MYHA 2J0UB 1NMZA 2MSEB 4AG6A 5DN6A 4MA4A 3SFVA 1G7SA 1KY3A 2V7QA 4ILEA 2UZIR 3FHTA 2OAP1 5EE1A 1MRSA 1ZU5A 3A1UA 4F4JA 1E3MA 4QNMA 2CCGA 3U3OA 3B5JA 1TNDA 2Q0HA 2BKUA 2DFTA 2XNDD 4QXAA 3U3JA 2OG2A 1OB5A 4A8JC 3BK7A 1S3GA 4XWKA 2YOHA 3MLEA 3A8TA 3O47A 3EW9A 4MRRA 4DKXA 1KSHA 3K0FA 2ZAOA 3KXKA 1KMHB 2V4ZA 4JYCA 1DAHA 3SZRA 1GITA 4Q9KA 1U9IA 4ZCMA 3B60A 3LQQA 2FOLA 3LY5A 2Q9AA 1W0KA 1XXHE 2IBMA 5BN4A 5DO9A 2FSFA 5CK5A 4V02A 1G3QA 1N6OA 2ONKA 2CJWA 4UQOA 4D4JA 1NN5A 4BE7B 5LBIA 1AZSC 4B3XA 4D0GA 3CRW1 3CONA 3T61A 2DPXA 4Q4LA 2QN6A 4ERNA 2HT1A 2ZE8A 4NE2A 3RSOA 3ZD7A 1IY0A 5FOUA 4JVSB 5J40A 4E09A 2QA5A 2BVNA 1OF1A 1T4GA 4M22A 2LWIA 1ZC3A 2BMDA 2OCPA 2D7DA 4Q1AA 4TTPA 1I2DA 2ORIA 3GLGB 3NBZC 1TTTA 1GG2A 1W5SA 2H92A 3QUSA 1TU4A 1BMFD 2JDIA 2AFHE 1NJFA 3CNLA 4JVMA 2ZE7A 3NHAA 5HE9A 5C46F 2ATVA 3ZGXA 2A3RA 4RD4A 1H8HD 3OEHA 3OFND 2VSFA 2PZEA 5C1BA 3E1SA 3GPLA 4MDEA 3NDBB 2O52A 3A36A 1YE8A 2OBLA 3HYRA 4QRHA 2PEYA 5CJ2A 3P27A 2GDJA 3RABA 3HR8A 4IOLA 4P31A 2B8TA 1F48A 2J7PD 3KZ1E 3AVWA 1JJ7A 2CJWB 4DVGA 1JR3E 4IEEA 2VSXA 2JATA 3IPYA 3X1XA 1E98A 4URXR 1LFDB 5CYPA 1FP6A 1I4DD 2QBYA 3H84A 3T06B 2P6RA 4PC7A 1LTQA 1CJVC 1MV5A 2OXRA 3QPUA 2IWRA 1KMHA 2DB3A 2ZSBA 1VECA 3BFXA 4Q4AA 4X8MA 5EJEA 2JJ8A 4CT4B 1E2IA 2CHVA 3MGCA 4RKFA 3RS5A 3CWQA 4KFRA 4ZI3A 2G1KA 5HKKD 4IDPA 1XB2A 1A1VA 4TQAA 2IS2A 3ZIAD 1MO6A 4MRVA 2IEYA 2BBSA 2DWQA 2PMDA 1EWRA 1R5BA 2O0HA 3SJZA 4MRPA 4BASA 3ECCA 4WIAA 1NVVQ 4XD7D 4QBGB 2ZIAA 1VG1A 4JSTA 1A4RA 1HE1C 3OEED 2R9VA 3KJGA 4HLUA 2D62A 2HJVA 3NVAA 1RZ3A 1CP2A 1OHHD 2PZGA 4JVNA 3ZLJA 4RZ2A 3B6EA 4BLSA 4DCVA 4GZLA 5JWHA 4DCUA 4HDCA 4IFBA 1X8JA 3ZVNA 4RD6A 1DG1G 1OFUX 4AC9A 3D8BA 5KO2A 3F5FA 2AKYA 1NJGA 1VCMA 1Z29A 3GP8A 5CK4A 1KKLA 3ZIAA 3CLVA 1NLFA 4CGZA 2GJAA 2YWHA 4PHTA 4TL6A 3ND8A 4BLOA 1ANKA 2F3TA 4DT1B 5DN6D 1G7RA 5L3QA 5E7MA 2ZM5A 4DUGD 4TLAA 4MH0R 1ZD8A 2DYKA 1G4UR 1TF5A 2IK8A 2NZ8A 3HPQA 1TF7A 2GETA 2NG1A 1GRQA 2Q3HA 2HEIA 2XB4A 4HZUA 3VAAA 3KQUA 1E1QA 1E9AA 1OH7A 4Q02A 4HAVA 3RNLA 1G6HA 1LS6A 1H8ED 2GKSA 3VR3A 4M1TA 1KO1A 5JCZA 1UEJA 1W4RA 2HLDA 3R8FA 1VG9B 2G77B 4G01B 3NTUA 3J81k 1U0HC 4F4IA 3QKRA 4JLMA 1W36D 3OZXA 5HZKA 1D8TA 3QVUA 1CR1A 5KSYA 2FFHA 4ZIRA 2QP4A 1NVVR 1MO5A 2QMEA 2CCKA 1P72A 1D9XA 2GZHA 1Q21A 1LV7A 4LI0A 2OBNA 1XP8A 1CJTC 2IW3A 1SVSA 2P3SA 1KY2A 3IDQA 3TUJC 2VP5A 4Z1MD 4A36A 4TMTA 3MUFA 4D26A 4D25A 2FFQA 2KI5A 3VQTA 1QHXA 4RY2A 1KI4A 3GJ7A 5H68A 1T8TA 2OO7A 4DCNA 3IHLA 1XEXA 4WBSA 3KXIA 2OFWA 3A4MA 3DPUA 3I72A 4NKRA 2WSSD 1N6LA 3T1QA 1RPZA 3QKUA 4WZAE 3W5IA 5BQ5A 2VQSA 3AKEA 3HPRA 5L3SA 1AQUA 5JJIA 4MUBA 1R0YA 421PA 2FX3A 4IDQA 221PA 3D31A 1II8A 1M8PA 4GBMA 1SKYB 4GRAA 4EJSA 4A0HA 4M53A 5F3WB 2EQBA 4BZQA 4CZ2A 3VR1A 4FW9A 4FCTA 4IDOA 3K0CC 2C9CA 1L7VC 4TL9A 2JEOA 3DDCA 1BMFA 2RGCA 1NSTA 2BCGY 1N6KA 2W2TA 4GZMA 4A0FA 3IIKA 1E2PA 3P4YA 1Q44A 5FFMA 1ZAKA 5KDLA 1TUEA 3L8ZA 2YWGA 2GILA 2GHIA 2OCAA 5A0FA 3LW8A 1NVUQ 2ZITA 3KKPA 3IQXA 2ZI4A 3IUYA 1GKIA 1P7CA 2GXUA 4LV5B 1HT1E 4CYMA 2VPPA 2RCNA 3RS2A 3RRMA 3AVTA 1Z0KA 3BC1A 4FMBB 4A6PA 2PT5A 1GZSA 2WJJA 1NRJB 4OJQA 4B2LA 1KK0A 3FGNA 1T0HB 2QPOA 3IO3A 3UWKA 4YONB 4B47A 5J4YA 5EXTA 121PA 1EFRD 1D2MA 1U8ZA 3ZZ0A 2QI9C 3PEWA 4L16A 4URUR 2IYSA 3SYLA 3V4RA 1RE0A 4BFXA 621PA 1YR8A 3WNDA 1YKSA 4B3GA 1KZGB 5DGXA 2QAGB 3K09A 4M9ZA 3B2EA 1ZM4A 2OT3B 1ODFA 2LCFA 1XPRA 1E2KA 1G8YA 3Q3JB 4OK3A 2YOFA 1UFQA 2CVFA 2KBFA 3CPEA 2HJGA 3CWZA 2C9OA 5JHHB 3U6BA 1KOFA 2V7QD 2Q6TA 4QL3A 3UIEA 5KYKA 2V6IA 4DC9A 4OHYA 1BYIA 4BFYA 1IXRC 2CL0X 4E22A 4NPHA 5AUNB 2JLZA 1IN4A 4B35A 3VR2A 4DLVA 2GBLC 3QBVA 2VLIA 3BH7A 5KU1A 4W5WA 2W2XA 1ZNXA 3AVQA 5C4GB 1J8YF 2PBRA 3MWYW 3TKLA 4PFSA 2WJHA 2XZLA 1N6RA 1DELA 1R0XA 1XMVA 3ZS8A 1JXMA 2HLDD 3WMFA 1RJ9A 4HSEA 3WYFA 2ORVA 2PLFA 4QHSA 1D6JA 2XAUA 4TTQA 2WJGA 4DIDA 2C78A 4DLXA 2D4HA 5F9HA 1KDPA 1EFHA 3ZS9A 2IXFA 1NKTA 4XH9B 4GP7A 1JB1A 2R44A 1CXZA 1HTWA 4Q4JA 4DUGA 1PVOA 4AYXA 4D4MA 1C9KA 5ANRB 2GCOB 2X2FA 5KNCA 1E2HA 1XCPA 1OJLA 3CPJB 1QBKC 4HUQA 3CR8A 3QXXA 3RS4A 4BZPA 2ODWA 4DT1A 4EPYA 1LF0A 4U00A 3T1TA 2WICA 5FOVA 1Z6GA 5BW8A 4HAZA 3M4YA 3RHFA 1M74A 3TJZA 1CLUA 1COWD 1E94E 3GMTA 4Y0VA 3ZDQA 1NY5A 2ANCA 4O3MA 1DAEA 1MT0A 4NCHA 5BWMA 1XD8A 1KNXA 4LX0A 1E9BA 4XWAA 4UJ3A 2I4IA 4E07A 3L0PA 2NZJA 2IWHA 1W44A 2F1RA 2FSGA 4YLGA 5JRZA 4XJXA 1DO0A 1NKSA 4A1FA 5FBLB 2EWVA 3QEJA 2IXEA 4MKIA 4XD7A 1L4YA 2C9YA 2VBCA 1KI1A 5HTKA 5FPTA 3GJ5A 4QOSA 1OSNA 4BWYA 1SXJE 4HAUA 3W34A 1KSGA 1AK2A 4FWTA 4V0KA 2WKPA 3NXSA 2BDTA 2CVHA 1WQ1R 5EE0A 3MWLA 1XTIA 4P4SA 2JLQA 3TR0A
chains in the Genus database with same CATH superfamily
3NRJA 1U9ZA 2WTEA 4IGAA 1H3EA 4LWQA 1X94A 4IXNA 5CA1B 4WKOA 4GECA 1CVLA 2OVFA 2OV1A 3UC9A 1B00A 3ABSB 3GT7A 1T5IA 3IXLA 1L4FA 2W2VA 1GTL1 3GLHA 4Q12A 4XUDA 3VKFA 3HCPA 4X7BA 1Q0PA 1PS9A 1M5UA 2JJYA 3QELB 2VH5R 1V41E 2P9EA 3CSDA 5IFLA 1KEEA 3LWZA 3TZCA 1GFZA 4Y9SA 2BGWA 1GZ6A 1NPDA 1WU7A 1D5CA 2J7PA 4G81A 3A3YA 5IH3A 5JDCC 4KREA 5EAIA 4DWOA 3TZLA 1PJRA 1ELOA 3CE9A 3QWFA 2PX8A 5G1PA 4YR9A 1A9RA 3H83A 1I7PA 2HTFA 4RM2A 3B3FA 2G9UA 3HEMA 1CUBA 3M5DA 5K8VA 2Z8YM 1F7UA 4HNUA 1Y5LA 3DV9A 3LMKA 4QXPA 4B5LA 1W2HA 1XAJA 1Z4PX 3GAAA 1LEHA 1EFUA 5GV8A 5LMCA 1UIRA 3SFZA 3UXEA 3WK8A 4O4IF 4CNQA 3ZCRA 3U6KA 3O84A 3VNRA 1CZKA 5HHTA 2QAGC 4ZRDA 1XDUA 3KHKA 3QEMA 2CNNA 3ZZ1A 5CT5A 3G0HA 3H99A 4BWFB 4B6FA 4M8SA 1MIHA 4P3YA 5CITA 2BZ0A 2OV6A 3NJRA 2OZEA 4EJSB 5BY2A 3Q8WA 3RFVA 5CDHA 2PD6A 5FYDA 1Y6GA 2IYLD 3CIFA 5EKXA 3QXJA 2JFVA 2HBQA 3SHVA 4F6CA 2XNDA 3TECE 5E3HA 2WTNA 4X85A 4XOUA 4RFLA 5A71A 3TNFA 2H4XA 1JIIA 1YIDA 1Z4KA 2AK3A 2M1ZA 3KOMA 1XLVA 4BAZA 4RJKA 4POOA 5AI0A 5KTPA 1VHJA 4E46A 2IS1A 4A91A 5BUZA 3AEKB 1DDOA 2ECQA 1XZ8A 3WDKA 3IKTA 4AG5A 1ABFA 1BH2A 3RVNA 1FUKA 1BS9A 1GA4A 3LXXA 3TSCA 2IXAA 4TXLA 3FMFA 2VTBA 2QP9X 5DKFA 5JXJA 3PTLA 3JX9A 1F0KA 3ADBA 1L6IA 4TGLA 4N5MA 2FPWA 4DUPA 2RCYA 1K08A 5GV7A 3FTPA 4NYIR 4MTCA 4Z86A 1QUFA 4PPNA 4HHEA 3OEYA 2EJVA 3ZIDA 4IH9A 1QYDA 4WBNA 2IT1A 1Z4JA 2Q4BA 2JB9A 3EB9A 1PYGA 4WKBA 4KVAA 4UARA 4GI7A 4O2AA 3H5RA 1DBPA 1JE1A 2G08A 2JFOA 3ZCTA 4BCBA 1JIUA 1KYVA 2PO7A 5E4JA 2XMCA 1BX0A 2G67A 4EY7A 5EA2A 2Y8EA 5EN4A 3QOXA 1KO4A 1VC2A 2D7CA 5TT0A 1OAOA 4NPCA 4DQLA 1TQ8A 2OL4A 2P90A 1IQ0A 3H5TA 1JPUA 3I01A 1P2SA 3QM1A 4GLFA 4ITVA 4TROA 1SBNE 4YV1A 5K1ZA 2Z08A 5FOWA 1NU6A 5SZKB 1I36A 4DLKA 2KM1A 3T15A 5AVSA 1QZXA 2DBQA 4UU7A 3BHMA 2I4TA 2XB8A 4MQEB 1V5GA 3LUHA 5K0GA 1PZHA 1EDDA 5CFMA 5I7EA 2VUTA 1E1LA 4K9QA 2IP1A 2Z1NA 3L02A 4QYTA 5EIBD 3ABZA 1PK9A 4HJXA 3WK4A 3AUFA 3CMCO 4YASA 4KO8A 1PE0A 1A8IA 3TBHA 1QFMA 2P75A 3K8OE 1JDJA 2BEUA 4G8DA 3S8MA 3C98A 4EY8A 1GL6A 2BELA 3IP9A 4X7PA 4D3XA 4CNBA 3H5AA 1LTKA 4DZTA 4JXKA 3K9HA 4JB0A 2BUAA 4X9XA 1POXA 3WI7A 4AY4A 3AILA 3EMVA 3THWB 1I1NA 2EKPA 3DQQA 3Q5GA 4D9FA 4Q66C 1XQ6A 1XHLA 1QV6A 2DKNA 2FSSA 3S55A 3ZUGA 3GA5A 4KR0A 4O4JF 2GN6A 5HOQA 4LF8B 1XL0A 1QIGA 4NBVA 4GIBA 2VP6A 2ZSHA 2CNWD 2LRHA 1QAQA 4N0MA 3A1CA 4I36A 1X3SA 3RWMB 5JQGF 1O8CA 1P4AA 1I9GA 1HY3A 4LF4B 5ELXA 1SHJA 1UOQA 5AXBA 1JSLA 2WSSA 3JAKA 4F12A 4OATA 2QW8A 1ZIPA 3QBJA 1Y5RA 3OPNA 5HMMA 4WDQA 4HGPA 2FLVA 2QTNA 3W3ZB 3WXBA 3SEFA 1RSZA 5B57C 2G3YA 4RJTA 5JI2E 1W73A 3HYNA 1VM6A 5JH7B 3GRFA 1N4DA 4OM8A 1TAGA 3QHAA 5K05A 4LF9B 1FPQA 2CD9A 3ROGA 5B64A 4XYEA 1OXSC 2X0IA 3LA8A 1EX6A 3VAZA 5C7OO 4DNPA 1R0KA 1PT7A 1M1XB 4TWJA 1WTAA 1YOVA 1VKHA 2NU6B 1R15A 3WE7A 2F8TA 4C88A 4ND2A 1WSDA 4RTNA 3I6YA 3VNUA 4Y1RA 5SZIA 3THWA 4Y6SA 3BWYA 4BUZA 1L7DA 1QQ6A 2G6BA 3FUTA 4Q9LA 3E1KA 3FNRA 2W4QA 5HW0A 1LLDA 2IF2A 2QP3A 4BV9A 1WXQA 1E92A 1ECJA 1SHLA 3RH0A 4IVNA 5TPWA 1JWLA 3C6YA 2H18A 3LAWA 4IIJA 1R0WA 4LHWA 3ZU3A 3NBYC 3E70C 5F98A 3R23A 1I7DA 1EXWA 3HU5A 1Z39A 4XPZA 3BE4A 4H6PA 4V39A 2G8NA 2W8BA 2WAOA 1KIFA 5JCOC 2B1GA 2BMEA 2IL1A 1C3JA 2CZGA 4HLQB 4MIKA 2AMLA 2GYUA 2FPXA 3DGEC 3INGA 3LY9A 4O4HF 1NE7A 1NF8A 1D4OA 2DE0X 2VXCA 3DE5X 1ZEMA 3H2GA 4FQ8A 4H59A 5IVHA 1R16A 3CMMA 5DGHA 3U3KA 3ZI4A 4HDNB 2QN8A 3KD2A 4AUEA 1QRRA 2BUBA 4PYJA 1N5LA 2BC9A 3VR6H 5LU8A 4OL0A 5K4AA 5M2QA 3EGXB 3G7UA 4YWJA 3KPUA 3FWPA 1Q1BA 1XQ1A 2CUKA 2ZI6A 3JQ9A 1X87A 4D98A 3OCCA 2PX0A 3AR6A 1Y63A 3OWXA 4N12A 4WGFA 3VOBA 1ML3A 2IIBA 3GIDA 4ER0A 3PUZA 1GVHA 1WUYA 2HFKA 3IOYA 4UVDA 5DM2A 2CLFB 3ZCUA 2JIZD 2ADMA 5HS6A 1OBFO 4U2EA 5FNVF 1ZNYA 2REXB 5B3JA 3MW8A 2GD1O 4PYMA 3B1ZA 4O2LA 2GK4A 3C1AA 2A9FA 2EGUA 3OQVA 5EWMB 1VG8A 1IATA 1KO5A 1AKEA 2A5DA 1LBSA 2B92A 4QOIA 1LH0A 1LUAA 3ABQB 3LDAA 1PTJA 4UULA 3MTGA 4ZEXA 4F7WA 1U7XA 3AF1A 4CL3A 1N7GA 3I1FA 2ODNA 4Z8XA 5I8PA 4YCDA 2MIIA 4KXYA 4PZUA 1KFCB 4ZP1A 3JSXA 5JAOA 3K15A 3RE1A 4FYVA 3U4AA 2MSKA 4M76B 5LYYA 3ZWDA 3V9AA 3ZXXA 3RC2A 5J3JA 2GZDA 3CRVA 4OA5A 1OGIA 4YGYA 4LHZA 1NR1A 1COZA 2AWOA 2QX7A 1F2TA 2NXEA 1FX0A 3KR2A 3VUFA 1INLA 1WXIA 4EZEA 3SC6A 1BD4A 3PS9A 4KPUA 1Y9ZA 2GRAA 3OLWA 3SIPA 1QP0A 4DSNA 2QYSA 4BDTA 3GFSA 4I5GA 4ZZ2A 1SG9A 1YBVA 1DBRA 2DKFA 2WIJA 2XI4A 1JHXA 3HU1A 5AI4A 3SJ7A 4ZVSA 3VDNB 4ZQGA 1SRQA 2PMEA 4B4WA 4YXFA 4ZKDA 3IH5A 1O89A 4B75A 4KR7A 1H5UA 1QRDA 3A10A 1BZYA 5LD2B 4DB2A 3EXIA 1UZUA 5K45A 2ZJOA 5G4LA 1VSVA 2YDXA 4X61A 3SS8A 1GUDA 1N5OX 5CD9A 2ZUUA 2BEVA 4LGVA 4UFOA 5IAKA 1G2PA 3JQGB 3TOSA 1Q7GA 3D4NA 4LMRA 4K9OA 1M72A 3T9EA 5FPSA 3SIXA 3UMGA 3W5CA 5DNYB 2AG6A 1ZHHA 1TCVA 1N77A 3KCQA 5L51A 2W9XA 4UEOA 3EQ2A 2H57A 2CXQA 2GF9A 3KQHA 3LUKA 1XJ5A 5JAIA 2DPMA 4MLZA 3LHIA 1SVMA 3A6DA 1XDSA 1AUQA 2A9QA 2Y0BA 2PXXA 4RACA 3TE7A 1RWOA 4NZ9A 1W2GA 3BE6A 4B4UA 5BQFA 1F12A 4LPSA 1J97A 3NNNA 4B09A 2OCYC 3CNQS 3L5OA 1YUNA 4LZJA 4OB8A 3HBAA 4BFWA 1IZ0A 3AJAA 4Q5IA 3RRJA 3GJTA 3FXAA 2PX5A 5IC6A 1C9NA 1FOEB 1LLQA 1Q3TA 4EJMA 3FPHA 4BNYA 3HKDB 3MINB 4YAEA 2UDPA 1W8IA 1GTZA 2GESA 1J56A 2EWMA 5AICA 4LXUA 1SVIA 1SZCA 1GRVA 1TUBB 1A2QA 1WZIA 1EP3B 2FZWA 3A14A 3IMFA 3LX5A 2QM8A 2EP7A 2MOKA 2VO1A 4FHFA 2NZUG 1CVIA 1ONOA 4N76A 3JAWB 3BCSA 5AM4A 1XO1A 3B3GA 2ONCA 4QXOA 2GDZA 2IKQA 3FYDA 4IIJF 4DA0A 2YJGA 4IJVA 3D3NA 5I45A 2QNBA 4QWMA 1PLLA 3E3LA 3KYDB 3W2TA 2VNKA 3CVVA 1KYQA 1UINA 1TPZA 5LYJB 3N7TA 5IDVA 2FF5A 4CV2A 1M2OB 2XHZA 2ST1A 4G63A 4B74A 3LPAA 4ETWA 1Y3BE 4LZZA 4RMNA 3HBLA 5FUBA 1NT2A 1NW9B 2GA9A 1YE5A 3EY4A 5HCNA 3WP1B 4FB5A 2I76A 1JB9A 4NOMA 2HRBA 1P9OA 4PZPA 1G8SA 2ODAA 5IPFA 1VGVA 3LQYA 3VXKA 2JGNA 3G89A 3QUBA 2JBAA 4BJ3A 4OHWA 1I4EB 4Q0MA 2GZ1A 5EE3A 5JEDA 2A0WA 3P9YA 1TIKA 4QSMA 1GAWA 1YZHA 2NADA 4J4TA 4ND5A 3K5WA 5TX7A 3RDPA 1H0RA 2ZRNA 3QEBZ 2X7HA 1OV4A 4HB2A 4ZDIA 4A26A 4KIFA 1KP3A 2OM2A 4F6RA 1HK7A 1OVGA 4H7IA 4LMAA 4YX9A 5KHLB 3NTXA 4ZU3A 1HEUA 3FROA 1QXSA 4BCDA 3TOVA 2ZP1A 1WOYA 1IMJA 4S04A 4NV1A 1Q1QA 4J1TC 5KNDH 1T9ZA 3KSAC 1K88A 4RF4A 1NLYA 1ZH0A 4LXGA 5DLPA 4BGVA 5SYAA 2IYAA 4ZTUB 5TMEA 3Q3CA 5DASA 3BFVA 3NHFA 1HG1A 1RRFA 1WY7A 4JGBA 4JLSA 2PKQP 3VR6A 2TYSB 1OXTA 1YR3A 1GU1A 1WU8A 3AHGA 3QLVA 3DCYA 1T1SA 3PUJA 2GJSA 4BVGA 3SVTA 3QIVA 3CTMA 1O5TA 4HMOA 4Y1GA 5DYIA 3O75A 5BR7A 1U9CA 4QDJA 3H3XA 1Z8NA 2C8JA 1P80A 3GXBA 2X1HA 5K0TA 3PGLA 3D2CA 3L43A 1XMJA 3W2EA 1KR2A 4WA7A 1TDJA 2PUWA 3BB1A 4JJZA 3AOEC 1T4BA 3MHPA 4S1OA 4WZAA 2CFRA 3D6AA 4Q7LA 3A58B 4JBWA 2B20A 4UW9A 3MWFA 3PX3A 2J3MA 4ZARA 3RCBA 5JLJA 1T5SA 4N82A 2VF2A 2B8EA 2PZFA 4WFJA 3VU8A 5K2OA 2XMSA 5TQ2A 5LD2C 1UP4A 3AF5A 3CR3C 3NHBA 1DCTA 5LUAA 1K6EA 2BCEA 3AR9A 2K2QB 1I13A 4K3UA 3LKBA 4J0FA 1TT5A 5D5HA 5HRUA 3TR5A 4D80A 1HLFA 1R12A 3I45A 1PWHA 3SJUA 5AUOB 2ZXFA 1VJCA 4KSBA 3X1ZA 4ZVRA 1CY6A 1UBNA 3PFIA 4EF4A 4M0DA 2IFTA 3GQBA 4BMVA 2PKCA 3JD2A 1S4QA 4MKHA 3WJ7A 3QFFA 2GEBA 1JG6A 1KKMA 3AKDA 1QZUA 3NI2A 3ITDA 4R8MA 2CE7A 4BLQA 1UMDA 2HV9A 1H0HA 1JEYB 4E03A 5IJXA 4Y9TA 2VSYA 1WXXA 1F2UA 4UTVA 4ZN6A 3TRKA 1L7AA 4HQNA 1N0IA 3C8ZA 4JROA 3LQ2A 4DTCA 2H1VA 2JGMA 1J0BA 1JMVA 2LDXA 3DKKA 3DOEA 1EFLA 1R37A 2X1LA 1QKJA 3GFOA 3HDHA 4ZAZA 2XXAB 2F6RA 2XCLA 1AOXA 2O14A 4JQYA 4ZOLA 4LTNA 4CVNA 3QWHA 4L5AA 1C9YA 1VJ0A 3FFWA 4HWKA 3AU8A 1QVAA 4I6EA 5C5IA 1BFDA 3BHIA 5HNKA 1RKXA 4LRUA 5DYNA 5EMMA 2V8BA 5FI3A 5FTWA 5LB4A 3RJTA 4CLOA 1LV8A 3HXLA 1CR2A 2X9QA 1K8QA 4B4DA 1YSCA 3K6JA 3EA0A 3DF9A 1E58A 4JXJA 2MU1A 2P2YA 1T0PA 3KWJA 2AG1A 2VUUA 3TGPA 3CR7A 4J43A 3OU6A 3ZGOA 1NT4A 1BFKA 1IHDA 1JQBA 1R0CA 4GKAA 1RXYA 3A6JA 3PFKA 5FLKA 2WZQA 4WLOA 5C0OE 4I50A 1BVRA 2LIVA 3SQOA 4LQCA 2JA1A 4MUMA 1YZVA 3MJDA 2XE6A 4YQFA 3DFMA 2HPVA 3HA3A 1XI2A 4PCLA 4AB1A 2ZZMA 4X7RA 5B1DA 4BQPA 1KDTA 5KINB 1CZOA 4YRAA 2EKBA 2V74B 3QG5A 3MSXA 1JR6A 4OO3A 2RHBA 1VI2A 1JFLA 3OG9A 2INGX 4WW0A 1N6NA 1GEGA 2I1WA 3ZW8A 2ZM6B 3VMMA 1BGWA 4F9TA 2VP0A 2F43A 1VE9A 2Q8QA 2BONA 1YR6A 4ALMA 4F21A 1BCSB 4ILKA 1OI4A 3KX2A 3VV2A 4PTYA 4INOA 3SXUB 1RWBA 2QGFA 2Y4OA 3FHOA 2XUQA 5AK4A 4AYTA 4OQXA 4X90A 3UMCA 4DIBA 5F9FA 3I9V6 3PDCA 4EFNA 1OFHA 2X5OA 3BIWA 2C0QA 3IIIA 3CG4A 3AXTA 2G9QA 2YYAA 3MNFA 2WM3A 3MTEA 2GB4A 1XMSA 2EKLA 2IVZA 2Z4RA 1HDOA 3K0EA 4RK6A 5F73A 3UVEA 2A0FA 2E87A 4QTTB 1WPGA 2B4QA 1SVKA 4LHSA 4G5XA 3A7EA 3KB2A 3C5EA 3RBVA 5AOAA 4P34A 3FAKA 2IOFK 3SEQA 1RBZA 1I3CA 1O97C 4CKEA 1QLJA 1NR5A 3AUAA 3DMRA 2OZLA 4IS3A 1AKWA 4N3CA 4PPYA 3F97A 4UEJA 3HJCA 4PU0A 2BOVA 3B2QA 4YYZA 2Y2VA 5KOHA 2G0TA 1PUJA 5HGXA 1FNMA 1EFPB 3IQFA 3KE9A 4HB0A 1OH8A 2GZRA 1OX5A 1IY9A 2FEXA 1B8VA 5KHAA 1R2QA 2Q1UA 1EXVA 3VPAA 5IK2D 3DBHB 3THRA 4HXYA 3S2ZA 3JQEA 3ROEA 4QUEA 3GQBB 4JL6A 1OC2A 3LUDA 4IRUB 1K5GA 3CKLA 1I4LD 2FV8A 3C14C 3CUWA 4IYJA 1M0SA 4L07A 1UP7A 3P2IA 4X1KA 2PDAA 3G1WA 1DIBA 4MK4A 2JJ1D 2ZYTX 1RRPA 4Q4DA 5JVDF 1PSDA 4PYQA 1Y9JA 1H2XA 1P19A 3BWMA 4HGNA 5B1EA 1XYVA 1E9FA 2EFJA 2R6CA 4H4DA 5ITZB 4G84A 2XQJA 3QYJA 1R5NA 5FPKA 2I7VA 2CLEB 4JJEA 3ZIUA 2WJ4A 2J5BA 2JFWA 3IKVA 2ZYSA 2QLBA 4LJLA 3FZGA 3V42A 4BNKA 5KTSA 1E1YA 3F74A 3QI7A 2UZ3A 2ZYGA 1GRRA 4J16A 3TPZA 4AWXA 4EPXA 3A4NA 3I01M 2P41A 3UNXA 2KB0A 3GARA 2C4WA 4QOGA 1DIOB 3QG1A 5E95A 3S2UA 4M1OA 1Z4IA 4GEGA 2WM2A 4JGGA 1G6KA 2O48X 4L8LA 4LCEA 3UHAA 3D4OA 2FW1A 3DJYA 1CJCA 3LPCA 3JRWA 4MUIA 2WPDA 3T3GA 4XXHA 1N0UA 3T9AA 1YJBA 1TB4A 4JDPA 3TQQA 2CHQA 3QYFA 1O96B 1T3LA 2EZ4A 2GARA 2IYPA 3RIXA 4BO9A 2NNWB 2HZBA 1GGJA 1B0UA 1NV9A 1SQ0A 3DNMA 3KQMA 3P2YA 1N78A 1Y3FE 4P08A 3ITNA 1SBHA 3QA3E 3MT0A 1OH5A 4BLVA 1ZUIA 3O03A 1XD9A 4AMUA 3IVGA 4IKPA 3IFSA 2XUJA 4EI9A 3LQFA 4WJZA 1GZDA 5B7GA 3CH4B 2FMTA 4B7UA 1SAYA 2AZMA 2BJHA 2J32A 4OXQA 5ES4B 4DG5A 1JGTA 4I1OA 1B8OA 3HV0A 1YS4A 2QVCA 2VJYA 1B41A 1UH5A 3AKYA 5A3SA 4BS9A 4G0MA 3EJ6A 5H82A 1B0ZA 2DFDA 1NP6A 2PH7A 4HWOA 4UAUA 4F9EA 1SUEA 2HDWA 5BSFA 1V47A 3LYLA 3PEFA 3BORA 1E5LA 3L0IB 4P8RA 3O8RA 1DRVA 4Q18A 2W6PA 4RC9A 2UYQA 1DPFA 2VDKB 4AI6A 1F4LA 1RFGE 1U0JA 4RE5A 4UUMA 1O0CA 3I0NA 2NVWA 1DAKA 4P6VF 4Q00A 4PZ0A 4TTAA 2G04A 1JI0A 4PXAA 4W6QA 2PUFA 3DC7A 3K30A 1G21A 3L82B 3C3XA 3DOIA 3Q0IA 3QJYA 4G0QA 4U7PB 1ISJA 5K03A 2Z58A 2O8BB 2OHIA 4KJXA 2CKDA 3HKCA 3BMNA 3GRZA 1AURA 3PE4A 4OREX 2YV1A 4DHWA 1EWYA 1YF3A 3IJPA 2E55A 4EI8A 3FYHA 4LQLA 1OCEA 2E89A 4XIIA 4GAEA 4ER5A 4ZOEA 3TKYA 2EKDA 4LEIA 3ZQUA 1RHUA 4IEFB 4L51A 4Q3CA 2MCFA 2YRXA 2PH3A 4KH0A 3RG2A 3HKEB 1AQIA 4MRMA 1Z4NA 4X3OA 1F8FA 4CM8B 1OLXA 4V1CI 1XK7A 1AQLA 4LDRA 3W8DA 1L6RA 3O0TA 1G7TA 1CB7A 1XN4A 3D8RA 4LRTB 5ESWA 5SY6A 2Q2QA 5FXMA 3UENA 3MWEA 2Y67A 3UH1A 3QX3A 2BGTA 3EDYA 5DH9A 4IVPA 4L4ZA 3THXA 5JC1A 1EDOA 3U80A 3OOWA 1A1SA 5EI5A 4BX9A 3OY2A 1QGAA 2PJZA 4QGBA 2HF7A 2RJNA 4WFIA 3MA0A 5CA1A 1OGJA 4EYGA 2CWWA 3D81A 2FDRA 5AM3A 5JI3E 5IVKA 5I7RA 1QORA 2J3IA 3U39A 3RK4A 1C7ZA 4DMHA 1JHDA 4G5HA 3OP1A 5JPCA 3WAKA 1DIRA 3BWDD 2O5CA 3MTDA 5LYJA 1U8FO 3PC6A 1PFUA 4C0BA 2EX4A 3T1TA 2C59A 3OIFA 4U0JA 5CFRA 1SZJG 1KR5A 5D7NA 4P4TA 3FN4A 2C94A 5AKYA 3EX7C 4AZTA 2GD6A 3SXUA 2R00C 1IPFA 2BP7B 2VEOA 2LPMA 2RGAA 3K2IA 1OGYA 3OECA 4R6WA 2OUIA 3VDQA 5I47A 1QRUA 2GFIA 2OFXA 3ANMA 3G5AA 2GTHA 4XGRA 3TX2A 1T3GA 3WWEA 2IUFA 3INRA 4B32A 1Q1ZA 1OU4A 3HWSA 1IEQA 1UXKA 4TT8A 1A9XA 1KO7A 1DP4A 3ONFA 1Z5PA 5TIIA 4X0EA 1CDEA 5FBWB 4M89A 4QVIA 1DADA 2EL7A 2D2FA 4KKXB 4Q1FA 3WOHA 3I2IA 4R2LA 4BKRA 2I3GA 3IMGA 1VPWA 1KMIY 1ORTA 2CXPA 3KYCB 5CHYA 4RZSA 3RVDA 3NH9A 1NHGA 3ZDFA 4RTRA 1ISHA 3SF8A 3TL3A 3ZVRA 2H2IA 2JLBA 5DNCA 3RYTC 2H1OA 1NR7A 5IN5A 4KVFA 3A9SA 5GADl 4DYVA 4YMWA 3AKCA 2R6AA 2XUDA 3JAWA 4KPGA 3BKWA 4QHTA 4QO7A 4TLLB 3ZLTA 4AJPA 1L7NA 3T1YB 4QODA 2NTVA 3C8UA 3I0ZA 1B3BA 2QQFA 3QXHA 3UJNA 2IYVA 4L7VA 1WBDA 1J2RA 1GNQA 1M8GA 3L5KA 3CFYA 3RLFA 3P5BA 4CTMA 3P9CA 3O74A 4XE5A 5D01A 3WYCA 1J0DA 1AQYA 1YI0A 4H2DA 4S0ZA 3AOGA 1DBVO 2F1HA 1ISGA 2WIAA 4A0QA 1CRPA 4TSFA 3QFCA 1BC5A 1MV8A 1UADA 1XZPA 4YLYA 3FHCB 1ND6A 5JD6A 4B4VA 2YH2A 1G8GA 5EQJB 2PQ0A 4MUXA 4K1LA 1QO7A 5BWBA 1XAGA 2HQSA 4GOKA 1PW5A 2IXGA 1T6XA 4WCVA 2PS9A 5AI8A 3VPDA 4RJJA 5JMPA 3RTBA 1HGXA 1MQAA 4V24A 4BVHA 1A98A 1JWBB 2Y0CA 3OCYA 4GE3A 2BEJA 3L4BA 3OJEA 3DVLA 5THQA 3ZWNA 4DMKA 1PVDA 2BBTA 1CUUA 2CDNA 1H9CA 3E3NA 2FPUA 2JFPA 4IXTA 3VJKA 5LMNB 1K27A 3PNBA 4EKIA 5KWJA 1IOZA 2EZ9A 1ZD4A 1GOTA 5GPBA 3WADA 1GPH1 1R4MA 3UCEA 4F6RB 1XZCA 2WT8A 2F3SA 4BNGA 2H1RA 1Y3IA 3WZLA 3ZZNA 1U0GA 1HETA 2AX4A 4JAVC 4B46A 1ZZGA 1HYQA 4AS2A 3ZI7A 3VSBA 4JXXA 1S6YA 1ZVVA 4KQMA 4U7DA 1KERA 1GU0A 1NVDA 3F1KA 5H59A 3REGA 4CMCA 1E1CB 2I2FA 4BVKA 1TMGE 4FFOA 1XMIA 2P79A 5LM3A 2PEZA 1FZTA 1IHPA 2VHTA 5AVYA 5CPFA 2C5GA 4OQEA 2F3UA 4FGWA 1QBGA 2H8KA 4FMDB 2J5QA 3D4LA 3DUWA 4HNVA 3I4LA 3AK4A 3ENVA 4M7WA 3DXYA 1L5HB 2CLDX 2X23A 4QDOA 1U2RA 4UATA 4EW2A 2QBYB 4PNPA 1HUQA 4NCBA 4JKOA 5KKCA 4CMEA 4Q7QA 4DANA 4MIEA 4MZXA 2Z5LA 2AI1A 4GYWA 1GFWA 4D6YA 4KC0A 3NM5A 4J0QA 3MXOA 1LJUA 2OP0A 2WE8A 4HPXB 3ZDEA 4ZZIA 2XT0A 5BNIA 4CLRA 3W6OA 3ZJTA 4RAOA 3LBHA 4TL8A 4ZQEA 1V7PC 1VOTA 3SPXA 4COOA 1MAVA 3B13B 1K7CA 5H8WA 1FFCA 1HE3A 1ZVMA 1ZK4A 3N2GA 4KQ2A 1ZCAA 4D0RA 1Z6XA 1O96A 3MYYA 1WEHA 4YT5A 3ZE9A 2RHGB 3LPNA 1C2TA 2QTHA 3QENA 5HUJA 4G4SO 4W9MC 1O57A 2AC4A 3NG1A 5IKXA 4JQCA 1UR5A 3QXCA 3KJEA 4Q82A 4BFVA 3JVDA 4UUPA 3IHKA 4ED9A 4HAXA 4B7AA 3HR7A 3M6FA 5K3SA 5ECDA 1YOVB 4E88A 3GIWA 4GPEA 3QVLA 1GARA 3JZMA 4M9RA 4TYMA 4BO3A 2YRFA 2X4DA 4GGMX 1SQGA 1G3IA 5L53A 4F91B 1TX4B 1F17A 3A1WA 4OBXA 4FGJA 4MQ4A 4AMYA 4O4JA 3A2KA 1IQRA 5FYQA 3L8GA 4K6MA 2R4UA 5FTKA 4L8WB 4PQGA 3LECA 1I6MA 5C8DA 1KMQA 5DNAA 2FR1A 4EKEA 2A0UA 2DSTA 2V45A 1RRKA 5DWVA 1MXHA 4E4RA 3N76A 1EFCA 1RFLA 2EX1A 2JIPA 4Y7CA 1VDZA 3QIAA 1FB5A 1HT3A 4RO0A 3ZWXA 3WKCA 4UOQA 4N3NA 1ZD9A 1GQ2A 2DQSA 2YRWA 1DAMA 2I2XB 3FRJA 2DHEA 1QTRA 3FFTA 4CU5A 1PX0A 3M70A 2PE5A 1I6LA 1PR6A 3B38A 3P0EA 1KC1A 4UVHA 1YC5A 2WAXA 4ARZB 3O4JA 3ONWA 4LE2A 4EGAA 3NCTA 4JUAA 4OFBA 5HDQA 3TUIC 1AGPA 1EFVB 3RF7A 2P6OA 2EBWA 3ND9A 4Z9BA 4F9FA 4PVCA 5EXSA 4MQUA 1BD3A 4G56A 4DV2B 4JR0A 1K06A 5A1JA 1XMPA 2QGNA 3WTBA 1FTGA 2QN2A 2JGFA 2JBHA 3HY6A 4MPJA 4RHCA 3MTQA 2I2BA 1CUCA 3D6FA 4KPFC 3TIVA 2GBPA 2JCBA 1B6GA 1V5EA 4L9AA 1JEDA 1BA2A 3JWIA 3IC5A 3LUPA 4W1SA 4BEWA 1MQ8B 3SKXA 2V7GA 3JV7A 5PNTA 4HX2A 3B9PA 3G2LA 1PL7A 4RLFA 2Q7DA 4L6AA 3UK2A 3V4FA 2C0CA 3UG6A 3UW1A 1PL8A 1SUFA 2G36A 4IDAA 2H2HA 1LXCA 3L49A 3ZHCA 4CDMA 4XIYA 1UOPA 2D2IA 5HFAA 3SC2B 3PHHA 3RBXA 4RABA 1G3UA 2FEMA 4U6NA 1YB6A 3M6UA 1DLJA 4PC1A 5HFJA 2O7RA 4F1JA 5TQ0B 4F8EA 4OCZA 4RL6A 3L8CA 5FJJA 2LTAA 2VUSA 3V1YA 3C1OA 1L7RA 2DWCA 3EG9B 4IXDA 1HL7A 3S29A 1U8YA 2VHXA 1WXWA 2E4YA 2YASA 4KLCA 1J39A 5JUWA 1AQJA 2EFCB 2RHTA 2OORA 1EXNA 4A6XA 3DLAA 2R62A 4JLDA 5G2OA 2PR2A 3MQ2A 1NYQA 1JL3A 2PG3A 1YKGA 2RJ3A 1XCBA 2O2HA 2JKYA 1ULZA 1FL9A 3IEPA 3X1WA 1ZYUA 4OLJA 5I7WA 1AGRA 2CZCA 3PD7A 2C31A 1X7XB 1GO2A 1D09A 1DEAA 3NV7A 4A7PA 5JAZA 5FA6A 4B6OA 3LGSA 4DLWA 2B8NA 5JZSA 2O8VA 2GEFA 1I9CA 3I5MA 2WHXA 1D03A 1SHZA 4BKPA 3JTEA 1VLQA 4RK4A 4MQFB 1V0JA 2CHEA 4Z54A 2X58A 4ND7A 4RGVA 4W1PA 1RJDA 2Y1DA 3DQPA 5D86A 1I0ZA 5F2KA 5LBTA 3W78A 3WK7A 2HWKA 1V8PA 1KY5A 4IIEA 3ONEA 2KE5A 5HFNA 1O58A 5BOVA 3VTKA 2RG1A 5BSGA 1E1KA 3MQ4A 2O2GA 5IJAA 1EFKA 2AF4C 2IHTA 3D64A 4JEIA 1ZA1A 4XFKA 3AEUB 4WZ6A 1ORVA 1LRLA 2EKQA 1G55A 1SC4A 2FYTA 3UATA 4WBNF 2GNOA 1SCJA 4QPZA 4BCCA 1OXVA 3DYBA 3R3JA 4D9HA 5AHKA 2IP4A 1P4GA 1W34A 2NPIA 4PXSA 1K7EB 2GJ9A 3DLTA 5CG1A 1K8ZB 3TPFA 2PSHA 2RBGA 3G0CA 3M6XA 4H4CA 4N5IX 4ETNA 2VNHA 2ISSD 2C2MA 1WUJS 4CDGA 4B3HA 3O2JA 4BAGA 1PBTA 3A9WA 4MYUA 2G17A 5EZQA 1DC3A 2AXNA 3PF9A 4PBTA 4ZCLA 2ZYAA 2ZBUA 1PNRA 1JVNA 2WDZA 4GMHA 4Z8YA 4WXYB 2D3WA 3UMFA 2VDJA 3BSWA 3PFHA 5ALOA 5I7UA 5C18A 3R1IA 3WBKA 3DD5A 1AMNA 5ERYA 4YUWA 1U5CA 4FE3A 4W7IA 1Z45A 5DBOA 4MR8B 4IHKA 3GA0A 2QSZA 3VZBA 1RWWA 3M82A 4BX8A 5JS2A 3KQQA 1WPXA 2PV0A 3AR5A 2ZXUA 2NO5A 3KZNA 4OXXA 1YJCA 3UTCA 3VOSA 2GVZC 1DRWA 2MYUA 1EE9A 1FUUA 5BP7A 2GFHA 1VTKA 4PGGA 3FKSD 1RZRD 3NAZA 5CU7A 3GPCA 4L1KA 3TZQA 4Y1EA 1Z6AA 2WFLA 4JLAA 4RSRA 1KBZA 2R96A 4PFKA 5ES3A 3W5SA 4FXPA 2P9ZA 3T5TA 5BN5A 2EFGA 3OUZA 3LY7A 4AZ0A 1Q0UA 4HDAA 1FA9A 4KDCA 4U1RA 3H4VA 2PY6A 2DTDA 2YJNA 4W99A 1XAIA 1SM4A 1AIPA 3HJHA 3QELA 3VC1A 2DOKA 2OCIA 2ZSIA 4HATA 4L5YA 1Z4QA 3VGPA 4OAQA 1HFEL 3RK1A 1HE2A 1X7WB 2XWSA 1V7CA 3PD1A 4HB3A 5ITSA 3A1TA 3ZDBA 5KYXB 5AKLA 1WE2A 2PUJA 1QJCA 1NJ6A 3GGDA 3IIMA 3KKLA 3EQ7A 4KGDA 5K8TA 4C2UA 4WEQA 4IJMA 1NXSA 1VIMA 1ZSVA 1NJ1A 2GTIA 3RRZA 5IT5A 2GZ2A 3VUEA 4YRIA 1SZPA 4HN4B 2ASVA 3TO5A 4FMCB 1DCMA 2VUHB 2ZTSA 1J23A 4EG4A 1S3IA 4FX2A 4C87A 1V4NA 4MVCA 4B83A 3EFHA 2BM1A 4NHEA 2Q3MA 3CNNA 4GU5A 1E2NA 1K63A 1R6TA 4PSAA 4W5RA 3AQ4A 1N5KA 4MUGA 4NZOA 3UICA 1EE2A 4MV4A 1B6RA 4RHYA 1TW3A 2HPZA 2FZ4A 1FRFS 1T36B 3BS4A 4ICIA 2ZBPA 2BW0A 4I1YA 4WHMA 2I1LA 4B71A 3IX7A 4JLUA 3U7IA 5EJIA 1J1IA 4DUYB 2AFIE 3KRTA 3MPUA 3OQJA 4EPTA 3RU3A 1TYAE 2QXUA 3M8KA 3MELA 3WK5A 4YJGA 5ILGA 4P84A 1JA1A 5JMTA 1NWCA 4MQEA 5CVTA 3GZ4A 4MYRA 4MS3A 2FDCA 5FBRB 4Y2TA 3RU2A 1OE0A 3IS3A 4UDYX 1H4SA 3TQSA 1HV8A 2FPKA 4CM9D 3B8HA 2V1UA 2JGDA 3I4FA 4JB2A 1UZAA 3SAJA 4HVLA 4HSGA 5E7JA 4UREA 1GPKA 1IZ7A 5JDCA 1UEXC 5J2TA 3KZOA 2XLBA 1L3IA 2O3JA 5JAQA 3OA2A 3Q7IA 4U2DA 1HRKA 2OV3A 1SHKA 2X22A 4WQMA 1UDXA 4EELA 3E2PA 3ZE8A 1EBUA 3W8NA 1GGKA 2XWQA 4KAXA 2FWRA 4R8VA 4OFWA 5B3KA 3GDOA 1Q50A 1MH1A 1P7ZA 1FXUA 3OZBA 1REQA 3ROMA 3JQGA 3S81A 1J1UA 2IKSA 1X92A 4PYNA 3NFRA 1FSPA 1UM9A 1X8KA 1TZJA 4G5OA 5LQSA 3X2FA 5M04A 1FFGA 1KYTA 1TT5B 2Z3ZA 1OFTA 1U8EA 1WABA 2W43A 5FL7A 4ZI5A 5BURA 5KTKA 2A94A 1PD0A 1VI5A 1E62A 3C6BA 2NAFA 2UKDA 3EVEA 3BWBA 3OX3A 2G0AA 4AP6A 1BU8A 2C95A 1L8QA 2RAPA 2P67A 3F96A 3K09C 3SSAA 4D8VA 2WWYA 3AV3A 4FZRA 1A97A 2PK3A 3ELUA 1EA7A 3Q3HA 4N0QA 3TCXB 4YRPA 1CBUA 2XUOA 2I2DA 1J8QA 2IUSA 4CEHA 3PKZA 5CIYA 1UZNA 5K0BA 1Y0BA 1U0NA 4RPGA 1WDWB 2NXWA 1JX6A 2IYQA 3Q3VA 5T4BA 4UQPA 1IVNA 3AHFA 5ICMA 4DMLA 4JLKA 4M1MA 5KVSA 2PUCA 1MO2A 2N0SA 2ATCA 2GNPA 4M0FA 2OCDA 4HS4A 2PRJA 3FDIA