1B0VA

I40n mutant of azotobacter vinelandii fdi
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECNDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN)
publication title Alteration of the reduction potential of the [4Fe-4S](2+/+) cluster of Azotobacter vinelandii ferredoxin I.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b0vA00
2V2KA 4AYBD 3MMAB 3OR2A 3MM8A 1GAOA 1WTFA 1H7WA 4KT0C 1F5CA 1G3OA 1F5BA 1XERA 5CH7B 1Y4ZB 2PDAA 1BD6A 6FD1A 1SIZA 2XSJA 2WSCC 1FRHA 1GTHA 1K0TA 1VJWA 1BLUA 2C3YA 4XK8C 1B0TA 3EGWB 3MMCB 1FCAA 1C4CA 3OR1B 5E7OB 1HFEL 3MMCA 1SIWB 1FD2A 1FTCA 2FJAB 2IVFB 1FDAA 2WB1D 1Y5LB 1CLFA 1B0PA 3MMAA 1SJ1A 3GYXB 4OMFG 1FDDA 4DHVA 1FXRA 5FD1A 1BWEA 1FF2A 1H0HB 1FEHA 7FD1A 4Y28C 1FRLA 1DFDA 2FD2A 1KQFB 2VPZB 3MM7B 4YDDB 2FJEB 3HKZD 4ID8A 1DAXA 1FRMA 1G6BA 2C3OA 1R27B 2WSEC 2VKRA 1JNRB 3OR1A 2VPYB 3IR5B 1FRJA 2PA8D 1FRIA 3IR7B 4OV1A 1F2GA 1JB0C 6FDRA 1KQGB 3LW5C 2GMHA 1H98A 2FJBB 2FGOA 1FRKA 2V4JB 1Y5NB 1FERA 2GMJA 1DURA 2V4JA 3MM5A 1GTEA 5BYRA 2WAQD 4XDCA 1BQXA 2FJDB 3IR6B 5CHCB 1RGVA 7FDRA 1FXDA 1KEKA 1IR0A 3MM5B 3MM7A 3MM9B 1Y5IB 2C3PA 3PNIA 1B0VA 2C3UA 3MM9A 3OR2B 5L8RC 3MM8B 1Q16B 5BYQA 4XDDA 2C3MA 1ROFA 2Y0SD 4RKUC 5BYSA 2C42A 3EXYA 3MMBB 2XSJB 4L6V3 3MMBA 2WSFC 1BC6A 1IQZA 1GT8A 1C4AA 2VPXB 2FDNA 2ZVSA 1JNZB 2VPWB 1H7XA 3MM6B 2PMZD 1FRXA 1FDNA 3MM6A 2Z8QA 2O01C 1AXQA 1FDBA 4CI0B 1PC4A 3C8YA 1PC5A 2UZAA 1A6LA 3EUNA 1D3WA
chains in the Genus database with same CATH superfamily
5KG1A 2QG9B 2M9KA 4X4RA 4HDHA 4LFAF 2DY1A 2HK3A 4K2JA 1BD6A 3EPIA 2YWKA 3BPDA 3CCSS 4J9MA 4DR5F 4DG1B 3D1OA 3QWPA 4Y6IA 1SIWB 4OYZA 3MAHA 3AXMA 2BEFA 2R8IA 4F04B 5B08A 2VQEF 3MEGB 2EFOA 1OS5A 2A10A 3DC2A 2HKEA 2I8EA 3IGNA 1AT1B 3IG1A 3H2LA 3UCGA 1RU1A 2MKCA 4X64J 3T1HJ 4A47A 1EZZB 4UT4A 2O1PA 1HNXF 3QATA 4R0EA 4HEA9 2OGUA 1NSAA 2HFOA 3ITHB 5KFOA 2HZCA 2OFGX 2XB2D 4R5PB 5DG8A 1VIXA 3OXFA 4A48A 2GHVC 2ATLA 1PAUB 3OTBA 3FC9A 4L73A 5ETNA 3RR7A 1FDBA 1TUGB 1U6BA 3PACA 4DR7J 4PXEA 2MQQA 2M52A 4N76A 3G6ES 2OHDA 1HKAA 3R9LA 1SI9A 2ZH5A 1TP7A 2LKZA 5D0GA 3A13A 3JTNA 4ZHRB 4K59A 1LWEB 4AT1B 2RKIB 3IBCB 2XGQA 4KIAA 1HHQA 1UVKA 2LQBA 3EE3A 3GYXB 1YLXA 2KJWA 1KNZA 5T7LB 2D3OR 1KTQA 4B9LA 2ASJA 1UPPA 2ROEA 1RAEB 5JXSA 1G6BA 3R7SB 1WWHA 6FDRA 1VLOA 2OPSA 3CB4A 3UWTA 2MKSA 1NH8A 4XPCA 1Q79A 3EVOA 1FTRA 4FNHA 5I3QA 2HHWA 1F6TA 2VBYA 1T9TA 1RT6B 1VQYA 1HD1A 4CLUA 3CCVS 4Q8EA 4B9TA 5LXRA 1BC6A 3MAQA 1APSA 2FLLA 3RGIA 1U1RA 1RWNB 3MEEB 2Z4PA 4M8LA 3R2CJ 3NOCA 5MLCV 1WC0A 2W4PA 4Y2IA 1F5BA 1LOUA 4M5GA 2JH3A 1Q1KA 1WG1A 1UETA 2YWGA 1XMQJ 2ZH7A 3CCRS 2IHR1 3IS9A 2RD5C 2XNRA 2CPJA 2J8SA 4DQPA 4CQ1A 2VF3A 3Q86A 3R1HA 2NZ4A 2IBOA 2DEIA 2AIRB 1HW8A 2HVDA 1TL3A 4ITSA 1JJ2R 2MZJA 3MFIA 2HWHA 2YKPA 4ID5A 4IR1A 1H2TZ 2WRMA 4FBUA 2G2YA 5AJ3F 4ZKAA 1F1BB 2BW2A 4EBDA 4HHHA 4EZ6A 4LFCJ 3M7VA 2GMHA 1PBUA 2RT3A 3EX7B 2V8PA 3GFZA 3HHEA 1O5JA 1QSSA 5E0OA 4K4TA 4DLEA 4OHXA 1WSRA 5KT7A 2B4PA 1LFPA 5HAOA 3N0VA 2R7RA 3GIJA 1XR6A 2N4DA 2VC0A 1U2RA 3I6PA 1KC8T 4PXBA 4EWTA 3VQTA 3RAMA 1X4FA 3LANA 2C2RA 4IYQA 4J9NA 4KB7A 2ZZMA 1U0HB 4BLGA 5K14B 2J8AA 2ZD1A 1C1BA 2V9KA 4O3SA 3O3LA 2UVWA 2UU9J 4ZP7A 1VFJA 2MKKA 5DGBA 4E2FB 2EKNA 4FYVB 1HPZA 3CO0P 1HR0F 4RX6A 1FRIA 3CUNA 1VRQC 1GNKA 2FJBB 3IWLA 3CJKB 4UZBA 4DXLA 2IPOB 4UW2A 2MSTA 4ZIVA 1NCLA 2BJ8A 2KT2A 4C0OC 4C97A 1WORA 5B09A 2QC3A 4UUXA 3M2RB 1HWIA 2CFXA 4PAAA 3RBXA 2RJZA 2OEMA 3JYTB 1K0TA 5T41A 1RT5B 2BZ2A 4PWUA 1CULA 4NLWA 1DY3A 4Y0FA 3VHQA 4DV0J 4AXIA 2KZZA 4DQSA 1GH8A 4JBCA 2FJEB 4FZVA 3IFEA 5J1EB 3H0PA 5CA5A 4EUVA 1Y3KA 3DOKB 4NA2A 4CYUA 5IQQA 3QT7A 1N36F 5D4PA 4NMLA 3I5BA 4LF8F 2RS8A 1AYEA 2N7YA 3BR9A 3HHKA 3LTOA 4TY8B 3HJFA 4NRTA 2FVSA 1NHKL 3OHBA 1RUSA 3CJ5A 4OZ2A 1KVKA 2YKQA 1YJWS 2BA9A 1HNZJ 2YKNB 3UDEA 4Y2CA 2P9GA 2MHEA 4C4WA 1YZ6A 5GVQA 3R5GA 2BABA 3DLKA 1VRTB 4TU7A 2XWXA 4RU2A 1TK0A 4DSEA 1RAHB 1NDKA 1IN0A 1WTFA 1XJWB 2QN6B 4ZVRB 5CH7B 3HHLC 3RG6A 2WSCC 2X1FA 3HULA 1FT8A 4KKOB 4UZCA 3KHLA 2KU7A 3Q2SC 3NMAA 4QJVA 3AY0A 2WW8A 4DV2F 2HMIB 2DTJA 1V3SA 1SC4B 5C2GA 3SFGA 3SV4A 4MKBA 3MPWA 4NLXA 1UEKA 1RTDB 1T9UA 1S1UB 2DRAA 1OSCA 3KLFA 3G86A 1V3RA 2HQ3A 3PR4A 5G4DA 2DIVA 5IFMA 4DV6J 2WAQD 4DSFA 4EU0A 4PUOA 3CC4S 1YGYA 2DVIA 1UWAA 1VRUA 2WOMA 2VICA 2PSZA 2W7OA 3TAMB 2L48A 3KJNB 4DR2F 4MK8A 4ATNA 1S0VA 4MIAA 4MIWA 5I3PA 3KK1A 2RE1A 5DG7A 2ATCB 1S79A 1F9HA 1HI8A 5LJ5Y 4LF4J 2PT0A 4U7UK 3PJWA 4DR4F 1SUQA 2JRSA 4C3LA 2NS1B 4GRSA 4MMOA 3G6VA 1QDUB 3JAMU 2ZBPA 2W9AA 1F5AA 2LQ8A 1S7IA 3M9OB 4DS4A 1DTTA 2EC0A 2B0GA 4O44B 4CTAA 5EUHA 3NEKA 1SKWA 1YHQS 4A8FA 5LL6d 3IAS9 3P49B 2CWXA 4X4PA 3DLGA 1F0XA 3PFEA 3HSZA 3MPUB 3K5NA 2ZNYA 1C0TA 3MM9B 5GAHU 3TR5A 2DGTA 4JV5F 5LJ3Y 3DCAA 3QGHA 4EMDA 1J5EF 4K4ZA 2KFZA 2RU9A 2DXFA 4DV3F 1HMVB 2CDRB 1FKAF 3GYNA 5RUBA 2G1DA 4KY3A 5FIIA 1RHQB 4L3KA 1FKPB 5KFBA 5IV4A 4FYWB 3OLAA 4ZPWR 2GJIA 3DFEA 2IVFB 4RL1A 3OPKA 2LXFA 2K3KA 3FVYA 1IBKF 2B51A 2E9TA 3R5JB 3H5UA 4GMKA 2DNLA 1H2UX 3DI6A 1N5QA 2GIQA 2C2MB 1KQFB 3ISNC 5KG6A 5F41A 3O8WA 1T11A 1WG4A 3NBPB 3BO2A 2RQCA 5CYQA 3GPAA 5D8HB 2NREA 3DRSB 1RE1B 3NGKA 2ZBRA 5I4MA 4YDXA 3RB0A 3HP6A 1L3TA 3QGIA 4QIFA 5IOLA 3GIMA 1PCAA 2D9PA 1H2VZ 3MM6B 4LF7F 4OIXA 2Z8QA 5B0GA 3TVZA 1M5OC 2CPIA 3TZXA 4WIIA 4WWSA 4WBFA 4O3RA 3SXLA 3GFHA 2O5DA 1G3OA 2GVDB 4ED4A 2HWTA 1UZHA 2K2PA 4OHYA 4DG1A 2VA2A 5CZVA 2NUHA 3MURP 1TL4A 3O6QA 4K50A 3GE9A 5DLFA 3Q24A 1LWXA 3TW0A 3HO1A 4KGZB 4NPOA 3PM9A 4TNOA 1HBNB 2MKYA 3MEGA 3OFGA 1QJHA 2XBPA 5CCLA 4P10A 3DHXA 4OV1A 3HK2A 4A8YA 3LW5C 3I0RB 4PWDA 4YUDA 5HJYA 1TKDA 1XNRF 2KDOA 1FNXH 5H1SV 2UVUA 2LEBA 4QYZK 3VVUA 3TX0A 3ZZTA 2LEAA 4R5PA 1VISA 4DR6J 4J9LA 1ZAWA 3LALA 2V68A 2H54B 2IBKA 5J1NA 4LFBJ 1ZAXA 2MZTA 2W7AA 2XY7A 1FRXA 3I82A 4P2MA 4BBYA 2YNHB 3FK4A 1U1KA 3SYZA 1KLMA 1PJ5A 3DLEB 4ZOSA 2R8HA 1DHMA 5L1KA 3SZ2A 1S1VA 4RNFA 4ZVUB 3VV2B 1SC6A 3ZXWA 2EBEA 1RTHA 2HG4A 1LWEA 3NNAA 4L3NA 2RKIA 4FKXA 2VQFF 5DETA 2CQ2A 1DBDA 1QM9A 4OX9J 5T7LA 4H4MB 1H0HB 1PYOB 4F4YA 3EGNA 2UXBF 5A2QU 4MYTA 2ZOGA 1N48A 4F0KA 3OR1A 4ZPBA 5ETQA 2HHQA 1S57A 3MZIA 4F8RA 7AT1B 5EWFA 1RBOB 2OD6A 3I96A 3MFHA 3J7AN 1FK9A 3F44A 2P6TA 1MNEA 4E8UA 2C2EA 4OLPA 2MJUA 3BH6B 5DZ7A 2ZH1A 1S6PA 4FN5A 1YJ9S 4I7FA 1TL1B 1NK7A 2R8GA 1E6VB 3T1HF 3QFWA 2PE8A 1RT6A 5HMWA 1ZA2B 1X4GA 4OYOA 1RCOB 4FVCA 5M2PA 1Q82T 4PQUB 2DCUB 1HWLA 4PCQA 4JI5J 5KFAA 3TZWA 2LP4A 1UA1A 1VQKS 1OPIA 1NK6A 2DRDA 3KWMA 5JVHQ 1IVZA 1NH7A 1S72S 2B8QA 4RBUA 2OSRA 1URRA 4CM2A 2QL9B 4IFYB 3C16A 4OZ3A 2K1RA 4NRUA 1N5TA 1FXLA 3V81B 1DAXA 3CCUS 1KBRA 4N77A 1WKJA 4PG4A 1HNIA 1RP5A 4CWBA 5DZ6A 1T3NA 1DURA 2XYGB 1KHWA 1RGVA 1EETB 3KK2A 5CD4A 1FHTA 2IJFA 3LP1A 1N32F 1YWXA 3I32A 4DPOA 3T6JA 2XZWA 3OVBA 3M9MB 2DHSA 4O4GA 4ETXA 4IG3A 1YK9A 5IT9Y 1LW0A 2QMXA 2NR0A 5F0UA 1D8YA 1H7WA 5GAHI 1TV6A 4QPTA 1EJ7L 2GQCA 1JKHB 2R7UA 3GIRA 4CT9A 3HKWA 2F3JA 2EI5A 4EGLA 2AJQA 1SH3A 2FJAB 1U0HA 3QRRA 3VAGA 3TJ8A 1MWQA 2HFNA 5K14A 4YB5A 4K2XA 4K4SA 2E9ZA 4OL8A 3NGDA 3HM9A 1FJ7A 4OX7A 4ZJLA 4ZVFA 3MEKA 1YZ7A 2AZ1A 3IR5B 1LEOA 5HQ8A 1Y00A 2OJ3A 2MKIA 5DQGA 2VB6A 2AQ4A 1BY9A 3W9HA 1SC3B 1IR0A 2GV1A 3PZPA 5ETMA 4AL5A 3N79A 3T5LA 3CMAS 1QUPA 5A6PA 4ZVPB 5J2QA 2R8KA 1QUVA 2JVRA 4DDFA 4C8OA 2W2PP 3MUVP 1WD6A 1OMSA 1R8CA 4TYAA 3KLVA 5D3GB 1EQMA 3I9V9 3C15B 2NLWA 2NPIA 1DARA 4FF2A 1OQ3A 1XERA 2PDAA 1CJTB 1MMDA 3JYTA 2QEXS 5KG0A 2D3ZA 2BJDA 2VH7A 3WC2A 1IBLJ 5K9FA 1NB7A 2GHWA 2B6AA 4F2SA 2D74B 2CJXB 3SDEA 4USJC 3IXQA 3W65A 2IA6A 1RT1B 2AV5A 1XNQJ 1RXOB 1BQNB 4LF5F 1M1HA 4FDFA 4HI2A 3ELHA 3SMZA 1UFLA 2LLZA 1Q86T 2E66A 1WG5A 4HACB 4M5JA 3JQMA 3NS6A 1DLOB 3W61A 4IH7A 2NXCA 1FNMA 2VA3A 2E9RX 2H4YB 4OHWA 4LJMA 2VUGA 2UU9F 5DQIA 1P27B 5KFKA 3JQKA 2NSBA 3SQOP 5IXUA 2DHXA 2XZDB 4NE9C 4ED1A 2F1FA 2UUCF 3EDQB 1WSVA 3GV7B 2YKNA 1P6TA 2CQBA 2AYBA 4MH8A 1S7HA 3NCPA 4L76A 2QLWA 1VRTA 3R2DJ 2B3TB 1CJVB 3M8ZA 4NLSA 3MDFA 4WYLA 4GKJF 2XMUA 2XMVA 5BJRA 2OPPA 1CVJA 3HFVA 2CNOB 4KGVB 4JI7F 4DR1J 1X9SA 3G6XA 2FHOB 1VQNS 5A6WA 3LGNA 1HQ2A 1HARA 2ZOMA 1NZAA 1D9FA 2FD2A 2RVJA 3BREA 1S1UA 1M5VC 4OI1A 4QYRA 4DV0F 1RISA 2KFYA 1P9YA 4DFPA 4JYAF 5DRKA 2X3GA 5ADZA 1J5OA 5F8HA 2JSXA 4IQMA 3TAMA 1S59A 2V50A 5HP1B 2ZH9A 3J80U 3C14A 1WTBA 2DNRA 3BKUA 4U8VA 4ZP8A 4I6AA 5HROB 1CJUA 3CF5Q 3M8PB 1CJKB 4FKYA 4CH7A 4PG5A 1Q4RA 5HVHA 4DV5F 1GMWD 3I56S 1UMJA 4N5SA 5D78A 5THWA 3KLGB 1DZ5A 1N5YB 2VFRA 1M5HA 1EX8A 1LV5A 3BBBA 4NWBA 1X4HA 1BMQB 1NHUA 2ZJQQ 2RUSA 1X4CA 3Q22A 1EKSA 1JJCB 4O44A 3SEOA 3CCZA 3J81j 4DLGA 5A0YA 4ELUA 3HSDA 4IOBA 3CDUA 2WW4A 9RUBA 3CE8A 1ACMB 2MEWA 4C48A 5KFGA 2Z58B 1N8RT 3MM9A 3KXDA 5BYQA 4F4WA 4F25A 2CVEA 2LA6A 2ZE2B 3PTWA 2XMTA 5L1LA 1X4EA 1FEEA 4UQGA 3HHLB 4YEAA 1T0TV 3IP0A 1HMVA 1VQ6S 4X66F 2IAJB 4NXMF 3LP0B 2XLKA 4PYAA 1O51A 4HT5A 4IR9A 2H1YA 3MUMP 1RU2A 3KUGA 4A8KA 4B3TJ 4TXSA 4ZCLA 2WVFA 1RAGB 3Q8UA 2FVPA 4LF4F 5B7WA 4K4UA 5AT1B 2H51B 3PYDA 4Q8FA 2FHMA 5ETKA 3M1VB 1BWEA 1HNVA 1LXJA 5JUMA 3MM7B 2WONB 3Q8RB 2DNHA 3CJ3A 4O3QA 2VPYB 1QAIA 3UDVA 4ECQA 3X1LB 1RHJB 1N34J 3NBPA 4YR3A 3CJ2A 3TZYA 4LF9F 2NUUG 4RW6B 4P2SA 4KPYA 3V4IB 2CJYB 1RYSA 2AD9A 1TUVA 4QBUA 1QLNA 3HD2A 1FJGF 3MI7X 3BBCA 1JLCB 2OP5A 4O3OA 4C3KA 3A8JA 4A8WA 2ZBCA 5HN0A 3W62A 1FJCA 2QRRA 4FP9A 1FWKA 3MM6A 1NO8A 3FRYA 4X62F 1X9WA 3T5KA 3R7NB 3FDSA 3R27A 3TO8A 5KG7A 5AXLA 2J0SD 1T03A 2GVDA 1B3TA 2BACA 1N88A 3MMCB 3K5OA 1N6QB 5CCMA 1EP4A 1FDAA 3G96A 4DOZA 1E6YB 1HQUB 3CNQP 5FD1A 4Z7CA 1HBNA 1VQ8S 4AL6A 2DNQA 1T95A 2R4FA 2YX1A 3B82A 2EK6A 4O0NA 4QWCA 2VONA 2Y1RI 3H4DA 2W24A 2IA0A 5F8NA 1TK5A 4FXWA 3VWSA 4CLKA 5L39A 3G8SA 4HLBA 5CHCB 3POTB 4QR1A 3UVJA 1ZM3A 3T5JA 3IWNC 4M5LA 2DHAA 5L46A 3QO9A 1RAFB 1OY8A 4XO0A 4IOCQ 1WC3A 2FYXA 3CCTA 5KOXA 2V8GA 1OWXA 2UZAA 4WFZA 3T5HA 4K8RA 4F36A 1SJFA 5A76A 1R8BA 3GCXP 1YVFA 3H98A 4UOFA 1FRHA 5LSRA 2G2OA 1RLCL 2GA7A 2YX7A 4F2RA 2JEJA 4U96A 3IC1A 1HI0P 2N3LA 3LOUA 2MQNA 4U7CA 1VI7A 1X31C 2ACYA 2JJ4D 3M6WA 1IUJA 4IDKB 1R0AB 3FMBA 4H4MA 1EKRA 1ZZFA 3E01B 3VAJA 1JB0C 4LBHA 1O0PA 3OSPA 5F8GA 4NLOA 3VALA 3K8WA 3GLJA 4DR5J 3EM1A 4OX6A 5SUHA 3PX4A 5MAOA 2VG6B 3QLHB 3AXKA 5DDPC 4DCPB 2NXEA 4ED8A 4ZMMA 1WHXA 3D6MB 2HFSA 3H5XA 5HBMB 4IRDA 1MWZA 5J2PB 2VQEJ 2CYYA 3LAMA 4OYPA 4I2QB 1X0PA 1U25A 2I6WA 4USHA 4QW9A 4A8XA 2MLYA 2G0IA 4KR0B 4DX7A 4PQUA 2RB7A 4J7CA 5LSLA 1HNXJ 1W2IA 3OTDA 3G8TA 8AT1B 2B56A 4CDIA 4LRAA 4V19X 4RNMA 3KG4A 4DL3A 3P4UB 2RHQB 4OZ0A 1AUDA 4N8OA 1RWKB 4ILRA 2V63A 2WBRA 3KYLA 4I4BA 1GMWA 3HHLD 9ATCB 1WC6A 2MKHA 3IMQJ 1UJ6A 3PW7A 2MHNA 4I1TA 3G71S 3K5LA 1YJNS 1U4BA 5BYRA 5ETOA 1RAOA 4DS5A 2V9WA 2DNYA 1JQGA 4OQJA 1EETA 3C6UA 2LQ9A 4URQU 4OZLA 1VHFA 5KAKA 1N4LA 2J9EA 1R0BG 3JSBA 3ISZA 4WFXA 1C1CB 4F4AA 4M5HA 4UY8T 4F4ZA 3ILIA 2M8HA 3GWCA 3N5FA 5HVFA 5C24B 3A8IA 1KR4A 5B0DA 1JKHA 3LWMA 2FUG9 3MPYA 2KYZA 2IC3A 4WKYA 4JI5F 1IKYB 1MU2A 1NDCA 2ZZTA 1C2PA 3OD2A 4DPUA 4ZLJA 5C25B 5GMKa 1U49A 1SJ3P 2AP6A 1NPKA 1SJRA 4ID8A 3P8BB 4JI4F 1NAQA 2RRNA 3DM2A 3I0SA 4NA3A 1U7LA 4DPWA 5A8WB 2D3UA 1D09B 3EJMA 1UVMA 2MTLA 1BWVA 1KOOA 1VJQA 2XULA 4B08A 3KJQB 3DN9A 2HAIA 5K8NA 3PY8A 3TP2A 3RYLA 1VOMA 1FFGB 2DHGA 3OTCA 2C42A 4DFKA 4B9MA 3QZ8A 3VAIA 3AH6A 2CPYA 2BRKA 2IJNA 1W25A 3MF5A 4ECRA 2MQOA 1Y9OA 2KN4A 3BSCA 4FBTA 1KWMA 5AJ3J 1NNDA 4X4VA 2VBXA 3H2UB 2KFNA 2JNJA 2ASYA 3TA0A 4RNHA 1R31A 2GJFA 2BJ3A 1UPMB 1WC5A 1R8PA 4OI0A 1YJTA 1VBYA 5IT0A 3KHHA 4RW8B 1HYSB 1B70B 2ZEJA 3UDCA 2OPSB 1KTVA 4MKVA 4I2PA 2DR5A 1BQNA 2KM8C 2VDIA 3G2XA 4J9PA 2A1BA 4Z37A 2KT5A 3CD0A 2CQDA 4R25A 1F2GA 3HPOA 1GMUA 5F9LA 4F02A 1YDLA 2J6SA 4OX8A 3W5ZA 4CLLA 1JX4A 2VHGA 3DMJA 1EIYB 2RSQA 2WSFC 1B64A 4P6QA 3ISND 2ROGA 3QMQA 3EGZA 5E3QA 4ZPDA 1JLFA 4LRCA 2ZFHA 3K58A 4KQZA 1Z2ZA 3ILJA 1HR0J 3OR2A 2R2RA 4ZK7M 1CJVA 3I5AA 3MPDA 2B43A 4JI1F 2IRUA 2H3EB 1TL3B 4JI8F 2A6OA 1S6QB 4RUAA 5HATA 1GTHA 4ID5B 1S12A 1IR2A 3TVYA 1ZBTA 4WFBQ 3US5A 1WDDA 4OI6A 1FTCA 4RW7A 1HBMA 1BHNA 5KOWA 3PJ9A 2LU2A 4I69A 3VVTA 2D7SA 1U1OA 1D9DA 4LRBA 3PO4A 4YDDB 2DGUA 1XN9A 1IBLF 2Y9HA 4RJVA 4DPXA 3FEZA 1IM6A 2CXEA 1V5IB 1WF2A 4Y65A 4DJBA 2FPHX 4OLOA 3ENQA 4HI1A 4LRDA 3VAMA 4A8MP 3ZZRA 2XO7A 1M90T 2ZNZA 3R5CA 4ZCKA 2MYFA 3BYPA 4QIEA 3IM9A 2Y0BB 4UF4A 3SIPB 4XDDA 3FEYB 2DXEA 2WVBA 3QT8A 3CULA 3J81Y 4RUCA 4P7VA 2H65B 3QJJA 5HP1A 1K0VA 2W7PA 2K3IA 2J7KA 3MM5A 1RWXB 2J5AA 2ZH8A 3AAWB 2YKMB 3M8PA 3M6UA 1KFSA 2RRAA 5JMNA 3MECA 4FPIA 1RA7A 2Y1JA 3A3OB 3CCLS 1HPZB 2Z56B 4QIWD 3M32A 3KLGA 4K4XA 2CQ3A 1N5YA 2GAHC 1FESA 3WX4A 4DF4A 4TLRA 3UQSA 2OEJA 4WPAA 1RWOB 3P3DA 2MY8A 2XEXA 3AA9A 4LF6F 2PI4A 4EK2A 2ACMA 2HQDA 4DR1F 3TNVA 1LWFA 2OPQA 2R2UA 2PFFB 5KFXA 3OJSA 1NK9A 3QIPA 3WQPA 8RUCA 1BQXA 3ZTSA 3OVAA 1Y5IB 1R3NA 1I94F 2ZJRQ 4KH1B 4DV2J 4C7QA 1IKWB 3LH2S 1T9WA 3TRGA 3SCIE 1CULB 2BQUA 3HHLA 1X9MA 1QVGR 3EVMA 2FJWA 2NQPA 3O1LA 5DG9A 2Y3YA 3KNGA 2IVMA 2M5YA 4RUHA 3S7RA 4W92B 4DSJA 2HQIA 4CYUB 3DGVA 4RWXA 4A8OA 3M1VA 2HHTA 1FF2A 1WACA 3KFWX 1AA1B 4KRWA 2FZGB 2DNZA 3KJVA 2WONA 5DGAA 1HA1A 1UFKA 3CDAA 4IQXA 2DGVA 2K7JA 3L7UA 2KH9A 4DR4J 2KYXA 3DLKB 1CC8A 4RW6A 4O0IA 3IGVA 3V4IA 3PG9A 3M8RA 1UW4A 2BE7D 3MOJB 4DL5A 3MHYA 3UO0A 2YTCA 3DDKA 3CCWA 3UR3C 2RF2A 2BM1A 2XHWA 3N28A 1QSLA 2AJ4A 3GU0A 4UOGA 1NSKL 3DRPB 1S4EA 1U26A 2BJ1A 1Y4ZB 1WNEA 2BBEA 4F0MA 2RU3A 3GILA 3MMCA 3GSDA 1N6QA 2ZHOA 2VFUA 1Q8LA 5HL7Q 4WFNQ 1E6YA 1HQUA 1TMJA 3LGMA 3DU5A 1LWCB 1MLAA 1UP1A 4JV5J 5AE1A 2UUBJ 4B3TF 4PUOB 2DH9A 2DNOA 1W26A 2E5IA 2W2QP 3OQ2A 4ZPVR 4ECWA 2IM3A 2HNDB 2WOMB 3M8WA 2MQPA 3HT3A 2IY5B 2QFIA 1WI6A 4NLUA 2RIJA 1YTYA 1EQ0A 2MB0B 4C0HA 1TMMA 2EC2A 1FXDA 3POTA 2BDPA 1KS2A 1B0VA 1RZMA 3PRBA 2NXJA 3AD7C 1ZTWA 1N34F 4URSA 4WJBA 1LK5A 3W2WB 4J5OA 4HTJA 4LR7A 4DCJB 4QWEA 2EWHA 2M70A 1RHMB 3CJ4A 4IFVA 4UOHA 2PMWA 2DCLA 4PG6A 4LT6A 2PN6A 4USWA 3GZ7A 4Z7YA 1TVRB 1DTTB 4CTAB 4CLPA 5KFCA 1VGYA 3L09A 3S8SA 1VJWA 3VZIA 5CXTA 2CJKA 2QLFB 1T3OA 4HDGA 2ZKTA 4IUFA 4LIWA 3DLGB 1WOOA 3BV8A 4IDKA 4K7QA 1R0AA 2AGQA 3PCOB 4J9RA 2V2VA 2XS5A 4L72B 4LF7J 4QZVB 4FVMA 1Q8IA 1R27B 2OTJS 4Q7AA 1SH0A 4KPCA 4WFYA 4GC7A 5EWEA 4CT8A 4OHZA 4QR2A 1EAYC 1Y5NB 2RRBA 3BN4A 5B0BA 2X1BA 1GEHA 3VAHA 3AT1B 1T9VA 4JOUA 2VG6A 3NWRA 2E5LJ 2VOPA 1RWPB 4OZ1A 4PKDB 1X4AA 5IWAF 4ES3A 3BS9A 2BKNA 3DLBA 3UD3P 3Q8QB 5C42B 5J2PA 3TYTA 2NYIA 4I2QA 3I4PA 1S1TA 4LR9A 1FD8A 1ELOA 1XEZA 3D3BJ 3DI6B 4L74A 4LUBA 1XNRJ 4BS2A 3MR3A 4EI2A 4R0JA 2VD3A 4A46A 2K7KA 2DNGA 1KVIA 2CZ4A 5B0AA 3M8QB 3F0NA 2XWYA 4BC7A 4C8ZA 3Q0AA 2BUNA 1Q7LB 3OV7A 4DZ6A 4M63A 3IRXA 2HRYA 2YQ0A 2WSEC 4Q2LA 1MN9A 3WC0A 1I3OB 4OZJA 4B3MF 1ZA1B 4WFAQ 2OPRB 2W4DA 2XMJA 5J2MB 1ZAVA 5H9FK 3ULHA 2VQFJ 1A7GE 3C19A 4LBPA 2HQFA 1UTAA 2VIHA 3DU6A 3NOGA 2YNIB 2VPXB 4ILLA 2UXBJ 1Q95G 1C1CA 2O01C 1AXQA 3D9BA 2EG1A 2KRBA 3AOAA 1CS4B 2GNKA 3PRDA 4OFZA 2Z57B 3K8VA 4ZLLA 4ZITA 2H4WB 3AJDA 3GR1A 5C24A 3JSYA 1WEYA 2P5VA 3D4JA 2WHOA 2HEKA 3HX9A 1REGX 1YITS 2XHCA 1G4CA 4WTYA 4ETZA 3DKDA 1IKYA 4PWDB 4B3SJ 1SJ4P 3UCUP 1KLNA 4NOHA 1NK8A 3FMWA 5C25A 1YJRA 4JI0F 4ELTA 4OJGA 5SZTA 4AFFA 2FIUA 4Q2MA 1RJJA 2RNEA 2G0CA 2L3MA 1MW7A 5KFDA 5A8WA 4J9SA 1VK8A 3TJAA 3NGSA 3D1QA 4EYIB 1KLMB 4FYXB 4QR0A 2JHEA 3GV5B 1S1VB 2ASDA 3T1YF 2LMIA 3QFHA 2J0QD 4ZIWA 1RTHB 3THTA 1FI4A 2C2DA 3ZNUA 4LR8A 1OY6A 3EZ5A 4U6PA 4YQWA 3M2UA 1R6YA 1NJWA 3OL8A 1RBLA 1VYAA 3CCES 3OR1B 2IDLA 4WK1A 3S1TA 3OTOF 3D6TB 3KK3A 1N32J 4RW8A 1HYSA 4YHHJ 2N3OA 3OXLA 4IRKA 4K4VA 4N56A 5EN1A 4IG0A 4HYKA 4P52A 1FK9B 2DO4A 2Q1LA 4UY85 1DFDA 1S6PB 4I7FB 3BGOP 4F67A 3FRZA 3Q8VA 4ECSA 2DNMA 4GVBB 1FVQA 4M5KA 4V1Ak 2HGNA 2IM0A 2LQ5A 4RUBA 3DYAA 3KLHB 3GCWP 4UQTA 1RWVB 1RT4B 4MK9A 1WOSA 5KFEA 2C3PA 3PNIA 2M7SA 5E41A 1XMBA 3OFHA 2O67A 5F3ZA 3FQLA 1NU4A 2N82B 2V94A 1TQLA 2OAUA 1U8WA 3RW6A 1YSJA 2W9CA 2CJAA 2ZM6F 2IDEA 3IBWA 5G0RA 1PJ6A 1JJ4A 2XSFA 1T02A 3EGVA 2FY1A 4K5RA 2P9CA 1WJ9A 3C16B 2FC8A 2QSFA 2DGWA 2XMAA 1S6QA 2K1RB 1WELA 1A9NB 4NCBA 1VBKA 3FJ2A 1U02A 2V2QA 4LSLB 3K89A 4KFBB 2OTLS 3QAUA 3M6XA 4DX6A 2AKWB 1HNIB 3GG1A 4KC5A 2CVIA 4QWAA 1AZSB 3PKYA 2KT3A 1ZTTA 3BF4A 4NI2A 3JSMA 3KK2B 2JEFA 3MXHP 3LP1B 1T8EA 2Q6CA 2PA8D 1RTJA 3Q8PB 4K4WA 1WHWA 3LP2A 4J37A 5ITHA 3PYFA 4TN2A 4O4GB 3UNYA 4IG3B 1VQ9S 4BDPA 1LW0B 1UEUA 3FBEA 4QIVA 4C8LA 1TKTA 1N54B 5GMEA 3AHPA 3TARA 4AQYF 2C28A 1JLAA 1TV6B 5BYSA 1RHRB 3H40A 2XNQA 3BB5A 4KGMA 3UD4P 4LF5J 2ZDPA 1TL7A 5KFQA 3UD5A 4X4QA 2NSCA 2IM1A 2O3DA 1JXVA 2PEBA 1OQ6A 1QAXA 2YKMA 2CAJA 4ZCIA 2ZOFA 2J0WA 2FY8A 3NAIA 4N41A 1FO1A 1YKWA 4M5DB 1Y10A 4OYBA 1M1GA 5A8RB 3SCKE 2KM8B 3P6YC 2XM3A 2HFZA 3TOQA 1F9EB 1Y11A 2UUCJ 3FZ2A 3OUYB 3C2PA 2DPJA 3FSXA 3W3SA 4NZ6A 1B99A 5J2QB 3GSIA 5KT4A 2SXLA 4GKJJ 1ZETA 2DNPA 2J76E 2HVEA 2WVEA 2ADBA 4OZ5A 2WBMA 2W1BA 5KFNA 2AT1B 3T6BA 3VQSA 3HXMA 5J1PA 3M4XA 4JI7J 2BANA 3QZ7A 1IKWA 3I9ZA 1Z2LA 4KGKA 3BO3A 4GO5X 4NCGB 2CADA 2B6AB 3OLBA 2KG0A 1P1LA 3SDEB 1NM2A 4MFBB 1UWBB 1R89A 3KLEB 4LRFA 2RH3A 1NJYA 1AFIA 2ALZA 3CPWR 3W63A 3BQ1A 4JYAJ 5DQHA 1B4SA 3MEDB 2JFKA 3R97A 4O4RA 2UXDJ 3TUJC 4WF9Q 2IYIA 4DZDA 3NCQA 2VG7B 1N52B 1NB2A 4WYWA 5IC6B 1J2VA 1PYTA 2AGPA 4YR0A 4G6VB 1YBUA 3B8HA 4YS2A 4DV5J 2V4JB 3BM7A 1FERA 2DRBA 1SC1B 1BQMB 3SV3A 1Q16B 4PWWA 1H38A 4WCEQ 4B17A 3PVXA 1N5VA 2XQCA 1T05A 5LMNJ 1SXLA 2OPPB 4I0WA 1JNZB 3RAQA 1CBKA 2W8LA 1QD1A 1KDNA 1U48A 1HBOA 4X4SA 1FWLA 4G1QA 3DRPA 1X60A 2UUAJ 4DR3J 1SIZA 2KB2A 2XSJA 3Q8YA 1T9YA 3NMRA 3SSSA 3Q2TC 3TANA 3CJRA 3LAKA 4Q43A 5DM7Q 2BXJA 1PIEA 3LWLA 2E5HA 3FCWA 1LWCA 1RAAB 5K20B 2ZKUA 1RABB 1FEHA 1J5OB 2FLNA 1CQMA 2UVVA 1T7PA 4E0DA 3D67A 2HNDA 1UA0A 4X66J 2OELA 2F4VF 4NXMJ 4F4XA 5FLXU 1DTQB 2DR7A 3C14B 1L5UA 3BBFA 1CJUB 3JQJA 2DGXA 3HMJG 3QQCD 2J9DA 2R2TA 3A3PB 1RTIA 4DF8A 2CQCA 4CO4A 3D0HE 4YN3B 3AQPA 4ILMA 2J9DE 3V6DA 3H90A 1C4AA 4KJIA 1VCTA 3W2WA 3FKBA 2CQ1A 4ZLPA 4NASA 3IBFB 3MD1A 4W90B 3PW4A 2BKOA 5D6GA 1G1XA 1GK8A 4USVA 3OFFA 1Z4UA 2PD1A 5EX0A 3H4BA 2MQLA 2NZCA 4LF9J 1TVRA 1K1QA 5KFPA 4G65A 5LMUF 4QYZJ 5A0YB 2J7UA 2GS8A 2BX6A 4LREA 2WB1D 4Q5VA 3GTYX 2BQ3A 4YP3A 1TAUA 3SSRA 4X65F 1FJGJ 1PILA 5L9NA 4B9NA 2DHHA 3MOZA 4X62J 4DV4F 4YB1P 2OI2A 5E33A 4AUKA 1S9EA 4E98A 4M5NA 1JLQA 1U24A 3E51A 4F3OA 2UUBF 1SKUB 4CRJA 4IOAQ 4Y00A 4GO7X 2YKOA 4RBVA 4XDCA 3W1YC 2CQPA 4K5SA 3LPEA 3N01A 1KONA 4RZRA 2QYCA 1VQ7S 2CPXA 4CCHA 3J7ZT 3MPVA 4B02A 3NNCA 4DL2A 4TVAB 4ELVA 2M0GB 3RRKA 1SJQA 2R8JA 5C42A 5F8MA 4XTTA 4WKRA 2CA9A 3C8YA 1SQEA 1S76D 2I5JA 2KL8A 3N6LA 2YNGA 1Q78A 5E3RA 5FJ4A 4WXOA 3JXOA 1HNVB 4ZN3A 5IS2A 4ZJQA 3D54A 3BDPA 2OIHA 1YBTA 4K0KJ 1T94A 2F8MA 1Y5LB 4WP8A 1R43A 1CLFA 1SJ1A 3M8QA 2W9BA 4OMFG 1NPRA 2D41A 3RZAA 2CPFA 2QMUB 1CPZA 2QE5A 1VS3A 2V34A 3AODA 4DI6A 3UNGC 2LA4A 3IRWP 1CQNA 1VIOA 3UPFA 3HI9A 3W7BA 1RYRA 2RHSB 4PXDA 2VODA 1RWUA 2OPRA 4DQRA 2C1EB 3VZHA 2JL9A 5J2MA 5E3PA 4C8NA 4DL7A 5KG4A 5CD4H 1TFWA 1T03B 5M2RA 1ZPWX 3IA0A 3DOLB 1WHVA 1ZS6A 5LM7E 4P75A 4NXNJ 3EICA 5K5MA 2YNIA 4X84A 1EP4B 3E8OA 4B3RJ 4CLFA 1O8BA 2E5LF 2CNNB 3HVWA 1CS4A 4YR2A 5GAEU 2AGOA 4JP8A 4FNIA 2JX2A 1VC6A 2HHVA 1VQLS 3BYRA 3G87A 4BWJA 2ZITA 1Y3JA 2E1CA 4Z2XA 1L3UA 4ANCA 3VAKA 5KFVA 2ZH4A 3Q23A 3GJRB 2HVZA 4H4KC 2W01A 1XIQA 3UVJB 2RQKA 5F0WA 3Q8SB 4ED7A 3B54A 4EBCA 3KHRA 3E3XA 1J27A 4LMZA 3QO9B 3CMES 3DHWC 1VDHA 2D69A 2FZCB 4EZ9A 4Q44A 1PJ7A 2GX8A 2KI2A 3L7OA 1OSDA 4P2FA 2L41A 2APOA 4EEYA 1ZM2A 4AE5A 3MR6A 2VV5A 2I0XA 4RO0A 4GKKF 1BXNA 2E7VA 3C46A 1U8SA 2DR6A 2EBGA 2RILA 1I5OB 4FF4A 2XS2A 3MM8A 5D4OA 3RRHA 1PG5B 4HHUA 2IYGA 2YPZA 4ICLB 4DV7J 4NLPA 2YVSA 3OTEA 1VQ4S 4PPZA 4MK7A 5FDLB 3OVSA 3FCHA 3ZZUA 2KTQA 4DN0A 4X4OA 3HSGA 1S1XB 2MLZA 3G6YA 3ZZOA 1VBXA 1H73A 2L9NA 2FVQA 3ENWA 4DSKA 2Z2MA 3CJSA 2RMLA 3I5CA 2LYVA 3OW2R 4B3SF 4PQAA 4RBTA 4GVBA 5JVGQ 2HVHA 2F9DA 2OMLA 3RRGA 3GR0A 5J2NA 3BR8A 3KLHA 2L9DA 3UE2A 1RT4A 2AYGA 2P8IA 3VGTA 4PPDA 4LVOP 2VU5A 2W2NP 1D1UA 4ES1A 4WZQA 3V6JA 2MDAA 4ZLNA 2H5EA 4W4MA 3K7RA 1YIJS 1AROP 3CVKA 3KDNA 5IM0B 4C3MA 4Q45A 1F3VA 2E5GA 4JI4J 4ZPAA 2GVZA 4Y34A 2RQ4A 3WZ0A 3NL0A 3BGLA 4JI2F 2GC8A 1X5TA 3HVAA 2DNKA 1S0NA 1F3FA 1IKXA 4V19J 2C3YA 3JAMY 1JLBB 5ETTA 4LSLA 4KFBA 4LVNP 3AFGA 5KG2A 4PG7A 4MAKA 1AZSA 2G9OA 2HHHF 1KRPA 3W9JA 3KJFB 3C6UB 2DH8A 3TWZA 4YHHF 5KT6A 5DDRC 3DLJA 2DXDA 4N8NA 4QIGA 1KVJA 2IM2A 2GJ2A 4X2BA 1ZYQA 3NY0A 3CCMS 4DX5A 1NKCA 4MYUA 6AT1B 4FS2A 2V8DA 1IM4A 1IQTA 3ET6B 2BE2A 3SI8A 1WEXA 3B78A 3N4WA 4JI6J 4ZS6A 3TI0A 1BE4A 4LBIA 4RR5A 2HLTA 3PW5A 3TEHB 3PYGA 3KMQA 4CH0S 2KHDA 3ZTOA 4CLWA 3VR1A 5HK4A 2IC3B 2MSSA 1SPBP 2U1AA 3RTVA 1MU2B 2K06A 4YB6A 3F73A 3GONA 3VGVA 4WP3A 2EFQA 3TJ9A 1SB6A 2CIMA 4QWBA 5DDOC 4M5DA 1LFWA 1IBMF 2GIRA 3DM2B 2ZH2A 2BM0A 3I0SB 1DJ0A 5A8RA 5HANA 2ZUGA 3PR5B 1OYDA 5E3CA 2POKA 2L9WA 4ZCMA 3OUYA 3F41A 3D2WA 1X4BA 2HYIB 2HRUA 2RDDA 1JNRB 1TK8A 4BWMA 2VOOA 2H9ZA 4KYZA 2KJVA 3KKFA 2JOQA 4JI1J 3NGUA 3OSNA 4JI8J 1M0SA 5AXKA 2VZ9A 4J9UE 2ASLA 3KLIB 1ROFA 3MAAA 3WHIA 4BCAA 2YNFA 1MN7A 3ZTPA 4D3GA 1VBZA 4ED5A 2X3DA 3GV8B 5D0RA 2BMBA 4NCGA 1YJ7A 3GP9A 5D77A 4MFBA 1UWBA 3KLEA 1ICEB 4I2PB 4X4NA 1SVDA 3TEGA 3R6LB 3S6EA 1S5ZA 1RADB 4OYAA 3M8SA 1JMTA 3CWJA 2W8KA 1RT2B 4S0MA 4A8QA 4J9QA 3HZEA 4NYPA 3V6KA 3MEDA 1TAQA 4YY3F 2EW9A 1B0PA 3PFOA 2V69A 5GAEI 2VG7A 4I64A 3V2UC 3UDLA 3DMJB 2V4RA 3LQVA 3TVKA 4OI4A 3WDOA 2AJ2A 1JLFB 2V4JA 2X51A 1BQMA 2YQ3A 1Q8KA 3H59A 3OR2B 2J7WA 1PO6A 3ZO7A 4OJ3A 3CJ0A 5KFWA 1PKUA 3SFUA 2FVRA 1RSCA 2R7QA 3HT0A 4LF6J 2JLEA 3L3CA 3DRRA 4RW7B 1HBMB 1MMLA 1B7FA 4PYDA 1F5CA 2HHPA 3A4TA 3NG8A 4ZVHA 2P6SA 3HSJA 3RBZA 1I94J 3RJMB 1U2CA 4KSEB 3CIMA 4F3MA 3I87A 5A2QY 3HLUA 2R9LA 3MMJA 2NPFA 4CLSA 1Q5VA 2UXDF 1WHYA 1LK7A 1HWUA 4RPFA 3I31A 3L95X 4KBIA 2AF6A 2YWHA 1X8DA 5IC4B 3H2VE 2VG5A 2COLA 1DTQA 4PRFA 1SCJB 2GGPB 3IR6B 5CZXA 1R8AA 5KFYA 5HO4A 3MM5B 3G4SS 1IR1A 4BC9A 4H54A 5BXIA 5I3UB 5C2CA 2R7TA 4O3NA 1JXEA 3B4MA 3TUIC 3QSYB 3MECB 4LIRA 2GZOA 4OYIA 4ECXA 3M32B 3AOCA 3C66A 4AXJA 2CNKB 3PHEA 4IO1A 1YJVA 3DRYA 1D3WA 4NLRA 4TU8A 2DJWA 2XO6A 2JLGA 2DISA 1U6FA 1RBAA 1SKRA 5LMNF 2QA1A 1UAWA 1GX6A 4EO6A 3AJ2A 2MGZB 3MUTP 2CPDA 2IIHA 2J6TA 1S1WA 4ZDNA 3FBCA 4FYDA 2DNNA 3KHGA 1LWFB 5CYMA 3ILLA 4QU6A 4O3PA 2OPQB 2G0JA 1L3SA 2UUAF 4DR3F 1QAJA 3QIPB 4UTGA 1TKZB 1F2HA 3FZBA 4ZVEA 4CO2A 3HFKA 4N47A 1SV5A 2AEJA 4ZVGA 1ZPVA 1WOPA 5DO2A 2QLJB 1HD0A 1Q53A 1KEKA 1Q81T 2DKOB 5I42B 1XK8A 3FBBA 2N4CA 3QYYA 5BR8J 2ZC4A 4QWDA 1X5SA 3T41A 3NWGA 4L6V3 3T3FA 4LF1A 2CJ9A 2BOAA 1FJEB 2RUGA 2JDJA 4JV2A 3CDWA 2PMZD 3EVWA 4CO1A 3PYEA 3HZGA 4C11B 3NXZA 2VASA 2E1PA 4NLVA 1GX5A 2IVYA 1VK3A 2H5JB 3KJVB 2KXFA 5F9NA 4NEZA 2C22A 2F4FA 3THPA 2XI2A 1I1GA 1FE4A 4HKQA 3KG1A 3IAM9 3W60A 2YWFA 1HWKA 1FDDA 1S4FA 2DGQA 3KNAA 1H72C 3QPIA 1RKIA 4KHMA 2AZ3A 3B4DA 3PV8A 2AMCB 1UFWA 2Y8WA 2WB4A 2QLXA 1IKVB 1Q7YT 3HKZD 4DL4A 3CT9A 1Y0HA 2XCAA 5F8IA 3M2VB 4DL6A 3QRPA 1S6UA 2IFXA 5HMYA 1H98A 3NRBA 4P74A 3ZFVA 4KO0B 2RF2B 3VGUA 4RW9B 1NSQA 1KQKA 4LF2A 3DOLA 3FCVA 2MZRA 2ZHBA 2HQGA 5GAGU 2R42A 2HNZB 2VFVA 1JLGB 3R6GB 4YMEA 4I6WA 2Z0GA 1N33F 1RB0A 1SQGA 4OYWA 5L1JA 1UL3A 3CDBA 5KFUA 1YBAA 2WCXA 2HGMA 2FTRA 2V4QA 1WDTA 2DGOA 2RQMA 1IXKA 2ROPA 3W8GA 3J7Z5 3BQ0A 4WE1B 3JTOA 4HH1A 5IWAJ 2ZJPQ 4Y28C 1FRLA 4K0KF 3HVTB 3RW7A 3ENVA 2FZKB 4F50A 1NSPA 2QO3A 3FGVA 2VL1A 1KQGB 2J6UA 4R8UB 1NRKA 3ETMA 2XC9A 4ECVA 2DD8S 3TA1A 2AW0A 2DIUA 3UR0A 2B5JA 4CNZA 3G8QA 3P45B 4IFVB 1M5PC 5EHHA 1NK4A 2X1GA 2OKQA 3Q89A 1H7XA 4ZJOA 5M2UA 1XBWA 1NHVA 3SQGB 1OYEA 4B9UA 5IT9U 1PSDA 3NS5A 2E7WA 2PMHA 4B3MJ 1MROA 1FFSB 3CXCR 4ICLA 2AYMA 5HI7A 4NXNF 1UCNA 1CSJA 5T14A 2QV6A 2A2CA 5FDLA 5HQLA 4B3RF 1FD2A 2GIFA 1S1XA 3MMAA 1NEEA 5KTQA 5DM6Q 1AB8A 4ZN1A 7FD1A 1LW2B 2FQQB 4C6AA 2VPZB 1MSWD 2M3DA 2QZ8A 3D0GE 2RAQA 3D28A 3THVA 3L9ZA 1CG2A 4CH1A 2UXCF 3PJXA 4CO5A 4USUA 4DMZA 1S1TB 5ETSA 1QAYA 2PFDA 4RKUC 3TUZC 2ZWOA 3J80Y 1KD1T 4KHPJ 4Y2AA 1GT8A 1DRZA 2FDNA 4JI0J 2UP1A 5IM0A 4Y3CA 3IWXA 3V5RA 1L3VA 1Y7PA 2HS0A 3ETOA 2EEYA 3D5MA 3OT9A 1U47A 2FLOA 4Q0BA 2CNLB 3IRXB 2A3JA 4JV0A 1S10A 1JLBA 1V3ZA 3WIVA 4W98A 2B4UA 2Z2YB 4DV7F 2DR9A 3KOAA 3T1YJ 4DV1F 2ZZNA 3QAEA 2ZC3A 3QBCA 2QJ3A 2GHPA 5D15A 4LQ3A 3MD3A 1ITPA 4QQBA 3TX8A 2CPHA 4NZ7A 4ZVOB 3ICLA 1R6VA 5LXYA 4XPEA 1YX2A 3OL7A 4DSIA 1LQ9A 1NZ8A 3HJVA 5EGYA 2OSQA 2KKHA 5LOQA 3QGGA 5F8LA 2FJDB 1KQSR 4NA1A 2HZAA 1Q5YA 3ET6A 4CLYA 3OTOJ 4ECZA 1FNOA 3CSKA 4DUZJ 1SL2A 4I56A 1UVNA 3DRXA 5L38A 1QTNB 5DS7A 3P5BP 2CPEA 4X4TA 3ITHA 1BUXA 3H8YA 4NLGA 2KXNB 4OYXA 1RACB 2LCWA 1GXTA 1KN6A 4I6YA 1D8ZA 2YY3A 5D4LA 2E1RA 4RU9A 3D6FB 1JLEB 1RWWB 3DNCA 2I2YA 3TQEA 2I1RA 4J9OA 4QU7A 2ZM6J 3TZZA 4ZHRA 1JWWA 2AJFE 1FRMA 4JI3F 2Z2LA 4H4OB 3OL9A 1LNQA 3UI3A 2PC6A 2ERRA 1W7WA 4M95A 3GB0A 2OMOA 4L75A 2YPYA 2VFTA 5KFHA 4ALZA 1N56A 3KLIA 4ZVQB 4IO9Q 3M2UB 2LDYA 3ZZ0A 5CABA 1NUEA 2B7BB 3PHTA 2HS4A 4KH0B 2BKPA 3GQCA 3BGRB 2KZMA 3LPYA 5KFFA 2LXIA 2ZVSA 2HBQB 4C8YA 2A18A 1T9XA 2B4OA 4HT7A 3KK3B 4JI6F 3CC2S 1GAOA 4IG0B 4X64F 2KG1A 4C9DA 2ZH3A 1YRTA 2W25A 3ZZZA 3P5TL 3QWUA 5KG5A 3MWBA 3QJLA 4OJHA 2YQ1A 1RT2A 2FJVA 5GAGI 3OHAA 3MEEA 4AQYJ 5CYJA 1UJ4A 3DYAB 2ZBQA 3TA2A 1EARA 5D4NA 1WKLA 4DR7F 1UVLA 5C7PA 2UV8G 2MQMA 1NLKL 2Y1IA 3IN5A 3QT5A 2V2ZA 3H42A 2W9CB 2XY6A 1V5VA 2EFNA 1UEVA 2AHOB 1ZZNA 2XG8A 5G0RB 3N6MA 1U1LA 4DPYA 2JC1A 4I68A 4LQ9A 3R7BB 3GMGA 2LEPA 4P73A 5LT5A 1S77D 1U2FA 3LGHA 3CO9A 2HSEB 2CJBA 3T19A 3BSNA 1Z1ZA 5F8JA 5HSPA 4QOTA 5A8KB 2QTWA 1WC1A 3W2VB 1TELA 4NI2B 4DUYJ 3EMTA 3JSMB 3NNHA 2PGCA 2W2MP 3UN5A 3S01A 4TY9A 3GFYA 5E7OB 2RDJA 1RTJB 2Y1LB 2EFVA 3LP2B 1DQAA 3DLLQ 4M94A 4M5IA 1YG0A 5GADU 1TKTB 3A3NB 3V6HA 1QE1B 3K17A 4DSLA 2HGLA 2C3OA 1LXNA 2ZBIA 3NLCA 1JLAB 4PG8A 1S0OA 2V8VA 1TL7B 2GMJA 3AD9C 2GGPA 1XMQF 3J7YU 4P71A 4ED0A 1S97A 1R8HA 2OD4A 4B3OB 5IZHA 1XC9A 3OL6A 5I3UA 2Y0SD 5U47A 1UVJA 4NYOA 2EFPA 2QYGA 2E7XA 1SH2A 2E29A 1HBUB 1G2EA 5EWGA 1GQEA 3CJKA 3R5BA 4LFCF 2AJ0A 3CDEA 8ATCB 3OBIA 6FD1A 4LSNB 3QT6A 2MGZA 5EX3A 1SQFA 3BPSP 4TLQA 1C4CA 3M6VA 1V9OA 4ED3A 3N5BA 2OH2A 2HW3A 3HHNB 2YWEA 2GQQA 1OPZA 1I6JA 5AXNA 2FHKA 3M2RA 3DXSX 4URGA 3PEHA 1K8AT 5HQMA 2QA2A 2M88A 1TKZA 5ETPA 3WX8A 4WZMA 1RT5A 3ZNJ1 3PRVA 3U27A 2BANB 2GAGC 4EBEA 1MWYA 2GW8A 3TAPA 2ZH6A 2E1MC 1VQPS 2DT9A 4TQRA 5EDWA 4M1KA 2YWWA 2I38A 2MQ8A 3AB4B 4I67A 5I42A 1FX2A 1XQIA 3R8YA 5J1EA 3T9ZA 3VF0B 3DOKA 2BJ7A 4U7UD 2LECA 2KO1A 3QNWB 3BH7B 3PX6A 1MG7A 1XMOJ 1UKUA 4TY8A 2FLPA 3BSOA 4C11A 1P1TA 1JJHA 2CQ0A 3PEJA 2QLBB 4U9RA 1QSYA 1UZDA 2F4VJ 4ZVTB 1HLWA 1NK5A 3ILOA 4AL7A 4U67Q 4PR6A 3U1NA 4JUZA 5HMZA 1RT7B 1IJEB 2E1AA 3BKFA 4ZPTR 3DOMB 1N0VC 2BQRA 1IKVA 2JC0A 1K1SA 4KKOA 1RHKB 2VJVA 3IR7B 1FVSA 3M2VA 1VQOS 1T05B 3P96A 5KT5A 3EPGA 4KAIA 2HMIA 3NP5A 3CMQA 4KO0A 2HIYA 2R7VA 1U0SA 2JVOA 5LMUJ 4ZA1A 1RTDA 1HBOB 1ZH5A 2HURA 5IT4A 3BEGB 4G1QB 4RW9A 4X65J 4FF1A 3D68A 2XSJB 3FFIB 4YOEA 1FFWB 2AWZA 3R5DA 3PKMA 4ECTA 2HNZA 4WXWA 3BGFA 4DV4J 1ZOTA 5BR8F 2BVZA 3MCOA 1JLGA 4RNOA 4QPXA 4KT0C 4JV1A 1RTZA 4NZ0A 3L4BC 1HW9A 3K0JA 1B0TA 3HVRA 3TQ1A 1FKOB 5H9FJ 1I51B 2CQ4A 1H6KX 1X5PA 5B0FA 3M30B 1AUSL 4G3IA 4WE1A 1VQ5S 1UJ5A 1HNZF 2WTFA 1NJIT 2HZVA 5CAAA 3HVTA 2UVRA 2CUYA 1RTIB 4HTIA 2V6AA 4OYMA 4USIA 3W5XA 2ALYB 1ULRA 2NXNA 1KSPA 4R8UA 2HNYB 3V6DB 3OFEA 3DLHA 1GTEA 2PA3A 1U45A 3BO4A 2JZ5A 1HI1A 4ENOA 5AXMA 5K8PA 2HQCA 2XMKA 2BR0A 3PIOQ 4MKYA 1VLYA 2ZUAA 1TKXB 4FXVA 5KFIA 4Y2KA 3DGPB 4B9SA 4F4KA 3ONQA 1UW9A 1HNWJ 4AD6A 4A8SA 3SQGA 4TU9A 4OI2A 1XR7A 4TQSA 1TUWA 2PIIA 1TFYA 2CWKA 4DV6F 1GMVA 1TL5A 5C5JA 3G9CA 3AD8C 3D66A 1S9EB 2VBZA 1JLQB 2F40A 1P9QC 4PEOA 3RUBL 3T1AA 2QFJA 3DXBA 1LW2A 1FKPA 3GJSB 2MPUA 4NLYA 4ED6A 2IRYA 2HLUA 2HHUA 3LA0A 4OJ1A 2HWIA 1RA6A 2UUWA 1HWJA 3MCSA 2Y8YA 1FRKA 4ZPCA 4J9VA 2MKJA 1RAJA 4DUTA 3KUHA 3T9NA 2J9CA 2ILYA 1WF1A 2XMWA 3A8KA 2I5JB 2OEKA 4OV6A 5GADI 2YNGB 4J9KA 4IH5A 4HL9A 5KFLA 1TTHB 4DCOB 3FSIA 4M5MA 4G1PA 2FB0A 5DLGA 3VCDA 3DRSA 2ZWPA 3NS7B 1PC4A 3LF0A 1A6LA 2G4BA 2F8EX 1W2BR 1KKHA 3UFCX 3GIKA 3J7YI 2W9BB 3RBEA 2LVWA 2EVZA 2EK1A 4JB8B 3D1HA 2LXUA 4P7TA 2XTJP 3U1MA 1S49A 1C0UB 1FCAA 4H4KA 2HVIA 2LDIA 4ER8A 3EDRB 1HQEB 1KFDA 3ZZYA 3H5SA 3GG0A 2DGSA 1FXRA 4HR2A 4F7VA 4C98A 2CJQA 1RT3B 1YRXA 3D3CJ 2FJXA 4GKKJ 4WIQA 2MZ1A 2ZVIA 2DPIA 4J91A 1S9GB 1OIAA 2A2DA 1REVB 2M8DB 1FRJA 4RLEA 2WK4A 3GFXA 2EXUA 2K8GA 2BYCA 5ETLA 1VR6A 2BV3A 3UCZP 2XGPA 2JEIA 5D0EA 2EPIA 5D0HA 1K73T 3BSAA 1AW0A 4KE5A 1RKJA 2JLFA 3O5TB 3ADAC 2HS3A 4HVZA 3MMBB 1YQHA 3I0RA 3ZC4A 1IQZA 2X7IA 3ZTQA 1FDNA 4CI0B 1CC7A 4EYHB 2HRTA 1GXUA 5KFSA 3EWGA 4NLQA 2DYAA 4DN9A 2V8HA 4KHPF 2VFSA 1VC0A 5HLFB 4FYYB 2YKAA 3RAXA 3C6TB 3G82B 1JLEA 2PI5A 3VAFA 2YH1A 3LUYA 2YNHA 4F0HA 5KT3A 4QW8A 3CEDA 2CG4A 3CJ8A 3DLEA 5JJBA 3HD1A 3PW2A 4PABA 3H25A 3N9UC 3CCQS 3W9IA 2F65A 2P9EA 4N7TA 4NEYA 2DR8A 2L08A 1RLDA 4H4OA 3CD5A 4RW4B 1Q0NA 2G2ZA 3HDSA 4JI2J 2XYPB 2FGOA 2CQIA 2XY5A 2F9JA 2HHSA 7FDRA 3CTRA 2V0NA 3MM8B 2LQJA 3EXYA 3GJTB 4LFAJ 5B0CA 2FHJD 2HHHJ 4KV8B 3BGRA 3J81U 2VPWB 3AA8A 4DU8A 2N7CA 3CJQA 2R3VA 1JXLA 4ZP6A 4MIBA 2R2SA 4K4YA 3ZZPA 4IKAA 2GMLA 2V2KA 3X3UA 2BOPA 4DUZF 3AB2B 1TL1A 1DQ8A 1E6VA 3EXCX 3VTIA 2CZ9A 2WVDA 4NMXA 4FXDA 2HPUA 2UV8A 2BJEA 1MMNA 3LO3A 1PAEX 1VC5A 2C2KB 2AEFA 3IO1A 4DR6F 3L7PA 5J2NB 4LFBF 4ED2A 1GFWB 1U6ZA 3QGPA 3DDNA 2D9OA 3KDOA 3M9NB 1ZM9A 1NKEA 2YBVA 4IFYA 2QGFB 2C2ZB 3MGJA 2E5JA 5K8MA 5KFRA 2GVZB 1IBMJ 3V81A 4LSZB 2F63A 3RBDA 3MTKA 3C3LA 4OX9F 3F56A 2H48B 1IKXB 3NGRA 5LSOA 4OHVA 2JFDA 4FS1A 4EFAC 3U7JA 5L9XA 3UN2A 4DPTA 5A8KA 2PEHA 2DH7A 1O6XA 4ECYA 3W2VA 4U8YA 2ZHAA 4PZVA 4IH6A 2CZVC 2KVIA 1YRUA 1BGXT 4WK3A 3O44A 2DEJA 1BLUA 4NYZA 2P2CB 1NXIA 1IWAA 5KT2A 1F9FA 3U1LA 1YJUA 3QSIA 1L3KA 2HAFA 3MR5A 2HFVA 2BE2B 3BJYA 2NCKL 3NKYA 2QX0A 3PO5A 1QE1A 3IG1B 3W5YA 2G1HA 3W64A 2MXYA 3DDIA 2I9SA 1IWGA 3PDNA 3A1YG 2F8HA 2IRXA 2OFHX 2U2FA 4C0BA 4B3OA 1WKKA 4YY3J 1S48A 3PW0A 2BJ9A 2VBWA 3A12A 1Q8BA 4U95A 2OO4A 2WVCA 3CIZA 3HF5A 3FBFA 2XLJA 1NDLA 3I4HX 4GC6A 4CO0A 2F5GA 2YH0A 3IM8A 1HBUA 2Q6BA 4CIOA 4YFUA 1RCXB 3QJPA 3K57A 4RWWA 4ZP9A 4QCLA 3FUYA 2IMWP 4LSNA 1PYSB 1K47A 5D3GA 5F3TA 1HFEL 4CNYA 3C15A 1X5OA 3O2IA 1VQSA 2HHXA 1X7VA 4DEZA 1X4DA 2HFUA 4DUYF 1M1KT 3VGSA 5KFTA 1CJTA 2GO8A 1GXLA 5CQGA 3RU0A 3MAAB 1JK9B 1SL1A 2YNFB 3KG0A 3K5MA 1RT1A 3CGIA 5IV3A 1M5KC 1KOHA 2HIQA 3CJTA 3A8EA 2V5HG 2C3UA 2D1CA 3K2YA 5L8RC 2Q66A 1WUUA 3H5YA 4ERDA 3R3TA 4HACA 4D3HA 2O66A 1DLOA 2FC9A 4DFMA 4CLTA 4J90A 3FEXB 3JTPA 1HL6A 1SBRA 2KXHA 4XAKA 1NKBA 2QIFA 1PBAA 4KHRA 1S99A 2EFGA 3TAQA 1WI8A 3I55S 2HBZB 1P8GA 2R7SA 1HIYA 3IS9B 2MJNA 4F26A 1XTZA 3M05A 3GYGA 4ECUA 1RT7A 3RR8A 3AOBA 2E44A 3RB3A 2VKZG 4TYBA 2VC1A 3RB4A 2V67A 3FNNA 1R0CB 1WF0A 3DOMA 3BDEA 2Z30B 2B8PA 4DBQA 2BRLA 2R7XA 1HHTP 2YX4A 5ETRA 3K59A 2D3O1 3HFZB 1AFJA 4NL5A 3DRRB 2KHCA 2QA4G 3EZUA 2M2BA 2AEMA 2X1AA 1YI2S 2GCFA 4P2XA 4NX9A 4WP9A 3NAHA 2AYEA 2GFFA 1FX4A 1XNQF 2DITA 3WBZA 3FFIA 2KRRA 4NLTA 2DBBA 3D0IE 3SCJE 1NPPA 1G7CB 2MY7A 1PC5A 3R1LA 2DY9A 3EUNA 4AYBD 3W66A 5E5NA 3ENAA 4GVLA 5IQ6A 4C8MA 4USTA 3UN3A 4CM0A 5L1IA 4F3QA 2XMMA 1XMOF 5GMDA 1RWMB 1HHSA 4OI3A 1NBEB 4XK8C 2H5IB 4HHJA 2ABYA 3N6NA 1FKOA 5HROA 3CC7S 1FA0A 2MMYA 3GIIA 1K44A 1S9FA 2ZD1B 4MTPA 2FHJA 3M30A 1CJKA 1C1BB 4CO3A 1N36J 1NDPA 1EB0A 2VG5B 5AE2A 4UUWA 2MLXA 4LF8J 5KFMA 5KG3A 3SBMA 3U02A 3NCRA 2FGCA 4O23A 4WU2A 1PGZA 4X4UA 3MR2A 2HBYB 2FVCA 2HNYA 3H7HB 4MJKA 2C2OB 1RAIB 2QA4S 2A6MA 3UW1A 1CEZA 3TUPA 4XIUA 2C3MA 1U1PA 4NLDA 4TKTA 1TZ0A 3BQ2A 1TKXA 2XS7A 3DGPA 1NJZA 1KHVA 3D7SB 4C2MA 4KGXB 1S1WB 4ANDA 1U1MA 3KMSA 3BKTA 2PO4A 4WTOB 5CYMB 5HJXA 3OXGA 5ETVA 3EZOA 4DQQA 2AX0A 4DL0C 4RNNA 1NMEB 4ZVSB 4G1IA 3J7A1 4IRCA 3MCMA 2ZE2A 1WC4A 2DO0A 1WEZA 2QL5B 1SV5B 3MTJA 4MT1A 1SL0A 5H9EJ 3SSQA 4C8KA 2IMOA 1XR5A 4DFJA 1X0FA 2IAJA 3LP0A 1OJ4A 2CPZA 2Q3PA 4ANEA 1U09A 2XZTB 5KFZA 3BGUA 1U1QA 1IBCB 1N33J 1QY7A 4DR2J 2CQGA 4DU7A 4BHQA 5KFJA 3CD7A 3MM7A 2HBRB 3SCLE 3MCNA 4B9VA 3WIUA 1VHIA 2QL7B 2LFVA 1RDRA 2GO9A 2OLWA 2A0FB 2B9XA 4DWIA 2B7CB 3JB9k 1OY9A 2QSWA 1UVIA 1RK8A 2Q43A 2HK2A 3CW2C 2ILZA 2QT7A 2YXLA 2DB1A 1JLCA 1B7YB 3JS9A 1HNWF 2B9EA 2CKWA 4DQIA 1C0UA 3W8PA 1KP6A 2J0XA 4CP5A 1HQEA 2B9WA 3E2EA 3Q83A 3AQOA 5E2QA 1RT3A 4FF3A 3CCJS 1H74A 4PXCA 1S6OA 1URNA 2GQ2A 2CG8A 2VKRA 4YB7A 3KLFB 1S9GA 2BW7A 1REVA 3R5AA 3K5PA 3KUEA 2BE9B 3PIPQ 2IJRA 3QRQA 2LU1A 3H20A 1J5EJ 2MZSA 1VRUB 2AJ1A 4P72A 4DV3J 3BZQA 2VJUA 3FSYA 1U1NA 3CD6S 1RHUB 3MMBA 4A4JA 1R7IA 3KK1B 3RB6A 3FQKA 2EG2A 4Y2MA 1F60B 1SUQB 2UXCJ 1IBKJ 1A0OB 3PXGa 3EYZA 5HLFA 1H3DA 2Q79A 3GJQB 2XLIA 3KTQA 2JEGA 3EGWB 3C6TA 3G82A 1VQMS 3NGTA 5K8OA 1FWPA 1IJFB 2XCPA 1EHWA 1SKSA 1D9AA 4USKA 2RDIA 2W4CA 3AJ1A 1NJXA 2B5JB 3HCXA 1LKZA 2B4VA 5H9EK 5HVGA 2W2OP 1OO0B 2CQHA 4ES2A 3PX0A 4RW4A 2XYHB 4USMA 1V6HA 4WU3A 4NCAA 1C0TB 4KTQA 3E01A 4DX8H 5AE3A 1MROB 1DQ9A 3OJUA 2C2NA 3QIDA 2RS2A 4DV1J 3B6BA 2WZ1A 2KVQE 5DDQC 2NXUA 1N5SA 2B9YA 4KV8A 1RQ0A 4CZCA 5DJBA 2ADCA 3QLHA 3BN7A 3MMAB 3V4MA 3M8YA 5E3AA 1RI7A 5HBMA 1TR0A 2AX1A 5HMXA 1N0UA 1VMBA 2AU0A 4P9SA 2R7WA 1XWLA 3JSRA 3D6HB 1FE0A 1TU0B 4OZNA 4CLZA 4MKAA 2VDHA 4DHVA 4UOCA 3HHDA 2NYHA 1K9MT 1QVFR 1NK0A 5B0EA 2M4MA 2OUGA 2JWNA 2MZQA 2F7VA 2UUTA 5FLXY 2Z2ZA 4EO8A 3ZTRA 5CYQB 1QTMA 1D0EA 2R7OA 1JIHA 1M5SA 2ZDOA 2CDQA 3MR7A 1ZM4A 2QMWA 4HH0A 4Q0BB 2CRLA 2DK2A 2EKYA 2XI3A 2G13A 1S0MA 4JI3J 4FPRA
chains in the Genus database with same CATH topology
4QOTA 1U48A 5A8KB 3FDSA 1HBOA 3R27A 5KG1A 3TO8A 4X4SA 5KG7A 5AXLA 2M9KA 4X4RA 2J0SD 3W2VB 4G1QA 4HDHA 3DRPA 4LFAF 1T03A 1BD6A 3JSMB 1SIZA 2KB2A 2XSJA 3EPIA 2YWKA 2PGCA 3CCSS 3NNHA 4J9MA 4DR5F 3NMRA 2BACA 4DG1B 3S01A 3SSSA 1N88A 3D1OA 3MMCB 3K5OA 4TY9A 1N6QB 3Q2TC 3GFYA 5CCMA 5E7OB 3QWPA 3TANA 2RDJA 4Y6IA 1EP4A 1SIWB 3LAKA 4Q43A 1FDAA 1RTJB 5DM7Q 2BXJA 2EFVA 3G96A 4DOZA 1E6YB 3LP2B 1HQUB 3MAHA 1DQAA 3DLLQ 4M94A 3LWLA 1YG0A 2E5HA 5FD1A 1LWCA 2R8IA 5B08A 2ZKUA 1FEHA 2VQEF 1J5OB 1HBNA 1VQ8S 4AL6A 2DNQA 3MEGB 5GADU 2EFOA 1OS5A 1T95A 2R4FA 1TKTB 2A10A 2EK6A 1CQMA 2YX1A 3B82A 3DC2A 4QWCA 3V6HA 2VONA 1QE1B 2Y1RI 2UVVA 4DSLA 2HGLA 2I8EA 2C3OA 3IGNA 3H4DA 1LXNA 2W24A 2ZBIA 3IG1A 2IA0A 3NLCA 1T7PA 1JLAB 3H2LA 3UCGA 5F8NA 4E0DA 1TK5A 2MKCA 4FXWA 2HNDA 1UA0A 3VWSA 4PG8A 1S0OA 2F4VF 4A47A 5L39A 2O1PA 1HNXF 2V8VA 4F4XA 4R0EA 1DTQB 4HEA9 3G8SA 2GMJA 4HLBA 2DR7A 1L5UA 3ITHB 2HFOA 5CHCB 3POTB 4QR1A 5KFOA 2GGPA 2HZCA 2OFGX 1ZM3A 1XMQF 2DGXA 2XB2D 3HMJG 4R5PB 3J7YU 2J9DA 5DG8A 2R2TA 4ED0A 1VIXA 3T5JA 1S97A 1R8HA 1RTIA 2OD4A 4DF8A 4B3OB 3OXFA 5IZHA 3IWNC 1XC9A 4A48A 2CQCA 3OL6A 5I3UA 2Y0SD 2GHVC 3D0HE 5U47A 4CO4A 2ATLA 2DHAA 3OTBA 3AQPA 1UVJA 3QO9A 4NYOA 4ILMA 2EFPA 2J9DE 4XO0A 3V6DA 4IOCQ 1C4AA 2E7XA 4KJIA 3W2WA 1SH2A 3CCTA 2CQ1A 4ZLPA 5KOXA 2V8GA 3RR7A 1FDBA 1U6BA 2E29A 3PACA 1HBUB 1OWXA 2UZAA 4WFZA 3T5HA 1G2EA 3MD1A 4W90B 3PW4A 4PXEA 5EWGA 1SJFA 5D6GA 1GQEA 2MQQA 1G1XA 1R8BA 3CJKA 2M52A 3R5BA 4LFCF 4N76A 3G6ES 1YVFA 3OFFA 2AJ0A 3CDEA 1Z4UA 2PD1A 3H98A 1SI9A 3OBIA 2ZH5A 1TP7A 2LKZA 6FD1A 5EX0A 4LSNB 3H4BA 1FRHA 2MQLA 3JTNA 4ZHRB 1TVRA 5LSRA 2MGZA 4K59A 1K1QA 5KFPA 5EX3A 1LWEB 5LMUF 2GA7A 2YX7A 1C4CA 3M6VA 4TLQA 1V9OA 5A0YB 2J7UA 2JEJA 4F2RA 4QYZJ 4ED3A 3IC1A 3N5BA 2RKIB 1HI0P 2XGQA 2N3LA 4KIAA 2WB1D 3LOUA 4Q5VA 2OH2A 2MQNA 4U7CA 2BQ3A 1VI7A 2HW3A 3HHNB 1UVKA 4YP3A 2ACYA 2JJ4D 2GQQA 1OPZA 2LQBA 2YWEA 1I6JA 1TAUA 3SSRA 5AXNA 2FHKA 3GYXB 3M2RA 3M6WA 4X65F 3DXSX 2KJWA 1PILA 1KNZA 5L9NA 5T7LB 4URGA 2D3OR 1IUJA 1KTQA 4B9LA 4IDKB 3RW6A 1R0AB 3FMBA 2ASJA 3PEHA 4H4MA 1K8AT 4B9NA 2QA2A 2ROEA 3MOZA 2M88A 5JXSA 1TKZA 1G6BA 1ZZFA 4WZMA 3E01B 4DV4F 1RT5A 4YB1P 5E33A 3U27A 2BANB 1WWHA 4AUKA 1S9EA 3VAJA 4E98A 1JB0C 6FDRA 1MWYA 4EBEA 1JLQA 1O0PA 2GW8A 2OPSA 3TAPA 2ZH6A 3CB4A 3OSPA 5F8GA 1U24A 3E51A 2E1MC 2UUBF 4F3OA 1VQPS 2DT9A 4TQRA 4IOAQ 4Y00A 5EDWA 4GO7X 2YKOA 4NLOA 4RBVA 4M1KA 4XDCA 3K8WA 3VALA 2I38A 4OX6A 3UWTA 5SUHA 2CQPA 2MKSA 3PX4A 1NH8A 4XPCA 1Q79A 4K5SA 5MAOA 2VG6B 1FTRA 3AB4B 4FNHA 3QLHB 4I67A 5I42A 5I3QA 5DDPC 2HHWA 5J1EA 4ED8A 3T9ZA 2VBYA 3N01A 4ZMMA 1WHXA 3VF0B 1RT6B 3H5XA 5HBMB 4IRDA 1KONA 3DOKA 1VQYA 2QYCA 4RZRA 1VQ7S 2CPXA 4CCHA 1MWZA 3J7ZT 1HD1A 3CCVS 4Q8EA 4B9TA 2LECA 2KO1A 5LXRA 1BC6A 3MPVA 4B02A 3NNCA 5J2PB 4DL2A 3PX6A 3MAQA 1APSA 1UKUA 2CYYA 4ELVA 2M0GB 3LAMA 3RRKA 1SJQA 4I2QB 2FLLA 1X0PA 2R8JA 1U25A 5C42A 4TY8A 1U1RA 4USHA 5F8MA 4WKRA 4QW9A 4A8XA 2FLPA 3BSOA 4KR0B 3C8YA 3MEEB 1SQEA 1S76D 4PQUA 2I5JA 2Z4PA 2RB7A 4C11A 1P1TA 3N6LA 1JJHA 4M8LA 2CQ0A 2YNGA 5MLCV 3PEJA 1Q78A 4U9RA 1QSYA 2W4PA 5E3RA 5FJ4A 5LSLA 4WXOA 4Y2IA 1HNVB 1F5BA 1LOUA 1W2IA 3OTDA 2JH3A 5IS2A 3G8TA 1NK5A 3D54A 1Q1KA 1WG1A 1UETA 2B56A 2YWGA 3BDPA 2OIHA 4AL7A 1T94A 2ZH7A 3CCRS 2F8MA 2IHR1 3IS9A 4U67Q 4PR6A 2RD5C 2XNRA 2CPJA 3U1NA 4JUZA 4DQPA 5HMZA 1RT7B 1Y5LB 4CQ1A 1IJEB 2E1AA 1R43A 1CLFA 1SJ1A 3R1HA 3M8QA 2NZ4A 2W9BA 2IBOA 4OMFG 4V19X 4RNMA 1HW8A 2D41A 3RZAA 2CPFA 4ZPTR 1CPZA 2QE5A 1TL3A 4ITSA 1JJ2R 2MZJA 1N0VC 2BQRA 3KG4A 1VS3A 2HWHA 3MFIA 4DL3A 2YKPA 4ID5A 4IR1A 1IKVA 1H2TZ 2WRMA 4OZ0A 3UNGC 4FBUA 2JC0A 5AJ3F 1AUDA 2LA4A 4N8OA 1K1SA 4ZKAA 2BW2A 4ILRA 4KKOA 2WBRA 4EBDA 3IRWP 1CQNA 3KYLA 4I4BA 1VIOA 3IR7B 1FVSA 3HHLD 4EZ6A 3UPFA 3M2VA 1VQOS 1T05B 2MKHA 3HI9A 3P96A 5KT5A 1UJ6A 3PW7A 2GMHA 2MHNA 3EPGA 3W7BA 1RYRA 4I1TA 4KAIA 2HMIA 3G71S 3K5LA 4PXDA 1YJNS 3NP5A 2VODA 2RT3A 1RWUA 1U4BA 2OPRA 3EX7B 5BYRA 4DQRA 4KO0A 4DS5A 3GFZA 2V9WA 2DNYA 3VZHA 2JL9A 5J2MA 2R7VA 5E3PA 4OQJA 2JVOA 4ZA1A 3HHEA 1O5JA 1RTDA 1QSSA 4C8NA 1EETA 3C6UA 4DL7A 5E0OA 1HBOB 1ZH5A 2LQ9A 5IT4A 4URQU 3BEGB 5KG4A 4OZLA 5CD4H 1TFWA 4G1QB 1VHFA 4RW9A 1T03B 5M2RA 4K4TA 5KAKA 1N4LA 1ZPWX 3IA0A 3DOLB 1WHVA 2J9EA 4FF1A 2XSJB 3FFIB 4DLEA 4OHXA 3JSBA 5KT7A 4YOEA 3ISZA 2B4PA 5K5MA 4WFXA 1C1CB 1LFPA 2YNIA 4X84A 2AWZA 3N0VA 1EP4B 3R5DA 4F4ZA 3E8OA 2R7RA 4UY8T 4ECTA 3PKMA 2HNZA 3GIJA 4WXWA 1O8BA 3BGFA 2E5LF 2M8HA 1ZOTA 3HVWA 1XR6A 5BR8F 4YR2A 2BVZA 2N4DA 5GAEU 1JLGA 3GWCA 2VC0A 1U2RA 3N5FA 4QPXA 4RNOA 5C24B 4KT0C 2AGOA 4JV1A 3I6PA 1KC8T 1KR4A 4PXBA 5B0DA 4NZ0A 1JKHA 1HW9A 4FNIA 3LWMA 4EWTA 3VQTA 3RAMA 3K0JA 1X4FA 1B0TA 2JX2A 3HVRA 1VC6A 3LANA 2C2RA 4IYQA 4J9NA 3TQ1A 2FUG9 1VQLS 2HHVA 4KB7A 2ZZMA 1FKOB 3MPYA 5H9FJ 2KYZA 2IC3A 2CQ4A 4BWJA 4WKYA 1H6KX 2ZITA 1X5PA 4JI5F 1Y3JA 1IKYB 2E1CA 5B0FA 4Z2XA 1L3UA 1MU2A 5K14B 3VAKA 3M30B 5KFVA 2J8AA 2ZH4A 3Q23A 2ZD1A 4G3IA 2HVZA 4WE1A 4H4KC 1VQ5S 1C1BA 1UJ5A 1HNZF 2V9KA 4O3SA 3O3LA 2WTFA 1NJIT 1C2PA 5C25B 2UVWA 5GMKa 4ZP7A 1U49A 1VFJA 2MKKA 5DGBA 2RQKA 2AP6A 5F0WA 1SJ3P 1SJRA 3Q8SB 4ED7A 3HVTA 4ID8A 2UVRA 4EBCA 4HTIA 1RTIB 3KHRA 1HPZA 4JI4F 1NAQA 2RRNA 1HR0F 3E3XA 3DM2A 3I0SA 4RX6A 4USIA 4NA3A 1U7LA 4LMZA 1FRIA 3CUNA 5A8WB 2D3UA 1ULRA 1GNKA 3QO9B 3CMES 3DHWC 2FJBB 4R8UA 1KSPA 2HNYB 3V6DB 3OFEA 1UVMA 3DLHA 1GTEA 2PA3A 1U45A 3BO4A 1KOOA 4EZ9A 4Q44A 2JZ5A 3IWLA 1HI1A 2XULA 4B08A 2GX8A 2KI2A 3L7OA 5AXMA 5K8PA 3DN9A 3CJKB 2HAIA 1OSDA 5K8NA 3PY8A 2L41A 3TP2A 2XMKA 2APOA 3RYLA 1VOMA 4EEYA 2BR0A 2DHGA 1ZM2A 3OTCA 2C42A 4DFKA 4B9MA 3PIOQ 4AE5A 3QZ8A 1VLYA 4MKYA 1TKXB 4FXVA 3VAIA 3MR6A 3AH6A 5KFIA 4Y2KA 4B9SA 2CPYA 2BRKA 2IJNA 2VV5A 4F4KA 2I0XA 1W25A 3ONQA 4UW2A 3MF5A 2MSTA 4GKKF 4ECRA 2KT2A 2MQOA 3C46A 1Y9OA 2KN4A 4C0OC 4C97A 3BSCA 1U8SA 4FBTA 4A8SA 2EBGA 1NNDA 4X4VA 3SQGA 2VBXA 2RILA 3H2UB 4FF4A 5B09A 2XS2A 2KFNA 3MM8A 4UUXA 5D4OA 3RRHA 3M2RB 4TU9A 2IYGA 1HWIA 4OI2A 4ICLB 2ASYA 1XR7A 4RNHA 3TA0A 4TQSA 1R31A 2PIIA 4NLPA 2YVSA 3OTEA 1TFYA 2CFXA 4DV6F 2RJZA 1VQ4S 3JYTB 1K0TA 4PPZA 1TL5A 5T41A 4MK7A 5FDLB 5C5JA 1RT5B 1R8PA 3G9CA 4OI0A 1YJTA 3OVSA 1VBYA 2BZ2A 4PWUA 5IT0A 3KHHA 3FCHA 3ZZUA 1S9EB 4RW8B 1HYSB 4DN0A 2KTQA 4NLWA 2VBZA 4X4OA 1JLQB 3UDCA 1S1XB 2OPSB 2F40A 4Y0FA 3G6YA 4AXIA 1P9QC 3ZZOA 3T1AA 2QFJA 2KZZA 1VBXA 3DXBA 4DQSA 1KTVA 4I2PA 2DR5A 1BQNA 2L9NA 1GH8A 2FVQA 2KM8C 3ENWA 1LW2A 4JBCA 2FJEB 1FKPA 4FZVA 4J9PA 2A1BA 2MPUA 3IFEA 4NLYA 2KT5A 4Z37A 4ED6A 2IRYA 4DSKA 2Z2MA 5J1EB 2HLUA 3CD0A 2HHUA 2CQDA 5CA5A 2RMLA 4EUVA 4R25A 1Y3KA 3DOKB 2LYVA 3I5CA 4NA2A 3OW2R 4PQAA 4RBTA 3HPOA 5F9LA 4OJ1A 2HWIA 5JVGQ 4B3SF 5IQQA 4F02A 2HVHA 1N36F 1RA6A 2F9DA 2UUWA 1HWJA 5D4PA 2OMLA 4NMLA 2J6SA 3I5BA 4LF8F 3MCSA 2RS8A 4OX8A 1FRKA 2N7YA 3RRGA 3BR9A 3GR0A 4ZPCA 5J2NA 3HHKA 4TY8B 3HJFA 3BR8A 3KLHA 4NRTA 2L9DA 2MKJA 1RAJA 3UE2A 3T9NA 1RT4A 2FVSA 2J9CA 2ILYA 1JX4A 1WF1A 2XMWA 2AYGA 2I5JB 4PPDA 3OHBA 5GADI 4LVOP 2YNGB 4J9KA 4IH5A 3DMJA 4HL9A 3CJ5A 5KFLA 1D1UA 2YKQA 4ES1A 1YJWS 4WZQA 3FSIA 3V6JA 2MDAA 2H5EA 2BA9A 2RSQA 2WSFC 1B64A 2YKNB 4G1PA 4P6QA 4Y2CA 2P9GA 3ISND 2ROGA 2FB0A 3QMQA 3EGZA 5E3QA 2MHEA 3K7RA 4ZPDA 3VCDA 5DLGA 3DRSA 4C4WA 1JLFA 5GVQA 2BABA 1YIJS 1AROP 3CVKA 3DLKA 5IM0B 4C3MA 4Q45A 2ZFHA 3K58A 1VRTB 1PC4A 3LF0A 2E5GA 4KQZA 4TU7A 1A6LA 1Z2ZA 2F8EX 2XWXA 1W2BR 2G4BA 4RU2A 4ZPAA 1TK0A 3UFCX 4Y34A 2RQ4A 4DSEA 3GIKA 3OR2A 2R2RA 3WZ0A 3J7YI 2W9BB 1IN0A 1WTFA 3BGLA 4JI2F 3I5AA 4ZK7M 3RBEA 3NL0A 4JI1F 2B43A 2LVWA 2IRUA 2GC8A 2EVZA 2FLNA 2EK1A 1TL3B 1X5TA 3D1HA 3HVAA 4JI8F 1S6QB 5CH7B 3HHLC 2LXUA 4RUAA 2DNKA 4P7TA 2WSCC 1S0NA 1GTHA 4ID5B 2X1FA 1IKXA