1B13A

Clostridium pasteurianum rubredoxin g10a mutant
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
54
structure length
54
Chain Sequence
b'MKKYTCTVCAYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RUBREDOXIN)
publication title Rubredoxin from Clostridium pasteurianum. Structures of G10A, G43A and G10VG43A mutant proteins. Mutation of conserved glycine 10 to valine causes the 9-10 peptide link to invert.
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 8
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1b13A00
1DX8A 1JYBA 1DVBA 4AR4A 5RXNA 1IROA 3KYWA 2VL6A 1LKMA 4AR3A 1LTLA 1QCVA 1SMUA 1R0FA 1T9QA 1YK4A 3KYXA 4YWLA 5AI2A 1ZRPA 1B13A 1IRNA 1IU5A 2RDVA 1YUXA 1YK5A 1R0GA 2DSXA 1SMMA 2KKDA 1RDGA 3KYVA 1YV1A 1VCXA 1R0JA 3PZAA 4ME3A 1B71A 3SS2A 2GMGA 1E8JA 1BRFA 1BE7A 6RXNA 3RYGA 1S24A 4TPUA 5AI3A 2V3BB 3RZTA 3RZ6A 1FHHA 1LKOA 1YUZA 4POGA 1B2JA 4POFA 5IY0A 2KN9A 1R0IA 1C09A 2M4YA 2PVEA 2K2DA 3KYYA 1T9PA 1CAAA 1BQ9A 7RXNA 1T9OA 1RDVA 3QVDA 1RWDA 8RXNA 1RB9A 1S2ZA 1CADA 3A44A 3MPSA 1BFYA 2MS3A 2PVXA 2QL0A 1QYBA 1H7VA 1B2OA 3PWFA 4AR6A 1R0HA 4RXNA 4YWMA 4K9FA 1IU6A 1NNQA 2PYAA 2HR5A 1BQ8A 1RYTA 3KYUA 1LKPA 4AR5A 1S30A 1SMWA 1FHMA 2LCQA
chains in the Genus database with same CATH superfamily
3I4ML 3RZOL 1R9TL 4AI3A 1JYBA 5M3FL 4AR4A 2JA7L 3KYWA 4A3IL 3PO2L 4AI0A 3LWRB 3PKJA 2CKCA 1QCVA 3LWPB 3H97A 3S17L 3KYXA 5AI2A 5GADc 4B8CD 1R0GA 4ZN1B 1SMMA 2KKDA 2E2JL 4A3LL 2XJPA 4AI2A 4LHNA 3LPEB 2APOB 3LWVB 4ME3A 4A3ML 3GTOL 3S16L 2C6BA 1BE7A 6RXNA 5IP9L 4XXBB 3M4OL 2CR8A 4GS7D 3S2DL 3RZTA 2O5JD 5C4XL 4POGA 2C6AA 4X6AL 4POFA 5IY0A 3GTGL 3HOVL 2XJSA 3ZG6A 2HVYC 2Y0SP 3RZDL 4C3IL 3S14L 1T9OA 3IU3I 4BY7L 1RB9A 1F4LA 2VUML 2JI3A 4XGHA 4E6YA 3CQZL 3LNLA 2ERJA 4AI1A 5GAHc 1P7PA 1I3QL 1QYBA 1H7VA 3PWFA 1PFVA 4RXNA 4K9FA 3S15L 2PYAA 1RYTA 4JADA 3HOYL 2R7ZL 2XJVA 4AR5A 5EIOC 2A6ED 5IYCL 1FHMA 3PL5A 2LCQA 1DVBA 1IROA 1TWFL 3JR7A 3H3VM 1YK4A 4YWLA 3HKZP 1IW7D 3K7AL 1B13A 3PO3L 1TWHL 2CKAA 1PFYA 1YK5A 2A68D 2ERSA 2NVYL 1RDGA 1YV1A 3S2HL 3H9BA 3VPBE 1VCXA 4G6BA 2E2IL 3PZAA 5H1Sc 4A93L 4Y7NL 1VZGA 4BY1L 3NFPI 2XJTA 3RYGA 1Y1VL 3S1RL 4C3HL 4UY81 4A3GL 1LKOA 1YUZA 5GAEc 5DM61 3GTPL 2WB1P 2XJUA 5MFZA 5FJ8L 3S1QL 1C09A 5JVH1 1ODHA 2M4VA 1SFOL 2R93L 3K35A 1RDVA 2V0FA 3MSUA 3HJYB 2AYJA 3A44A 3FDJA 5K2ME 2AUSB 1NXGA 4AHWA 3S1NL 1NNQA 2V0EA 2E2HL 2ZIXA 3HOWL 4U671 3J7Z1 2BE5D 1TWAL 3GTML 2PPTA 3PKIA 1S30A 1SMWA 5IYDL 3H9CA 4ZN3B 1DX8A 5RXNA 2VL6A 2B5ID 1LKMA 4AHZA 1WCML 5M3ML 4AR3A 1LTLA 3HOUL 5MF6A 1R0FA 5EINC 5IYBL 1ZRPA 3H99A 1IU5A 4A3JL 4JAEA 2R92L 1I6HL 2JA8L 2DSXA 5MGNA 2PSMC 4BXXL 2M6PA 4WFN1 4A3DL 4BBRL 4A3KL 1B71A 3SS2A 2GMGA 1BRFA 4TVMA 3LWQB 1Z92B 1S24A 3FKIL 4TPUA 5MLC3 4A3EL 4QIWP 1QQTA 1B2JA 2PMZP 1RYQA 2B63L 5IP7L 1R0IA 2WAQP 2L0ZA 2PVEA 4C2M1 2NVXL 3MQKB 2K2DA 1T9PA 3GTKL 7RXNA 3H0GL 1RWDA 3J7Y1 1S2ZA 1BFYA 4AHYA 5DM71 2QL0A 4JAFA 3WWNB 3P2AA 1B2OA 2Z3RB 5MFPA 2NVTL 4AR6A 1R0HA 4LHLA 4YWMA 4C3JL 1IU6A 1BQ8A 2YU9L 4AHXA 1LKPA 1OWCA 2EY4E 1PZXA 2Z3QB 1PFUA 4A3FL 2A69D 2JI2A 1K83L 1TWGL 3GTJL 3I4NL 1SMUA 1T9QA 2XJRA 3HJWB 5C44L 1IRNA 3B0AB 1Y1WL 3M3YL 3P8BA 1YUXA 2RDVA 1VZHA 2JI1A 3KYVA 2M6OA 2AQCA 5M5WL 4JAGA 3QQCE 3PIO1 1R0JA 1WJVA 4V196 5FLML 2H12A 3B08B 1E8JA 3HOZL 4BBSL 1VZIA 3LWOB 5AI3A 2JA6L 2V3BB 4A3CL 3RZ6A 1FHHA 5C3EL 2KN9A 1TWCL 5M5YL 2J9UB 1I50L 2M4YA 3KYYA 4Y52L 2NYDA 1PFWA 1CAAA 1BQ9A 2JA5L 3GTQL 3QVDA 2XJQA 8RXNA 1CADA 3PIP1 3MPSA 1OWBA 2MS3A 5JVG1 2PVXA 5AN9H 4AYBP 2RFKB 3GTLL 3WWLA 2HR5A 5C4JL 5GAGc 3S1ML 1NXEA 3KYUA 3HOXL 2A6HD 5M5XL 4A3BL 2NVQL 3HAXC
chains in the Genus database with same CATH topology
4ZN3B 4AI3A 1DX8A 1JYBA 1DVBA 4AR4A 5RXNA 1IROA 3KYWA 4AI0A 3PKJA 2VL6A 2B5ID 1LKMA 4AHZA 2CKCA 4AR3A 1LTLA 1QCVA 1SMUA 5MF6A 1R0FA 5EINC 1T9QA 1YK4A 3KYXA 2XJRA 4YWLA 5AI2A 1IW7D 1ZRPA 1B13A 1IRNA 1IU5A 3B0AB 5GADc 3P8BA 4JAEA 2CKAA 1YUXA 2RDVA 1YK5A 1R0GA 2A68D 4B8CD 1VZHA 2ERSA 2JI1A 2DSXA 4ZN1B 1SMMA 2KKDA 1RDGA 3KYVA 2M6OA 5MGNA 2PSMC 2XJPA 4JAGA 3QQCE 1YV1A 4AI2A 2M6PA 4WFN1 4LHNA 3LPEB 3VPBE 1VCXA 3PIO1 1R0JA 4G6BA 3PZAA 5H1Sc 1WJVA 4ME3A 4V196 1B71A 3SS2A 2C6BA 1VZGA 2H12A 2GMGA 3B08B 3NFPI 1BRFA 1BE7A 4TVMA 6RXNA 1E8JA 1Z92B 4XXBB 1VZIA 2XJTA 2CR8A 3RYGA 1S24A 4TPUA 4GS7D 5AI3A 2V3BB 5MLC3 3RZTA 4UY81 3RZ6A 1FHHA 1LKOA 1YUZA 2O5JD 4POGA 5GAEc 1B2JA 2C6AA 5DM61 4POFA 2XJUA 5MFZA 5IY0A 2KN9A 1RYQA 2XJSA 1R0IA 1C09A 2J9UB 2L0ZA 5JVH1 2M4YA 2PVEA 1ODHA 3ZG6A 2K2DA 2M4VA 3KYYA 2NYDA 1T9PA 1CAAA 1BQ9A 7RXNA 1T9OA 3IU3I 3K35A 1RDVA 3QVDA 1RWDA 2XJQA 8RXNA 3J7Y1 2V0FA 1RB9A 3MSUA 1S2ZA 2AYJA 1CADA 2JI3A 3A44A 3MPSA 4XGHA 4E6YA 4AHYA 1OWBA 2MS3A 3PIP1 1BFYA 5K2ME 3LNLA 5DM71 2ERJA 2PVXA 2QL0A 4AI1A 4JAFA 5GAHc 5JVG1 1NXGA 5AN9H 3WWNB 1QYBA 3P2AA 1H7VA 1B2OA 3PWFA 2Z3RB 5MFPA 4AR6A 4AHWA 1R0HA 4LHLA 4RXNA 4YWMA 4K9FA 1IU6A 1NNQA 2PYAA 2V0EA 3WWLA 2HR5A 1BQ8A 1RYTA 2ZIXA 4AHXA 4JADA 5GAGc 4U671 1NXEA 2XJVA 3KYUA 2A6HD 1LKPA 3J7Z1 1OWCA 2BE5D 2PPTA 4AR5A 3PKIA 1S30A 5EIOC 1SMWA 2A6ED 2Z3QB 1FHMA 2A69D 2JI2A 2LCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DX8 A;  1JYB A;  1DVB A;  4AR4 A;  5RXN A;  1IRO A;  3KYW A;  2VL6 A;  1LKM A;  4AR3 A;  1LTL A;  1QCV A;  1SMU A;  1R0F A;  1T9Q A;  1YK4 A;  3KYX A;  4YWL A;  5AI2 A;  1ZRP A;  1B13 A;  1IRN A;  1IU5 A;  2RDV A;  1YUX A;  1YK5 A;  1R0G A;  2DSX A;  1SMM A;  2KKD A;  1RDG A;  3KYV A;  1YV1 A;  1VCX A;  1R0J A;  3PZA A;  4ME3 A;  1B71 A;  3SS2 A;  2GMG A;  1E8J A;  1BRF A;  1BE7 A;  6RXN A;  3RYG A;  1S24 A;  4TPU A;  5AI3 A;  2V3B B;  3RZT A;  3RZ6 A;  1FHH A;  1LKO A;  1YUZ A;  4POG A;  1B2J A;  4POF A;  5IY0 A;  2KN9 A;  1R0I A;  1C09 A;  2M4Y A;  2PVE A;  2K2D A;  3KYY A;  1T9P A;  1CAA A;  1BQ9 A;  7RXN A;  1T9O A;  1RDV A;  3QVD A;  1RWD A;  8RXN A;  1RB9 A;  1S2Z A;  1CAD A;  3A44 A;  3MPS A;  1BFY A;  2MS3 A;  2PVX A;  2QL0 A;  1QYB A;  1H7V A;  1B2O A;  3PWF A;  4AR6 A;  1R0H A;  4RXN A;  4YWM A;  4K9F A;  1IU6 A;  1NNQ A;  2PYA A;  2HR5 A;  1BQ8 A;  1RYT A;  3KYU A;  1LKP A;  4AR5 A;  1S30 A;  1SMW A;  1FHM A;  2LCQ A; 
#chains in the Genus database with same CATH topology
 3I4M L;  3RZO L;  1R9T L;  4AI3 A;  1JYB A;  5M3F L;  4AR4 A;  2JA7 L;  3KYW A;  4A3I L;  3PO2 L;  4AI0 A;  3LWR B;  3PKJ A;  2CKC A;  1QCV A;  3LWP B;  3H97 A;  3S17 L;  3KYX A;  5AI2 A;  5GAD c;  4B8C D;  1R0G A;  4ZN1 B;  1SMM A;  2KKD A;  2E2J L;  4A3L L;  2XJP A;  4AI2 A;  4LHN A;  3LPE B;  2APO B;  3LWV B;  4ME3 A;  4A3M L;  3GTO L;  3S16 L;  2C6B A;  1BE7 A;  6RXN A;  5IP9 L;  4XXB B;  3M4O L;  2CR8 A;  4GS7 D;  3S2D L;  3RZT A;  2O5J D;  5C4X L;  4POG A;  2C6A A;  4X6A L;  4POF A;  5IY0 A;  3GTG L;  3HOV L;  2XJS A;  3ZG6 A;  2HVY C;  2Y0S P;  3RZD L;  4C3I L;  3S14 L;  1T9O A;  3IU3 I;  4BY7 L;  1RB9 A;  1F4L A;  2VUM L;  2JI3 A;  4XGH A;  4E6Y A;  3CQZ L;  3LNL A;  2ERJ A;  4AI1 A;  5GAH c;  1P7P A;  1I3Q L;  1QYB A;  1H7V A;  3PWF A;  1PFV A;  4RXN A;  4K9F A;  3S15 L;  2PYA A;  1RYT A;  4JAD A;  3HOY L;  2R7Z L;  2XJV A;  4AR5 A;  5EIO C;  2A6E D;  5IYC L;  1FHM A;  3PL5 A;  2LCQ A;  1DVB A;  1IRO A;  1TWF L;  3JR7 A;  3H3V M;  1YK4 A;  4YWL A;  3HKZ P;  1IW7 D;  3K7A L;  1B13 A;  3PO3 L;  1TWH L;  2CKA A;  1PFY A;  1YK5 A;  2A68 D;  2ERS A;  2NVY L;  1RDG A;  1YV1 A;  3S2H L;  3H9B A;  3VPB E;  1VCX A;  4G6B A;  2E2I L;  3PZA A;  5H1S c;  4A93 L;  4Y7N L;  1VZG A;  4BY1 L;  3NFP I;  2XJT A;  3RYG A;  1Y1V L;  3S1R L;  4C3H L;  4UY8 1;  4A3G L;  1LKO A;  1YUZ A;  5GAE c;  5DM6 1;  3GTP L;  2WB1 P;  2XJU A;  5MFZ A;  5FJ8 L;  3S1Q L;  1C09 A;  5JVH 1;  1ODH A;  2M4V A;  1SFO L;  2R93 L;  3K35 A;  1RDV A;  2V0F A;  3MSU A;  3HJY B;  2AYJ A;  3A44 A;  3FDJ A;  5K2M E;  2AUS B;  1NXG A;  4AHW A;  3S1N L;  1NNQ A;  2V0E A;  2E2H L;  2ZIX A;  3HOW L;  4U67 1;  3J7Z 1;  2BE5 D;  1TWA L;  3GTM L;  2PPT A;  3PKI A;  1S30 A;  1SMW A;  5IYD L;  3H9C A;  4ZN3 B;  1DX8 A;  5RXN A;  2VL6 A;  2B5I D;  1LKM A;  4AHZ A;  1WCM L;  5M3M L;  4AR3 A;  1LTL A;  3HOU L;  5MF6 A;  1R0F A;  5EIN C;  5IYB L;  1ZRP A;  3H99 A;  1IU5 A;  4A3J L;  4JAE A;  2R92 L;  1I6H L;  2JA8 L;  2DSX A;  5MGN A;  2PSM C;  4BXX L;  2M6P A;  4WFN 1;  4A3D L;  4BBR L;  4A3K L;  1B71 A;  3SS2 A;  2GMG A;  1BRF A;  4TVM A;  3LWQ B;  1Z92 B;  1S24 A;  3FKI L;  4TPU A;  5MLC 3;  4A3E L;  4QIW P;  1QQT A;  1B2J A;  2PMZ P;  1RYQ A;  2B63 L;  5IP7 L;  1R0I A;  2WAQ P;  2L0Z A;  2PVE A;  4C2M 1;  2NVX L;  3MQK B;  2K2D A;  1T9P A;  3GTK L;  7RXN A;  3H0G L;  1RWD A;  3J7Y 1;  1S2Z A;  1BFY A;  4AHY A;  5DM7 1;  2QL0 A;  4JAF A;  3WWN B;  3P2A A;  1B2O A;  2Z3R B;  5MFP A;  2NVT L;  4AR6 A;  1R0H A;  4LHL A;  4YWM A;  4C3J L;  1IU6 A;  1BQ8 A;  2YU9 L;  4AHX A;  1LKP A;  1OWC A;  2EY4 E;  1PZX A;  2Z3Q B;  1PFU A;  4A3F L;  2A69 D;  2JI2 A;  1K83 L;  1TWG L;  3GTJ L;  3I4N L;  1SMU A;  1T9Q A;  2XJR A;  3HJW B;  5C44 L;  1IRN A;  3B0A B;  1Y1W L;  3M3Y L;  3P8B A;  1YUX A;  2RDV A;  1VZH A;  2JI1 A;  3KYV A;  2M6O A;  2AQC A;  5M5W L;  4JAG A;  3QQC E;  3PIO 1;  1R0J A;  1WJV A;  4V19 6;  5FLM L;  2H12 A;  3B08 B;  1E8J A;  3HOZ L;  4BBS L;  1VZI A;  3LWO B;  5AI3 A;  2JA6 L;  2V3B B;  4A3C L;  3RZ6 A;  1FHH A;  5C3E L;  2KN9 A;  1TWC L;  5M5Y L;  2J9U B;  1I50 L;  2M4Y A;  3KYY A;  4Y52 L;  2NYD A;  1PFW A;  1CAA A;  1BQ9 A;  2JA5 L;  3GTQ L;  3QVD A;  2XJQ A;  8RXN A;  1CAD A;  3PIP 1;  3MPS A;  1OWB A;  2MS3 A;  5JVG 1;  2PVX A;  5AN9 H;  4AYB P;  2RFK B;  3GTL L;  3WWL A;  2HR5 A;  5C4J L;  5GAG c;  3S1M L;  1NXE A;  3KYU A;  3HOX L;  2A6H D;  5M5X L;  4A3B L;  2NVQ L;  3HAX C; 
#chains in the Genus database with same CATH homology
 4ZN3 B;  4AI3 A;  1DX8 A;  1JYB A;  1DVB A;  4AR4 A;  5RXN A;  1IRO A;  3KYW A;  4AI0 A;  3PKJ A;  2VL6 A;  2B5I D;  1LKM A;  4AHZ A;  2CKC A;  4AR3 A;  1LTL A;  1QCV A;  1SMU A;  5MF6 A;  1R0F A;  5EIN C;  1T9Q A;  1YK4 A;  3KYX A;  2XJR A;  4YWL A;  5AI2 A;  1IW7 D;  1ZRP A;  1B13 A;  1IRN A;  1IU5 A;  3B0A B;  5GAD c;  3P8B A;  4JAE A;  2CKA A;  1YUX A;  2RDV A;  1YK5 A;  1R0G A;  2A68 D;  4B8C D;  1VZH A;  2ERS A;  2JI1 A;  2DSX A;  4ZN1 B;  1SMM A;  2KKD A;  1RDG A;  3KYV A;  2M6O A;  5MGN A;  2PSM C;  2XJP A;  4JAG A;  3QQC E;  1YV1 A;  4AI2 A;  2M6P A;  4WFN 1;  4LHN A;  3LPE B;  3VPB E;  1VCX A;  3PIO 1;  1R0J A;  4G6B A;  3PZA A;  5H1S c;  1WJV A;  4ME3 A;  4V19 6;  1B71 A;  3SS2 A;  2C6B A;  1VZG A;  2H12 A;  2GMG A;  3B08 B;  3NFP I;  1BRF A;  1BE7 A;  4TVM A;  6RXN A;  1E8J A;  1Z92 B;  4XXB B;  1VZI A;  2XJT A;  2CR8 A;  3RYG A;  1S24 A;  4TPU A;  4GS7 D;  5AI3 A;  2V3B B;  5MLC 3;  3RZT A;  4UY8 1;  3RZ6 A;  1FHH A;  1LKO A;  1YUZ A;  2O5J D;  4POG A;  5GAE c;  1B2J A;  2C6A A;  5DM6 1;  4POF A;  2XJU A;  5MFZ A;  5IY0 A;  2KN9 A;  1RYQ A;  2XJS A;  1R0I A;  1C09 A;  2J9U B;  2L0Z A;  5JVH 1;  2M4Y A;  2PVE A;  1ODH A;  3ZG6 A;  2K2D A;  2M4V A;  3KYY A;  2NYD A;  1T9P A;  1CAA A;  1BQ9 A;  7RXN A;  1T9O A;  3IU3 I;  3K35 A;  1RDV A;  3QVD A;  1RWD A;  2XJQ A;  8RXN A;  3J7Y 1;  2V0F A;  1RB9 A;  3MSU A;  1S2Z A;  2AYJ A;  1CAD A;  2JI3 A;  3A44 A;  3MPS A;  4XGH A;  4E6Y A;  4AHY A;  1OWB A;  2MS3 A;  3PIP 1;  1BFY A;  5K2M E;  3LNL A;  5DM7 1;  2ERJ A;  2PVX A;  2QL0 A;  4AI1 A;  4JAF A;  5GAH c;  5JVG 1;  1NXG A;  5AN9 H;  3WWN B;  1QYB A;  3P2A A;  1H7V A;  1B2O A;  3PWF A;  2Z3R B;  5MFP A;  4AR6 A;  4AHW A;  1R0H A;  4LHL A;  4RXN A;  4YWM A;  4K9F A;  1IU6 A;  1NNQ A;  2PYA A;  2V0E A;  3WWL A;  2HR5 A;  1BQ8 A;  1RYT A;  2ZIX A;  4AHX A;  4JAD A;  5GAG c;  4U67 1;  1NXE A;  2XJV A;  3KYU A;  2A6H D;  1LKP A;  3J7Z 1;  1OWC A;  2BE5 D;  2PPT A;  4AR5 A;  3PKI A;  1S30 A;  5EIO C;  1SMW A;  2A6E D;  2Z3Q B;  1FHM A;  2A69 D;  2JI2 A;  2LCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...