1B13A

Clostridium pasteurianum rubredoxin g10a mutant
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
54
structure length
54
Chain Sequence
MKKYTCTVCAYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RUBREDOXIN)
publication title Rubredoxin from Clostridium pasteurianum. Structures of G10A, G43A and G10VG43A mutant proteins. Mutation of conserved glycine 10 to valine causes the 9-10 peptide link to invert.
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 8
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1b13A00
1R0FA 1B71A 2LCQA 1NNQA 2V3BB 5RXNA 4POGA 4AR3A 1JYBA 1B13A 2QL0A 1IROA 1H7VA 2KKDA 4RXNA 1E8JA 1S30A 3RZ6A 2K2DA 2PYAA 1RWDA 1S24A 1IU6A 1RYTA 4YWMA 1R0JA 2HR5A 2DSXA 1B2OA 1LKMA 1BRFA 1T9PA 3A44A 1YV1A 1CADA 2GMGA 5AI2A 1FHMA 1BFYA 2PVEA 1IRNA 3PZAA 4AR4A 2VL6A 3SS2A 4TPUA 1QYBA 1SMWA 1IU5A 1DVBA 1YK5A 1SMUA 1LKOA 6RXNA 2KN9A 3KYWA 3PWFA 1BQ8A 2MS3A 4K9FA 1C09A 3MPSA 3QVDA 1BQ9A 1B2JA 5AI3A 4POFA 1T9OA 1LTLA 2M4YA 1FHHA 1SMMA 8RXNA 1VCXA 4ME3A 4YWLA 1R0GA 3KYXA 1T9QA 5IY0A 2RDVA 1BE7A 1YUZA 1QCVA 4AR5A 1ZRPA 3KYYA 3KYVA 3RZTA 1S2ZA 7RXNA 1YK4A 1LKPA 4AR6A 3KYUA 2PVXA 1CAAA 3RYGA 1DX8A 1RB9A 1YUXA 1R0IA 1R0HA 1RDGA 1RDVA
chains in the Genus database with same CATH superfamily
1R0FA 2XJTA 2LCQA 1NNQA 5RXNA 4XXBB 4LHNA 4POGA 3H9BA 1B13A 3FKIL 2C6BA 1IROA 2R7ZL 5M5YL 1PFWA 5K2ME 4UY81 3H3VM 3PL5A 3RZ6A 2ZIXA 1WJVA 4A3DL 1S24A 2JA7L 4BBRL 4AHZA 3K7AL 1IU6A 3LNLA 4XGHA 2CR8A 4E6YA 5C4XL 3NFPI 4WFN1 3PIP1 5IP7L 5GAEc 2JI3A 4C3JL 3MSUA 2A6HD 3HOWL 2M6PA 1IRNA 2R92L 2VL6A 3GTQL 1SMUA 2NYDA 3K35A 3S14L 1BQ8A 4K9FA 5AN9H 3S1RL 5EINC 5AI3A 1PFVA 1T9OA 5MLC3 1PZXA 1NXEA 4A3KL 5C3EL 1TWCL 3VPBE 2ERJA 2AUSB 2YU9L 4GS7D 4AI1A 1ZRPA 3KYYA 5FLML 4JADA 3LWPB 3ZG6A 4ZN3B 2XJVA 4BBSL 2AQCA 1TWAL 2C6AA 2PVXA 1Y1VL 2H12A 1YUXA 3S1NL 1RDGA 3I4ML 4AI0A 3P2AA 4AR3A 2QL0A 3PKIA 3HOVL 2KKDA 2M6OA 1SFOL 3M3YL 1S30A 2PYAA 2JI1A 1I3QL 1RYTA 4YWMA 3FDJA 5GAGc 2A68D 2E2HL 3H99A 3S16L 4AHYA 4AI2A 3GTKL 1VZHA 4A3ML 2NVQL 2JA8L 1YV1A 5AI2A 2JI2A 4A3EL 3S15L 3HJWB 1PFUA 2PMZP 2Z3RB 1SMWA 1IU5A 2Y0SP 2A6ED 1LKOA 1IW7D 3PWFA 4AYBP 1C09A 3QVDA 1B2JA 3IU3I 3S1QL 2M4YA 2E2JL 5DM61 4U671 3WWLA 4ME3A 4A3JL 4AI3A 5M5XL 1T9QA 3HJYB 3GTGL 1BE7A 1QCVA 3GTPL 3B0AB 5IP9L 2M4VA 1TWHL 4A3GL 2CKCA 3J7Z1 2A69D 2AYJA 2RFKB 1LKPA 4AR6A 3KYUA 2BE5D 1CAAA 1DX8A 3GTJL 1RB9A 1R0IA 3H97A 4AHWA 4BY7L 4X6AL 2V3BB 4C2M1 4C3IL 2HVYC 5M3ML 3S2HL 1H7VA 1OWCA 1P7PA 1E8JA 2K2DA 5H1Sc 1RWDA 5GAHc 3RZOL 3HAXC 2ERSA 4C3HL 2HR5A 2NVTL 4B8CD 3B08B 1PFYA 2DSXA 1B2OA 1LKMA 1BRFA 1T9PA 3A44A 2EY4E 1TWFL 1CADA 2Z3QB 2PVEA 5DM71 3PZAA 3LWOB 1ODHA 1QYBA 1DVBA 4A3CL 1WCML 3S1ML 4G6BA 1K83L 3KYWA 2V0EA 2MS3A 3H0GL 4AHXA 3MPSA 1BQ9A 2NVXL 3H9CA 2XJSA 2XJRA 8RXNA 2WB1P 4YWLA 1R0GA 5JVH1 5IY0A 2RDVA 1YUZA 3LWRB 3RZDL 3I4NL 3LWVB 3HOYL 1I50L 2V0FA 5MFPA 4A3LL 3RZTA 4Y52L 3KYVA 5MF6A 2XJPA 3M4OL 5IYBL 2NVYL 2JA6L 3CQZL 3PO3L 2VUML 3RYGA 5MGNA 3WWNB 1R0HA 1RYQA 3PIO1 1RDVA 1R9TL 4BY1L 1QQTA 1B71A 3GTOL 2B63L 4JAEA 5M5WL 1F4LA 1JYBA 3PO2L 2PSMC 4V196 3JR7A 2XJUA 1Z92B 5C44L 4RXNA 3GTLL 5IYDL 2L0ZA 1Y1WL 2R93L 1VZGA 3HOZL 4A93L 1R0JA 3QQCE 1TWGL 2J9UB 4LHLA 2JA5L 5IYCL 2B5ID 3HOXL 4QIWP 1I6HL 2GMGA 3LPEB 3GTML 1FHMA 1BFYA 2WAQP 5MFZA 1OWBA 4AR4A 4JAGA 3SS2A 4TPUA 3S2DL 1YK5A 5GADc 5FJ8L 5JVG1 6RXNA 2KN9A 5M3FL 4POFA 1LTLA 3PKJA 3S17L 2APOB 1FHHA 1SMMA 4A3FL 1VCXA 3HOUL 3KYXA 1VZIA 4Y7NL 3MQKB 5C4JL 3HKZP 3LWQB 4ZN1B 5EIOC 4BXXL 4AR5A 3J7Y1 4A3BL 2O5JD 1S2ZA 4TVMA 4JAFA 3P8BA 2CKAA 7RXNA 1YK4A 2PPTA 1NXGA 4A3IL 2XJQA 2E2IL
chains in the Genus database with same CATH topology
1R0FA 4AI0A 1B71A 2XJTA 2LCQA 1NNQA 2V3BB 3P2AA 5RXNA 4XXBB 4JAEA 4LHNA 4POGA 4AR3A 1JYBA 1B13A 2C6BA 2QL0A 1IROA 3PKIA 2PSMC 4V196 1H7VA 2XJUA 1Z92B 2KKDA 2M6OA 4RXNA 1OWCA 5K2ME 4UY81 1E8JA 2L0ZA 1S30A 3RZ6A 1VZGA 2ZIXA 1WJVA 2K2DA 2PYAA 1RWDA 1S24A 2JI1A 5GAHc 5H1Sc 4AHZA 1IU6A 1RYTA 4YWMA 1R0JA 2ERSA 3LNLA 4XGHA 2HR5A 2CR8A 5GAGc 2A68D 4B8CD 3B08B 3QQCE 4E6YA 2DSXA 1B2OA 2J9UB 3NFPI 4AHYA 4AI2A 1LKMA 4WFN1 4LHLA 1BRFA 3PIP1 2B5ID 5GAEc 2JI3A 1T9PA 1VZHA 3A44A 3MSUA 2A6HD 1YV1A 1CADA 2Z3QB 2GMGA 3LPEB 2JI2A 5AI2A 1FHMA 2M6PA 1BFYA 2PVEA 3PIO1 1IRNA 5MFZA 5DM71 1OWBA 3PZAA 4AR4A 2Z3RB 2VL6A 4JAGA 3SS2A 4TPUA 1ODHA 1QYBA 1SMWA 1IU5A 1DVBA 1YK5A 5GADc 5JVG1 4G6BA 1SMUA 2NYDA 2A6ED 1LKOA 6RXNA 3K35A 1IW7D 2KN9A 3KYWA 3PWFA 2V0EA 1BQ8A 2MS3A 4K9FA 1C09A 3MPSA 4AHXA 3QVDA 5AN9H 1BQ9A 1B2JA 3IU3I 5EINC 5AI3A 4POFA 1T9OA 5MLC3 1LTLA 3PKJA 2M4YA 1FHHA 1NXEA 5DM61 1SMMA 2XJSA 4U671 2XJRA 8RXNA 1VCXA 3WWLA 4ME3A 4YWLA 1R0GA 5JVH1 3KYXA 4AI3A 1T9QA 1VZIA 3VPBE 5IY0A 2RDVA 2ERJA 1BE7A 1YUZA 1QCVA 4ZN1B 3B0AB 5EIOC 4GS7D 4AR5A 4AI1A 2V0FA 3J7Y1 2M4VA 5MFPA 2O5JD 1ZRPA 3KYYA 3KYVA 3RZTA 5MF6A 2XJPA 4JADA 3ZG6A 1S2ZA 4ZN3B 4TVMA 2CKCA 4JAFA 2XJVA 3P8BA 2CKAA 3J7Z1 2A69D 7RXNA 1YK4A 2PPTA 2AYJA 1NXGA 1LKPA 4AR6A 2XJQA 2C6AA 2BE5D 3KYUA 2PVXA 1CAAA 3RYGA 5MGNA 1DX8A 2H12A 1RB9A 1YUXA 3WWNB 1R0IA 1R0HA 1RYQA 1RDGA 1RDVA 4AHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R0F A;  1B71 A;  2LCQ A;  1NNQ A;  2V3B B;  5RXN A;  4POG A;  4AR3 A;  1JYB A;  1B13 A;  2QL0 A;  1IRO A;  1H7V A;  2KKD A;  4RXN A;  1E8J A;  1S30 A;  3RZ6 A;  2K2D A;  2PYA A;  1RWD A;  1S24 A;  1IU6 A;  1RYT A;  4YWM A;  1R0J A;  2HR5 A;  2DSX A;  1B2O A;  1LKM A;  1BRF A;  1T9P A;  3A44 A;  1YV1 A;  1CAD A;  2GMG A;  5AI2 A;  1FHM A;  1BFY A;  2PVE A;  1IRN A;  3PZA A;  4AR4 A;  2VL6 A;  3SS2 A;  4TPU A;  1QYB A;  1SMW A;  1IU5 A;  1DVB A;  1YK5 A;  1SMU A;  1LKO A;  6RXN A;  2KN9 A;  3KYW A;  3PWF A;  1BQ8 A;  2MS3 A;  4K9F A;  1C09 A;  3MPS A;  3QVD A;  1BQ9 A;  1B2J A;  5AI3 A;  4POF A;  1T9O A;  1LTL A;  2M4Y A;  1FHH A;  1SMM A;  8RXN A;  1VCX A;  4ME3 A;  4YWL A;  1R0G A;  3KYX A;  1T9Q A;  5IY0 A;  2RDV A;  1BE7 A;  1YUZ A;  1QCV A;  4AR5 A;  1ZRP A;  3KYY A;  3KYV A;  3RZT A;  1S2Z A;  7RXN A;  1YK4 A;  1LKP A;  4AR6 A;  3KYU A;  2PVX A;  1CAA A;  3RYG A;  1DX8 A;  1RB9 A;  1YUX A;  1R0I A;  1R0H A;  1RDG A;  1RDV A; 
#chains in the Genus database with same CATH topology
 1R0F A;  2XJT A;  2LCQ A;  1NNQ A;  5RXN A;  4XXB B;  4LHN A;  4POG A;  3H9B A;  1B13 A;  3FKI L;  2C6B A;  1IRO A;  2R7Z L;  5M5Y L;  1PFW A;  5K2M E;  4UY8 1;  3H3V M;  3PL5 A;  3RZ6 A;  2ZIX A;  1WJV A;  4A3D L;  1S24 A;  2JA7 L;  4BBR L;  4AHZ A;  3K7A L;  1IU6 A;  3LNL A;  4XGH A;  2CR8 A;  4E6Y A;  5C4X L;  3NFP I;  4WFN 1;  3PIP 1;  5IP7 L;  5GAE c;  2JI3 A;  4C3J L;  3MSU A;  2A6H D;  3HOW L;  2M6P A;  1IRN A;  2R92 L;  2VL6 A;  3GTQ L;  1SMU A;  2NYD A;  3K35 A;  3S14 L;  1BQ8 A;  4K9F A;  5AN9 H;  3S1R L;  5EIN C;  5AI3 A;  1PFV A;  1T9O A;  5MLC 3;  1PZX A;  1NXE A;  4A3K L;  5C3E L;  1TWC L;  3VPB E;  2ERJ A;  2AUS B;  2YU9 L;  4GS7 D;  4AI1 A;  1ZRP A;  3KYY A;  5FLM L;  4JAD A;  3LWP B;  3ZG6 A;  4ZN3 B;  2XJV A;  4BBS L;  2AQC A;  1TWA L;  2C6A A;  2PVX A;  1Y1V L;  2H12 A;  1YUX A;  3S1N L;  1RDG A;  3I4M L;  4AI0 A;  3P2A A;  4AR3 A;  2QL0 A;  3PKI A;  3HOV L;  2KKD A;  2M6O A;  1SFO L;  3M3Y L;  1S30 A;  2PYA A;  2JI1 A;  1I3Q L;  1RYT A;  4YWM A;  3FDJ A;  5GAG c;  2A68 D;  2E2H L;  3H99 A;  3S16 L;  4AHY A;  4AI2 A;  3GTK L;  1VZH A;  4A3M L;  2NVQ L;  2JA8 L;  1YV1 A;  5AI2 A;  2JI2 A;  4A3E L;  3S15 L;  3HJW B;  1PFU A;  2PMZ P;  2Z3R B;  1SMW A;  1IU5 A;  2Y0S P;  2A6E D;  1LKO A;  1IW7 D;  3PWF A;  4AYB P;  1C09 A;  3QVD A;  1B2J A;  3IU3 I;  3S1Q L;  2M4Y A;  2E2J L;  5DM6 1;  4U67 1;  3WWL A;  4ME3 A;  4A3J L;  4AI3 A;  5M5X L;  1T9Q A;  3HJY B;  3GTG L;  1BE7 A;  1QCV A;  3GTP L;  3B0A B;  5IP9 L;  2M4V A;  1TWH L;  4A3G L;  2CKC A;  3J7Z 1;  2A69 D;  2AYJ A;  2RFK B;  1LKP A;  4AR6 A;  3KYU A;  2BE5 D;  1CAA A;  1DX8 A;  3GTJ L;  1RB9 A;  1R0I A;  3H97 A;  4AHW A;  4BY7 L;  4X6A L;  2V3B B;  4C2M 1;  4C3I L;  2HVY C;  5M3M L;  3S2H L;  1H7V A;  1OWC A;  1P7P A;  1E8J A;  2K2D A;  5H1S c;  1RWD A;  5GAH c;  3RZO L;  3HAX C;  2ERS A;  4C3H L;  2HR5 A;  2NVT L;  4B8C D;  3B08 B;  1PFY A;  2DSX A;  1B2O A;  1LKM A;  1BRF A;  1T9P A;  3A44 A;  2EY4 E;  1TWF L;  1CAD A;  2Z3Q B;  2PVE A;  5DM7 1;  3PZA A;  3LWO B;  1ODH A;  1QYB A;  1DVB A;  4A3C L;  1WCM L;  3S1M L;  4G6B A;  1K83 L;  3KYW A;  2V0E A;  2MS3 A;  3H0G L;  4AHX A;  3MPS A;  1BQ9 A;  2NVX L;  3H9C A;  2XJS A;  2XJR A;  8RXN A;  2WB1 P;  4YWL A;  1R0G A;  5JVH 1;  5IY0 A;  2RDV A;  1YUZ A;  3LWR B;  3RZD L;  3I4N L;  3LWV B;  3HOY L;  1I50 L;  2V0F A;  5MFP A;  4A3L L;  3RZT A;  4Y52 L;  3KYV A;  5MF6 A;  2XJP A;  3M4O L;  5IYB L;  2NVY L;  2JA6 L;  3CQZ L;  3PO3 L;  2VUM L;  3RYG A;  5MGN A;  3WWN B;  1R0H A;  1RYQ A;  3PIO 1;  1RDV A;  1R9T L;  4BY1 L;  1QQT A;  1B71 A;  3GTO L;  2B63 L;  4JAE A;  5M5W L;  1F4L A;  1JYB A;  3PO2 L;  2PSM C;  4V19 6;  3JR7 A;  2XJU A;  1Z92 B;  5C44 L;  4RXN A;  3GTL L;  5IYD L;  2L0Z A;  1Y1W L;  2R93 L;  1VZG A;  3HOZ L;  4A93 L;  1R0J A;  3QQC E;  1TWG L;  2J9U B;  4LHL A;  2JA5 L;  5IYC L;  2B5I D;  3HOX L;  4QIW P;  1I6H L;  2GMG A;  3LPE B;  3GTM L;  1FHM A;  1BFY A;  2WAQ P;  5MFZ A;  1OWB A;  4AR4 A;  4JAG A;  3SS2 A;  4TPU A;  3S2D L;  1YK5 A;  5GAD c;  5FJ8 L;  5JVG 1;  6RXN A;  2KN9 A;  5M3F L;  4POF A;  1LTL A;  3PKJ A;  3S17 L;  2APO B;  1FHH A;  1SMM A;  4A3F L;  1VCX A;  3HOU L;  3KYX A;  1VZI A;  4Y7N L;  3MQK B;  5C4J L;  3HKZ P;  3LWQ B;  4ZN1 B;  5EIO C;  4BXX L;  4AR5 A;  3J7Y 1;  4A3B L;  2O5J D;  1S2Z A;  4TVM A;  4JAF A;  3P8B A;  2CKA A;  7RXN A;  1YK4 A;  2PPT A;  1NXG A;  4A3I L;  2XJQ A;  2E2I L; 
#chains in the Genus database with same CATH homology
 1R0F A;  4AI0 A;  1B71 A;  2XJT A;  2LCQ A;  1NNQ A;  2V3B B;  3P2A A;  5RXN A;  4XXB B;  4JAE A;  4LHN A;  4POG A;  4AR3 A;  1JYB A;  1B13 A;  2C6B A;  2QL0 A;  1IRO A;  3PKI A;  2PSM C;  4V19 6;  1H7V A;  2XJU A;  1Z92 B;  2KKD A;  2M6O A;  4RXN A;  1OWC A;  5K2M E;  4UY8 1;  1E8J A;  2L0Z A;  1S30 A;  3RZ6 A;  1VZG A;  2ZIX A;  1WJV A;  2K2D A;  2PYA A;  1RWD A;  1S24 A;  2JI1 A;  5GAH c;  5H1S c;  4AHZ A;  1IU6 A;  1RYT A;  4YWM A;  1R0J A;  2ERS A;  3LNL A;  4XGH A;  2HR5 A;  2CR8 A;  5GAG c;  2A68 D;  4B8C D;  3B08 B;  3QQC E;  4E6Y A;  2DSX A;  1B2O A;  2J9U B;  3NFP I;  4AHY A;  4AI2 A;  1LKM A;  4WFN 1;  4LHL A;  1BRF A;  3PIP 1;  2B5I D;  5GAE c;  2JI3 A;  1T9P A;  1VZH A;  3A44 A;  3MSU A;  2A6H D;  1YV1 A;  1CAD A;  2Z3Q B;  2GMG A;  3LPE B;  2JI2 A;  5AI2 A;  1FHM A;  2M6P A;  1BFY A;  2PVE A;  3PIO 1;  1IRN A;  5MFZ A;  5DM7 1;  1OWB A;  3PZA A;  4AR4 A;  2Z3R B;  2VL6 A;  4JAG A;  3SS2 A;  4TPU A;  1ODH A;  1QYB A;  1SMW A;  1IU5 A;  1DVB A;  1YK5 A;  5GAD c;  5JVG 1;  4G6B A;  1SMU A;  2NYD A;  2A6E D;  1LKO A;  6RXN A;  3K35 A;  1IW7 D;  2KN9 A;  3KYW A;  3PWF A;  2V0E A;  1BQ8 A;  2MS3 A;  4K9F A;  1C09 A;  3MPS A;  4AHX A;  3QVD A;  5AN9 H;  1BQ9 A;  1B2J A;  3IU3 I;  5EIN C;  5AI3 A;  4POF A;  1T9O A;  5MLC 3;  1LTL A;  3PKJ A;  2M4Y A;  1FHH A;  1NXE A;  5DM6 1;  1SMM A;  2XJS A;  4U67 1;  2XJR A;  8RXN A;  1VCX A;  3WWL A;  4ME3 A;  4YWL A;  1R0G A;  5JVH 1;  3KYX A;  4AI3 A;  1T9Q A;  1VZI A;  3VPB E;  5IY0 A;  2RDV A;  2ERJ A;  1BE7 A;  1YUZ A;  1QCV A;  4ZN1 B;  3B0A B;  5EIO C;  4GS7 D;  4AR5 A;  4AI1 A;  2V0F A;  3J7Y 1;  2M4V A;  5MFP A;  2O5J D;  1ZRP A;  3KYY A;  3KYV A;  3RZT A;  5MF6 A;  2XJP A;  4JAD A;  3ZG6 A;  1S2Z A;  4ZN3 B;  4TVM A;  2CKC A;  4JAF A;  2XJV A;  3P8B A;  2CKA A;  3J7Z 1;  2A69 D;  7RXN A;  1YK4 A;  2PPT A;  2AYJ A;  1NXG A;  1LKP A;  4AR6 A;  2XJQ A;  2C6A A;  2BE5 D;  3KYU A;  2PVX A;  1CAA A;  3RYG A;  5MGN A;  1DX8 A;  2H12 A;  1RB9 A;  1YUX A;  3WWN B;  1R0I A;  1R0H A;  1RYQ A;  1RDG A;  1RDV A;  4AHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...