1B16A

Alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-3-pentanone
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (ALCOHOL DEHYDROGENASE)
total genus 96
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b16A00
2X58A 1JAXA 2C2YA 3H5AA 4YBZA 1G6KA 3VZPA 4DLLA 2X23A 1XKQA 1H6DA 4XYLA 1GFSA 4BVAA 2GN9A 1ZSNA 4B8ZA 2BH9A 1RKXA 3LDHA 3H5RA 4NH4A 3DBVO 4YXFA 5T5QA 3GNTA 4F46A 3S2FA 2GO1A 1IHXA 1K6XA 4KMSA 4DC0A 2E6UX 1K2WA 4E5PA 1ENZA 3PQDA 4UUPA 3LQFA 1TLTA 2VTEA 3HQ4O 1GYQA 4IZHA 4P4GA 4C7KA 1YL7A 2NLOA 1RPNA 4CMBA 3GPIA 3O03A 1BW9A 4M55A 1LDNA 2PZLA 3DWFA 4ONEA 4OXNA 5I9MA 5IDXA 2E82A 2YDXA 3QSGA 4GMGA 3KHUA 4RPHA 3ANMA 3P7MA 4CV0A 4BKPA 5CHEA 1E3WA 5AXBA 4ZA2A 2NADA 4D0SA 2EG9A 4WK6A 3DAFA 1N1GA 1EMDA 4RVUA 2BFMA 4NK4A 4A26A 4XB1A 4TROA 1R4NA 2V6GA 3I6IA 1J49A 1O94A 4DTIA 1ML3A 2GSDA 3U09A 2VWHA 3PWZA 2GF2A 4E3ZA 2QQ5A 1EVYA 3HN7A 4YJGB 2VTDA 5TGDA 1F12A 1KVQA 3QQPA 2HCTA 1IHYA 3DBRB 3IJRA 1HWYA 1YXMA 7MDHA 2H5LA 3M2PA 2Y1EA 1A7AA 1LSJA 4GQAA 1LJ8A 4NFSA 8LDHA 1EE9A 5B4TA 2AE2A 1C0IA 4A2CA 3D4PA 4J90A 3JQ8A 4L9RA 1H6CA 4PVCA 4U0JA 4KTTE 3RBXA 1VRWA 1I32A 4CQLA 4YVFA 5JAIA 3TDKA 1EDZA 3WDSA 3MJVA 4R1NA 3VDRA 4CODB 4R3WA 2I65A 1KVRA 2Q4EA 3VH3A 1N8KA 3GC6A 3T7EA 1T2AA 4FFPA 3AI1A 4UAGA 2NVBA 1I0ZA 4H15A 2HRZA 3JQ8B 4GX2A 4J9VA 1OBFO 5DBIA 3IQDB 3FI9A 4NFYA 1W6UA 3X2FA 4E32A 4MP8A 4P4LA 3LT1A 4BHTA 3UCFA 4PLFA 3ZWOA 4FFLA 5JFOA 3S2EA 4J7XA 2YFQA 1DEHA 1BWSA 1LRJA 2V6FA 2E48A 1DHRA 3CMMA 4IBOA 4Q3EA 1PEDA 2GUGA 4J6FA 1HYEA 4BMNA 4NPCA 1AXGA 3CUKA 5CPFA 3WGGA 4XB2A 1E5LA 2Z1NA 2R2GA 4FS3A 1T2FA 3DMTC 4Y8VA 3DOJA 2W8ZA 2J3JA 2O23A 3PP8A 3SXPA 4IXTA 4Z9FA 3ROQA 1PL6A 4QFDA 4ITUA 2Y1DA 1IPFA 2Q2QA 5IZCA 2GGSA 4P4NA 2ILTA 1WZIA 2BFPA 1TXGA 5KCZA 1B2LA 4J43A 1ZH8A 1XSEA 2HKIA 4E5MA 2D2IA 1C14A 3IJPA 2OFPA 3Q2KA 3IAHA 3VDQA 1QYDA 1SCUA 4J9UE 2R6JA 3M1AA 1P31A 1SZJG 9LDBA 2C5EA 1ENPA 1A7KA 3AM3A 2EWMA 4TRMA 1E3LA 1A9YA 4M87A 3V8BA 4B8WA 1CRWG 2CSUA 1LX6A 3TJRA 2UUOA 4WOJA 4NHEA 3ZN2A 4BNVA 2D0IA 5JCJD 2EHDA 4N5LA 3KM0A 5JDIA 5HA5A 2Y66A 2X0NA 4KUGA 2EKLA 4CUKA 3DBHA 3KSZO 4RPLA 1YQDA 2EF1A 3ZW9A 5KJCA 1UXIA 1QYWA 3CSDA 3F1KA 4E2XA 3HJAA 1QORA 3GLQA 3L6EA 1ONOA 1R4MA 1J5PA 3ZU5A 4HNHA 4BNTA 1YB4A 1RM0A 4DBVO 5A9SB 1DRUA 2CDCA 1O6ZA 3GHYA 4PLGA 3UVEA 1TVEA 4CLDA 4J1NA 4IGEA 4IGFA 4MJLA 1E7SA 4CMIA 4FDAA 2B4QA 4CR6A 5HS4A 4GAEA 1L7DA 1CQIA 1JN0A 3PJDA 4MKXA 1X15A 2D4AA 1ULSA 4RF4A 3VPFA 2ZJ0A 4BO0A 1JWBB 1GR0A 1NHGA 3IC5A 3LT0A 1EZ4A 3IUSA 2PFGA 5DN9A 1DPGA 1T1SA 4GWGA 4K6FA 4A10A 1J0XO 3K2BA 4HADA 1R4MB 4WCDA 1NNUA 3F5SA 3K31A 4BGIA 2JFHA 3F3SA 3OF2A 4GWKA 5CEJA 1GCOA 1GZ6A 2O2YA 2C5AA 1RJWA 1E1NA 3IP1A 4YT5A 4CV1A 5FWNA 1HE2A 1PJBA 4MIYA 4L4SA 1DAOA 1B26A 1U5CA 3P19A 4J16A 3NYWA 1VL6A 3T7CA 2YHIA 3KOUA 1I3MA 1PZGA 5EIOA 2XF8A 3GDFA 4XEHA 3BTVA 3GG9A 1WXDA 4P22A 3OJFA 2X86A 4TRNA 5T57A 1A5ZA 1UXKA 4YJFA 2Q50A 1QYXA 2C54A 5DULA 5GZ1A 5TNXA 4WEQA 3U62A 2NM0A 1HE5A 4D7AA 1LLQA 5FEUA 2HMSA 2JCYA 3ONFA 4P8RA 5EQDA 4DC1A 3ON5A 5KOIA 3WIEA 1ZXBA 2DPHA 5B4UA 3PHJA 4Z6KA 3OQ1A 3RIHA 3UFXA 2B35A 1WP4A 3HFSA 5HS6A 3ZWNA 3C1OA 5HTOA 4W9NA 4GBJA 3FWNA 2PD4A 4JGBA 5JYEA 4M89A 4PRKA 1MV8A 1ZZEA 2AQ8A 2O3UA 2B5WA 1XLTA 4CMCA 3EZYA 5EL0A 3U4CA 4URFA 1Q2XA 3GFGA 1O95A 4W82A 4RVFA 2DBRA 2W2LA 2JD2A 3ETGA 1EQ2A 3U0BA 2EERA 4FD3A 3JQGA 4BO9A 1BVRA 2Q1TA 3RD5A 2AE1A 3L4SO 2VUTA 4MPDA 3LVFO 4NJMB 4DPMA 3BIOA 3R1IA 4CM8A 4RLHA 1A27A 1LDGA 1UAGA 4Q39A 1M6HA 3UCXA 3PHHA 5COQA 2YDYA 1ZK1A 2FY8A 2G17A 3ICPA 4XGNA 3RUDA 4CPDA 4UUMA 3LT4A 4AL4A 4NK5A 1VPDA 4RCVA 3LYLA 1KERA 4CMAA 4CQMB 3KEOA 4K1LA 5C5IA 2EIHA 2VHWA 4I08A 4D43A 1LC0A 5CEFA 3UCEA 3PGXA 1PS9A 4EEXA 1QXSA 3AY3A 1ZVMA 3P5SA 4D45A 3JD1A 5TS3A 5CEEA 4LK3A 3EW7A 5H81A 4H3VA 4CLRA 3ZWMA 3RKUA 3AY6A 3HDYA 3RUHA 5JC1A 3ZWXA 1U2GA 4O6VA 2YV3A 3ZW8A 3GVCA 5CPBA 3U9LA 2IEDA 3OMLA 4WEOA 2ZATA 3SC6A 1V35A 2VYVA 4A0SA 3INRA 1RM4A 1UJMA 5TF4A 3UICA 1YJQA 4RV9A 3F1LA 4YJGA 1R66A 2VWGA 2VCYA 4YT8A 6LDHA 4N54A 2B5VA 4XGKA 1B8VA 4NMHA 1PJTA 1Y8RA 4Z0PA 2NACA 4RF2A 4LSMA 1LDBA 4QUKA 1J6UA 5AXCA 1NXQA 1ZK0A 1MA0A 3BMQA 4XYEA 3ENNA 1I24A 5G0SA 5ER9A 3WFJA 3ADOA 1G0OA 2DLDA 1QV6A 2I3GA 4WCFA 2O7QA 3RQSA 4J91A 2HMTA 4OM8A 4CM6A 4BNYA 3V2GA 3JQ7B 1H2BA 2ZB7A 3EGOA 4DPLA 3JV7A 3KYBA 2WYVA 3O26A 4KZPA 2BGMA 5ITWA 1VLLA 4EJMA 3DZHA 4ZGWA 4M8SA 3JYOA 4EW6A 3TL2A 3QE3A 1DDOA 1NAHA 4O59O 4BNLA 1AE1A 2HO5A 4CM4B 2OP0A 2RHCA 4E13A 4R1SA 2X7HA 2JAPA 1K5HA 4WE3A 1BSVA 1Y81A 3H65A 2OL4A 4MO2A 1LXCA 3WGZA 1Y7TA 1LDEA 4BNZA 1B0AA 4Y6SA 4E6PA 3VC7A 5TIIA 4XJTA 1JAYA 4U6SA 2Y67A 3PYXA 3HNPA 3WNQA 2GZ1A 3A06A 4EDFA 1JDJA 2XAAA 3COSA 3PXXA 1ZBQA 5AVOA 1NPTO 4WLUA 1CQJA 4DVJA 3L4BC 1PTJA 3HWRA 4CM5A 2NTJA 5JS6A 2P68A 2D3TA 2EJWA 2OZPA 1N5DA 3E5RA 4OMUA 5KVSA 3GVHA 4D44A 1DBVO 4L75A 4IQGA 4RORA 1ONPA 3KETA 1PJ4A 4D0RA 4ZQEA 4FFMA 5A9SA 4C4OA 4XCVA 3NDRA 3NT5A 1HDXA 2Q1SA 4FQ8A 3EAGA 3U4IA 4I9NA 2ZJ1A 4EJ0A 2JHFA 2Y0CA 2Z5LA 4DLAA 4LW8A 4TRRA 4XRGA 1EUZA 3I9MA 5IXYA 2EGGA 4W7IA 4GLLA 5THKA 2VT3A 2J6IA 4WASA 5JAQA 4AJJA 1KETA 1M76A 1YBAA 4E33A 3FWZA 3LU1A 1ZK4A 3A9WA 4RPGA 1JVSA 1ADGA 1E7WA 2RHRA 3RC9A 4UVHA 5EJ2A 4BGUA 1DXYA 1R16A 3V1TC 4WPGA 2FWMX 2GN8A 2VQ3A 3I52A 5TQVA 4UVIA 1HDCA 3DEYX 1S7CA 2GZ3A 3FHLA 4FW8A 3H5NA 1ONNA 3ZHBA 2X6TA 1ISHA 1GUFA 3C7DB 4PIVA 4HFNA 2JCXA 2Z1MA 1WVGA 4MVJF 1MG0A 1P1KA 3C24A 1H6AA 4R69A 3UOGA 3FN4A 1M75A 4BKRA 3ROKA 1A9ZA 3JQAA 4ALNA 1V3UA 1D3AA 3GPDG 3HSKA 6ADHA 4IPTA 4Q3AA 2G82A 1N1EA 3QVWA 5JPIA 3WYBA 4CMEC 3H8VA 4LMRA 4NIMA 4YTEA 4GKBA 2JCVA 4WUVA 1KIFA 3E1KA 3RFXA 2W2LD 1EBFA 1UP4A 2I99A 1XEAA 2IXBA 1UR5A 4DQVA 3OSUA 4FFNA 5CDGA 4NJMA 1E92A 1IOLA 1I3KA 1Y8RB 4CLXA 5L9AA 4JNKA 4B79A 4BV9A 4JROA 5F5NA 3MJEA 3TN7A 3PYLA 4ALKA 4G5HA 2E49A 1SOWA 1C1DA 2WSBA 3VVBA 3AOEC 3FPLA 1YGYA 1EBUA 2ZKLA 1Y1PA 3AWDA 4FJ1A 4EYEA 1LLCA 5MGBA 3V1UA 3OQBA 5KKAA 2HJSA 2B36A 2AEFA 3AI3A 1KY4A 2FR8A 4GX1A 4BL5A 3RAJA 5B37A 1T24A 1HEUA 3W4KA 3OJOA 3KBOA 2FRDA 4FFRA 2TMGA 3I3OA 3OEYA 3G17A 3JYPA 4FB5A 4M49A 5DOVA 3TWOA 1IY8A 1SBYA 4CL8A 2B37A 3STHA 8ADHA 1ZIDA 2F00A 3DAPA 3BYZA 2R00C 4QEDA 3DR3A 3QV1A 2V6BA 1DC4A 2YZ7A 2Y93A 3KUXA 1HSZA 2ZTVA 4CV2A 4OO3A 4ROSA 3FBGA 3EY4A 4WLFA 5JO0A 3QHAA 3PWSA 1W4ZA 3CXRA 1T26A 4R01A 4O63O 1P0FA 1K3TA 1HTBA 2PY6A 3FBTA 2X5KO 1DIAA 1OC4A 2ZYDA 1N92A 1E7QA 1XWFA 1ZK3A 2Y99A 4JJIA 4MVJM 1E5QA 2FMUA 2P9CA 3I9LA 1AUPA 3WQQA 4WOKA 1UDBA 3CZMA 5DNAA 4J1SA 3OIDA 5C7LO 1G0NA 1C1DB 4IXWA 2CF5A 3PRJA 4HY3A 1DC6A 1HLPA 2Y0DA 1C0KA 1T2DA 2VNAA 3IIEA 1P77A 4HKTA 3SEFA 1U7TA 3QWFA 3WICA 4RDIA 3R3JA 3PZBA 4IY1A 5EMHA 5A05A 4F6LA 2P2SA 2C7GA 4IM7A 4ND2A 3WBBA 1K6JA 1P74A 2QG4A 1GAEO 3BMCA 2J8ZA 4I9HA 1EFLA 5CG1A 1E3IA 1V8BA 1ARZA 1K0UA 4U5QA 1U8FO 1KY5A 1MC5A 2PR2A 3BXXA 1LSUA 3WGTA 4A03A 3VPGA 4Y67A 1UAYA 3GZNA 4M86A 4QO7A 3TPCA 3E48A 2Q2VA 1A4UA 1KVSA 4RZHA 1PZEA 2DBQA 2NTVA 3WWYA 3Q0EA 3WXBA 5KNLA 5DCYA 1FJHA 4DQUA 1HZZA 1YDEA 2ZYAA 2Q99A 1SB9A 3ZHYA 3L9XA 2PD6A 3H2ZA 3KEQA 1SMKA 1GCUA 1OFGA 3KTDA 4TVBA 3IKVA 1M67A 4ZQHA 1ADFA 2O48X 1Y8QB 3BTSA 1P0CA 1U4OA 1ZO8A 4TRJA 1LSOA 4XIYA 3ROMA 3D5TA 5BSFA 3AU9A 3ROPA 2PGLA 4NBWA 3QVSA 3A1NA 1PZHA 4KWHA 3C7AA 4W7HA 2BFAA 1NVTA 4AJIA 1UP7A 3IMFA 4ALMA 1D1TA 2NUAA 5EESA 1ZEMA 5DF1A 3FTNA 1B3RA 5ENDA 5BNFA 5JCJA 1KC1A 1Z82A 5EPOA 1ZXLA 4B3HA 3JQEA 2QRKA 5I9NA 4PZDA 4XJSA 3WQRA 4BNJA 1HE3A 1DIBA 3RUAA 3UAGA 2VYND 1NVGA 1WPQA 3DZFA 4FPXA 4RF5A 2FPGA 3HE3A 4PN3A 5B1YA 4XRRA 4N5MA 2FOIA 3ICCA 4KQWA 1BRMA 2E4AA 1IZ9A 4I5FA 3Q1LA 1H0KA 4E5KA 5AXDA 4ID9A 1PGOA 5BSGA 2GYYA 3GFBA 4CMEA 3ZHZA 5AYVA 4CUZA 3NJ8A 3U4HA 3ZZNA 4E5YA 1PJLA 1W73A 2BI8A 3SX2A 2G76A 1NQOA 4GVXA 4S1VA 1O9BA 1QV7A 4AJ2A 3ZWBA 1GV0A 2DQ4A 4HFMA 1DO8A 4E30A 4AJNA 5JAMA 2V6MA 3ONEA 4U8GA 3TZCA 1IUKA 3HG7A 3IDSA 2JD1A 1BGVA 4YCAA 5I8WA 4A73A 3NDJA 4YQYA 3G0OA 3JQBC 3PYMA 4L73A 4JXKA 3D0OA 1I3NA 4XR9A 3X2EA 4RLSA 3GEDA 1VJ1A 2AEJA 1DC3A 3HZZA 1SNYA 1GTMA 2Q4BA 4HV4A 4K28A 2O3RA 3ASVA 4BO2A 4HFRA 4Y6RA 1CJCA 2EW2A 4KDEA 4LMPA 5F5LA 4K6CA 1LUAA 2IZ0A 1YVEI 4TMFA 3SLKA 3VZRA 1TA4A 1VSUA 2JD0A 2D8AA 2CVZA 2NQ8A 3IOYA 4JBGA 3CEAA 4CLOB 3C3XA 2OO5A 3ZGYA 1CEQA 4YPOA 3NGXA 1UXJA 3K8ZA 2IZZA 4YJFB 5I7EA 5DP1A 2CD9A 3FRJA 5L4LA 3OQ6A 4FCCA 4NNJA 1AXEA 1DFGA 2VRCD 3DDNA 3WYEA 1OOEA 3H4VA 1J4AA 3QWHA 5AOVA 2YQ4A 3OHSX 4AJLA 4XX0A 3E03A 1PWXA 3JQ9A 4EUFA 3L4BA 4DYVA 2AQIA 3NT4A 4BO8A 2JAHA 3ZHXA 3WQSB 1ZW1A 3GK3A 3VPXA 5G0WA 2VUSA 4R54A 3UXYA 1PJ2A 2JKVA 3JQFA 3TFOA 4OKNA 3T4EA 1IB6A 2AW5A 3CINA 3NUGA 4B3IA 2I66A 2HK7A 3ABIA 4NZ9A 4IJKA 4XIJA 4Z3DA 2PLAA 1P9LA 2CDBA 2OMEA 3D4NA 2VOJA 3O9ZA 2XXJA 4G2NA 5IDWA 2Y0EA 2BGLA 3NJ4A 4NU6A 4E21A 5C37A 4BKOA 1BMDA 2W2KB 4YAEA 4GSLA 2UUPA 3G1TA 5BSEA 1WNTA 1AGNA 1T4BA 3RC1A 5HRUA 2CNBA 4RVHA 4MVJP 4CMIB 3ZV5A 2AQKA 1I2ZA 3HHPA 4NFHA 3OA2A 3D4OA 1YQXA 1P3DA 1SB8A 4WLOA 2VT2A 4GH5A 3BZUA 4OXYA 1U3TA 4CM8B 4S3MA 1U1IA 3AUUA 1A4IA 1CETA 3WGOA 3KRTA 4YB8A 5LC1A 5IAAA 2A9FA 4E2YA 1GL3A 3LT2A 3F5QA 4ZRMA 4YAIA 3RJ5A 2ZTUA 3OM9A 4YACA 4IUYA 1BXGA 1PQPA 2PKQP 5ICMA 1DRVA 1MUUA 2XOXA 1LI4A 2DBVO 2DUWA 3KYDB 4Z0HO 4L76A 3BMOA 4GPD1 5COAA 4BNFA 1V3VA 1MFZA 3H9QA 3FPCA 1EE2A 2WM3A 3VZQA 1G1AA 3L6DA 4CLRB 2AQHA 3H9EO 3TF5A 1HDRA 2PKQO 2WMDA 4NJOA 1W0CA 1HXHA 2C07A 3RVDA 1PQUA 3FSRA 3SJ7A 4PLPA 3PHIA 4MVJH 1O8CA 1E1LA 1Z7BA 4CR8A 5KVVA 4YJDA 3AY7A 4J4HA 2D1YA 1LLDA 4YR9A 3I6QA 5B4VA 5ITVA 1PJ3A 4BNIA 3E9MA 1ZSYA 4H16A 1NPDA 4IINA 2YFHA 1HKUA 4D79A 1YQGA 4LISA 3ZV4A 3I83A 1NFQA 2PZJA 1U5AA 3WG9A 4BUCA 3GA0A 2VYNA 3AK4A 4EBFA 1UH5A 4LVUA 4OAQA 3OICA 4D3SA 4YEDA 3BAZA 1M66A 3BTUA 1DFIA 2CUKA 4HUJA 4DREA 1XU9A 4R3NA 3ST7A 1H9AA 1X1EA 3D7LA 1UDCA 1X14A 3DZBA 2NSDA 4B4VA 3BHIA 1DLIA 4B7UA 4QXMA 3ZI0A 4BNHA 4FN4A 3RKRA 1I2CA 4IS3A 3RFTA 3KV3O 4BKUA 1NBOA 1MXHA 1QR6A 4UULA 4ZVVA 3ZV3A 4I8XA 4GVLA 4BO3A 4CM9A 5TC4A 4R51A 2HRBA 4AJKA 2CF6A 3NEPX 1NX6A 4OIMA 4M54A 3KB6A 4D46A 5T6BA 3S2GA 3QIVA 4PLWA 1PX0A 4YAKA 4PG6A 3RUCA 1MFPA 3MTJA 2DM6A 1PGPA 3WR5A 1NFRA 3H9UA 5BNIA 2DFVA 4MVJG 5I8ZA 3E18A 3OP4A 1R12A 4WLEA 4XDYA 3AOEA 3HUDA 4NQZA 2YHIB 1W8DA 2HDHA 3HB4X 3VVCA 1GU7A 2OBYA 1BTOA 1LBEA 3GT0A 1T2EA 3DTYA 5K9ZA 3INTA 4JP2A 4TZKA 4PLZA 3EDMA 3OBBA 2NU6A 1XA0A 4QECA 1DIRA 2W4QA 2WYWA 3JTMA 3ANNA 4J7UA 3ZNQA 5JDCA 3D3WB 3DB2A 2QW8A 1ENYA 5I7FA 2HK9A 5TLSA 4ND1A 3L07A 1WMAA 1ORRA 4IDAA 3U5TA 3PJEA 4XYMA 4CQMA 4EZBA 1R4NB 2P9EA 2C82A 1T4DA 5FF9A 1C1XA 2EGHA 4NI5A 3ZWVA 1FF9A 3KYCA 4Y9DA 1MX3A 1V9LA 4AVYA 1E3WB 1RYDA 5CFZA 2ZTMA 1S6YA 1NR7A 3O8QA 4YJHB 5G0TA 3AFMA 3GH3A 2GLXA 1PQWA 4YAJA 4PLYA 5L45A 3E82A 5F3RA 3AM5A 3INGA 5G4LA 3ZU4A 1UXHA 3GEGA 3GVIA 4JJFA 2PKRA 4XDZA 3W8EA 1TT5A 5GZ6A 2PWZA 1R15A 2EV9A 3AM4A 4ZHSA 2EP5A 5A5EA 1ZUD1 3N7UA 1NP3A 4CM4A 4CM1A 5IZ4A 3VKVA 2IDZA 3E9NA 4OQYA 4RVGA 4HFJA 3D3EA 3GN2A 3RUFA 2X0RA 1U9JA 4MP3A 1ISJA 4Z9XA 5ENVA 1O5IA 3OH8A 1LNQA 2AG8A 4WNCA 4R41A 4UEOA 3JQDA 2PGJA 2WD7B 1LDYA 3LF2A 1XQ6A 3BHMA 3UGKA 1GPJA 1UUFA 4AICA 4ZQGA 5U1PA 1EFKA 4JIGA 1SAYA 1E6UA 3FR7A 3PHGA 4LGVA 4E2WA 4GGPA 1KC3A 3WGYA 1F17A 1U7HA 4AJ1A 5KTKA 1Q7GA 4GSKA 5EERA 4Q3CA 1E6WA 1YBVA 3PDJA 1EEHA 1FDUA 4WECA 3UW3A 4DQXA 3ZWCA 1ZK2A 4UUNA 3P2YA 3DZGA 5GMOA 2FPPA 3GAZA 4L0QA 1PS0A 1E7MA 1R0SA 5COBA 3DO5A 3VKUA 3E5MA 1ZJYA 4DA9A 4N18A 2B0JA 3D64A 3JQFC 2DTEA 4J0EA 4J7CA 5CDTA 1QG6A 3GNQA 2FSSA 3D5QA 3ZH2A 4UVGA 3C8MA 3JQAB 1GEEA 1LA2A 2AG5A 1N7HA 1B7GO 4Q3BA 2I6TA 5IN5A 4I5DA 3BMNB 4KUEA 1Z74A 2HQ1A 2WE7A 4FGWA 4HX5A 4MVJD 1GYPA 4XGIA 1AN9A 3FNHA 3WOHA 2BI7A 1UP6A 2IE0A 1NPYA 3DBHB 2P9GA 3WGHA 3W4JA 1I3LA 1P44A 1JVBA 3B1FA 4G81A 1GQQA 2YV2A 5K6AA 1P45A 3WMWA 4CMKA 2VRBA 2GN4A 4WGGA 3DL2A 5J23A 4WJZA 2C59A 1FDVA 1EVZA 1VSVA 3LSYA 1KS9A 4JLWA 2HSDA 4MKZA 1H2HA 4R9SA 1VKOA 1Y9AA 4O5OA 4ZQFA 3QJ5A 3IL2A 1Z75A 5JSFA 1DAPA 3H2SA 1DFHA 4J1QA 1CDOA 4ND3A 4B7CA 1EK6A 1F8FA 1X7GA 3WGIA 1PGNA 1PL8A 3IS3A 3ONDA 5A4DA 1P1RA 1HSOA 1VL0A 1B14A 2X8LA 5DCUA 1Q7CA 1P1HA 1BXKA 3IUPA 4TQGA 1E1KA 5ILGA 2GPTA 2HAEA 5KIAA 2B69A 4DPKA 3ZNOA 3N74A 3PQFA 3GDGA 3RWBA 2X9GA 1RYEA 1YB5A 3T4XA 2HK8A 2H6EA 4OL9A 1GYRA 3E8XA 3LZ6A 3W4IA 7ADHA 1KOLA 4JBIA 5T8KA 4AJEA 3G79A 4DWVA 4PRLA 1YE3A 1YRLA 2DTDA 5A03A 3I1JA 1B16A 3DFZA 4HBGA 4AFNA 4CR7A 5LCXA 2OHXA 3GZ4A 2G1UA 4MVJE 1KEVA 3VH2A 1O0SA 1GY8A 2HMVA 3EUWA 3CZRA 3RJ9A 2CVOA 1HRDA 2Q45A 1I01A 1PIWA 2D5AA 1OI7A 3K5PA 4IMPA 3TZ6A 5HBRA 3Q9UA 5JY1A 5FYDA 1X0XA 3P2OA 4W6ZA 2VNSA 2CMDA 1ISGA 4YT2A 1KYQA 4GKVA 2AA3A 2Y1FA 4OSPA 4RQTA 2PA3A 1PR3A 3PWKA 3V2HA 1Z73A 4DIBA 5L4SA 2FR1A 3VTZA 2EW8A 1IPEA 4PG5A 1HE4A 3F9IA 4MIEA 1GEGA 1ZEJA 4BIIA 1JKJA 3KLMX 2PD3A 3JQ7A 4MDHA 4ILKA 2ZCUA 2VHVA 1D7OA 4UVDA 5BT9A 4CMHA 2A35A 1GD1O 3L9WA 4BOYA 4TWRA 1H9BA 2DTXA 1U3WA 3RASA 4NBTA 2O4UX 4FC6A 3O8QB 3JYNA 4R9RA 2AMFA 3K30A 1B8UA 3OETA 4IDCA 5L3ZA 1R6DA 3R6DA 2P4HX 1U28A 3ASUA 3FNEA 2B4TO 3JYQA 2GN6A 1HDYA 2GCGA 3QA9A 4J2HA 4EGFA 5CDUA 1F06A 5A9TA 3WJ7A 3SJUA 9LDTA 3RUEA 1QMGA 3C1AA 4AJHA 1QYVA 1BDMA 1H94A 3VH1A 4RZIA 5L95A 1WLYA 3QWBA 1NFFA 3JSAA 2OXIA 3MJSA 2Q46A 1XR3A 4QFCA 1PGQA 4PFJA 2EKQA 4PLTA 3K92A 5ILOA 4UVEA 1RM3A 2VWPA 1Y8QA 3B70A 1UZLA 4OYRA 5TJ9A 4J1TA 4J3FA 2JFGA 3ENKA 1NM5A 1VI2A 1BVUA 2B83A 2C2XA 4TKMA 5T64A 2WYUA 3DHNA 3PLRA 4DXHA 1YKFA 3ZWAA 4WCFC 1DRWA 3WTBA 1JTVA 3GGGA 2YYYA 4Z0TA 4WNIA 4E0BA 3PJFA 2VRCA 3ZU2A 1ISMA 4OXKA 1E0DA 3NRCA 4EEZA 3JCZA 2DPGA 4QX6A 3VHRA 2RAFA 3GOHA 5IDYA 1VM6A 4UUOA 1CWUA 2YHUA 2POQX 4WKGA 2HMUA 4Z3KA 1YB1A 1DIHA 2QX7A 4BNKA 4E31A 3NKLA 2IODA 4RGBA 1ZJZA 3R0IA 5DZSA 1O89A 1C0PA 3MEQA 1D1SA 3TQHA 4GLOA 2W98A 2YUTA 1WW8A 3MJTA 3I5MA 3ORFA 2NVUB 5KVQA 3G1UA 3CH6A 3KYCB 4BO5A 3QW2A 1C1XB 1AHIA 2A92A 4YRAA 5ADHA 4CLOA 5G0VA 5JMPA 4ZN6A 1QLJA 4MVJI 1X13A 3BTOA 4R5MA 1ID1A 3IP3A 1I33A 1B15A 1NVMB 2X4GA 2R00A 4A27A 2NQTA 3VPSA 5FI5A 3MTGA 4FFOA 4IQ8A 2QRJA 3GUCA 1EK5A 4DGSA 1HETA 3FF4A 3H7AA 1U2DA 4CM3A 4DBZA 5L51A 3BA1A 4OJNA 5I7VA 2VHYA 3K9QO 2FSVA 3AI2A 1U3VA 2GD1O 5JLAA 3SC4A 4OOFA 4DMLA 5JYDA 1JLLA 3DONA 5ES3A 1PJQA 1T25A 2WD8A 4CQMD 1N7GA 3I9NA 3LC2O 4JQCA 1R37A 2Q1WA 3I4CA 2UAGA 1QYCA 2J3KA 3HFGA 5L40A 4TZTA 5THQA 2BRUA 2Q49A 1WDMA 3GG2A 1X7DA 4B4WA 1OZAA 1XG5A 1GQYA 5A3JA 5F21A 5JC8A 4IDEA 1DOHA 2BD0A 5G2OA 2P5YA 4EUEA 3W6UA 4CMJA 2PGDA 5H83A 3WYCA 5TX7A 1QLHA 5LDGA 2RH8A 5DBFA 3WMXA 1A71A 3F6YA 1E3EA 2P91A 1L7EA 4XQ9A 1DHTA 2BGKA 4LRTB 1KBZA 3H9JA 3FNGA 1WAMA 4IJWA 2NVWA 4INAA 4GGOA 4BO1A 1IL0A 4BQPA 2O3JA 1PSDA 1VKNA 4PG4A 2X0IA 1IULA 5BSHA 3CIFA 4KWIA 2YY7A 4W99A 2H1SA 4LCEA 2A4KA 1XYGA 5L4NA 3DHEA 3Q11A 1OAAA 3WB9A 4DLBA 4TSKA 3JQ6A 1YONA 2H9IA 4N5NA 3BHJA 3V5NA 3F4LA 4BKQA 3M6IA 5A02A 2PZKA 4FBGA 4L74A 1JKIA 4E4YA 1K6IA 1VC2A 3LC7O 4R1TA 2EJVA 1D4FA 3HADA 2X5OA 1T2CA 2NVUA 3NGLA 2W90A 5HM8A 1M6WA 4PLVA 3PLNA 3TFQA 4QQRA 1DJNA 1PZFA 3G3EA 2BLLA 1P33A 2XPCA 4KTVE 3WIDA 4RPKA 4BS9A 1YDWA 3GY0A 3OJ0A 1GQ2A 1HDGO 4OSOA 4PZCA 3WJAA 5KJFA 4QTZA 1XDWA 2DUUA 2UYYA 5BNTA 2BFOA 1YJ8A 3JD2A 3CTMA 3QRWA 1ZKMA 2EKPA 1TT5B 4LRSB 4ZJUA 3MWDB 3HDQA 4LSWA 2LDXA 3W8FA 4ZRNA 1IE3A 1E7YA 5T67A 1GUYA 4FOSA 4BO7A 2G0TA 4HNGA 5IG2A 4F45A 1JWAB 5G4KB 2IZ1A 4DMMA 1DJQA 3RC2A 2DC1A 3VTFA 4EI2A 3PI7A 4OH1A 4IDGA 1I5RA 4B7XA 5C7OO 3TNLA 1EUDA 4KP7A 5DBGA 2Y1GA 3AUSA 3DAGA 5AQ1A 2J5RA 3D3WA 5F1OA 1GZ4A 2PV7A 1YH3A 4KDFA 2HUNA 1Y9EA 3QVTA 4Q3DA 2J5KA 3GHHA 4R16A 2BF7A 1YBMA 2X5JO 1MB4A 2X1HA 4ND5A 1NR1A 4J0FA 1DC5A 2V65A 5KJ1A 2IYPA 5ER6A 3ZWYA 3V2UA 3ETEA 5JE8A 3S2IA 1LU9A 1BDBA 4MIOA 4GL4A 2W2KA 4L8VA 3EVTA 4BNNA 3ZDFA 4ZQBA 1YOVB 2QHXA 3DBLB 3UKOA 2VHZA 5JW6A 4JK3A 2VZ9A 3NTQA 1DLJA 2V7PA 1HT0A 2DBZA 3O4RA 1PL7A 3GMSA 1HLDA 5A04A 4WLNA 3FCOA 1H5QA 3K96A 3SVTA 3WLFA 4E2ZA 1EUCA 3GRPA 1FXSA 1AHHA 4K26A 4XZ3A 5JBIA 2CVQA 5F1PA 3PTZA 2AHRA 2UV8A 2DT5A 3VZSA 1UXGA 3L77A 3ZV6A 2O2SA 3JQBA 2D5CA 3L6OO 4CL3A 4AJOA 2SCUA 4IIUA 3H3FA 4RPJA 3DBRA 4AG3A 4JJGA 3UH1A 1PS8A 1A72A 1QP8A 4PG7A 3A14A 2IEBA 3SLGA 3SBOA 3QY9A 4RDHA 3TZQA 2FR0A 1HF3A 4KQXA 3OECA 3PJGA 1Q0QA 3PQEA 1IYZA 2GERA 1MGOA 2I67A 4O0LA 3TZHA 4YAGA 4ZICA 1IZ0A 1JQBA 3AUAA 4LVCA 4DIFA 5DDIP 1ULUA 3ULKA 2QYSA 2O3TA 3WFIA 3I23A 4IDFA 2PH5A 5DP2A 5JXWA 2PTGA 3DMYA 4E12A 5IN4A 2Q2WA 2RBEA 3CPSA 2BELA 4Q3NA 2VOEA 2ZQYA 3ZU3A 4II2A 4PLHA 3DZIA 3GMDA 2PNFA 1NQ5A 4ALIA 2O50A 1C3VA 4HWKA 1R0KA 3TRIA 3RU9A 3ZCXA 2XXBA 4YDRA 4W9NC 1QSGA 1QRRA 5A1TA 1V6AA 1R0LA 1ZCJA 4E5NA 1NASA 2I5PO 4PGFA 1H93A 2ZB8A 1GUZA 2O3SA 3PFWO 1M2WA 1WDKA 3TOZA 5IJZA 4XQCA 3I9JA 2X9NA 2UDPA 3EYWA 3MCVA 3TSCA 4BB6A 4QO8A 3KYDA 1XCBA 3AJRA 4RF3A 1KVUA 3PPIA 1WDLA 3NT2A 4FGSA 3ETDA 3LC1O 5L7YA 2GRAA 2Q3EA 3CE6A 3GRKA 2HU2A 4BNUA 3RUIA 4PVDA 2OORA 1NWHA 3KO8A 2C29D 3DBLA 1JW9B 3GUYA 5IF3A 3JQGB 3RBVA 3MWEB 3VPHA 2DKNA 3EMKA 1BG6A 5G4KA 3GGPA 1I2BA 3A28A 4B3JA 5JO9A 3C85A 3R3SA 3JD4A 2C7VA 3DC2A 3G49A 3WS7A 1JU9A 3RC7A 2JL1A 1UZMA 1U4SA 1V0JA 2Y1OA 1E3JA 4IQ0A 4NU5A 4OOEA 2CY0A 4MVJA 3PK0A 2FHSA 2HLPA 1B3BA 1PJCA 2CDAA 2NWQA 4IDDA 2I76A 4RVDA 2PZMA 3O38A 4XD2A 4N7RA 4IZIA 1XELA 1LRLA 1CF2O 3NDIA 1Y5MA 3NX4A 1FDTA 5K6AC 1NQAO 5L53A 1SEVA 3F4BA 4BGVA 3C7CB 4IS2A 1LQTA 3C1TA 4O1MA 1Z6ZA 5I9LA 3QWIA 1F8GA 2OGUA 2YW9A 5TRTA 4YWJA 5C7IO 4HXYA 3GVPA 4NBUA 3GVXA 4D3FA 2D59A 4DL9A 2RIRA 1JKFA 3KLPX 4W4TA 3RCBA 4BB5A 1VJTA 3KVOA 3QVXA 1LC3A 3WX0A 3F47A 4IJUA 4KUHA 2BKAA 2GZ2A 3EC7A 3HDJA 3GZNB 4YRDA 5EINA 1Z7EA 3PVZA 1F0YA 2DFDA 2FN7A 1N9GA 4GI2A 2EP7A 5B12A 3HB5X 1HL3A 3OA0A 1HYHA 2YQ5A 4EJ6A 4WCFB 4TVOA 1LQUA 4L4XA 3A4VA 3NAQA 2X9VA 5K0ZA 3S55A 3WBFA 3OJEA 3HN2A 4ZD6A 5H82A 2LDBA 4K9DA 4NR0A 4D42A 2Y1CA 4BQRA 3U4DA 1Q0LA 2BMAA 3Q2IA 2HMWA 2BHLA 3WTCA 1MLDA 3ITKA 3W6ZA 2G5CA 3WWZA 3DHYA 2WJPA 1MC4A 2J5QA 4XR4A 1NWCA 5TT1A 5IFLA 4CV3A 4H7PA 1GDHA 2GR9A 4F3YA 4HP8A 4MKRA 3WSVA 1I30A 1SC6A 1HDZA 2C20A 5TT0A 2I3AA 5CDYA 5ICSA 3DMTA 3MOGA 1XQ1A 4GX5A 5G0UA 4DRYA 2ZK7A 3H6KA 4KOAA 4OQZA 4BMSA 4MP6A 4B4OA 4UREA 5L7TA 2O3QA 2ZIZA 1I36A 3L0DA 4I9UA 4I5GA 3H9GA 4MOWA 1YL6A 5IZCC 3KSDO 4YQZA 5FI3A 3MJCA 2DVMA 3V1YA 4XKJA 4II3A 5LDHA 1XHLA 1FMCA 1MXFA 1ISIA 5KJEA 1ADBA 4MINA 3CKYA 3DTTA 1GZ3A 2QRLA 4I5EA 4BGEA 2O4CA 3EVNA 2PK3A 4OHUA 3ADPA 1PR9A 1PWZA 3E9QA 4J4BA 3HDHA 2IRWA 2NU8A 4YRBA 5IDQA 3GEMA 3QP9A 3MZ0A 5T8KC 1NQTA 1D8AA 1EVIA 1Q0HA 1VJ0A 2JFFA 2WTBA 2P5UA 4YA6A 1WZEA 3EZLA 2OP1A 1EVJA 1EDOA 3TZKA 4IDBA 4U7WA 4JBHA 5JDCC 2NU9A 2GASA 2RH4A 5AXAA 4AJ4A 3H3JA 2Y68A 4GX0A 2O7SA 2J3IA 3DXFA 2YJZA 4XQEA 4J49A 1NYTA 1ZMTA 2F1KA 3VOSA 3NV9A 1U3UA 4FJ2A 5A3VA 1N2SA 4J2OA 4CLEA 3PEFA 3DQPA 4BNMA 1LSSA 3AU8A 3UF0A 4DYDA 1QKIA 3RSHA 3JYLA 1JA9A 2FZEA 5JMWA 1Q1NA 3PFFA 1WWKA 3Q6IA 1XGKA 4LN1A 3MOIA 1X0VA 1E3SA 2VUUA 4IJVA 1FDWA 4XA8A 3MJ4A 3DFUA 2NTNA 3RU7A 1GV1A 3U49A 3UN1A 1XIVA 2EEZA 2GNAA 3Q3CA 4TKLA 1Y5RA 4UEKA 3TL3A 5CAEA 1WMBA 1SPXA 3NTRA 2P4QA 2VZ8A 3JD0A 2DAPA 3QLJA 4XYGA 1SOVA 5JCXA 4FJ0A 3JD3A 3K73O 1N9GB 3OFSA 1U8XX 4JN6B 3UHAA 1SEPA 5DT9A 2ZB3A 4RVSA 5TJHA 4A7PA 4EITA 1X7HA 4BV8A 1CIVA 3AW9A 3ZNNA 4UEJA 3CMCO 4R68A 5DCWA 1GADO 3B6ZA 3AOGA 2NV6A 1YOVA 1ISFA 2RCYA 3DZJA 3ZNPA 2C0CA 4PCVA 3BMCB 1DB3A 2IXAA 3DOOA 3Q9NA 3DZKA 4ALJA 5TSDA 2VN8A 5BR7A 3GGOA 1MP0A 3GN1A 1DIGA 1YL5A 4LCJA 4BMVA 1LLUA 4XWYA 1E7RA 3FNFA 3ZWPA 4D41A 5JDIC 2CFCA 4R5HA 3GAFA 4FSHA 1T1RA 3JQAD 1BXGB 3FTPA 3QWAA 1GPDG 4Q9NA 4BO4A 4NG5A 1FK8A 2H63A 2VZ0A 2ZB4A 3VH4A 1Z45A 4IMRA 1YWGO 4ESOA 4NBRA 1LTHR 1XU7A 3LLSA 4BNWA 4DUPA 1VE9A 1DSSG 3S8MA 5KKCA 4G65A 3KXDA 4RO0A 4YJHA 2EXXA 4RQUA 5GY7A 1TI7A 2FP4A 3AFNA 5FFFA 3ZWWA 4J4TA 1ZFNA 2ZYGA 2YV1A 3N58A 2FZWA 4U6QA 2ZQZA 4XYBA 1RWBA 4ND4A 5A06A 4GMFA 1RM5A 2WE8A 3IKTA 4FR5A 3M2TA 4RL6A 3F46A 4BNXA 5GZ3A 4XQGA 3W1VA 4B4UA 2QYTA 2JJYA 2Z95A 2JHGA 4I1IA 1KEWA 4BO6A 4YYZA 3PZRA 3PHLA 5MDHA 1HYGA 5I7SA 1C0LA 1P1FA 1ENOA 2J3HA 4PG8A 3I4FA 3OIGA 2WD7A 3JQCA 3WNVA 3K2EA 5JAZA 1TEHA 3UUWA 1HZJA 3WLEA 1OMOA 2I9PA 5A9RA 2NNLD 5CP8A 3S1LA 1P1IA 5U9CA 2OUIA 4PLCA 4NDNE 2ZTLA 3GR6A 1HDOA 4JX8A 5U4QA 3RBZA 3PIIA 3B20A 3KSUA 3D1LA 4A5OA 3OIFA 3RFVA 3PGJA 4FIZA 5C3MA 1NHWA 3RI3A 3K6JA 3EHEA 4P38A 4U0KA 5CDSA 5KVCA 3DOCA 1PGJA 1B8PA 2WWRA 5DOZA 1ADCA 3GDOA 1CYDA 3BMQB 4Z9YA 3OEWA 1X1TA 4OGWA 4EUHA 4JP3A 5F1KA 4CUJA 3B1JA 2CZCA 1I8TA 2HJRA 2WEKA 1LDMA 5L7WA 1UDAA 1CERA 1EQUA 1LRKA 4CM9D 3E6AA 3JQ9C 1ZMOA 4PZEA 1E1MA 2ET6A 4ALLA 2OOSA 1E6EA 1P1JA 3B1KA 4BNGA 2NU7A 1SO8A 2A94A 1YS4A 5JNLA 5IXSA 3FR8A 4RJTA 5JY6A 2Y05A 2AXQA 1VL8A 1Y6JA 1OC2A 1F14A 3W8DA 1ZNQO 3PDUA 3QVOA 2UVDA 1FDSA 1E77A 2VHXA 4ZU3A 1V3TA 2WDZA 4CM7A 1KEUA 3WGQA 1ZSVA 2B4RO 4D3DA 4X54A 2ZCVA 4Y6PA 2X0JA 3EK2A 1TB4A 2FPIA 3LK7A 1YO6A 5A5FA 5EQFA 4CQLB 4YT4A 4CJXA 3GQVA 1K89A 3BMNA 3BMOB 3I9OA 4FOOA 1BHSA 1Q7BA 2VYVD 1TT7A 3LLVA 4C7JA 1PJSA 2GDZA 4NBVA 1H6BA 3RROA 3TOXA 3VAZA 4Y98A 2IYOA 2TMDA 4R1UA 3PIDA 3I9KA 4JCOA 5HWSA 5KJ6A 2OBNA 5BQFA 2PH3A 3LF1A 2AEMA 4IIVA 2QZZA 4M1QA 3ANLA 2Q1UA 4QSMA 3U3XA 4DIOA 2QIOA 2VWQA 3WSWA 4CLHA 1KVTA 3KZVA 4L4RA 1NAIA 5KWEA 3M1LA 2X22A 3ITDA 1MG5A 3GNSA 4AJPA 3FD8A 2E37A 3NTOA 4CMGA 3AUTA 3OJLA 1BXZA 3GF4A 1KEPA 4R4JA 4QT0A 1LEHA 4F6CA 1NTOA 5CG2A 4OKIA 1I10A 1PU2A 4WLVA 1L1FA 1UZNA 2QZ9A 1BW9B 2DU8A 5EN4A 4FC7A
chains in the Genus database with same CATH superfamily
1M6VB 1TCAA 4NZYA 2K7FA 4D6PA 1T4CB 4ACAA 3BD9A 2R85A 5KU7A 1O57A 3GCXA 4JB8A 1SKUA 1XQ9A 1DAMA 2ETVA 3BOSA 3CVWA 2W4MA 3QXHA 1H6DA 4RM3A 4BVAA 2GN9A 2PZAA 5K1ZA 3W3AA 3MINB 4Z4EA 5FV4A 1PF7E 4O4IF 1H66A 2XBMA 4R3UC 4EBBA 3H5RA 4NH4A 1NOJA 2ZGVA 3G13A 1TFUA 3G2IA 4LYJA 3ZUGA 3ROFA 5K3BA 2BKUA 1OH5A 2R65A 4RJLA 2GO1A 5JMTA 1IHXA 2B7CA 4UFOA 1ENZA 1QRDA 2FWPA 4OD0A 3HQ4O 4WI1A 4TTRA 1I4DD 4I46A 4I0WB 2I33A 4L2IA 4NYIR 1U0FA 2AN3A 3CGGA 2POCA 2DWUA 3EOBI 4DT1A 1NW9B 2IPOA 4OXNA 5KQPA 5I9MA 1N8NA 2VJLA 3C8DA 3S0JA 2YDXA 1S8NA 2CV1A 4GMGA 4YJ3A 1W5EA 1E2UA 3OF5A 4CN8A 4BKPA 2NADA 5C53B 3PR3A 4LEIA 4KWEA 2FEKA 1JJIA 4P83A 4WK6A 2VJBA 1HT1E 4QAQA 4NYJR 1XF9A 3AX6A 1EMDA 1XTVA 2BFMA 2R6ZA 4MUBA 4RVUA 4YJ3F 4KIGA 1QX4A 4A26A 4C9BA 1R5BA 1R4NA 4TROA 3U09A 1J49A 1O94A 3LD9A 1ML3A 4IOMA 3Q7RA 2VWHA 3IDFA 2Z9DA 3EPRA 1HE1C 5JXHA 5LOVF 2X0KA 1YRWA 3EVDA 3QQPA 1MO4A 3DCIA 3DBRB 1XXHE 3IJRA 1HWYA 3I6BA 1W9MA 7MDHA 2DPXA 5CDFE 3VR2A 3NVKI 1TKAA 4MROA 5J5AA 3EFBA 3U3DA 1JEYB 3PXBA 4QUIA 3VU1A 2WWXA 3MCAA 4C7OA 1TC2A 1YF3A 2Q41A 3JZMA 3VPDA 8LDHA 1BKYA 3ZLUA 5KDDA 1Y9JA 4MQFA 1RFGE 5AW2A 1NZFA 3ND6A 3WV5A 4ETIA 3NM6B 4QGSA 2IIBA 4L0DA 4KTTE 1VRWA 5IWCA 3TSZA 2ZRDA 3TLGB 1RBQA 2FFRA 4UMDA 4DF3A 2ATIA 2CHUA 3WDSA 1QIDA 3MJVA 3RU2A 4CODB 4R3WA 5A0VA 1E5TA 4JBWA 2JZNA 3X1XA 4HZGA 2PUTA 3T7EA 1BE6A 1T2AA 2UZIR 4JI5B 4DSNA 4LRQA 4IICA 1BWRA 1I0ZA 3S8YA 2HRZA 3ZBUA 1L7NA 3G7UA 4EW1A 2XRZA 3MWKA 4J9VA 4YRGA 1MAUA 1CQPA 1T5DX 3LCJA 1P3Y1 1MEEA 2CMKA 1R18A 3MTIA 4DJDC 3W9BA 3ZLVA 3QVVA 2C42A 3LT1A 4H6WA 5C32A 1GTJ1 1C81A 4QVKA 3RARA 4XJVA 3FVQA 4UE3S 4ZJZA 3NTUA 1EFCA 4AMYA 3QA3E 4B2IA 4XGRA 1LRJA 2V6FA 1RZ3A 2E48A 2V98A 1DHRA 3H18A 4L5YA 5JIBA 2HA2A 1EZZA 3I4LA 4ZYVA 1GPWB 4BMNA 4FMPA 3CUKA 4TQAA 3EQ8A 1EA5A 3N3BC 2ZPUA 2YCLA 4WBSA 1Z5PA 1Y34E 4BMYA 5FTLA 5E2BA 3CNQS 4GYKA 5D51S 2Q6OA 3CJQA 4FS3A 2NU9B 3VYUB 2VJPA 3G6KA 3SE7A 5AKIA 3DMTC 1EWQA 4FR2A 4TSFA 4WKBA 3SXPA 3A9CA 3RK1A 3FOBA 4IXTA 4D4LA 3ROQA 4Y9TA 3VZDA 4D81A 5ALSA 3VU0A 3BDAA 1IPFA 1KQOA 2OCBA 1CP2A 2Q2QA 3IAM1 4P4NA 1G98A 1FUUA 1N0UA 5IZCA 3OQMA 1TVKA 2BFPA 4IYJA 1NY5A 4N9QA 1K8YB 1TXGA 4OU4A 4UUQA 3I61A 1B2LA 4X95A 4Q9HA 3E84A 4J43A 4B76A 1X80A 4FKZA 3E61A 3R7WA 5DHAA 2D2IA 3KKQA 3T54A 3LZCA 4LECA 1C14A 4YECA 5JJLA 3VR5D 4MDEA 1A1SA 4JX9A 4LOJA 1QGED 2R6JA 3O8OB 3GJXC 4RELA 4WW0A 4YI3A 1IBCA 3B8HA 2C5EA 3O90A 4UPDA 1MTZA 4PINA 1FBTA 5KTRA 3G9QA 1YKGA 1OAOA 2CLSA 4F1KA 3S8EA 4GR5A 2CSUA 3A36A 2HZ7A 5L6MB 1NJ5A 4QBIA 1DX9A 1MVNA 5J2TF 1YC5A 1U2SA 4PQYA 1NSYA 2QT0A 2X0NA 3P9PA 3MRSA 4KUGA 4L3OA 2C9DA 3C3YA 2HRQA 4GM1A 5A4AA 2E1PA 1QYWA 1SA0A 3A04A 1IBRA 5BWCA 4BZZA 3AETB 1A8HA 1Q84A 1QCDA 3KT3A 2GAFA 4WBNB 4MGEA 1R4MA 3ECSA 4LGMA 2NSYA 4FXOA 3G1WA 3WZ2A 3CH5A 3OOYA 1FX0B 1UMCA 4XGQA 1QJCA 3A58B 1HO3A 3A1VA 3DTVA 1J7KA 1DRUA 2ZAMA 3UVEA 2EZ8A 4AP5A 2PX5A 1E4YA 4CLDA 3L0IB 1XZIA 4ZC8A 3KR2A 4X44A 4A36A 2J67A 3LUCA 2VHCA 1X15A 1ULSA 5FQNA 2YIDA 5K01A 1VKZA 3LT0A 5CITA 3IUSA 2G4VA 4LF4B 1DPGA 1P7CA 4FBMA 1J0XO 1U8YA 4K6FA 2Q4DA 5DTJA 3V8VA 1SM4A 4MWEA 2XWBF 3KTAA 5TF0A 3EVEA 1VKHA 3F5SA 2C04A 2JFHA 2EYUA 5D3ZA 2F8TA 1JHPA 1OX5A 2JFXA 3IP1A 3K6KA 1EGMB 2FVXA 2G88A 4IOJA 4LPSA 4LTNA 4PZUA 4Q47A 1SXQA 4AN4A 1C29B 1XZHA 3BF7A 4NV0A 1ODTC 1TF2A 3GLGE 1HE2A 2IA5A 1XI2A 2Z4RA 3U1TA 3Q8MA 4S1WA 2GPBA 2FFBA 2FZLA 1B26A 2ZSKA 3P19A 3RKSA 1R9GA 5YASA 4RYLA 3T7CA 1TX4B 3P0IA 4E09A 1PZGA 4D96A 5C8YA 1FDOA 1E1QA 2GXQA 5JEDA 3ND9A 1JHYA 1E2JA 1SUPA 3ENZA 1F2DA 4IL5A 3A4LA 2W93A 3OJFA 4B3BA 4KQJA 2QZPA 2QPAA 2XECA 1K7CA 1SA0B 4ISBA 4YJFA 2Q50A 1N25A 3K9LA 4G0UA 1G6HA 3U19A 3TXXA 1DO2A 5TVGA 2CLLB 2XGJA 1X80B 3KAPA 1SOMA 4D7AA 1LLQA 5FEUA 1JH9A 2JCYA 3ONFA 5EQDA 4EKDA 4ZARA 2P77A 2OD9A 2OR3A 1P3JA 1ODFA 2DPHA 4M0FA 4O5AA 4ER3A 1JB1A 1HC7A 4Z6KA 1KDOA 3O9MA 4F5ZA 4LZAA 5BORA 2YV4A 1Q22A 1Q3TA 1WP4A 3HFSA 4D8UA 3K32A 1XRSB 3P4UA 4GBJA 4JGBA 3ZZMA 4PXAA 2KPOA 4PTYA 3EULA 4DEVA 3ONWA 4MRPA 2RH9B 2G3YA 3FZQA 1ZZEA 3O93A 3NBYC 1FQOA 5B55A 3A26A 4V02A 2B5WA 4URFA 3GGCA 1NRWA 4RVFA 3A3KA 4R0VA 1CIPA 1OPXA 4UBOA 3WLOA 4B7AA 4OI0A 1S7GA 2F1HA 3IBFA 3OMWA 4JLPA 5DHTA 4L1KA 1I1OA 2PT6A 4US0R 2IV3A 4ZDIA 2HPZA 1E2GA 2AE1A 1LBQA 2DF8A 3L4SO 4MPDA 3LVFO 4BQFA 2IYUA 2VDPB 2XEXA 3BIOA 1TPZA 3HB7A 4JB0A 4PYRA 2OG1A 1JHUA 3KKPA 2D2XA 1DC8A 1V3QE 3Q7EA 1NW5A 1EX7A 1HI9A 1TMOA 2NU6B 3K53A 4Q39A 3T3DA 3UCXA 3ZHOA 4AKEA 2YDYA 2P69A 3ICPA 2FY8A 1RZRA 5FD8A 2R4UA 1EHYA 1VL2A 4UUMA 4AL4A 3OPMA 4JQYA 4N01A 1QQ5A 4QATA 4XDHA 4RCVA 3LYLA 5CT9A 4BUJA 1KERA 4GR9A 4CMAA 3TG2A 2BFDA 4DMHA 4X62B 3KEOA 3I5XA 2D0PB 3QFCA 5A3QA 2EIHA 4QARA 4BMXA 4EAAA 5CEFA 3UCEA 3FLEA 3WYNA 4BJHB 4P7JA 5AHWA 4EGAA 4WBNA 3ILVA 3LPAA 1ZRSA 3AF4A 3P5SA 1S2GA 2C2KA 4CIDA 3BCHA 3LRTA 1IM2A 1H0SA 5FWXB 3PT9A 3BL6A 5CEEA 2VK8A 1DXOA 5H81A 1U2QA 1ITZA 4H3VA 1WNFA 2W8BA 3F96A 3A6PC 3NB0A 4E14A 3HDYA 4CG2A 2VQDA 4EB6A 5IJ9B 3ADCA 2ZRCA 4TKZA 3R0JA 5I45A 1U2GA 1JQDA 1BEEA 1I7LA 2HBYA 2YV3A 4O6VA 5JI2E 4CEIB 3MRTA 2NSHA 2PG3A 3IE1A 2IEDA 2CEKA 2EEPA 3OMLA 2CHVA 4WEOA 2ZRKA 1KEEB 3DAYA 3QENA 1V16B 3LRPA 3CR8A 1RABA 1OROA 3PKZA 4LVOA 3T3IA 1VGVA 2VPWA 4J0CA 3GCWA 3OY2A 3I6YA 4JI7B 1AS0A 3UICA 1G3RA 3ND8A 3B36A 3H8JA 4YJGA 3FMOB 1R66A 2I4MA 3KC2A 1NF2A 1R7RA 4IRMA 4FLFA 1L8AA 1EIZA 2XVXA 4W5JA 2G9ZA 2O57A 1OBOA 3FDZA 4N54A 4XGKA 4UU1A 1XT6A 4NMHA 3S5UA 5A5VA 1U2GC 3F8TA 4LJ6A 3KTFA 4AY4A 2H92A 2FZVA 1VG0B 3HA5A 3QPCA 4OXRA 5AXCA 4KW7A 2G7ZA 2J48A 5LIRA 1WX1A 1ZZGA 4M0UA 3QEMA 1HX7A 2I3GA 4ECAA 1NDQA 4WCFA 4NAUA 2OXTA 2ZIAA 1M1XB 3RQSA 3E2IA 4J91A 5FDFA 4G5RA 4OM8A 3AF6A 2PSSA 3G0HA 3N1UA 4MRAA 1CY2A 2IBSA 3V2GA 2EAUA 4FDUA 3EGOA 4NCIA 1Z0IA 1GZSA 1HPLA 1W52X 3KYBA 3O26A 4X3OA 5HQ3B 3I62A 5ITWA 1QLWA 1VLLA 3A4NA 4ZGWA 3LHKA 4EW6A 2E7ZA 2V7WA 4NS1A 2Q5FA 4BNLA 2E85A 1JDPA 2HO5A 5AUQA 1SUIA 2OP0A 2RHCA 2ZVQX 4R1SA 4E13A 4TMKA 2X7HA 3HA2A 1EXDA 4AI6A 3RSZA 1K5HA 1UDRA 4DCSA 2F55A 1V9SA 3DYVA 2CFRA 1Y81A 2H06A 3D6TB 5EE9A 2V3VA 5BUQA 4TMXA 1AGPA 1R8XA 2OL4A 1K98A 2DY1A 3LPNA 3WGZA 4DEYA 2XMDA 1JG4A 3L7KA 3LBAA 4H08A 1B0AA 4Y6SA 3VC7A 1FMLA 4F60A 2GM3A 4RDCA 5K0CA 4OQ4A 1UJ5A 2F43B 3B2EA 1NBIA 2ALJA 4BEVA 2QTZA 3VR4H 5TIIA 4NMXB 2Y67A 3HJCA 4C14A 5HVNA 2B61A 3ZE7A 3K71B 1XLVA 3FROA 4Q6WA 4O3FA 4B6SA 4ZCRA 1B4DA 1CHNA 1NPTO 4ZYWA 2GBLC 1YTLA 4KAAA 1TIKA 1X39A 4NULA 4DAOA 5B5SA 2BBTA 6Q21A 2Q6VA 1CQJA 2J08A 1WQ3A 3L4BC 5BYAA 1OXXK 2Z4SA 4PHFA 1AN0A 3HWRA 4I9FA 5C5CA 1ULTA 1MX5A 2NTJA 4DNPA 1X19A 2P68A 5JS6A 2GZSA 2OZPA 4RANA 4RSMA 4EF5A 3QE9Y 5KVSA 1TM1E 3TLEA 1J5EB 2QJWA 3GVHA 3G2MA 1DBVO 1DWOA 1GG2A 5EWLA 2XSZD 4FYYA 2B34A 1SURA 3CZ9A 1PJ4A 5K0LA 4ZQEA 1I13A 5A9SA 2Y77A 4XCVA 3QUAA 3NT5A 1IQUA 3TLBA 4FQ8A 4BLRA 3FCAA 2HY7A 3U4IA 1T1JA 4FYIA 1HDIA 2Y0CA 3OX3A 4L3WA 1CP3A 5AD1A 1S96A 2ZT7A 3U26A 3ORYA 2F9MA 2V4UA 3F97A 1BE0A 1GFWA 4X94A 4LFAB 4KN9S 1YBAA 4F06A 4MQLA 4HNUA 1K9VF 3R9KA 1ZK4A 4NABA 1JVSA 5IYZB 3AEQA 1CEXA 2EFHB 3QUBA 1E7WA 4EWLA 1N2OA 3RC9A 3K4HA 1W9HA 3LX5A 1R16A 1NRIA 2WUEA 2PUWA 3FHOA 4H4DA 2EZ4A 4L8YA 3V1TC 2W6ZA 3H4TA 2J6HA 2VQ3A 5TQVA 3KE8A 3BJEA 1J2JA 1JYFA 4FW8A 2FDCA 1YQWA 5BWMA 1JR6A 3UH0A 1P62B 3KT6A 5CNMA 521PA 3A6EA 1PFWA 3OLYA 1AGXA 1NG9A 4PIVA 2GO7A 2JCXA 4NTZA 3I04M 5CA1A 4MVJF 1FFBA 4R69A 3C24A 1H6AA 4OTZA 1M75A 5ALVA 3KWLA 2DHQA 2R8XA 2WIGA 3G7SA 3F8WA 2P9FA 1RWKA 1JR3A 1B43A 2OB1A 1V3UA 4JI6B 3MTQA 4YRJA 3SYRA 4F6RB 4ENVA 5F2KA 2A59A 4MYRA 3PNSA 2AI1A 3LVQE 1KK2A 5LP1A 2WKQA 4CMEC 3MBOA 1J0BA 1ZJJA 5DI3B 2BMFA 5TPZA 3RVKA 4P3PA 2BE7A 1ML4A 3FI0A 4GKBA 1TK2A 5B1IA 3RFXA 4JC0A 2ZPAA 2W2LD 1UP4A 1BQ3A 2IXBA 4QOSA 1JIVA 1BD4A 2Z2XA 5CDGA 4FFNA 3PEWA 1BN6A 4C03A 1V5GA 4POAA 4JP1A 3TR0A 1UT5A 4Y0VA 1I3KA 3OT5A 3CQ9A 2VQFB 3G0BA 2HV8A 3HEAA 3MJEA 3O0TA 4FOLA 1JEQA 2I3DA 4O1IA 1ZPDA 1NLUA 3ZQKA 3AZPA 4LK2A 2F8SA 2G07A 1RAIA 2ZKLA 1L7RA 4R2JA 3EAQA 5MGBA 2WA1A 5KWSA 3CM0A 4NMWA 1W94A 2IYAA 4N47A 3EAFA 3ICOA 2XDWA 4KXWA 3WVNA 2HJSA 1N75A 5AVKA 1HLFA 3KP1A 1LTKA 4AMVA 1U0OC 1IRXA 3AR7A 3UFXB 3R9XA 4GX1A 4N6GA 4I2NA 4W6QA 5B37A 3RAJA 5BVGA 2TMGA 1UT6A 2IYTA 3ACBA 1FYFA 3OEYA 4UU7A 1ZLYA 2N46A 3GLTA 3L7BA 3QKIA 4G0WA 3CF4G 3JYPA 1JR4A 2I7XA 4M49A 3TWOA 3UUEA 4WXYB 1FP7A 2HA6A 5JTTA 2B37A 5CVTA 8ADHA 4LPKA 1NW7A 2J0UB 1PFUA 2REQA 2F00A 2ZOSA 3BYZA 3DAPA 3PSHA 2R00C 4TWBA 4C0JA 1XVAA 3QV1A 4V0KA 1DC4A 421PA 5LJIA 2PUBA 1GPLA 1UK6A 3M6UA 3DVAB 3SQMA 1UFRA 4BZXA 3RVLA 1WXIA 1OE0A 2YZNA 5ANRB 5IAEA 1KFCB 4CV2A 1CK4A 3EN0A 5BXYA 2HHHB 2IDJA 2IS2A 2ODAA 2P3SA 2VYQA 4UC0A 2MSDB 2NOAA 2GCOA 3G9UA 1W5SA 2PUVA 3VYRB 1W47A 2IXDA 1P73A 2X5KO 3B7WA 3IUEA 3K6RA 3HKBA 3L3BA 3L8GA 1OC4A 3J7TA 5DLEA 2EFCB 5THXA 2CXHA 1G9SA 1M0SA 2A58A 1FXWF 1E5QA 2FMUA 2OFFA 1AUPA 3WRYA 5AT1A 4BFYA 3CT6A 1KR2A 5K4AA 3A3PA 1YMQA 4NZNA 2PH1A 5DNAA 3RS7A 2NXEA 3OIDA 4M3NA 3ZU6A 1G0NA 1G2PA 1SH7A 3E9EA 3K5IA 4NE9A 4DLZA 2CF5A 4FYPA 1DC6A 2FE1A 4MCHA 4IHJB 1W36B 2R79A 1HLPA 1L5YA 1RXYA 3RS5A 2WHPA 3IIEA 1HM5A 2V54A 3B1ZA 3SEFA 2IC5A 3ZLBA 3GFTA 4FHDA 6CHYA 3BH7A 3QPVA 4F2WA 4LXYA 2OV6A 2FWAA 2Q0HA 2P2SA 3HVHA 4IM7A 2FMXA 1QBGA 1QGZA 5ELLA 1CUAA 1N4DA 5KX5A 1T13A 1U2RA 2BM0A 4D99A 4MDFA 1VJCA 2HQRA 3R5TA 2Q2OA 3VO9A 1E3IA 3N70A 5CX1B 1V8BA 3DUFA 5FH9A 4U5QA 1U8FO 2JNWA 4YRIA 1VCOA 3GI1A 2NO5A 5D5HA 3SSNA 4U7FA 4DCJA 1Z15A 2IXEA 2LNDA 3BXFA 3EODA 4JEUA 4KIWA 3WGTA 1U4NA 2ADMA 2ODTX 3L02A 4H4EA 4A03A 2O8DA 4FYJA 4QO7A 4CFYA 3E48A 4DR6B 5SV2A 3KVNA 1A4UA 2GBIA 3EFOB 2NTVA 3WWYA 1ECCA 3Q0EA 5KNLA 1G5RA 3KBBA 2FTKE 1B2RA 4BVFA 1Y42X 3F71A 4CF5A 4FT2A 2ZYAA 1EP3B 3SICE 2Q99A 4LSZA 4UPEA 1V5FA 1UKEA 1PR5A 2GPWA 1JJBA 4HDMB 1ZCAA 4OMCA 3JX9A 3VRHA 1OFGA 4TVBA 5ALFA 1UMDB 1Y6QA 2G1PA 1XK7A 3IRVA 3PE4A 1IOWA 2VPZA 1ADFA 1FNMA 4P2GA 4QDOA 1U6IA 1Z88A 3BTSA 1B6RA 1G9TA 1WG8A 2V96A 3HUTA 3PCXA 3ZV7A 7ADHA 1ZO8A 3FRIA 1N77A 2PKEA 4NLLA 2HGSA 4XIYA 3AVUA 3ROMA 4DB2A 2RK3A 1FFCA 3LLMA 3VYVA 2BGUA 1ZESA 1DBQA 1GAXA 3A1NA 5TGZA 2YV5A 4JYCA 2RHTA 1NVTA 4AJIA 1MHTA 3UG7A 2UXBB 1XZQA 5LP6A 3UMRA 3IMFA 4ALMA 1XUOA 2HWKA 4JGIA 3UMYA 4RKQA 4EB3A 2GRJA 5BNFA 3AZOA 2FOLA 1VLMA 4KQMA 3EQZA 5EPOA 4V0LA 1ZXLA 4FE3A 4B3HA 2P5SA 3WK8A 4LGCA 1GCGA 1HE3A 1MO3A 4IF6A 3MT8A 3H5OA 4QJ4A 4TTIA 2IQIA 3NHZA 4NV3A 5EJFA 3RUAA 3WV4A 1NVGA 4AF6A 4B3SB 3NNDA 4RF5A 2HQSA 4YK7A 3W2IA 4HH0A 2FPGA 2QL6A 2F1OA 5E9WA 4BTVA 4DY4A 4PN3A 3TECE 1TO1E 1JFFA 1XC7A 4IJMA 3WNZA 4D74A 1SKBA 3ICCA 2YIJA 3LT5A 4Q48A 3QI2A 5G1OA 3MB5A 2E4AA 4GP6A 3LE8A 4FGLA 1PEKE 1N3YA 3E5HA 3PPXA 3SYLA 3B3AA 1JJVA 1EJ6A 2ZYIA 4IUDS 3EXFB 4FW9A 2H29A 2QWXA 4CMEA 1SVOA 4CUZA 4N7JA 4K40A 4B71A 3SXUA 2QRUA 1T2NA 4FUTA 4PZPA 5E6RB 3SYKA 4DTCA 2G76A 3R4CA 4O2AB 3VR6D 4OBEA 1ZMBA 2BTEA 1VCHA 1QV7A 1AUXA 3IOBA 4LJ9A 1GV0A 1E58A 1XZBA 4O1HA 4V0RA 4EB6B 2JCSA 3W90A 2O8VA 4TWZA 4U8GA 3RYCA 3HYLA 1IUKA 1FOEB 3JWGA 1QZXA 1F8YA 2JI9A 5I8WA 3RLIA 3E22A 3NDJA 3PYMA 1D5CA 3BM5A 1KH2A 2JEZA 1RRVA 5H16A 3HVRA 2PQMA 4AWBA 1H3NA 1JG2A 2HRCA 1XTUA 3FZNA 1YJ5A 1D4ZA 1Q0PA 1W85B 3RG2A 3SQWA 4EA6A 2AEJA 3EQ6A 4L6IA 5EHQA 5BUZA 4FM9A 1IOZA 1F0NA 1IDOA 2BMVA 2PRSA 3HZZA 3UNXA 5DVZA 4XLZA 3O6VA 1E1DA 1XTIA 3CF4A 1J2RA 3DOHA 4K28A 5D7BA 5I6DA 4ZTUB 1EM8B 2FGKA 1CJCA 1RTTA 3P9QA 1LUAA 1XRJA 2QDKA 4RETA 1HG1A 5F5XA 3RIEA 3VZRA 3ADBA 2D8AA 1P5RA 5KSZA 2X77A 3HLTA 3SDSA 3RIYA 4A9AA 3Q8KA 2QDXA 4ZOLF 1EG2A 1Q77A 1EDDA 2NQ8A 1HH4A 1ULZA 2G9UA 1GTZA 2OHIA 3C6BA 3GAAA 1O3YA 4HAXA 4EYOA 2OO5A 3AERB 4GZ5A 4F86A 3MWJA 4L5IA 3HBLA 2YJ3A 4JJAA 1BX0A 2P6OA 2R9VA 4RPIA 3UMBA 2IZZA 4FP9A 4JZKA 3V2IA 5DP1A 4XVCA 3FRJA 1PW7A 3RWMB 3UW1A 3N8IA 1T36B 1XD2A 3DDNA 2WHQA 3DV2A 3GD7A 3H8WA 4EENA 1VIDA 2H4FA 2Z4TA 3W77A 2FN8A 3LUHA 4FHZA 3FNBA 1L6IA 5EFOA 4AJLA 4DDMA 2FW7A 5A7GA 5HKKA 2AQIA 1Q95A 4N0PA 1FPMA 1ONSA 1QC5A 2JAHA 4BO8A 3ZHXA 3AYXB 4QOGA 5G0WA 3VPXA 2HRRA 3QEKA 4PSDA 4W5TA 3PDWA 4P54A 2JKVA 3T4EA 1C9NA 1V8DA 4M0MA 1J9EA 5FHQA 3DE5X 4BQQA 2CHEA 1IB6A 4AROA 4QGGA 1USWA 1XALA 4XM2A 3RSCA 3VV2A 1N7JA 3PE3A 3NUGA 1SHJA 1TYDE 2ZRLA 2J0EA 4B3IA 4DNQA 1MO6A 1WMEA 3DR5A 4F1WA 1FIUA 3D4NA 1RZRD 2VOJA 5HF8A 4LZOA 5IDWA 5DASA 3B51X 3NJ4A 4HSGA 4E21A 5IX8A 2EATA 2W2KB 2IEAA 3EFEA 1GJRA 1XEWX 3NIGB 4YAEA 5C8YB 5C1OA 4GSLA 3IT2A 4H0NA 1WNTA 1UF9A 1T4BA 3OIWA 3RC1A 3REQB 1PVVA 5HRUA 3B9RA 2H2DA 1I2ZA 1QF9A 4NSNA 1L5GB 3SN6A 1C1YA 2HIAA 4FHCA 4GH5A 3BZUA 3H99A 2O5RA 1U3TA 4OXYA 4CM8B 5AM2A 2R48A 2H31A 1U1IA 4IDHA 4S3MA 5B3AA 5HCUA 1CVRA 1GT6A 1KP9A 3F2IA 3CEPB 4RE6A 3PXCX 1YS6A 4YB8A 1U0JA 3DVSX 5GWXA 3Q7TA 3UJ7A 1E1YA 1P0IA 1GNVA 1PVDA 2UUAB 4E2YA 5AJHA 4LSGA 2XBLA 2YRWA 4W63A 1MIOA 5IP5A 5ESDA 1CR4A 3WADA 4JI0B 4IOKA 5ICMA 3E3LA 2XOXA 3TR5A 3ZCTA 2Z8XA 3PUZA 4G1CA 4QUJA 1XPJA 4PAWA 1CNFA 4H35A 3TUZC 2NYVA 1Q7TA 1U8EA 1XPOA 2AC2A 4UARA 4MCIA 3GJ6A 1RT9A 2IU6A 1ND5A 3KVRA 3NETA 3OPYB 5IDVA 1T5OA 3DV9A 5EXEA 1MFZA 4OXQA 4MMXB 4CKYA 3FPCA 2I2DA 5LZ5A 2CKDA 2MYNA 4DCCA 5K09A 3TF5A 1ZKDA 5JWHA 4NJOA 1AUVA 1OU0A 1Y9ZA 2CBZA 4C2AA 3EC1A 5P8WA 4ZZ1A 2C07A 3ZG6A 2VSQA 4EH1A 4MVJH 2Q1YA 4YMSA 1JIIA 1O8CA 3RS0A 5DLDA 4F4UA 4Z7OB 2QUZA 3OZWA 2Y6VA 4G5SA 1AIPA 1YDGA 4OXIA 1O6GA 3VHLB 1US8B 3HVIA 3AY7A 4J4HA 2B21A 1LLDA 1CR2A 4QTTB 4YR9A 4PZ9A 4YRPA 4MLZA 1A4XA 2VLIA 1PJ3A 3LDUA 2HU8A 3I6ZA 3L93A 2QJOA 1ZNYA 3OOSA 2ZJ4A 1GGMA 2BT4A 2AN5A 3WMRA 2DP4E 4HRAA 3GA0A 2VYNA 5JFGA 5FNVB 2QX4A 3QG1A 4N8DA 5IKPA 1N9KA 4YEDA 3JVVA 2YWRA 1TZKA 1M66A 2MCFA 3C4JA 4HUJA 1AB5A 3Q5GA 4XVUA 1KBOA 4PY2A 3D7LA 1EE1A 2CXXA 3KB1A 3DZBA 4N76A 1NUTA 5HIMA 3ENQA 2APJA 3BHIA 3SAJA 3EF0A 4G0PA 1BMTA 2P3QA 2RGXA 4J2TA 1AZWA 2FPUA 1I2CA 1JLMA 1LVUA 3F9RA 3R3XA 4BKUA 5JNTA 3T5MA 4L4ZA 4X60A 4GT1A 4ZVVA 1EK0A 1FFAA 2P6NA 4X66B 1TQHA 3EIXA 4TWIA 1BCRB 1GNTA 2BONA 2HRBA 2X8BA 2VO1A 2HA7A 3K0CC 2GKGA 3NEPX 2NPIA 3T34A 4AW9A 3HSYA 5JSUA 2ZJFA 4ER5A 1ZLXA 4U3JA 3WL4A 1P7YA 2CHGA 3F6BX 4ATNA 4YAKA 4C5BA 1JU4A 2Q5JA 2JLBA 3TGPA 1CT9A 5H80A 2NZXA 3V1MA 3WGNA 3V7UA 2AKAB 2PKYX 1S3IA 3G2OA 2YWDA 3E27A 4TYQA 3RVOA 3MTJA 4YH1A 2DM6A 2WR8A 5CA1B 1L5MA 1PGPA 3H9UA 5EIXA 2WM2A 2Z8YA 3E18A 2GLUA 4XDYA 4QYTA 5K0SA 3V3TA 2NO7A 1ZNXA 3OPYI 4DG5A 5EYPA 1R9MA 2FUG6 1HL7A 1NBMA 4RHEA 1ZONA 5AJTA 3DT8A 1DBRA 4D8YA 4TTAA 1IXYA 3LKDA 1AQYA 2P27A 1QP4A 4HN2A 1DINA 2Q7DA 1MH9A 4Z2AA 2YQZA 3CVUA 1E62A 4KQGA 4EF6A 4DSOA 3AY0A 2MDTA 5AICA 2NU6A 4E5DA 2QI9F 1E3MA 4GLJA 1VLHA 5JDCA 2NZVG 3ANNA 4D80A 3B6JA 5KTTA 3I73A 5I7FA 2HTEA 3MFYA 1J9GA 4Z1MA 1A9RA 4QWWA 4LS3A 4IDAA 2SHKA 3ZY2A 3U5TA 4Y3UA 2UZ3A 1JEQB 3RT9A 1XCJA 1ZGJA 3NG1A 3F5DA 4EZBA 1QVVA 2P9EA 4AKGA 4LKOA 3H87A 5FF9A 2EGHA 4MW7A 4NI5A 2H0QA 1XWIA 1SIOA 3KYCA 4Y9DA 3DHWC 3FB4A 1OHHD 1UBKS 1NV9A 2CLKB 4C1NA 5GTDA 1FP4B 1VZ2A 2C4UA 4RE5A 1E3WB 1ZAYA 2I87A 1ISPA 1RYDA 1IZ8A 1RJGA 1K27A 1FYDA 1NR7A 3DFMA 4LV6A 4ODIA 4KNVA 3N3AC 1M54A 1KQPA 1ZAKA 2FPLA 3OAAA 3GH3A 2GLXA 5DNDA 4TUYF 3UEOA 4YAJA 5ALLA 4ES6A 4ERNA 3TQTA 1OTYA 1NNI1 2GPSA 3GRUA 4JJFA 3PUKA 5KNCH 4MQEA 1NXPA 1NVAA 3N5CA 2QTNA 4ZXPA 3W8EA 4EHJA 5CBPB 5GZ6A 3DGEC 3LFTA 3OQPA 1UIRA 4I14A 4ZVOA 4X85A 4I4NA 4XFJA 1L7VC 5A5EA 2D7DA 2A1UA 3NC4A 3OU2A 1YB2A 3X1MA 5JZMA 3PICA 1D04A 3QUTA 5LQCA 1KYTA 4CQNA 5IZ4A 1RBZA 2IDZA 1QHHB 1A7JA 3DP7A 4R9UC 1QTIA 2CGEA 3DUFB 3DT9A 4QOIA 5CLHA 1P0MA 3BB4A 1WXGA 5IAJA 1L9XA 3LRXA 4H7DA 4RLFA 3VZBA 4K6OA 5EG5A 4ABYA 4Z9XA 5KQSA 5JI3E 2Z6VA 3OH8A 1LNQA 1SCNE 2AG8A 4WNCA 1NQXA 3B60A 2PZ8A 2VR1A 1LDYA 2QRHA 3HWSA 4QC2A 4YUZA 4AZWA 3L5KA 4HRYA 4BYGA 3UJNA 5HE9A 4KJXA 4MUKA 3CUUA 4L7VA 4JIGA 1G7CA 2J9FB 4FFBA 4Z4FA 4GGPA 1VKJA 2ABWA 4BC0A 2TECE 3B9BA 1USVA 1OA1A 4RAOA 5EERA 1E6WA 3IBTA 3PDJA 3QITA 4GR4A 5CX1A 4DQXA 1ZK2A 4Y7DA 4ZMBA 3DZGA 4GE3A 4K2HA 5GMOA 4CF7A 4BQEA 2WAMA 4NARA 1E7MA 5COBA 4C4ZA 1HUQA 4GOJA 3N0WA 4IVNA 5SY4A 1X7WB 4ZQCB 3SJZA 2O8EA 3E5MA 1ZJYA 2OCAA 5BN5A 2OGSA 2GYWA 2XVMA 2X19A 3D64A 1RHMA 4MR9A 1I3OA 1Y9DA 5DXAA 1WB9A 2YY5A 4K46A 1UBSB 1VJDA 4FD2A 4OQEA 3B7GA 3AUFA 3GNQA 2XLCA 2IITA 2R6R1 1T4MA 1N7HA 5EIBC 1B7GO 2N47A 2Q4RA 4Q3BA 2I6TA 2IDKA 3LQ1A 4I5DA 1ZGCA 4YRSA 3CX3A 5EIBD 3L7NA 4MVJD 2VHQA 1RQRA 3SSAA 4RA9A 1X1QA 5IH7A 2XMRA 3FNHA 2C4NA 2JIDA 5GVSA 3SJAA 3PC7A 2P9GA 3BE6A 3LL4A 1GLGA 4F5WA 1I3LA 1MC8A 3HCDA 1P7WA 2FI1A 3LG2A 2AI3A 3B1FA 5LA6A 1GQQA 2W6OA 3FAZA 2VIIA 3FLBA 1NMXA 2MU1A 2Q28A 3JU3A 3LOUA 4U9UA 3RANA 1BXRB 3K9WA 4LBYA 2IV7A 3T5BA 3WNBA 4CMKA 1Q57A 3PS9A 3OZXA 2GCOB 3JRXA 3LOPA 2JHAA 4X1OA 4EQZA 2DQYA 3ZGOA 1JT2A 1VSVA 3LSYA 3TKYA 1RIIA 4QG7A 1ZG3A 2X9QA 5C80A 1K0FA 3BT7A 1O77A 1JKJB 4A2WA 4JYPA 4IAOA 4N1AA 1GRQA 2Q1XA 3PA6A 1DFHA 1CDOA 2A3RA 1BE8A 1Y48E 2GF0A 3Q0TA 1UBHS 5HZGA 2NXJA 2D13A 5E1BA 3SSMA 4QVIA 1QYIA 5DIFA 1B14A 4IILA 1P1CA 4RGYA 5FB3A 1DTWB 3T61A 1Y33E 3SDZA 4N3CA 1P1HA 2J59A 1CRLA 2HNKA 2WW8A 1AK9A 3KDPA 4TQGA 5BXQC 3MS7A 1E1KA 2GPTA 2IUEA 4FIDA 3TL6A 5GPBA 5DW0A 5ECWA 4CG0A 5KIAA 3TTSA 2B69A 2YBEA 3ZNOA 4F5EA 5BN5B 5EXTA 4F2DA 3PQFA 2C5HA 2PAFA 2CFTA 3GDGA 5AOAA 4H77A 3T4XA 4HB4A 4ZDWA 5LBTA 2B2XA 1OAKA 1RLUA 5FA8A 4OL9A 2HPHA 1A8PA 1ZI8A 2GM9A 3KT8A 3LZ6A 4QOFA 1Z7WA 4R2HA 3W4IA 4BQOA 3ZHRA 1UJ2A 4BKMA 5AESA 2C5GA 4O2AF 4Q21A 5IM5A 3FA2A 3GQBB 3SHOA 3G79A 1QPGA 2W71A 3STVA 4DWVA 4M1MA 4M6WA 4LA4A 1YE3A 4EG0A 1M2OB 3IULA 4WZAE 1FNCA 1TNDA 1ODCA 3LX6A 4GYYA 4HBGA 4CR7A 1IY2A 3OOEA 3CRMA 3KHSA 4ZV4A 5A4KA 3VH2A 2HMVA 3AP2A 3AR8A 2ORIA 1GGKA 3AKDA 1UK7A 2Q45A 1FC0A 1I01A 4XQ0A 5DHRA 1KGSA 4IMPA 1JB9A 1JIJA 4HJRA 4HH4A 4XB6B 4KPFC 3P2IA 3QU5A 5ELMA 4R8SA 1G6OA 2IEZA 4I55F 1X0XA 2VDMB 1RW4A 4HVTA 4H27A 5FTKA 5IJXA 2UZ4A 2Q5HA 4RQTA 2AA3A 1A5AB 1J8QA 2PA3A 1PR3A 4JD5A 5JWOA 4Q4DA 3V2HA 4E08A 2VEDA 3Q8WA 4ITRC 4RPCA 5BQOA 2F7SA 3QGMA 2BV3A 4TWAA 1GL7A 5ARDA 2PRIA 2XVYA 3VTZA 4QM7A 2HJGA 3MT9A 2EW8A 1IPEA 2ZRAA 1HE4A 1E9DA 1JJ7A 4PW0A 2F64A 3OU7A 1JFFB 2FB9A 4U4AA 3QBVA 1UKBA 2AFRA 1OZHA 2OSBA 3UWKA 3OPVA 4XTRA 2ZCUA 3V97A 4B47A 3NEJA 5BT9A 4JUDX 1GD1O 2NZWA 2C3PA 4BOYA 4UTPA 1H9BA 4MV6A 3RASA 4DYHA 3QBEA 4NBTA 4PPYA 4HX9A 3B5JA 3RVMA 5LQRA 2D5BA 2CEAA 2RDMA 2CJWB 3EXG1 3JYNA 1WTCA 2AMFA 3NBQA 3O8QB 3T9AA 2D0DA 3ZVLA 1K6MA 1F4PA 2C97A 5L3ZA 2ZBFA 3THRA 5CVUA 4GKKB 4BU0A 4V03A 4DA4A 2B4TO 1X77A 2IY9A 1EINA 3JYQA 2GN6A 1HDYA 3QVKA 3SFTA 3W3AH 2AS0A 1F06A 2L69A 1SPBS 4RA9B 3WJ7A 3SJUA 3VR5H 2VAXA 2P2DA 5D8DA 1E9CA 1DKOA 3VH1A 1RWQA 2HIGA 3QWBA 2O6LA 2FXIA 1NFFA 4NX2A 2BKEA 1OXUA 3PXGA 2QAGC 2QUKA 2I2AA 1XDGA 4QFCA 1Q1QA 2Z56A 4PLTA 5ILOA 3I2YX 3K1YA 1SKAA 3HL4A 4ZOCA 4FFVA 5DWDA 4B3CA 1Z0UA 3B70A 4KRXA 3LFHA 2EWVA 3LX4A 4BAUA 1NV8A 1FTSA 4LF7B 4OYRA 1VJGA 1U0GA 4J3FA 1Y4SA 2JFGA 2KYRA 1VI2A 1MBZA 3QLVC 4B80A 2QE7D 5K4HA 4B9AA 1N2JA 1MRSA 2WYUA 2JIOA 2N3ZA 5B3KA 2XA9A 2ZT6A 3WO1A 4DXHA 1YKFA 3ZWAA 1DWUA 4DJAA 2I6FA 1DRWA 1FFEA 2EP8A 5LIPA 3GGGA 2YYYA 4Z0TA 1U5BA 4JQZA 1MO2A 1YV9A 3OSZA 4QDZA 4UM5A 4EI8A 4GOOD 4UTNA 4L72A 4C78A 2JI8A 4YS6A 3CBGA 2FUCA 3DDSA 3JCZA 1YULA 2DG2A 2ONYA 4P3XA 1CFZA 4QX6A 4UCFA 2I3BA 2RAFA 3VHRA 3GOHA 1EVLA 4RA6B 1GUAA 1EFDN 1Z6AA 2CCKA 1Q0ZA 3PD0A 4RNCA 4ZT2A 4BJ1A 3GWGA 1J21A 4UUOA 1XCMA 1PYDA 2OGWA 1CWUA 2YHUA 3HCBA 3KL4A 4RMNA 5EWMB 2HMUA 2JLYA 5AVXA 5ICGA 3UT5B 1THMA 3NKLA 4MUHA 4PO8A 4QHTA 4R2LA 3R0IA 4X6XA 1NP7A 4MTLA 1O89A 2O2CA 4WNAB 1C0PA 3U3MA 3ZQ6A 4C4TA 3AEYA 3FB1A 4NL4H 1EAYA 2OFWA 2X5NA 2Z09A 2W98A 5FYQA 3WHPA 3WRYC 2YFKA 1GKKA 2PU7A 3AWIA 3FCSB 3THYB 3MJTA