1B16A

Alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-3-pentanone
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (ALCOHOL DEHYDROGENASE)
total genus 96
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b16A00
3E18A 3EZYA 3MCVA 2D5AA 4FPXA 5CG1A 3LT0A 5JDCA 2HO5A 1PS8A 3K2BA 1HDRA 1Z73A 5TLSA 1AHHA 1E77A 4P8RA 2HUNA 2PNFA 3ZNQA 1YOVA 1HLDA 1ZEJA 2P2SA 1HDYA 2XF8A 1EDZA 2AW5A 2O3SA 4GX2A 5F5LA 3MTJA 4LSMA 1B14A 4L74A 4H16A 1XU7A 4U8GA 2YHIB 1P0CA 3IP1A 2I66A 1U7TA 2Z1MA 5I9NA 1R15A 1VLLA 4Z9FA 4YDRA 2IZ0A 3HFSA 1T2EA 5KJFA 3IAHA 2X6TA 4FN4A 3MOGA 3JQCA 3OA0A 4NJMB 4B3HA 4RL6A 2PA3A 3JQFC 1Y7TA 4MVJM 1ULUA 3K8ZA 4L4RA 4MIOA 1DHTA 3Q6IA 2YYYA 3F5QA 4KTVE 4CLDA 4F3YA 3JD0A 4XQ9A 3WMXA 4WLNA 1KC1A 3MWDB 2P4QA 1HF3A 4MIEA 3GEGA 2D8AA 3AM5A 4GPD1 4RF2A 5G4KA 2J5RA 2QRLA 2I76A 1XU9A 1MXHA 3OA2A 3LC1O 3Q11A 2EEZA 3TQHA 4W99A 2P9EA 4WUVA 2CNBA 4I5GA 3Q2IA 3IC5A 4FR5A 1U28A 3C1TA 4BO6A 1IZ9A 1UXIA 1PL6A 1XHLA 4U6QA 1EFKA 5A9SB 5H82A 4DREA 3P7MA 3V2GA 3F46A 4R1TA 2FR8A 3D3WA 1WMBA 2UV8A 3PGXA 3VPGA 5KKCA 4RVHA 4BS9A 3TRIA 3GR6A 2PD6A 3ZU4A 1BGVA 2E48A 4N7RA 4HNGA 4NPCA 4W82A 4GX5A 5IN5A 3T4XA 4M49A 4MJLA 4DUPA 1NVMB 4YR9A 3D0OA 1DXYA 3EUWA 1PJLA 1E6WA 1HL3A 2NU9A 3F9IA 3H3FA 1DFGA 4QX6A 4JNKA 4XGIA 1DC4A 5DOZA 1LEHA 5ENVA 4GL4A 3ULKA 4FBGA 1GZ4A 1LJ8A 2CF6A 4ND2A 2E37A 3HN7A 1I8TA 4ZHSA 1ZUD1 1ZK4A 2I99A 2HSDA 1MFPA 4EITA 3WGIA 3Q9UA 5A04A 3NDIA 4D42A 3LLSA 2O4UX 3VZQA 1ZBQA 1V3UA 1YONA 4IZHA 1X0VA 5JCJD 3IKTA 2NU7A 4ALJA 1VC2A 3PDJA 4HNHA 4HV4A 5I7FA 1L7EA 4M1QA 1E92A 4NDNE 3VZPA 3VZSA 3WIEA 5H83A 1LRLA 3HDJA 3U3XA 2VT3A 1NAHA 3ASVA 3IQDB 2VZ0A 1GCUA 2Q46A 5EINA 2HK7A 1KETA 1YB1A 3E03A 1XA0A 1A9YA 4AJIA 2YUTA 4M54A 1PWXA 3VH3A 2QYSA 1ZEMA 3GDFA 3ETDA 1C1XB 5CFZA 1XR3A 1LDBA 4L76A 2O2YA 4XQCA 4XCVA 5CG2A 5JC8A 5TC4A 4KTTE 2VRCD 3LT2A 3OEYA 1JA9A 1UXHA 4IMPA 3GHYA 4B7XA 4BGUA 5DOVA 4E33A 3LK7A 2Q4BA 3ZW8A 3BTSA 3K6JA 3ZV5A 4BL5A 5ICSA 1OFGA 2JJYA 4N5NA 5DULA 3MEQA 1GTMA 1B3RA 3I4CA 1RYEA 4YJFB 2OBYA 3OICA 3R3JA 2GN8A 3VH4A 4CPDA 3FF4A 3GVXA 5HTOA 2C2YA 3JQGB 5EJ2A 3OJLA 3QE3A 3U4DA 4BKOA 2VHYA 5CDTA 2DU8A 5CEJA 3KHUA 4CL8A 1NAIA 4ZGWA 3RC7A 4ZQGA 2G17A 4BNWA 3ZI0A 1EVJA 1H6CA 1AXEA 1VSUA 1R66A 3MJSA 4R16A 1IUKA 3AUUA 4IMRA 5A9RA 1HYEA 1A7AA 4GI2A 1FDVA 1AUPA 4AJJA 1YBMA 3DAPA 4J49A 3BMNB 5K6AA 1E3WA 1WVGA 1K6XA 1YQXA 3PFWO 4JK3A 5AVOA 1JVSA 3DZIA 1PJTA 4E2YA 2I65A 2EJWA 4RPLA 4CMAA 1Z7BA 5IN4A 2WWRA 3ROPA 3FD8A 4RZHA 2GN6A 4L8VA 4NR0A 4FW8A 1I3KA 2YHIA 1E3WB 2YW9A 2AG5A 1E3JA 2O4CA 2YQ4A 2OORA 3DHYA 5F5NA 1DO8A 2Q49A 1A4UA 3AJRA 4BKPA 5TJ9A 1NPYA 2DC1A 6LDHA 1NQTA 1VPDA 3OFSA 5G4LA 1EDOA 5DNAA 5IDYA 3RUDA 5FWNA 1KVSA 5L4LA 5C37A 4D7AA 3PFFA 4H7PA 5F1OA 4CM6A 3HDHA 4R5HA 1ENYA 1BXGA 1OAAA 4PZEA 5G0WA 4B3JA 5C5IA 1PJ2A 3A06A 4QSMA 5ITWA 5EQFA 4F46A 3RFXA 4FCCA 2AQ8A 3LSYA 4XYBA 5A02A 3I1JA 1MG0A 1LBEA 4R1UA 4R1NA 3UGKA 5KJEA 2JD1A 2DVMA 3GY0A 1BTOA 1LRJA 4R5MA 4RPHA 3UXYA 2WMDA 2QW8A 1OC2A 3AUAA 4PLTA 1E3IA 4UUMA 4BO8A 1E6EA 1JAXA 2O23A 3JQ8A 4KWHA 3DAGA 4PLWA 4S3MA 3UN1A 4CUZA 4XRGA 4GX0A 2EIHA 1C1DA 4ID9A 1ZCJA 1U3TA 3ZU3A 3VTZA 1AGNA 4PG7A 2LDBA 5HRUA 1I24A 4E4YA 1NYTA 3IKVA 4YA6A 4WKGA 5IZ4A 4I5DA 1KEUA 3A28A 4HXYA 3FBTA 3L9WA 3ONDA 3NUGA 1CETA 2Y1OA 4LW8A 2YFQA 4RDIA 1PJQA 4D0RA 3TNLA 3RUHA 2B0JA 4OKNA 3B1JA 1EQ2A 2QRJA 4AJEA 4CM8B 2GZ2A 4FIZA 2ZQYA 1DAOA 4DXHA 4NK5A 4BO5A 3JQFA 4DQXA 1FDWA 4ROSA 3PHIA 4WEQA 2C59A 1UDBA 2WYVA 4U0JA 3U4CA 3UAGA 2VRCA 1W0CA 2BD0A 2J3JA 4PIVA 4CLXA 3ZNPA 1XWFA 4YT8A 1DFIA 2XOXA 3H8VA 4CMJA 2JD2A 2HK9A 2SCUA 5A5EA 3IIEA 3KYCB 5JAZA 1N2SA 3SVTA 3HADA 4IM7A 4J0FA 3BTVA 4XQEA 4KP7A 3H5AA 4WOKA 2J5QA 3ON5A 1CEQA 2WE7A 4EBFA 3MJVA 1H94A 1P3DA 2IZ1A 3Q9NA 4J2HA 4MVJD 4WLEA 3NJ4A 3TL3A 2NU6A 3C24A 4CM4A 4UVIA 3FHLA 3H9EO 3H9QA 4GWGA 3ZCXA 2JFHA 1PR9A 2HJRA 2DLDA 1VM6A 3DXFA 2P4HX 4NI5A 5F1PA 1PQPA 3DR3A 1P74A 5K6AC 4WJZA 4EJMA 3CTMA 3IJPA 3ZNNA 2I3AA 3LF1A 3QWBA 4UVHA 3ZHXA 2X1HA 1C3VA 4XB1A 5EN4A 3AOGA 3ZGYA 2D59A 1I01A 2RIRA 2AMFA 1PS9A 3K2EA 4FFNA 4IDBA 1XG5A 4WCFB 1XQ1A 2G76A 2HQ1A 3GN1A 2NVUA 5KJ6A 4OQYA 4RQUA 3W6ZA 3SLKA 4OJNA 3O9ZA 2Y68A 4L75A 2VN8A 5EESA 2BMAA 2DFVA 1LTHR 4I1IA 4BV8A 1JN0A 3OP4A 5A06A 3TF5A 2RHRA 1S7CA 2GLXA 3K73O 1IPEA 5L7TA 2Y1GA 3C7DB 1BSVA 4HWKA 4CM7A 4OYRA 4LISA 1P1IA 3U0BA 5DZSA 3KOUA 3AUTA 5JO0A 1GU7A 2B4RO 3BHIA 4A26A 4J9VA 5T67A 3UCXA 3O26A 1N7HA 3X2EA 1SO8A 4EW6A 3JQAD 1GYQA 4A27A 3LVFO 3HDQA 4GLOA 1TB4A 1CRWG 3OETA 4R9RA 1F0YA 3WX0A 1JKIA 4LMRA 1SPXA 3JQ8B 3PRJA 1HRDA 2VWPA 4MOWA 3ZDFA 1U7HA 3OIFA 4CV0A 3CMCO 4HFRA 1F8FA 1H6DA 5L4NA 1MGOA 2ZTVA 2VUSA 2X4GA 5HBRA 1GFSA 1UUFA 1V9LA 2J3HA 3FNEA 4D0SA 4DLAA 3RFTA 1X7GA 1LSUA 2VYVD 3VH1A 4RPKA 3S8MA 3KLPX 4IPTA 4QFDA 5I7EA 4DYDA 1HE4A 2FP4A 2H1SA 1DIAA 4ZD6A 2Z5LA 5BNTA 1E7QA 5IF3A 1I30A 1LUAA 1QYXA 3CE6A 1V8BA 3LQFA 3PJFA 4G65A 1RJWA 4IDDA 4NH4A 4ZVVA 1CYDA 2BFMA 4GLLA 2W90A 4BUCA 1Y8QA 1M67A 2CMDA 1GZ6A 4Y6PA 1PZGA 2WE8A 1PL8A 2CFCA 3E6AA 3V8BA 3D4NA 3ZV6A 1Q7GA 2B4QA 2B37A 2GSDA 4A03A 4E12A 1W8DA 3KSDO 4JXKA 4UUPA 1M75A 4AVYA 3BMOB 2VOEA 5I7VA 5JS6A 3NKLA 1EUCA 2NVWA 4CV1A 2EKQA 2UVDA 3AI2A 4DMMA 4EEXA 3W8DA 1LSOA 2P9GA 1HE2A 2O48X 3MOIA 2PZMA 4II2A 2QQ5A 1LA2A 5DBGA 4E6PA 1EVZA 1J4AA 5TGDA 4A2CA 4BNXA 4TROA 1UDCA 2AEFA 2JAHA 4CMIB 1NVGA 5KVQA 3JYQA 4CM5A 4DLLA 4IGFA 2FOIA 4J16A 3WLFA 1Y8RA 1ADGA 5JO9A 3INGA 3MJEA 1R0LA 4R54A 1HSZA 5THQA 1WWKA 3TFQA 1Z7EA 1NHGA 5KVCA 4BNKA 1EZ4A 1ARZA 2I5PO 2VHXA 4A0SA 1YL5A 1R0KA 4Q3BA 4NG5A 1E1MA 4Q9NA 2PKQO 1Y8QB 2CVOA 2HMVA 1KIFA 3UKOA 4C7JA 3UFXA 4WLFA 3PDUA 1XIVA 3VVBA 3IL2A 3VTFA 1I36A 3GPDG 5B4VA 1N7GA 1BXGB 4JN6B 3WFIA 2OO5A 1WXDA 5JLAA 4K28A 1E6UA 2VZ9A 1Y81A 3L4BC 3DBLA 5COBA 2YV2A 2CDBA 1Y9AA 3KXDA 2X9NA 1M6WA 1I0ZA 2VNSA 1H93A 1DEHA 1HE5A 2V6GA 1RPNA 3OBBA 4UAGA 3T7EA 2DBZA 4BIIA 2FPGA 2RH4A 5A4DA 4BNUA 3IMFA 3PHJA 2Q2VA 2GUGA 5F3RA 1YVEI 3GG2A 2JHGA 2AQIA 3TN7A 1DFHA 4R41A 1UP7A 4CM9A 4JGBA 3NEPX 1F06A 5ITVA 1HLPA 1I10A 3QQPA 3PZRA 2IZZA 4J6FA 3F4BA 1DJNA 2DBQA 2Z1NA 4GKVA 1BG6A 3CINA 1HETA 2DM6A 2Y1EA 2IE0A 3CIFA 3L77A 4K26A 3LC2O 3VPSA 3BHMA 3KYCA 4DA9A 1YBAA 3EVTA 5CDGA 4PVCA 1Z74A 2Q2QA 1MG5A 4YRAA 3ZV3A 3F5SA 3ZV4A 3RUIA 4XIYA 5LCXA 2ZYAA 4YJFA 1VJTA 2DPHA 2GF2A 1M76A 3CZRA 5CHEA 5L7YA 3ZWPA 7MDHA 3TFOA 2IDZA 2PWZA 3TZHA 1LSJA 3GNSA 3DB2A 2GD1O 2PZLA 3W4JA 3JQAA 1N9GB 3D4PA 5AOVA 1IHXA 3G0OA 2P68A 4E30A 1JWAB 3WWZA 2Y1FA 4Z9YA 3AI1A 1SB9A 2Y66A 2G1UA 3GN2A 3QHAA 3PGJA 4BGIA 2H5LA 4BNMA 5C3MA 3E8XA 1P9LA 1C1DB 2AHRA 2YDXA 4B8ZA 1N9GA 3H65A 1JTVA 3PLRA 3C7CB 3ZZNA 2H6EA 3PI7A 2OOSA 3V1YA 2ZCUA 4PVDA 2ZB4A 1YWGO 5L9AA 5A9SA 1PWZA 2DFDA 1LLDA 3DBRA 1NNUA 2ZB8A 3WMWA 5KVVA 1DC6A 3D64A 3I23A 3QV1A 4E13A 1DLIA 3DMTA 5JBIA 1VSVA 2ZQZA 4TVBA 3ZWVA 3STHA 3AUSA 3GG9A 3SC6A 1GYRA 4Z3DA 3GMDA 4XYEA 4MDHA 3RFVA 4QFCA 1V3TA 3L4SO 4U6SA 4FGSA 5LDGA 1HDOA 4PZCA 4X54A 3K30A 4OOEA 4YEDA 1FDSA 1R4MA 4Q39A 3IUPA 2G5CA 3DMYA 4Y9DA 1ENZA 1WDLA 5F1KA 4AJNA 2VUUA 1JKFA 1SZJG 1UZLA 4PRLA 3QWHA 4YAKA 5L7WA 4UVEA 1PGOA 3FRJA 4IUYA 1YDEA 3VPFA 4JIGA 5KWEA 4RVDA 5JE8A 1MC4A 3WG9A 4ZU3A 2Y67A 3FR7A 3ZHBA 5I7SA 3WXBA 3PYLA 3ANMA 4K9DA 3BMNA 2O7QA 3OHSX 2HMSA 3GVCA 4HKTA 4CR8A 3Q0EA 1E3LA 1ZK0A 1O8CA 3IOYA 1ZSVA 1ZJYA 4E2WA 3RUAA 3BIOA 4BNZA 3N7UA 2PGDA 1LDNA 4PLGA 1WW8A 2BRUA 1U2DA 4J43A 2XPCA 4HFJA 3S1LA 3S55A 4QXMA 5MDHA 1LDYA 5TT0A 4J9UE 4A5OA 4RF4A 5J23A 1EVIA 1NASA 3GT0A 1DAPA 4QO8A 2FRDA 2VOJA 3D1LA 5KCZA 2EW8A 3EHEA 3RASA 3WGGA 5KVSA 4RDHA 1P45A 1B8UA 5JMPA 4RVGA 5IFLA 1EFLA 4YJHB 1PJSA 4FS3A 2W98A 1HDGO 1LXCA 3EAGA 3BTOA 3NTRA 3F1LA 1ML3A 4ZICA 3ONFA 2YY7A 3WIDA 1S6YA 2I67A 4HFMA 5KJCA 2PLAA 3RBXA 2OGUA 2BFAA 3PYXA 4TRRA 1MB4A 4AJ4A 1ZSYA 4U7WA 1AHIA 3DONA 3PJEA 5JFOA 4FFPA 4LRTB 2NACA 2O50A 3OQ6A 5JY1A 3HDYA 3RAJA 4YTEA 1EQUA 1TXGA 1ISGA 1JDJA 1I2BA 1J49A 3BMOA 3OMLA 3G17A 1GUZA 3I9MA 2YHUA 1JW9B 1F12A 1XCBA 3JD3A 1H5QA 4FJ2A 4P38A 4GWKA 4E32A 1QG6A 3KSZO 1RWBA 4I9HA 3PK0A 1B26A 1IYZA 3GVPA 2W2LA 3E5RA 4J7XA 1QORA 1G0NA 2E6UX 3KM0A 1P1JA 3NRCA 1WZEA 3EYWA 4O5OA 3U5TA 3AM3A 4EYEA 4M86A 3SX2A 1O9BA 2O3UA 3BZUA 4TZTA 1LLUA 4E5YA 4UEKA 3INTA 1W73A 3DZHA 4RQTA 1PZEA 2PH3A 4CMKA 5A03A 1J6UA 4LVUA 1T2FA 2GN9A 1ZZEA 2OBNA 5JW6A 1GAEO 5K9ZA 3RC1A 4MVJI 3WQSB 2EWMA 4OXYA 4DBZA 2D1YA 4JQCA 5TS3A 1UR5A 3RWBA 3BHJA 2DAPA 2UUPA 2WM3A 2NTVA 4PLCA 2PKRA 1HSOA 5MGBA 5L40A 2WDZA 4E21A 1LLQA 5C7LO 2UAGA 3OJ0A 4IJKA 3EZLA 1A71A 3DL2A 1KC3A 3FNHA 4LSWA 3GUCA 4KMSA 4XDYA 4AG3A 1ONOA 1WMAA 5U1PA 3LF2A 1UDAA 4WASA 4Q3DA 3PQFA 4GMFA 1CERA 1LQUA 1NWHA 5TT1A 2NNLD 1EK6A 4E5KA 1U8XX 2CDAA 3WJAA 1NQ5A 1MC5A 2B69A 2JCYA 3KB6A 3RJ5A 3HZZA 3AFMA 4TSKA 4ZRMA 3UOGA 4NJOA 3TWOA 4ALLA 3AK4A 3PEFA 2RCYA 2JL1A 3FBGA 3OECA 3HUDA 2O3JA 1TA4A 4I9UA 3SXPA 1TI7A 4E2ZA 3CPSA 4CMBA 2ET6A 1E7YA 4PLYA 2X9GA 4J3FA 3NT4A 1SEPA 2QHXA 4FQ8A 4BB6A 4FDAA 2TMDA 3NAQA 4OHUA 2YV3A 3W8FA 5KTKA 1G0OA 3PWKA 4BO7A 1YKFA 1ZW1A 2ZYGA 4ITUA 1KEPA 1X14A 4IQ8A 2I9PA 4JCOA 4AJ2A 2R2GA 3D3WB 1K3TA 3E82A 4CUJA 2FPPA 4KZPA 1SOVA 4QT0A 2B5WA 1QV6A 4S1VA 4D44A 3OQ1A 2I6TA 1NP3A 4NBTA 3JYNA 3UCFA 1VL0A 3HSKA 3GGOA 1WDKA 3PIDA 2CDCA 3ZHZA 4MVJG 1H6BA 1Z45A 4J1TA 5U9CA 4MKZA 2NU8A 4JP2A 1QYDA 3WDSA 1LC3A 1NM5A 3PVZA 3DQPA 1VJ1A 4IJWA 3NTOA 2C2XA 2FY8A 2IXBA 1H2HA 1WLYA 4IS3A 4XWYA 2H9IA 1ORRA 5KOIA 3I9OA 5L53A 2BFOA 5GZ6A 3M2TA 5ES3A 4B8WA 3I6QA 2FZEA 4BNGA 3ST7A 4IBOA 1XGKA 3RQSA 3KRTA 4CMHA 1NVTA 3GRKA 2G0TA 4LN1A 5L51A 4J7UA 1BDMA 3JQEA 3VAZA 3SBOA 3ZWWA 5G2OA 4BO4A 3Q3CA 3WGHA 3PHLA 4N5LA 1OZAA 4DVJA 3PLNA 3MJTA 3TDKA 3AW9A 3MJCA 4PG8A 5L3ZA 1I33A 4MVJF 4WCFC 1LU9A 1R4NA 4XA8A 4J2OA 3CH6A 2HDHA 2ZTLA 1CQIA 2VHWA 2VWGA 4A7PA 4BKRA 4CM3A 3T7CA 5CPBA 4GVLA 5B1YA 4B3IA 2AE1A 2W2KB 4CMGA 1RM5A 4M8SA 3JQDA 1DC5A 4YJGB 1H9AA 4CLRA 1BXZA 2X7HA 4ZQHA 5TJHA 2IYPA 1X1EA 3W4IA 3TZCA 1PGJA 3JQGA 2C7GA 4L9RA 1U3VA 3WYEA 3U4HA 3AY3A 3ORFA 4R1SA 4BMNA 1HWYA 1ADFA 1GV0A 3DZKA 2OHXA 2V7PA 1T4BA 2JCVA 3FNGA 2IYOA 3SC4A 4NJMA 4J91A 4BVAA 5G0VA 1PQUA 4RVSA 4CM9D 2PKQP 3G3EA 1I32A 3JD2A 4BMVA 3DC2A 4OMUA 3V2UA 3WTBA 2O3RA 2OL4A 3V1TC 2W4QA 1OOEA 2JAPA 4WLOA 1FDTA 1JVBA 1GDHA 4CM1A 1F17A 3KTDA 3F47A 3FWZA 3L6EA 3WYBA 4YXFA 2J5KA 4AJLA 3VZRA 3QWIA 4CM4B 1ZK1A 4MINA 3ITKA 4BO0A 5T5QA 3I9KA 5B12A 1PJ4A 4RV9A 4UVGA 3G79A 4ALNA 1N8KA 3AM4A 5IDXA 2C5AA 3K92A 3DZBA 2R6JA 2JCXA 4YRDA 4B4UA 3U49A 4B4OA 2VYVA 4KUEA 4JBHA 1K6IA 3WOHA 4CV3A 5A3JA 5CDUA 1W4ZA 5COQA 2FSSA 2NM0A 2X23A 4EGFA 1DRUA 3DBHB 3LDHA 3KZVA 1KBZA 1ISHA 1P1FA 1O5IA 4WGGA 4QUKA 1E7RA 1ZNQO 4PLFA 4R3WA 2E4AA 2GNAA 1DBVO 4BO2A 1O0SA 2PD4A 4O63O 5BSFA 3K31A 4OSOA 4RVUA 3SEFA 1R37A 3NTQA 4RCVA 3BMQB 1K89A 3OJOA 1NTOA 3WTCA 2GASA 1H2BA 1BDBA 4IS2A 3MWEB 2NUAA 5DBFA 2J8ZA 1ISFA 1EEHA 3E9NA 1Q0QA 4J1SA 3GEMA 5JCJA 3ASUA 1IHYA 5JAMA 4MP8A 3JTMA 1Z75A 5BNIA 4OIMA 3DBHA 4II3A 4KOAA 5TIIA 4MVJP 4EUEA 4EJ0A 2D3TA 2ZTMA 4OXKA 3WYCA 3LLVA 3AY6A 5THKA 5IXSA 2YDYA 1EK5A 1I5RA 1ZK2A 4K1LA 4DLBA 2Q3EA 1ISIA 2A9FA 3GF4A 3GMSA 1KVRA 2AG8A 3PQEA 1R12A 2ZIZA 4CLHA 4N5MA 5T64A 3OF2A 2A35A 3VKUA 4DL9A 5FI5A 3GPIA 4RF5A 1IL0A 1WNTA 1D8AA 3OIDA 3DZJA 5A9TA 3WSVA 3CXRA 4Z0TA 4BNVA 3R0IA 4DIFA 1DIRA 5CDYA 2NTNA 2G82A 5FF9A 2A92A 3WGQA 4W6ZA 3PP8A 1NPTO 3KEQA 2VTDA 1VL6A 2OXIA 1U1IA 2EKPA 1PGQA 1T26A 1VKNA 3L6OO 3PZBA 4QEDA 1T2AA 1Y5RA 2HLPA 1HDXA 2NTJA 1LDEA 2GERA 3V2HA 2WTBA 1VL8A 4ZQEA 4HX5A 5COAA 4PRKA 1T24A 4FFOA 3QIVA 4OH1A 4Q3NA 4NBUA 4YPOA 3FNFA 1DSSG 3FWNA 2CZCA 5TF4A 5BT9A 3PHGA 4ONEA 3FN4A 1H6AA 2FSVA 1E3EA 3N74A 2QX7A 2IRWA 1UZNA 4KDEA 3GZ4A 1FK8A 1PSDA 4YJDA 4YAJA 4ZQBA 1UH5A 1ZJZA 2FMUA 1E1NA 2PZJA 3O8QA 1T2CA 1UXJA 5DCYA 1MLDA 1ZO8A 3GOHA 3NGLA 3OJEA 3Q1LA 3UCEA 4DBVO 3W8EA 1PR3A 3MTGA 1YL7A 4DMLA 3CEAA 1HDCA 4Q3EA 2HRZA 1QV7A 2DTEA 3L9XA 4CLRB 3HJAA 4IDCA 1NWCA 2DTXA 1LX6A 1N5DA 1GQYA 5A5FA 3RUEA 1UXGA 2EGGA 4IINA 4KDFA 4PZDA 4W7IA 4J90A 4P4NA 1DB3A 3ROMA 2B35A 4PLVA 4AFNA 4HBGA 1YXMA 1K2WA 4B79A 3NDRA 1DRVA 1E3SA 1YJQA 1YB4A 2V6BA 1C0LA 1PL7A 1R6DA 3F4LA 1TT7A 3BA1A 3I5MA 4DPKA 1GZ3A 5DP1A 3DDNA 1B0AA 3SLGA 3FCOA 2EW2A 4QO7A 4G5HA 2AQHA 3M1LA 3A1NA 4FFRA 4NBRA 2VRBA 3AY7A 1Q0LA 1HZJA 3EMKA 1P77A 3QVSA 1MX3A 2YV1A 4YRBA 3M6IA 2HU2A 2ZYDA 5CAEA 4WOJA 3TSCA 4DTIA 2FPIA 2R00C 4XYLA 3V1UA 2GYYA 3DHEA 1X7HA 3DOCA 1E7SA 2RHCA 1BW9B 4JP3A 3WICA 4R68A 1HTBA 1QLJA 4UUNA 4XR4A 1FDUA 3R6DA 1LQTA 1SCUA 1PU2A 5JYEA 3JQ7B 3O8QB 1BVUA 4FJ0A 4XYGA 2PGJA 4WK6A 4EJ6A 5JAQA 3WBFA 5BR7A 3GAZA 3D5TA 5GY7A 3TZQA 2CSUA 3ANLA 4W9NA 3ICPA 3LC7O 2HKIA 4KUHA 3K5PA 3JQBC 3P19A 1ZXBA 5TQVA 4OQZA 3WGZA 3ANNA 4CM8A 5EMHA 3W4KA 4NU6A 2NWQA 5FI3A 3OSUA 3QW2A 1X13A 5EL0A 4L73A 3IDSA 4UULA 3ROKA 1SNYA 1EMDA 3JQAB 1LDMA 3CUKA 3JYPA 3DTTA 8ADHA 2I3GA 4OSPA 4BNFA 2ZJ1A 2Y1CA 1EVYA 4JJIA 1V6AA 4XRRA 4E5MA 1PQWA 1N1EA 2YZ7A 5LC1A 2QYTA 2P5YA 3PJDA 1YL6A 3GGGA 4Y6RA 2X22A 3JSAA 3QLJA 4XQGA 3RC2A 4Z6KA 1YOVB 1K6JA 2O2SA 3O38A 4BO9A 4EUHA 4EUFA 1TLTA 5BNFA 4O6VA 3W6UA 5IDQA 2Y05A 4DWVA 3GZNB 3KUXA 3JCZA 1IY8A 2C0CA 3ENKA 5BQFA 1U3UA 1ZH8A 2OMEA 1DHRA 3ZH2A 1ZMOA 1T25A 2Y0CA 3E48A 2BI8A 4ND5A 3GZNA 3WSWA 5FEUA 4Y8VA 5DT9A 1TT5A 1LC0A 2YFHA 1DRWA 4BNYA 3GNTA 2EJVA 4BNNA 2F00A 4BNHA 4C7KA 1WDMA 1I3LA 1O94A 3DBRB 4RLSA 1ULSA 2BGKA 4RZIA 4HP8A 2DQ4A 5JDIC 1YB5A 4F6CA 3O03A 1QP8A 2V65A 3DWFA 1EE2A 1JWBB 2AQKA 4D3FA 3GEDA 3H4VA 3LZ6A 4M55A 5TX7A 2X0NA 4YAGA 1GEEA 1PJCA 2BGLA 4TRJA 4F6LA 3VOSA 1SAYA 1PGNA 4CV2A 1XELA 1CIVA 1D7OA 1CDOA 4D43A 2DPGA 1DIGA 3CZMA 4PG4A 5B4UA 2QRKA 2VUTA 3LT4A 3IS3A 1JU9A 1O6ZA 3HQ4O 4R69A 4M87A 2B83A 3U09A 2BLLA 2AXQA 4O59O 4AJOA 3GAFA 1ZSNA 5IG2A 1BVRA 3H2ZA 2P91A 1MFZA 1Q1NA 3JQ7A 1R0SA 4CJXA 1SC6A 2JFGA 1KVQA 1LI4A 5ER6A 4RPJA 4ZA2A 4GSKA 1V0JA 3UICA 2DKNA 2PH5A 4CQMB 2EXXA 5TRTA 3R1IA 5B4TA 2DT5A 4KQWA 3RVDA 2BKAA 5DBIA 2A4KA 3KO8A 1XDWA 4YQYA 1D3AA 2NQ8A 2POQX 3GQVA 4DC1A 2ZK7A 1YBVA 3EY4A 1LDGA 5LDHA 4ND3A 1BWSA 1DOHA 1UXKA 5JNLA 4U5QA 1KY5A 1BXKA 1Y5MA 4BB5A 3PIIA 4J7CA 1DIHA 2OP0A 4IQGA 4E0BA 2Q1SA 4RVFA 1VI2A 4WCDA 4CMEA 1A72A 1IE3A 1KS9A 2GGSA 3WQRA 1OBFO 1GYPA 3NYWA 1E7WA 4ALMA 1ENOA 4AJ1A 1NQOA 4IDAA 3K96A 4BQRA 2EP7A 5KJ1A 2W2LD 3DZGA 3RU9A 4CUKA 1BHSA 2PY6A 2VYND 3O4RA 3PPIA 4R01A 3JYLA 3DOJA 4HUJA 4U0KA 5JAIA 1EE9A 3C85A 5EERA 4PGFA 3V5NA 1HE3A 3PWZA 3KYDA 4KUGA 1U2GA 2QG4A 4TZKA 4URFA 3X2FA 2GDZA 3WS7A 2Z95A 1XYGA 2VWQA 3MJ4A 2C82A 3C3XA 2IXAA 3ZWOA 1CWUA 5GZ3A 2WYWA 2XAAA 1M6HA 3FR8A 1D4FA 1PTJA 4RF3A 4LCEA 3VC7A 4YAEA 4AJKA 3GA0A 4B4VA 2EG9A 3JV7A 3WQQA 4PG5A 2RBEA 1YQGA 1ADCA 2BGMA 3Q2KA 4N18A 4YYZA 3VVCA 1P1RA 3KYBA 1U5CA 2PTGA 4KWIA 3TOXA 1UP6A 1YDWA 3C1OA 1L1FA 5TSDA 1KY4A 3HHPA 2VNAA 1JLLA 1Y8RB 4N54A 1BMDA 4BGEA 4DYVA 4DGSA 2AE2A 4W7HA 2OP1A 4Q3CA 2E49A 1NFRA 3I9JA 4BO1A 4BQPA 1P31A 1WAMA 2XXBA 3ZW9A 3AWDA 1XKQA 4QTZA 2HJSA 4O0LA 3G49A 4YBZA 4CQLB 3F1KA 4ZJUA 3E5MA 2JHFA 4IXTA 1N92A 3KLMX 3A14A 1IULA 3ETEA 3ICCA 4FFLA 4YCAA 5JDCC 4PLPA 3DFUA 3OIGA 4D3DA 2UUOA 1JKJA 1I3NA 4D79A 1PZHA 1CQJA 4M89A 3UW3A 4OM8A 4FJ1A 3EW7A 1B8VA 4TRNA 4MP6A 4J4TA 3WLEA 1YE3A 2VWHA 3WGYA 2EP5A 1A7KA 2VYNA 5G4KB 3ONEA 3RKRA 2Q4EA 1SBYA 4PG6A 5AQ1A 3G1UA 2D5CA 2AEMA 1RM3A 4OO3A 1YGYA 4DQVA 1T2DA 2FHSA 2O3TA 2XXJA 3BYZA 2GRAA 1QSGA 3KETA 4NHEA 1B15A 2OZPA 2VT2A 1C0PA 4JJGA 5JC1A 2Y93A 2X5KO 1GR0A 2FN7A 4NQZA 3QRWA 4WLUA 1ADBA 1UP4A 1I3MA 3MZ0A 1A5ZA 6ADHA 2Q45A 3OH8A 1LLCA 2Q50A 5C7IO 4OGWA 3RBZA 1GEGA 4Z3KA 4XEHA 3ZWYA 4AJPA 4YACA 4RJTA 4CR6A 1P1KA 5AXDA 3U4IA 2VCYA 1P0FA 2CY0A 3GGPA 3A4VA 3BMCA 5DN9A 2Y99A 1UAGA 1KVTA 4FOSA 2J6IA 3DZFA 5L4SA 1NHWA 2F1KA 2Y0EA 3CSDA 4BNLA 1U9JA 1ZXLA 1NFQA 4CLOA 4DPMA 3L4BA 4A10A 3W1VA 4L4XA 3WBBA 3QY9A 1QYCA 2AA3A 1CF2O 1NPDA 1K0UA 5CDSA 3QP9A 3OM9A 3S2EA 1MV8A 3PWSA 4BNJA 5L45A 1V3VA 1ZFNA 3WR5A 1ISJA 1FF9A 1MUUA 1YQDA 4FD3A 7ADHA 2FZWA 5ILOA 1UJMA 2BHLA 3ZWCA 2VHVA 3ZHYA 4RGBA 3KVOA 2C20A 4YT4A 3HG7A 2A94A 2VQ3A 1D1SA 4NBVA 2GO1A 4BKUA 4XJTA 1FXSA 1Y6JA 3L07A 1SOWA 3K9QO 3QJ5A 3B1KA 4ZQFA 3RROA 4PN3A 4P22A 2HMTA 2DUUA 2D0IA 3H7AA 3VKVA 5KIAA 1Z6ZA 1T1SA 3QVWA 3DBLB 3P2YA 2WD7B 1XLTA 3INRA 3C1AA 3H6KA 5AXCA 3JQ9A 1Q2XA 4NFSA 4MP3A 5TNXA 1JAYA 4I8XA 1GQ2A 4XJSA 5AXBA 4BGVA 4BMSA 3LYLA 5T8KC 4R9SA 2J3KA 3NDJA 3TOZA 3JYOA 2ZKLA 1TT5B 1C0KA 4J1QA 3ITDA 5CP8A 4K6FA 4R3NA 2Q99A 1BW9A 1IB6A 4MPDA 2PZKA 1E5LA 4CLOB 4NFHA 1QKIA 3NJ8A 5JPIA 4LGVA 5IZCA 1E5QA 3AFNA 3P2OA 4FSHA 2C54A 2RH8A 4I9NA 4DRYA 1EBFA 4RORA 1DC3A 3EVNA 3C7AA 4FC6A 2QIOA 3I9LA 1NFFA 3FTPA 4TMFA 2P9CA 3D4OA 4IDEA 4XX0A 3WJ7A 1G1AA 3KYDB 1KERA 1OC4A 3ZNOA 2VTEA 4AJHA 3UUWA 3GVHA 1VE9A 4I08A 4XKJA 2ILTA 1DDOA 1GUYA 4IQ0A 4XD2A 1ONNA 2VHZA 4JX8A 3GFGA 4OOFA 3I9NA 4W9NC 2UDPA 1B8PA 4FOOA 1E7MA 4GKBA 3DEYX 3G1TA 4Q3AA 5T8KA 4ND4A 1NBOA 2X9VA 4GGOA 3HN2A 5ER9A 1NQAO 4LRSB 4INAA 1GPDG 3AOEC 1B7GO 4FC7A 4XGKA 1HEUA 1YJ8A 1Q7BA 4H3VA 5F21A 3LU1A 1YO6A 2DUWA 4NBWA 2W8ZA 5FFFA 1V35A 3GDOA 4TKMA 5BSEA 2CUKA 2Q1WA 1GQQA 9LDTA 4BKQA 5IZCC 3HE3A 2NVUB 5IAAA 4NU5A 4Y6SA 2EKLA 2WYUA 5CPFA 5JXWA 4MVJA 4GMGA 1U3WA 5AXAA 3CKYA 1N1GA 3GLQA 4PFJA 4R4JA 1IPFA 2ZTUA 2WEKA 4F45A 4TRMA 3UH1A 3WGTA 4UEOA 2PFGA 4TKLA 4WE3A 2AEJA 4DC0A 1XSEA 4WEOA 4IJUA 4A73A 4NNJA 4Z0HO 4MVJH 1QXSA 2Y1DA 3BMQA 4LMPA 1A9ZA 4W4TA 4YWJA 4TQGA 3KBOA 5B37A 3F6YA 3AU9A 5JMWA 1Y1PA 1Y9EA 5EQDA 4DIOA 3DFZA 4FFMA 2NSDA 1GD1O 3D7LA 3HB5X 5DDIP 1F14A 1VJ0A 2PK3A 3FPCA 3GUYA 1R4MB 1VKOA 3RUCA 3FSRA 1EBUA 3UF0A 1GY8A 1U4OA 3OEWA 5GMOA 2ZB3A 4C4OA 2WD8A 1GL3A 4CODB 2YJZA 4ALIA 5A1TA 3GDGA 3T4EA 4D3SA 2ZATA 1PJ3A 1DJQA 3GRPA 3VHRA 1XQ6A 5IDWA 2FR0A 3L0DA 3ZWNA 1QR6A 1PEDA 5BSGA 3UHAA 5IJZA 4DQUA 4G2NA 1UZMA 3EK2A 3ADOA 2HAEA 5H81A 2BFPA 5G0SA 3WFJA 3NGXA 1HT0A 1IOLA 3LT1A 3KV3O 2IEBA 2ZJ0A 5DP2A 5I9MA 5JY6A 3QA9A 2EF1A 5JDIA 2V6MA 3FPLA 1H0KA 2FR1A 2P5UA 3E9MA 1VRWA 1WZIA 4QECA 3H5RA 1U8FO 3WNVA 5ICMA 2Q1TA 3QWAA 4FGWA 2GCGA 1X15A 1PIWA 1HKUA 4D41A 2HRBA 5HS6A 4JLWA 3GC6A 4FB5A 2X8LA 4G81A 1SEVA 2EERA 1TVEA 3HWRA 3DAFA 1K5HA 3OQBA 1WP4A 2X5OA 3HFGA 3KEOA 3H5NA 4J0EA 4RO0A 5EIOA 3RSHA 4NFYA 2X86A 4BO3A 1HYHA 1U4SA 4XZ3A 3B20A 1OI7A 3M1AA 1B16A 3QSGA 3S2GA 1DPGA 4Y67A 2EGHA 3UVEA 2B36A 5IXYA 1ENPA 1HYGA 3A9WA 2JKVA 1QRRA 1A27A 1GV1A 5DCUA 4WCFA 1QMGA 4IDFA 5JCXA 2BF7A 3PQDA 5DF1A 1MP0A 1L7DA 2PV7A 3OJFA 5HA5A 4WNCA 3RD5A 4CL3A 3HB4X 2X5JO 1WPQA 1KEWA 5ENDA 5T6BA 3DOOA 1MXFA 1ZVMA 4LK3A 4GQAA 4IDGA 4MO2A 2IEDA 3I4FA 4B4WA 3VDRA 4XGNA 3RI3A 3M2PA 4IY1A 5G0UA 4DPLA 3ADPA 2TMGA 4UREA 1DIBA 1J5PA 3GFBA 2D4AA 1GPJA 4NMHA 4KQXA 3RCBA 5A05A 3SJUA 1QLHA 3JD4A 2NLOA 1NXQA 3H9JA 1PS0A 4E3ZA 1O95A 5EPOA 3WB9A 1O89A 4J4BA 2W2KA 4BNIA 3RJ9A 3I52A 4B7UA 4D46A 2PD3A 4OKIA 3NT2A 1ZIDA 3IP3A 2X0JA 3I6IA 5BSHA 1FJHA 4EDFA 5HM8A 1U5AA 4IZIA 3ZWMA 4WPGA 2GN4A 4ALKA 4B7CA 3BTUA 1HZZA 4NK4A 5I8ZA 1HXHA 4PLHA 1LSSA 3GK3A 3TJRA 4MIYA 3QVXA 5I9LA 3U62A 1GCOA 4QQRA 2DBRA 3F3SA 2B4TO 1NR1A 4PCVA 2GZ1A 1I2CA 4I5EA 3TZKA 1OMOA 1IZ0A 4YAIA 3JQ6A 4CMIA 1QYVA 2Q2WA 4CQLA 5T57A 4TVOA 3P5SA 3DMTC 4AL4A 4JBGA 2CVQA 2VZ8A 2Q1UA 1C1XA 1KVUA 3GH3A 3ZWXA 3DBVO 4Y98A 2NV6A 3AI3A 1M66A 3RBVA 4WNIA 4E5NA 4EI2A 2IODA 3D5QA 4CMEC 4J1NA 4DIBA 5I8WA 5JSFA 4ND1A 4E2XA 2PGLA 2C7VA 5A3VA 1T4DA 4IIUA 1DLJA 4GBJA 3S2IA 3U9LA 4YJGA 1W6UA 4WECA 5C7OO 4BNTA 4BOYA 3VH2A 1RM4A 4CQMD 1AE1A 1M2WA 1B3BA 2QZZA 4ZRNA 5KKAA 5CEEA 1G6KA 2X0RA 4O1MA 5GZ1A 3DTYA 1R4NB 2EV9A 2UYYA 3VDQA 2NADA 1B2LA 4ESOA 1PZFA 3KSUA 1J0XO 1GADO 1E1LA 3EC7A 2BI7A 2GR9A 1RKXA 3L6DA 1C0IA 4IIVA 3D3EA 1P44A 1EUZA 1QYWA 2HCTA 4XYMA 2LDXA 9LDBA 1HDZA 1F8GA 2HMWA 2FWMX 4OAQA 4BHTA 3IJRA 3RC9A 2NVBA 1GUFA 3WNQA 1XEAA 1A4IA 2C07A 3H9GA 8LDHA 3PJGA 1YRLA 4JROA 1RM0A 2DBVO 3DO5A 5U4QA 4XB2A 3EDMA 5HWSA 4GVXA 4YJHA 2WSBA 4UUOA 1X0XA 4YVFA 1EUDA 3AOEA 1ZKMA 3QVOA 3FI9A 1ZK3A 4NIMA 4XR9A 5L95A 1PJBA 3QVTA 2Y0DA 1X1TA 4YQZA 3ETGA 2B5VA 1R16A 3ABIA 3B70A 3WWYA 1ONPA 4MKXA 4NZ9A 4RPGA 3S2FA 2R00A 1X7DA 5K0ZA 1BRMA 1MA0A 2H63A 4GGPA 2PR2A 2EHDA 4GSLA 4ILKA 2RAFA 3ENNA 1TEHA 2YQ5A 3I83A 4UVDA 3ZWBA 3ZN2A 4CLEA 3B1FA 4JJFA 3NX4A 4JBIA 2CD9A 1SB8A 4IGEA 1KOLA 2WD7A 1I2ZA 4LVCA 3RKUA 1Q7CA 1Z82A 1UAYA 1YH3A 4XIJA 5ADHA 4GX1A 5KNLA 2QZ9A 4Z0PA 4L0QA 1FMCA 4E31A 3QWFA 2BH9A 3PYMA 4HFNA 1CJCA 1ISMA 4XDZA 4YB8A 3GNQA 3TZ6A 4CR7A 1T1RA 2D2IA 4HY3A 3COSA 2X0IA 1KYQA 3DHNA 4GH5A 2CF5A 3E9QA 4YT2A 2HMUA 4LCJA 1LNQA 2OUIA 4CMCA 2C5EA 3ZU2A 1E1KA 2JD0A 1JQBA 3BAZA 3VPHA 3ZWAA 3CMMA 4GAEA 3TPCA 5DCWA 1Q0HA 2O7SA 3AU8A 5AYVA 3RUFA 4CQMA 2C29D 2O3QA 3ZU5A 2J3IA 4PLZA 2ZB7A 3NT5A 4BV9A 2WJPA 3GHHA 2CVZA 4I5FA 4D45A 3H9UA 3PXXA 1NX6A 3B6ZA 3R3SA 3RU7A 3I3OA 3PHHA 1ZMTA 3FTNA 1NR7A 3H2SA 1PX0A 3BMCB 3HNPA 4MKRA 5CEFA 4L4SA 4R51A 2OFPA 1RYDA 3H3JA 4EZBA 4OL9A 4Z9XA 2X58A 3ROQA 4E5PA 3WGOA 4WLVA 1P33A 1KEVA 4IJVA 2GZ3A 3N58A 2HK8A 2JFFA 1LRKA 2DTDA 4J4HA 5ILGA 3VPXA 4ZN6A 4AICA 3IUSA 4UEJA 3BXXA 3E1KA 5FYDA 3PTZA 1E0DA 3SJ7A 1SMKA 3TL2A 1P1HA 4P4GA 5G0TA 1PGPA 2ZCVA 4YT5A 1H9BA 1ID1A 3C8MA 4H15A 1AN9A 1C14A 3JQBA 4K6CA 4MVJE 3JD1A 1YS4A 4TWRA 1AXGA 3JQ9C 2GPTA 4RLHA 5HS4A 4OXNA 1D1TA 2NQTA 3GVIA 3RIHA 2E82A 2V6FA 3EGOA 4EEZA 5JYDA 2BELA 4P4LA 4HADA 3NV9A 4IXWA
chains in the Genus database with same CATH superfamily
4YUZA 3E18A 4XH9B 1GZVA 1YR3A 3MCVA 3I6MA 5KO2A 2D5AA 4HL6A 4YUWA 2CFTA 3M1IA 2HO5A 4AUMA 4DLRA 3GXOA 1IOVA 2PM8A 2FUG6 5T3YA 4PX2A 5LDDC 3UHJA 1J7KA 5J63A 3H11B 4LHWA 1YU9A 3BF7A 5FRDA 1ZEJA 1KMMA 2OAQ1 2P6UA 3S2YA 1HDYA 4PAGA 2AW5A 1RPZA 4ENPA 3BGSA 5E7MA 5F5LA 2AX3A 4H7FA 5AHKA 1W30A 1GLNA 2MT9A 3AUXA 4KL8S 3AR7A 2BCJQ 2YHIB 1P0CA 4KDRA 2IHVA 2KMLA 3X3HA 2I66A 1FFYA 1Y4SA 4GF5A 1N3LA 4WDQA 5I9NA 1RP1A 3G6WA 2OWDA 3BRQA 1VLLA 2IW1A 5KHOC 2KBEA 4CL0A 4ESEA 3C97A 1C81A 2JBAB 5KNCH 3IAHA 4FN4A 1IK4A 3FPJA 4H7HA 3SIRA 2QNBA 3DCYA 3UXMA 1EP1B 1OQAA 2VBCA 3GCZA 1Z08A 3ISVA 3WDKA 2HGZA 4F4DA 2SHKA 4OUDB 1N0VC 4G8JA 4L4RA 1GPNA 4MIOA 3I37X 2YYYA 3Q6IA 4I66A 3DEKA 4CLDA 5JRDS 4C21A 5LWQA 4XQ9A 3WMXA 4WLNA 4WD3A 4MLCA 2W2PA 1E9DA 1KC1A 1ZHHA 2D2FA 4BLTA 5EUCA 3OPYA 1WZCA 1F3OA 4E31A 3PNMA 2XTZA 2HBQA 3D6TB 3TO5A 5AW7A 2B9EA 1RQGA 4RF2A 4MYHA 3B60A 4GPTA 4IH4A 1MXHA 5CGQB 3G2HA 4ZT3A 4W99A 2P9EA 5MN4A 4CCSA 3ZJUA 5CA0F 5ED4A 4WUVA 4HS4A 3COYA 5KB3A 3T95A 3DF9A 3DD5A 2PUVA 3IDZA 3U4AA 1BMQA 3F5DA 3EEFA 4O2AB 3Q2IA 3STWA 1U28A 4Q1FA 4G5QA 4LQCA 4E88A 1EFKA 3DULA 2EVWX 3P7MA 3OZCA 5AUQA 3AZOA 2FR8A 1ZJ4A 3CH5A 2JCGA 3D3WA 3PGXA 1OJLA 4NMWA 2WZDA 1W1WA 2AT1A 1OREA 2QV0A 3MMSA 2FMIA 5IBRA 3GR6A 3DE4X 1GZ5A 1OE0A 4C20A 4UDYX 5E4YA 1HL7A 1QJ4A 4N7RA 2Z4RA 4W82A 3T4XA 3WLOA 2C94A 1JL3A 4KAXA 1MR3F 4G5FA 4UUQA 3T5AA 3V6MA 1NVMB 4JASB 3ELDA 3U3ZA 5JISA 5LMNB 3H2GA 4WZAB 1CZOA 3SE0A 4LRQA 4CN8A 1P5FA 2NU9A 1PI3A 2Q8NA 3R6GA 2YWDA 4JNKA 1VG9B 1JKMA 5DOZA 1LEHA 2IYNA 5ENVA 2OV1A 2H1OA 1U90A 2C2OA 2VDRB 2XDAA 2XZTA 3AHIA 2R85A 3HN7A 4IVRA 4UM9D 5HMMA 1WCV1 2ACKA 2HSDA 2R6DA 3A6FA 3UMFA 4FB4A 4M0MA 1VRCA 5A04A 2C98A 3MCAA 4D42A 3LLSA 1FMLA 1ND5A 3HUFA 3R3HA 3MS2A 1P4HA 1SKYE 4NAHA 4ENTA 1L1QA 1V3UA 3IAEA 1BD3A 1YONA 4GECA 3W06A 3JAWB 1TEXA 5BN4A 4G6ZA 4YRGA 2NU7A 1DEXA 3PDJA 2WUWE 4AUKA 1N1MA 4HV4A 4R0VA 5I7FA 4ARZB 1E92A 4NDNE 3VZPA 5LQKA 1QMPA 1VPWA 2FQ1A 1LRLA 3U3XA 4IX9A 1BFUA 1U0OC 1L5SA 2REOA 1T3TA 4M1ZA 4QXOA 3E7PA 3GJTA 5JI2E 2GILA 2XB4A 1ZXXA 5DYYA 2AKYA 4C4SA 2YFYA 4F21A 1A1SA 2NAFA 2AI1A 3D3JA 3U31A 1OA0A 3WHPA 2QJRA 4Z5XA 3BIJA 1RPTA 1EFUA 1CQXA 2ZJ6A 3UO8B 1PWXA 4ZP1A 5DLDA 5HCIA 4F5EA 3ETDA 1MBZA 3NIGB 4P3KA 3DMHA 4DLXA 1Z56C 4F12A 4AK9A 3EDYA 3HU2A 2JDIA 4L76A 1Z0DA 1W85B 3GRRA 4N9WA 4K1XA 1H22A 1X77A 2Q4RA 2LKDA 2OV3A 3CSUA 3FRIA 4F6RB 1AS3A 3LT2A 3MXTA 4M8NE 3ZY5A 2ZIXA 3W5HA 2D5IA 4LBZA 1RHMA 1T9GS 1RWPA 2AFHA 2HL6A 2QMYA 3LUFA 4QJBA 5A1JA 3A1SA 1CR2A 1BGWA 3LK7A 3PU6A 4L57A 3ZW8A 2IYQA 4HQ0A 1RLTA 2I4LA 2P2NA 3FA2A 4BL5A 1GNSA 3IQWA 3LIIA 5ICSA 2JJYA 3GGCA 3OCJA 1GTMA 3S1AB 3I4CA 1KEZA 4GXQA 4RKFA 3OICA 4WHMA 4JC8A 4GPIB 2X15A 2ZOSA 2QL5A 3IBTA 3SKVA 2J32A 3AQIA 4IKEA 1ETHA 2GBIA 1UJ5A 2CMKA 2DH6A 3QE9Y 5CJJA 2DU8A 5JNRA 1FP1D 4MRMB 2BIFA 4R1OA 2J3LA 1XTSA 2VJLA 2X9LA 3Q7IA 4CL8A 3L1KA 5AT1A 3UK0A 4NU0A 1EXDA 2G17A 2HWUA 2I4NA 3BSFA 3K05A 1H6CA 3UB2A 2ODPA 1THGA 3I8OA 2QJOA 1R66A 2V55B 3LK6A 3PNYA 2KB0A 4LQ4A 5FHQA 2PU5A 1QRDA 2QTGA 4EATA 4IMRA 3ODPA 5A9RA 2P6NA 4NZYA 1A7AA 2HLDA 4MUAA 3CLRC 1OLXA 3UJDA 3FYTA 2XX3A 4MRAA 1CJSA 1NL3A 1ZVQA 4HQ6A 1WVGA 1K6XA 1GUDA 2XKBA 3HA5A 4ZYVA 5AVOA 3WO1A 4PZYA 4E2YA 4HX2A 4CMAA 1Z7BA 1CF4A 1FXUA 4XLLA 1XO1A 1DEKA 4NYJQ 1WD5A 1LV8A 1Z2AA 3ROPA 4URUR 3G5LA 4MMYB 1LCIA 4PICA 1E3JA 3DDUA 3V8MA 1L4LA 1Q0TA 1DO8A 4IEEA 1KFEB 2OD2A 2Q49A 3F90A 3T0FA 1A4UA 1F60A 1WHSA 3AJRA 1L5YA 1F5SA 4BKPA 1NPYA 4BVEA 5AVZA 3TLGA 3LCVB 5HCUA 3BJIC 4RS4A 1EDOA 3RUDA 3NBQA 5FWNA 4ZJZA 3ZDEA 1KVSA 1YASA 3PPWA 1YQEA 5TQ2B 3WGVA 1SKMA 1X1AA 4R5HA 1BXGA 4EI8A 3CX6A 2PIDA 1JSXA 3TKLA 4S1OA 1ULHA 4U02A 3OE7D 5FT9A 1JILA 3P1JA 3TZEA 1GCAA 2ZULA 5EQFA 2XGGA 3I01M 4PO9A 4F46A 3G2KA 2HDWA 3PEUA 1YBFA 2XLBA 1M1YA 4FZJA 1YFKA 4KSCA 1FW6A 3B7PA 1LH0A 3ILVA 1MH1A 4R1NA 4R1UA 2DVMA 3GY0A 4V0QA 3HJHA 4M0UA 5AVVA 4CKCB 2VAWA 3TPFA 1GDTA 1KYXA 3NM4A 4DSTA 1Z5PA 1B74A 4MHTA 4FZ5A 4OK3A 1N78A 2QW8A 1P7CA 1WABA 3AUAA 3TSWA 1DKNA 1E6EA 3FJOA 1AZTA 3MMXA 3QI2A 3DAGA 2EIHA 4KQCA 4ID9A 1U3TA 2QD4A 3G8DA 3PI6A 3RNLA 3UA3A 1IQ0A 4IILA 3U39A 4B46A 4CTOA 1XQ9A 3ZCRA 5AW1A 1M6NA 3QG1A 2NIPA 3ES9A 3EGDB 5K6AC 1KEUA 1LBTA 1UF9A 2CBXA 2ZBQA 4HQLA 4QPDA 1T6YA 1UMBB 1Y42X 3T52A 5CFOA 1T8SA 5KNDH 2Z2YA 4RVNA 4BEBA 1GFWA 1XK7A 1PJQA 3COJA 2XB9A 2CCJA 4YUXA 4E5DA 3AR5A 1EQ2A 2QRJA 4D97A 9ATCA 1WU7A 2W93A 5C1PA 2WIJA 3QITA 1VMEA 1OLSA 1H4TA 1QIIA 4LHVA 4D9NA 5MF6A 4PGAA 5F73A 4BO5A 3JQFA 1FDWA 4RTMA 3U4CA 3LM8A 1OD6A 2PKEA 3B9BA 1W0CA 1Q3KA 3VBCA 5M2QA 4L0MA 2AVDA 3U2QA 3ZK9A 3ZNPA 1XWFA 5ADUS 2AMLA 2ZRAA 1RRCA 2J0QA 3CG4A 5CR9A 2IYFA 2QX6A 4IUCS 2HK9A 3I5YA 4MB6A 1XA4A 5KYYA 3H97A 3KYCB 4GYJA 2GZAA 1LV7A 1N2SA 3SVTA 1SVNA 2AZ4A 2XZOA 4DZZA 1DU4A 2QQ0A 4F4IA 5JXGA 2Y1WA 3UPTA 4XQEA 3NJRA 2BGGA 3IBCA 2JIOA 1FSFA 3MJVA 3W1EA 3ZCUA 8GPBA 2IZ1A 4MVJD 4WLEA 3TL3A 2Y1LA 3C24A 5CLJA 3M9WA 5JFGA 3H9EO 3H9QA 2XMCA 4L28A 1PR9A 4DMGA 5DLEA 4QOJA 2FSFA 2XAUA 3H5LA 2G9VA 3U7QB 4OMFG 3TW8B 4WXHA 3K8OE 1XDBA 4UPDA 1MKYA 1JFLA 3DFIA 1X7ZA 2R8BA 2Q3BA 2XNKA 2X8AA 4RJJA 4S04A 2GXAA 3LF1A 3QWBA 5JS8A 3QTBA 3M3DA 1IHOA 2WF9A 1C3VA 4UHJA 1TVMA 3IJEB 4JLKA 3LAWA 1AD2A 3AOGA 5JHHB 3ZGYA 1FFXA 1ZL0A 3OM0A 1IM5A 4RGVA 1PS9A 4J07A 4U2DA 4Q02A 3RTDA 3VO2A 3E70C 2FDCA 2O52A 3DP7A 2NVUA 2IYAA 3PE3A 2D62A 1EK0A 4BRZA 3NETA 1XZEA 3EXAA 2VAPA 2DG2A 2RB5A 2VHUA 2WIKA 3IAM6 4UE3S 4NEHB 2NSYA 4PY2A 1QS0B 1H1DA 1LJLA 4I36A 4RQUA 2P41A 4U7FA 3W6ZA 3HA2A 3T7TA 5EJIA 3O9ZA 2DHDA 1EHYA 3D1JA 5D86A 3RRMA 2GNPA 3U3MA 3DE6X 1A9TA 1IMOA 3EA5A 1WCIA 3I9V6 2YN2A 3OP4A 4B6FA 3TF5A 2QUKA 2RHRA 1RJEA 1IPEA 2IHTA 4RTJA 3IBGA 5FBZA 1BSVA 4EG0A 4L1KA 3LBFA 1RQRA 2XYPA 3MB8A 1GUAA 2NT4A 4EPXA 3N2LA 3NXKA 5HJ5A 5DHUA 1Z33A 3AUTA 1GU7A 4MSUA 5HFAA 3BHIA 3DVAA 1MPTA 2RB4A 4A26A 8ATCA 3LI2A 3O26A 1G20B 1QHNA 4LV8B 3X2EA 1N2EA 3AEUB 3JQAD 2MSNA 1Z25A 1UK6A 2I6SA 1MDFA 1W0JD 4MPJA 4MW1A 1Z17A 1UWKA 1YBHA 3U81A 3ZEAA 2VQFB 3Q7SA 2WABA 2D7DA 5TR9A 3SS9X 2PGIA 1A5SB 4EYGA 1F0YA 1RRMA 4TLBA 4AQYB 3QELA 2Q8PA 4M7OA 2QX4A 2GQ0A 2M6RA 3RIGA 1EAYA 1SPXA 2IOFK 3JQ8B 1HRDA 2AYYA 4B81A 1NI5A 2V7WA 3CEHA 1U7HA 2NVOA 2OCYC 3CR8A 3DWIA 3FI0A 3OIFA 5AIAA 1G21E 1POXA 2QTTA 2F43B 4O08A 4WAUA 3TTSA 2RGDA 4XWTA 1IXKA 1MGOA 4BFCA 2DQYA 2KHZA 3V2IA 3I2GA 4BNDA 3VNRA 1RRKA 2EFEB 3HJTA 4BMOB 3FNEA 4C6TA 4LZLA 5J1TB 4DLAA 3JY6A 3TG8A 2VYVD 5FUXA 2YVAA 3S8MA 3HVRA 4IPTA 1U5BA 4QFDA 4EHNA 3FGNA 3BX1A 1KPGA 1HE4A 4DYDA 1H2FA 4K9NA 1BDHA 1R5OA 3P0HA 2BMWA 2JATA 5CLLA 4H1WA 3OQMA 1CPYA 3K6KA 1X86B 2F48A 4NZNA 4G65A 1ADYA 2XD9A 3WO0A 2UUBB 1U6KA 1R5NA 2P3SA 4GLLA 4HRYA 3ZE9A 1ZIYA 4LJAA 1ECJA 1Y8QA 3ABQB 5BSVA 5HGXA 1SVOA 1AURA 2VJQA 4L5BA 1U0TA 4ER7A 2PGAA 4FIDA 3H6GA 1GTSA 3KOYA 3RU2A 2JLUA 1XEFA 3QKWA 4MW0A 3G9XA 3NYIA 4A03A 4ZVQA 4EHBA 1BIFA 3EMVA 3FHTA 1W8DA 3A2KA 1M75A 4HPWA 4HAYA 5DMXA 5I7VA 2X3YA 4C7XA 3TIXB 1UODA 4GDFA 4C2UA 2UVDA 5BNZA 5E7IA 1UT8A 1E89A 1RHQA 3OLVA 3QGMA 5K3FA 1ZGGA 3VX4A 4AU1A 1HE2A 4ETIA 4MARA 1RXEA 5AKGA 2Q5CA 3IIJA 2QQ5A 1JYFA 1FFGA 1LA2A 4BBJA 2FK7A 3AFHA 2QY9A 2HC9A 2II6A 2VXCA 3ED5A 1P61B 13PKA 2QU8A 3EBOA 3BT7A 3LDAA 2VJKA 3HVHA 4CMIB 2F1OA 4DLLA 2HFKA 2VPQA 2SKDA 4DLUA 4JGGA 3ZBPA 2PUEA 1JLLB 1PUJA 2ZEJA 1RE1A 3MK31 4MQMA 5JO9A 2G5PA 3INGA 1SVKA 2PKYX 1P81A 3PL5A 2VSXA 4MK4A 5BW5A 2DB3A 1F9AA 2HXSA 2BBSA 1D2HA 3PA6A 5AK4A 2OBXA 1Z7EA 2JANA 2PYZA 3HHEA 4GOLD 3CVWA 1CNEA 2X7JA 3TECE 4M0EA 3RNOA 4A0SA 4PIPA 4NOJA 1YL5A 3UH0A 1OTYA 1YS9A 2XRMA 1M1YB 2BY4A 3AB7A 1E1MA 3ZKWA 1PZNA 5KOJB 2EBUA 4Q9NA 4BLOA 2PKQO 1RVV1 2CVOA 2J07A 3RYTC 5EJ9A 4WLFA 4EY8A 5I7OA 2J6BA 3VVBA 4OHYA 2GEVA 2RHJA 2VJNA 4MJXA 3O6VA 3ZC3A 2CE2X 1EU1A 4B6SA 2JGIA 3Q40A 4KPYA 5JYBA 3AESB 3AUYA 1GXSA 2EHJA 3WMRA 1Y81A 2MIIA 1OX4B 2QLMA 3L4BC 3AZPA 4Y3UA 1TA9A 4DB4A 3O7MA 4ZAWA 4G5RA 3TNJA 1M6WA 1SJ9A 2BEUA 3JQQA 4WZAA 3ENQA 4YECA 3OBBA 2QZ4A 4HDNB 2CVHA 2RH4A 3RT7A 4EOGA 2ODEA 3IMFA 4G09A 2JH3A 1GSOA 3OFJA 1VL5A 2BM8A 5F3RA 1J2TA 1TQDA 2AQIA 2IFTA 3OAAA 3HLYA 2WIGA 4MQBA 4R41A 3PQCA 1R6XA 2H1FA 3SJCA 3DP9A 4JGBA 1F06A 4K40A 1HLPA 2OO3A 3AIMA 4D82A 5AD1A 3OKAA 4Q4LA 5CLHA 1QWOA 4V3BA 1Y7LA 3PNQA 4J6FA 1V5FA 4AT1A 2ECOA 2JHPA 2XADA 2H7XA 1IWBB 2CLOB 2IE0A 3BQNB 3L77A 1SXJD 4K26A 4KB5A 5LL6P 3BHMA 1XDSA 2GVZC 1MO6A 1TYEB 1Z4JA 2NO9A 1Q0UA 3REFA 2BOVA 2Q2QA 3MINA 3RYFA 3WL6A 3GT7A 5EKUA 1B6TA 1R64A 2D0DA 3GGJA 4KQIA 4OHFA 3F5SA 4PHHA 1XFAA 4W5RA 1CUWA 2XLCA 4EF6A 5CHEA 5L7YA 1OH8A 3ZLBA 2JBWA 4QHYA 2IDZA 1M2OB 2PWZA 2Q5QA 4P5EA 1T3LA 2X4IA 3BL6A 5AUNB 4WN9A 5EFOA 5DNDA 1Q0PA 3EDRA 2W4IA 3P27A 1SXGA 1DARA 2PX0A 3W4JA 2EP8A 1ZY2A 1R5JA 1QVWA 5EHQA 2EU8A 3G0OA 3ZWDA 3PCXA 4GMXA 2OT3B 4NBSA 4X9XA 1GDDA 4XSGA 2Y1FA 1D4ZA 4FM9A 3CGGA 3AKCA 3FDZA 2WPDA 3QHAA 4BGIA 3B1VA 3B8EA 1H2WA 3EGXB 1ADJA 1C1DB 2AHRA 1MDBA 2FUKA 2OGWA 2YDXA 2H5IA 2GM4A 1SIOA 2NW6A 3M5PA 4ZTUB 3AVTA 3W2GA 3C7CB 2OK7A 1JHZA 3PA8A 4DRXA 1EUQA 1GU1A 1OA1A 3V1YA 1V9CA 2ZCUA 5BQ5A 1SKAA 2WUGA 2ZB4A 4HDQB 2JIRA 1BX3A 2GCOB 1GTG1 4HDMB 4G1VA 4KVZA 4MGYR 4LJ7A 3W90A 1KAHA 4C0SA 2JBHA 2QXUA 3DMDA 5FBQB 4RNCA 5IT5A 2O0JA 4GOOD 1IIBA 5KVVA 4X65B 3I23A 5A4MS 3I64A 1IN4A 1DTEA 3BICA 3DMTA 5AJTA 5JBIA 3TOCA 5J3JA 3FPBA 2ZQZA 4WQMA 4O33A 1PT8A 4B7AA 4MWBA 3GG9A 1QU2A 1Q19A 3DOEA 1CVLA 1ELOA 1TADA 2IU3A 1LW6E 3AIIA 3HC7A 5B2FA 5EXDA 1GYRA 5J2UF 4HK4A 4D8TA 1F2UA 2GHIA 3Q98A 3RFVA 2DUMA 4QFCA 1RXVA 3OFVA 5TMEA 1VGVA 1GRRA 4U6SA 3BGOS 4EKEA 1QDUA 3CY6A 2MMCA 2G25A 1G5RA 3C1UA 3Q7EA 4QQKA 2UYGA 3K30A 4O2BB 1V5GA 1A0OA 1KPHA 4OAPA 4Q39A 3IUPA 3DMYA 2QY6A 4MGEA 2P79A 3HFRA 4IJQA 4X91A 4Y9DA 3WK5A 4DNQA 1WDLA 5F1KA 2VUUA 2TRSB 4IXMA 4DXDA 2G40A 4PRLA 3QWHA 1UQUA 1DCKA 1K7CA 3HKEB 1H8HD 2UYOA 3FRJA 2BTOA 4Y7CA 2Z3WA 3UIEA 5KWEA 1APBA 3A9TA 3CUTA 2I71A 2I9KA 1G42A 2Y67A 2V97A 5CIWA 3FR7A 3UHFA 3NIDB 5EIHA 1F9EA 1WHSB 2B7CA 3CX7A 3DVSX 3WXBA 4BP8A 2F3QA 3B1WA 1ZA1A 3FTFA 3ANMA 1TUIA 4K9DA 4FU0A 1XN1A 1W1UA 2HMSA 1J9ZA 4PHFA 3AKEA 1AUQA 3KOMA 4M3NA 4N3GA 1WZUA 3Q0EA 1E3LA 4EFLA 1UBRS 3ID6C 4UAJA 3RK1A 1O8CA 2ISQA 1ZSVA 3I4LA 4EYOA 5BMVB 1ZJYA 3IXQA 3RYHB 5KOHA 3VBEA 4FGLA 2NN3C 2XVYA 1X7XB 3CYFA 4JJ7A 5BV8A 4P3YA 5CX1B 1WW8A 1E1QA 2DULA 2ONKA 2XPCA 5THXA 4B83A 3PITA 4C3VA 2ZBVA 4FCVA 2Y8EA 3ER6A 2C1XA 2J3DA 2QVXX 1EVIA 3SEAA 2RHGB 3BAFA 2O05A 1DAPA 2XDWA 4QO8A 1OFHA 2ZYUX 4B3GA 2N3ZA 1RAEA 3UNXA 2EW8A 4BFWA 3T9AA 3NPMA 3VNBA 4MX8A 4IICA 5HX7A 1PWHA 2FPMA 4RDHA 1A8PA 4H08A 1UOQA 1WXIA 3D2CA 4WI1A 1EUDB 4HCJA 5IKOA 3WKEA 1V1RA 1KO8A 1WXWA 4JHXA 1J1IA 1TM4E 2J4CA 3HCWA 3FB4A 4JS0A 4YJHB 5BT8A 4U9HS 1MHTA 1LXCA 1R0WA 4LYYA 2HR1A 3ZCVA 2DWPA 3ONFA 1SUWA 3HYRA 2JLXA 1AF4A 2WG1A 3EWAA 1S6YA 2I67A 4HFMA 4XGRA 4ZI5A 3RBXA 2OGUA 1PHRA 3S70A 1DG9A 2BFAA 3KKKA 2OLEA 1G3RA 2P8SA 3PPXA 1ZSYA 5DM0A 4AJ4A 3DNFA 3C6XA 4A92A 1AHIA 2W6NA 3PJEA 3PT5A 3DE2X 5JFOA 2QW0X 3GROA 5G1PA 3GX1A 4UHCA 1A9XB 2O50A 2QUZA 4EY3A 1GQOA 3AR6A 2GTIA 4YTEA 5K0LA 2QROA 2V0GA 5KSWB 1H2AS 3DFKA 3VR1A 4NBNA 4QELA 2R5WA 3BMOA 3LA6A 5KVAA 1DZ3A 1JT2A 1P1CA 1D2EA 1WVMA 2G1KA 2XB6A 3FFAA 3G17A 1OY1A 2JLQA 3I9MA 3OBIA 5DEOA 1ESCA 2HT1A 3RVOA 1C7EA 2RD2A 1DTWB 2E55A 1KDYA 2HQBA 4I9HA 1MIOA 2CLMB 4MO9A 4MROA 2H1CA 4AY4A 1JIKA 4XOUA 2YMLA 3A05A 4IO0A 3LQRA 2XNJA 4J7XA 1ZIOA 3S0JA 2E6UX 1NVKA 1UWLA 5FDFA 2XQFA 2Z2KA 3DUFA 3KM0A 3QMPA 1WZEA 3EYWA 4O5OA 3G89A 3AM3A 3GRVA 3AETA 2FE1A 2C88A 2I03A 2ZIUB 3KUDA 3SX2A 3ETJA 1JKXA 2C2BA 3BZUA 2Z2ZA 4TZTA 2QTZA 5FTLA 5M7EA 2JKZA 4Q15A 2HPAA 4E5YA 1OU4A 3INTA 5KU1A 1W73A 4D9IA 1QZXA 2J0UA 2ZSDA 1J6UA 2R44A 3NWEA 4YFVA 1OVMA 3R4CA 1E61A 3BGDA 1ODIA 3ND5A 3O7WA 3OCXA 4EB0A 3KD2A 3E7FA 4MQEA 1Q7EA 1XMVA 2DOKA 3RC1A 2AD1A 5K9ZA 4KR3A 4OXQA 4TTPA 3RUPA 3PFHA 4FT2A 1VIMA 3H5TA 1J97A 3IR5A 4JQCA 1T3SA 1UM9A 3B3AA 2DAPA 4KG7A 1D6MA 3USZA 2Q3HA 2AI2A 3K09A 4JBWA 3ZEIA 4ZHQF 1Y3AA 4E21A 2FSVC 4XPZA 1M2NA 1ZRNA 5C7LO 3R7NA 4UTPA 2PX5A 3EZLA 4JSYA 3NBFA 3ELBA 3SXJA 4GP6A 3G5MA 4ETMA 1YS1X 1OX4A 3DLCA 5A4KA 3AUFA 4QU8A 3OT1B 1WR8A 1SUPA 3PQFA 4WXEA 5JZVA 4K0KB 1R9MA 1TJ4A 2MU1A 1LQUA 2N1BA 5LP6C 1NWHA 3CVVA 1ZM2A 4F8YA 1B42A 1SPBS 2GAIA 1F2DA 1XMSA 2H1VA 3WJAA 4E5KA 1V2GA 5M29A 5EMNA 3RHSA 2OQVA 2PJDA 3DTVA 2ZXUA 4P98A 5CNIA 2FFJA 1KZHA 3PDCA 1Y80A 3T5TA 4JQSA 3AFMA 1A9SA 4XEUA 5GONB 3SOPA 4RHEA 3UOGA 4RMJA 3NWPA 2XWJI 4V03A 3AK4A 5KX5B 2HCJB 5D01A 2JL1A 2R4QA 3P9RA 3NUQA 4QDUA 5KQGA 3U19A 4DC9A 5FPKA 1P29A 4I9UA 1RHRA 3ZXXA 1QPGA 4CMBA 5EUQB 4DKJA 2H0QA 1MORA 1P4RA 3ZY3A 1EGHA 4S1TA 5EUBA 2Z30A 2JFBA 4G8DA 3RRFA 5EIXA 2CHFA 1T9DA 3EBPA 4PZPA 4ZZ0A 1DEOA 4D4HA 3VNVA 1BCSB 3QI7A 4LVOA 1CF9A 4QAQA 3ZDRA 3AB3A 3IVXA 2QD1A 4BO7A 1N2HA 2ZYGA 1ZW1A 2CFSA 4ITUA 4LV5B 1XF1A 4ZJPA 1MD9A 1F7UA 1J90A 2Z8YM 3LV8A 2VF8A 1UT5A 5K3FB 5JH7B 5K3EA 4DJTA 2X2EA 3QFHA 2IKSA 4S1PA 1SUCA 5ICFA 2IVZA 2D0OB 2X42A 2XV1A 3B6IA 1MO5A 3Q15C 4QT0A 2B5WA 3HYLA 4QDTA 2LD4A 3HWWA 3CR7A 1I7QB 4LYGA 1ZVVA 1CEXA 4NBTA 4QVIA 1N33B 1TCVA 1U28C 3CKLA 3HSKA 1NN3A 3L8MA 3UCFA 3QPVA 4DV3B 3O9VA 2PXCA 4JT9A 1BJKA 5EIAA 3PIDA 1JIQA 1ZYUA 221PA 3U4MA 2E4XA 4DV1B 1LPAB 3SJZA 1VYHA 3ZHZA 2Z8YA 3CCFA 1SBTA 1VKZA 3JZIA 3Q1KA 1Z45A 4X60A 5U9CA 1VE7A 1X39A 1E79D 1Z8HA 4FFSA 4IWXA 2ZDQA 4MKZA 4C4XA 4C6RA 2HF7A 1LC3A 1NM5A 2PL1A 3MQ2A 4TX1A 3DQPA 4MV3A 1A98A 1RP7A 1YS6A 2FP4B 3CZ5A 4UTXA 4V0ME 5F64A 3T0IA 2ATEA 2AOTA 5CVEA 1NVBA 3E3AA 3O3OB 2FY8A 3KKOA 4HNUA 2QB5A 4IHJF 2H9IA 1ORRA 1V5WA 4LE1A 5KOIA 5L53A 1QQ7A 2BFOA 1IEXA 1RXWA 2UZ0A 1PR5A 1WSWA 3M2TA 5ES3A 421PA 4RMNA 4B8WA 5KOHB 3FPKA 3GJYA 3K0FB 3SBEA 3LVQE 3RQSA 1FFSA 4CMHA 2BCGY 5D2CA 1L4EA 2QRVA 3NWOA 1UBTS 1KO7A 2W0SA 2H3HA 5REQB 4CIVA 3U1BA 4GO1A 2NXEA 1O87A 3EIUA 3PX7A 4DA6A 5JJBA 1LI7A 3GI1A 4ZVPA 1FUYB 1S9HA 2ZSFA 3OUTA 3PHLA 4BX2A 3B5JA 5B7QA 3STXA 4EJ2A 2ONYA 4TN1A 2NP6A 4QBGB 4W63A 4KPFC 3T3EA 4DVJA 4R1PA 3UENA 2BFWA 3MJTA 3TXAA 5KTPA 3QNMA 2C2KA 3TTUA 5L3ZA 3E3OA 2QGFA 4WCFC 1MH9A 3CT4A 1YMUA 5BSEA 2Z5VA 1LU9A 1KR5A 1V45E 4ZRDA 3MVEA 2RHLA 2AXNA 4CM3A 2VHWA 2OCXA 3AEQA 5FJIA 4CN9A 1EB8A 2WRZA 1JAHA 1V43A 4KKVA 4TQ9A 3WHIA 5B1YA 5J4LA 1J33A 3M1YA 4FYYA 3R24A 1N6NA 1SHLA 2JIZA 4I1SA 5DSXA 2ID9A 1HFJA 1Q17A 2AX4A 4M8SA 4CW7A 1CY6A 3TLCA 4CLRA 1U94A 2X7HA 5TJHA 1CUVA 2IYPA 3EEYA 4MGIR 3TZCA 3NIWA 3JQGA 3K20A 5EEHA 3PXCX 1U3VA 1T2VA 2PGXA 3AY3A 4MYUA 1N0HA 4MDYA 4NCNA 1CJMA 3H42B 4N49A 4ZCRA 3IAS1 5LP6F 1GNRA 2O7VA 1NIJA 2JCVA 4HH0A 1D4OA 1TVKA 3NKFA 3FNGA 4KN8A 4TV8A 3T3PB 3OKCA 4NZOA 4J91A 2XTMA 4IIEA 3SIPA 3EISA 1QO0D 4XDGA 1PQUA 5B3JA 3RIYA 5KQRA 4RVSA 4CM9D 1NLYA 2IYRA 2AK3A 2PKQP 3HPRA 4KBGA 3JD2A 4BMVA 5ULLA 4F85A 3VDXA 3TCNA 1XWIA 3I62A 2VDOB 1JALA 3OIWA 4HD8A 4Y9TA 5D1NA 5BQOA 2CT8A 2G1AA 3NHBA 2BFNA 3H87A 1OGJA 2K2WA 1Q91A 3CO5A 1FFBA 2HCFA 2OHIA 1RACA 3SICE 1GDHA 4CM1A 2JZCA 1R8JA 4MZXA 2I7TA 2OQRA 3H86A 4XLZA 3S28A 4PYIA 3F47A 1CR0A 3FWZA 2LWIA 4HG2A 3T7KA 3VI4B 1B00A 4YXFA 4K9SA 2EBHX 4O4JF 4AS3A 5LZ7A 4L3VA 2Z2IA 4IRMA 5CA1A 3I32A 3ITKA 5FTNA 5T5QA 4DANA 1H3EA 2DHEA 1B93A 4RV9A 3G79A 1JRLA 1KH3A 1UK8A 1RKVA 2F2TA 2XYGA 3QX8A 4IH1A 4ER3A 4YPVA 3RQIA 2XB2A 1Y8CA 5BUSA 1QHFA 2DYKA 1U7WA 2OHFA 4NOKA 4PFQA 1COZA 1G2QA 1FX1A 2R6JA 4OXXA 2V6IA 3AHCA 4DJAA 3MS7A 3QJYA 2H4ZA 4FMCB 1MT3A 4D4LA 5LZ9A 1QGUB 3AW8A 5HDBB 1YZUA 5COQA 2NM0A 3LDHA 1DUIA 1D5CA 3JXEA 1U8UA 4ZI7B 2B21A 2OGZA 1KBZA 4QBTA 4GMKA 5JALA 4TS3A 1ZNYA 4KE9A 3UB4A 4HAXA 4LYDA 3STTA 5JD6A 1E2IA 4CGYA 4GLJA 6REQB 1J2EA 3O8OB 2E4AA 4GS5A 4JH0A 4Q4JB 3MWEA 2Z58A 4DLZA 1O0SA 4ECEA 4L7QA 3FTQA 3I45A 4FMDB 1Y6FA 1M2JA 1JF8A 2VFAA 3L0CA 4QUHA 3GLHB 2OECA 2L19A 4EHAA 1Y1RA 4FYHA 2GASA 1KI8A 2JEOA 3DPSA 4OHCA 3AMVA 3VKGA 4NCIA 4POAA 1T0JB 2NUAA 2RKOA 4CWAA 1XOIA 3E9NA 4TLMB 1UKVY 1QCDA 1Q0QA 1XQYA 1ZM4A 2FZLA 1NBWB 4HDSA 4OFZA 4D98A 5JCJA 5JSHA 5JAMA 5KWSA 1Z75A 1NGSA 1UM9B 1P8AA 3A9CA 5IC6A 4NCAA 8AT1A 5IVKA 3QVGA 3DBHA 4ITRC 3TBFA 2VJPA 1DBIA 4II3A 4KOAA 2Q9CA 1JXMA 1DDGA 1J70A 4NJEB 4Y2GA 5EP2A 5INTA 5TIIA 3GPLA 1RRPA 5I5GA 3AY6A 1NATA 1JLKA 1MEEA 5IXSA 2PFSA 2QN2A 3KR1A 4QICA 2Q3EA 4TTVA 3EVAA 4Y2XA 4BX8A 2IS4A 2QT1A 3GMSA 4MCIA 3MWYW 1YFZA 1HE1C 3TM4A 2G9ZA 2ZIZA 3GRCA 3SF8B 4TUYB 3OF2A 2FCRA 1PUIA 1L1EA 5KYXA 5LXTA 4NEQA 2A35A 1DT3A 3ELWA 2P30A 4TMVA 5FI5A 5TEVA 4ZHQA 1DZIA 2F7SA 3PT9A 4WJLA 1WNTA 1SXJA 2O2CA 4X1KB 3U7IA 4S2EA 3KPJA 4YJ3F 5A9TA 3BM5A 4DA7A 3OMWA 4DOMA 4I55F 3SQWA 4DIFA 3JAKA 4WESA 4D9EA 2V7QA 1WMEA 3HWSA 3PP8A 1C9YA 2FWAA 3K8QA 3KEQA 3O4HA 4UAUA 1PEKE 3M6WA 2JW5A 2GRJA 5ETJA 3DB1A 4LQDA 2J5BA 4C08A 4ND6A 4I1RA 3DOUA 4LE2A 4E5SA 3EG5A 2I1LA 4RK5A 1TTPB 1IZZA 1S4QA 4QEDA 3PJRA 4KDCA 1L5LA 3EF0A 3QLVA 5J4KA 2A4MA 2HLPA 2I2XB 1LDEA 2GERA 3LP8A 1Z62A 2WTBA 1CP3A 2QN6A 4HX5A 4PRKA 1T24A 3LW7A 3QIVA 5BUZA 1Z0AA 4NBUA 5TARA 3FNFA 3LPMA 5E4FA 3MIZA 1P60A 5BT9A 1YTUA 1FNSA 1M83A 1FOEB 3DEAA 1AF7A 2B25A 1C80A 2OCKA 4GOND 5J40A 2R97A 1H6AA 2IEAA 1QIDA 2OB2A 2GCIA 2FSVA 1E3EA 2JA2A 2NZUG 2IYZA 3DL7A 4DCGA 3UJNA 4X20B 2PL5A 1AB6A 4OQ4A 2IRWA 1UZNA 4MYCA 1A2KC 4EECA 3GZ4A 1FK8A 2CUNA 4X6XA 4YBRA 2JIBA 4JR0A 4JUFA 4WOBA 4YAJA 3DWEX 1WHTB 2FVYA 4UMFA 4FE4A 3BN3A 4KQEA 1BJTA 2DP4E 2P8JA 4M88A 3USCS 4DMUB 1M2KA 2DSNA 3UT5B 4C5AA 1ZO8A 2HA4A 2PWAA 1N25A 2Q5EA 4QT4A 4XFDA 2ADOA 1Z15A 4DMLA 4OJTA 3D4LA 4TMZA 3IAFA 5DYNA 1JZTA 1UT6A 2DTEA 1RBQA 4NDAA 3LZCA 3PUJA 1LX6A 3CCBA 1C7JA 1CY2A 1F2TA 3Q87B 4WK2B 3RODA 4IINA 2APJA 2EDCA 4PZDA 4IV5A 4EL0A 1A9XA 3ROMA 1I4LD 1VJDA 1DX6A 1L8AA 3CIOA 3EASA 5HMLA 1NBMA 4HBGA 1YXMA 4YCCA 3WLJA 1K2WA 2C31A 2WU8A 3ISJA 4B75A 1O8BA 3NDRA 4DHEA 5LU9A 5E1DA 3TVTA 4AQDA 3U16A 5KTSA 1TFRA 2DKFA 1YB4A 1B8OA 1PWYE 1PL0A 1R6DA 1TT7A 2DPMA 3I5MA 4EW2A 1GZ3A 1RIIA 4LJ6A 4XD7D 1B0AA 3NBXX 4HVTA 2HJWA 4ZZ1A 2EW2A 4G5HA 2Z6UA 2VO1A 2C3PA 1NOKA 1UBSB 4FFRA 2V58A 3UC5A 3ICOA 1NDQA 3UBMA 4QAJA 3ECAA 4ISBA 5DTQA 5EMKA 3M6IA 5EQJB 2Y9MB 1OROA 5LOVF 2QE7D 5I9BA 5EFZA 4LRWA 4KX3A 2BEWB 2RAVA 1LPBB 2R00C 1NI3A 5CMLA 1W36D 3GLGE 1QHXA 4QRDA 1FYWA 2WQ7A 4HGRA 2VA9A 2Y6VA 1V95A 4R68A 5J5AA 2GBPA 1ZI6A 1QLJA 1ODLA 2ALJA 3CSSA 3CUUA 4X1OA 4DFDA 5JS1A 3SXUA 1SCUA 4OFWA 3NBKA 3FGOA 3LGSA 4GPBA 2PGJA 1M1ZA 4EJ6A 3T3NA 1QIJA 5IP5A 3WZLA 2I1WA 1FUEA 1CR1A 3Q5DA 4LRUA 2NPIA 4UNSA 1E0SA 3KXKA 3ANLA 2Y27A 3NNNA 1WEHA 3EFOB 2IBSA 2YY6A 3JQBC 1HT1E 1ZXBA 1DUSA 4YREA 1IEVA 3C8HA 1JSCA 3WGZA 3WLQA 2FN3A 1Z0UA 1EM8B 1LVGA 3W4KA 4BLQA 4P7KA 3BMXA 5IARA 4KNWA 3OCZA 4KYVA 1NRWA 4UULA 2A9RA 3MAJA 3ROKA 3CZQA 2W7TA 2G1PA 4HAWA 1FYXA 4ADSG 4RFSB 1D5WA 2ANBA 3OQVA 8ADHA 2H7YA 4OSPA 1C9DB 3O3NB 4N8SA 2YCBA 5DBHX 2EFJA 5FBLB 3STUA 3TZLA 4HGNA 1FNBA 4RULA 5CNMA 1PQWA 1ZM9A 1VKHA 1CQWA 2YZ7A 2QYTA 4BFSA 3ADKA 2IUUA 5AESA 1K8RA 3A3YA 3QLJA 4WDRA 2GD2A 2HBRA 3U26A 4JGIA 4F7WA 1NIPA 4EB8A 2WJJA 3F49S 4OBWA 2HZ7A 4BO9A 4EUFA 4GOMD 1TLTA 5ALVA 4O6VA 5FA8A 2IPAB 3HUEA 4DWVA 1ZS9A 3KWJA 3JCZA 3FOBA 4YRTA 1MC1A 3IV6A 4MPRA 3K9HA 1ZH8A 3GBPA 5E0KB 1TIKA 4ARVA 5KTTA 1T25A 1XMXA 5KNCA 4BDTA 1T1JA 3E48A 3KK0A 1SU6A 2GPBA 3WSWA 2GX6A 4IXDA 3V7YA 2GNOA 3LCUA 4PTLA 4BWYA 2FMFA 1XZKA 1NV9A 2YFHA 3D8HA 4AN1A 1DRWA 1SQ0A 4PQRA 3GNTA 4BNNA 4BNHA 1ZWKA 2LNDA 4HN9A 4PGMA 3NANA 4Q03A 3ZYCA 1GRNA 3DBRB 2JG3A 3KT6A 2HWXA 3PEWA 5FWYA 3DKRA 1S3SA 4DLPA 5JDIC 4CEIB 4NCKA 3O03A 1N0UA 3BPSA 2O2EA 4C06A 2XTJA 1USWA 3BS4A 2P2GA 5TX7A 2IPXA 4LX0A 4LTNA 3IE0A 4DNXA 1GEEA 3ZGOA