1B1HA

Oligo-peptide binding protein/tripeptide (lys hpe lys) complex
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 189
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b1hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b1hA02
3OSRA 1B3GA 1FQFA 2Q2AA 2UYFA 2BJJX 3KBRA 1DOTA 1J1NA 4WEDA 2XXIA 4OFLA 1D9YA 1B4ZA 1OQHA 3A3UA 1B5HA 1SW1A 2NOOA 1B3FA 1B7UA 5CM6A 1IXGA 1MS7A 2I3WA 4P0GA 4E0WA 2RCBA 1VFEA 5CBSA 4JSDA 2OZZA 3PUWE 4OTEA 5KDTA 4NWDA 4UA8A 2O51A 2XXPA 2XXTA 5EHMA 4PE5B 3W9WA 4H8JA 4YKPA 3TTMA 4AB5A 3BFTA 5H8QA 3TCGA 3C36A 5H8SA 3MP8A 1URSA 5J1DA 3LR1A 1DMBA 5H8QB 4R2FA 4HTGA 3PMXA 2GFEA 2V84A 3VLVA 2OLBA 4GOTA 3N5LA 5FHOA 2DWHA 3TDJA 3PGFA 3PPPA 5ICQA 1B40A 1B3HA 3MAMA 4GL8A 1M5BA 1PBQA 1ZTYA 5H8FB 5I56B 1Y1MA 3CVGA 2DVZA 2H98A 4LZ8A 4H5GA 4GLIA 2NUVA 3SEXA 4N13A 3IB1A 4MBPA 3RNNA 3DM0A 4BDMA 4RPOA 2RINA 1WDNA 3FXUA 1SYIA 3PMVA 4XKRA 3T22A 5ELVA 2HXWA 4FIMA 4R74A 1ZBMA 3PPQA 1FTOA 2ONSA 3OO8A 1EH3A 3UK4A 1SI1A 4H5FA 2XXHA 3T9XB 4KYEA 5DT6A 3EHTA 3UGWA 2Y7IA 2QS1A 5AA2D 2GRVA 2ZYOA 3AXFA 1MQIA 3RUMA 5FHNA 1FQAA 4ZECA 2UVIA 3O29A 4EQ7A 2Z23A 3QK6A 4I9DA 4OENA 1SBPA 3K0VA 3OSQA 3RT8A 1BP5A 4BDOA 5DEXA 1VE4A 2THIA 4RPNA 1TWYA 1SD3A 1IUDA 1MXXA 1ZMGA 5DEXB 2B3BA 3FV2A 1Y9UA 2DP8A 1I69A 4QRZA 4GL0A 3UP9A 1FTJA 4THIA 5DVIA 4KYDA 1SI0A 3G3IA 4RA1A 4QSCA 2ALUA 4R72A 3IO4A 3FVNA 5FTIA 2GHAA 3LUYA 4DCXA 4RYAA 4Q5TA 4R75A 3S9MC 2P2AA 1LGBC 3UA8A 3KJ7A 3TUSA 2HAUA 4YICA 4LA9A 4OERA 5JK4A 4F31B 1EZPA 1P1OA 1OQGA 1S7YA 3DP8A 3FJ7A 3K1PA 2ZYMA 3GXAA 1HSJA 4MF3A 3H6TA 2O68A 3O28A 1DPPA 1HSLA 2DWIA 4KPTA 4YB6A 2B65A 2VHAA 4I8CA 1BLFA 3QYTA 1O64A 3LVUA 3TTNA 1R6ZA 2QRYA 1B9JA 3KJTA 1LLSA 3JYRA 4F3SA 4MH5A 4P11A 3TKDA 1POTA 5EHSA 1URGA 1JNFA 3HN0A 3SKPA 5CMBA 1P1WA 2I48A 3DRFA 1AMFA 4XIGQ 3FD3A 3K6UA 3N94A 4TLMB 3OEKA 3H6WA 4F1VA 1A8EA 4AB6A 5KCJA 4H1XA 3IORA 1A54A 1LSTA 1B1HA 2Y84A 4FEBA 1OIBA 3E9XA 2PBWA 3HHGA 4U4XA 1Y3PA 1DSNA 5KCJB 4LQ2A 4R6YA 2Q89A 4LQ5A 1QUJA 3KEIA 3QSLA 4RNSA 5ICTA 1GGGA 3RQTA 2D3IA 3M3FA 5LOMA 4OESA 2HFBA 5I2KB 4R9FA 3VXBA 3IOVA 2XX7A 2X26A 4OFOA 2DQVA 4IO5A 2HQ0A 1Y20A 5JTYA 4LZ5A 4N6PA 1UIUA 2O1MA 1N7WA 1AL3A 2R9JA 2NWJA 3IO6A 4ZEIA 4F18A 3HSTA 1H43A 3R7XA 1JVXA 4X48A 5AA1A 1XHYA 3O2AA 2WOKA 1USYE 4TQUQ 3ODBA 1YCJA 3CRBA 2F35A 1SDXA 2R71A 4IB2A 1B05A 3PUYE 1UQWA 4AQ4A 4YMAA 3O9PA 4HCWA 1AH5A 1MPBA 4QFPA 3HPIA 3Q28A 3B6WA 1US5A 2DSFA 5H8HA 2I0CA 2HZLA 1N84A 3S2VA 3OMBA 5H8HB 2CZLA 4KQPA 3RLFE 3WAFA 1BIYA 3QIMA 2G29A 4YU0A 4QF9A 5AA2A 1MPCA 2Y7PA 5I84A 3VE1B 4L17A 3G3KA 4HW8A 4MFIA 3U93A 3H4ZA 3C9HA 4QHQA 3K4UA 5FHMA 3ZKLA 4GF8A 1WVJA 4U1OA 5A5XA 2F97A 1GTKA 4U21A 3U94A 4GVOA 4F39A 2V93A 3O66A 5A5XB 3PMWA 4UACA 1D4NA 3PUZE 1WODA 3S9EA 1ZIUA 4JWYA 3DRKA 4R2BA 3A3CA 2H9BA 1VSOA 2A5TA 1NFTA 4O3AA 1JEVA 2O1LA 1JETA 4OEVA 1H3DA 3KG2A 1O7TA 3QAXA 3GBBA 4F3BA 3IB0A 1M5CA 2ZNSA 2I0BA 3HO7A 1R9LA 2F78A 1IXCA 1NMUA 3FVOA 4Q0CA 4Z7EA 4PFWA 1NKXA 5FTHA 3CI8A 3K6WA 2Q2CA 4QSDA 4MLVA 2ESNA 1T0KA 2XXYA 4X1BA 2XXXA 4YZZA 3HHFA 3GLBA 1DTZA 3LBSA 5KDTB 2ZNUA 4YB5A 1B52A 4NMYA 2P1SA 3C35A 3LSWA 3PAMA 1IIWA 1R9QA 4F2OA 4DXCA 1PB8A 2YJPA 1LAFE 3IL1B 2QPQA 3OD7A 2DXYA 4PFYA 3V5AA 3GZGA 1N0TA 3OOAA 4RXLA 2F7CA 1N04A 5CMCA 3N26A 1EZOA 3KZGA 1XVYA 3MPLA 3DP6A 1FQCA 4FATA 4GD5A 3HV1A 2F8DA 4H8IA 1N7XA 4EF2A 4ZS9A 3EF7A 3PV0E 3K1MA 2DE4A 3MP1A 4BDQA 1JW4A 1MH3A 2ABHA 3THIA 1M5EA 3L6GA 3EPEA 4FAJA 1VFDA 5IAIA 4XKPA 3PD9A 1BTJA 4G68C 1OLAA 3FZVA 1QJMA 4R6KA 1F9BA 4NF4A 1LCTA 1OLCA 1N3WA 1XS5A 4N07A 4XTCQ 2O69A 4P0IA 5ISUA 1PB7A 3MC2A 2HEUA 1FTMA 4MLQA 4RY1A 4G8HA 4PFUA 2QL3A 3O6HA 5B7DA 3M3KA 5L9OA 1PDAA 1A99A 4WKMA 2UVHA 2H4IA 3E13X 3UORA 4ZZAA 1B51A 3H3GA 2O84X 2PT2A 2I4BA 4G77A 4TOZA 1EU8A 4ZEKA 1MG1A 2Q9TA 2A5SA 1XC1A 1QKBA 1N76A 2QMXA 2XHDA 3MQ9A 2NVUB 3PUXE 2PT1A 3VFJA 3MZ9A 1H45A 3LSXA 4H65A 2B3FA 2XXWA 3Q25A 4YKIA 4QFKA 1I6AA 4GXAA 4GIZA 3PPOA 3QUFA 1L5TA 3TTKA 1MY3A 1MXYA 1VR5A 3ZKKA 3SESA 3CG3A 2DOJA 1MY4A 3B7DA 3SEUA 1YAEA 3TCHA 2RCAA 3RTWB 3KSXA 4DXBA 3T93B 2V3QA 3WAEA 3DLNA 3G7WA 1N3XA 1TT1A 5CMMA 5ITOA 4OETA 3EHUA 1MXWA 3FJMA 1QKAA 4ONYA 3DELB 4OYVA 4OWDA 3E3KA 4QFNA 4HS7A 5I59A 1SVXB 3KGCA 4DLDA 3VVDA 4F3GA 3PPRA 2F34A 4JXIA 4YMBA 4G2ZA 3T9UA 1XVXA 1M5DA 1JEUA 1TFAA 4FE8A 3USDA 3FTOA 3MVYA 3OO9A 2F7AA 3KOSA 1IQ7A 4ESWA 1ELJA 5TPAA 3RN8A 1UTBA 3IOTA 2Q88A 3KOTA 4YB7A 3CFLA 3L6HA 2GHBA 5TPAB 2DWAA 1UTBB 4ISUA 1YTVA 2P0SA 1LFGA 1SW2A 1B6HA 3KN7A 3MZ1A 1IXIA 2VD3A 4WEPA 3ILUB 1Y3QA 1LB9A 3ONMA 3C33A 4WXJA 4BDLA 2H25A 4KHZE 1B0LA 1NH8A 4NF6A 4ECFA 2UVJA 1MRPA 2XD3A 2QS2A 3B6TA 1AOVA 1PBPA 2X7QA 3TELA 2AIXA 3C31A 3TQLA 1MQGA 3SETA 3DP4A 1RYOA 4PETA 3I5OA 3E4RA 2HZKA 4RK2A 3PD8A 4NF5A 4U1ZA 4ZE9A 5L8DA 1B1XA 1NNKA 5BUUA 3EQ1A 4OXVA 3CFZA 1ZU0A 1Y3NA 4EXLA 1I6QA 2DVCA 1ZLQA 1P1QA 3IK6B 3SERA 1H44A 4LP2B 2OWTA 3C32A 4H0WA 3MWBA 3SEWA 5JTYB 2Q8JA 4OFJA 3H03A 2Z8EA 3CFXA 3LC8A 3F11A 3IJXB 5K2YA 3JZJA 1DPEA 4H67A 5I58A 3MJNA 2VGQA 2X7PA 5AA4A 1USYH 5I58B 3S9LC 2F5XA 2AYSA 2DWJA 1MM7A 4QFLA 1XT8A 3CSGA 2VP1A 5AA4B 3K01A 3TODA 3U92A 4DE8A 3VVFA 2Z22A 2V3UA 2E1SA 4IO4A 5HPQA 1LBCA 3PPNA 4FEDA 5BWJA 4F19A 3IR1A 4FJPA 2Z8DA 4ELOA 2FNCA 2GH9A 4F1YA 5K2XA 1PEBA 1A55A 1A40A 1S9TA 4DZ1A 1SW4A 3SDFA 3FATA 2ZYKA 3MVZA 2VD2A 3LSLA 4LUBA 3BKIB 4G8NA 4O3CA 1LFHA 4JWOA 3ILTB 2Z8FA 5AA2B 2ZNTA 2I6EA 1H76A 3O97A 3O6IA 3A09A 2I4CA 2RC7A 4JWXA 4F29A 1MY2A 4JB7A 1MDP1 5TU0A 1IZ1A 4ELPA 4PQJA 1QUKA 2XXQA 4NE4A 4OEUA 5L9MA 4ELRA 3DRHA 5DVJA 1B32A 1I6BA 2WOPA 3FXRA 3MPKA 3UN6A 3G3FA 4ESXA 1S50A 4R73A 4LZ7A 3TFLA 1P1NA 4OHNA 3CR9A 1QUIA 3DRJA 4YAHX 4OVJA 3TMGA 2XXRA 1P99A 2ZYNA 3BFUA 3S4UA 1MPDA 1IEJA 4ZEFA 4KCCA 3R6UA 4JDFA 5I2NA 3T9VA 4NEDA 3VXCA 1LB8A 1MQDA 4IGRA 1FW0A 3I3VA 2A5TB 4FORA 5CBRA 1LFIA 1DTGA 2PVUA 4LVQA 3KN8A 4PFTA 4IY6A 4X9TA 5HBCA 3OELA 4XXUA 1O63A 2DE2A 4Q30B 4ND9A 1GVCA 2F7BA 3H6VA 5AA3A 3K1NA 4I1DA 1B3LA 3O6GA 1R1NA 3M8UA 2PMSA 3Q27A 2OCUA 2RKMA 3OEMA 5EYFA 3VVEA 1CE2A 2H99A 3TZAA 4IO2A 1FTLA 3PU5A 3D4CA 1JW1A 2H5YA 1TXFA 4F2QA 1JW5A 4DDDA 4HCYA 1FQDA 2RC9A 1D9VA 4RK9A 4NF8A 3U8QA 1SYHA 2ONKE 5JEIA 1GR2A 2LAOA 4ZDMA 3H6UA 4FECA 3VLUA 3TYHA 5I57A 1QW0A 4NF8B 3H06B 2QSXA 1NNPA 3I6VA 3VDFA 4I62A 1HSEA 5I57B 4BDNA 1ANFA 4POXA 4JBZA 3IB2A 4LATA 2F6PA 2UXAA 3K00A 4X1DA 3O6PA 3EHSA 2CMOA 2KLFA 4EDPA 3R26A 3FASA 2OBGA 4Z0IA 3CIJA 3RYBA 5H8FA 5I56A 4XKQA 1Y4CA 5CC2A 4M1VA 3TTLA 1B5JA 5F7VA 3W15C 5IKBA 4GXSB 1LAGE 2O6AA 4KI0E 5F1QA 2F36A 4GQOA 4K3FA 5DVFA 4KCDA 3S9NC 2AL5A 3DRIA 4C0RA 4NF4B 3V8XB 1ATGA 2PYYA 4E0XA 1UIVA 2W7YA 1D3KA 2RF1A 2DS9A 3B6QA 4EF1A 3Q29A 3TQWA 1Y4TA 4OMBA 2XD2A 3RYAA 2WOLA 4IY5A 1ZJLA 1MXUA 4G8MA 2VOZA 2DXRA 2RC8A 4NWCA 3RT6B 1FQBA 4C1UA 2O7UA 1Q1KA 1A7LA 4ZE8A 3FVGA 4ZEBA 1NNFA 2D21A 1OMPA 2HAVA 1MQJA 1B46A 1XOCA 4IO3A 4ZZEA 5DYHA 2QS4A 1B0HA 2XX8A 2WKYA 3T9HB 4U23A 3Q26A 1P1UA 4GFRA 5DTBA 1CB6A 3IOUA 5L9SA 2XX9A 2Y7KA 3GBAA 3TAJA 4EQBA 1QULA 1TFDA 2I58A 4KD5A 3BBRA 2OWSA 2B4MA 3MZBA 4EUOA 3FVKA 1M5FA 4GWOA 4F3PA 3C34A 1MY1A 3TPAA 3RTFB 5B70A 2ZMBA 1MQHA 4C1TA 2YLNA 4U4SA 3V89B 2DYXA 1B4HA 3FXQA 3KFMA 2IEEA 4GRKA 1NL5A 3VLWA 2XXUA 1OVBA 3SEYA 3LSFB 4ZEDA 5I59B 1EZ9A 4XKNA 1NNTA 1US4A 2Y7RA 4KR5A 1B7HA 2G93A 5AE4A 3OO6A 2AL4A 3MVWA 4YKKA 4OQOA 3ZS6A 2ANJA 3MUQA 3P7IA 3EN3A 2OJTA 4IO6A 1JVYA 1POY1 3IAZA 1AIVA 4BLAA 2QJEA 3JV9A 4EQ9A 4BDRA 3OENA 1RYXA 3G3HA 4DCYA 2R6GE 3CSBA 4O3BA 3IJOB 5CMKA 2REJA 1IXHA 2V3TA 1OVTA 2UYEA 4NF6B 1Q35A 1YPNA 5CRYA 1B5IA 3FJGA 4DXUA 3K6VA 3CHGA 3IOWA 1Z7ME 2O7IA 2QS3A 1LBBA 5KZTA 2NXOA 1QVSA 3N6UA 4R9GA 2E0SA 1GV8A 2ONRA 3RPWA 3TEPA 3MVXA 4LONB 3MP6A 5I2KA 4NF5B 4QFOA 1UTHA 4R6HA 1BKAA 4Q8RA 1MDQA 4TLLB 4U22A 3K2DA 3G3GA 3OO7A 4RJZA 1MXVA 1UTHB 4ELQA 3K02A 3OXNA 2FA7A 2F6GA 2REGA 3T66A 3U72A 1NH7A 1KWHA 3CG1A 3ZSFA 2IA4A 3FGSA 4DIGA 4QSEA 4U2RA 3VV5A 2YPNA 1MXZA 1Z7NE 2UVGA 5CI5A 1B7ZA 2HCAA 3T96B 1B3EA 3TTRA 2M8CA 1A8FA 2QMWA 5M2VA 2Y7WA 5ITPA 1FTKA 2I49A 4POWA 1SW5A 3U1OA 4EXKA 3FUZA 3W9VA 3D4GA 4M4GA 4JSOA 2B4LA 2I3VA 1II5A 3N6TA 3V83A 4YKJA 1IITA 5HM4B 1ZKBA 1RKMA 3RY3A 4H6DA 3HCQA 5TP9A 1MM6A 3PUVE 2D5WA 3G3JA 3KSJA 3UIFA 3TCFA 3K6XA 1JQFA 4F1UA 5TP9B 4IGTA 3SEVA 1URDA 3ECRA 1MY0A 4PP0A 3IX1A 1B58A 1Y1ZA 2OK2A 1PB9A 3DRGA 1B2HA 3C4MA 3RGYA 4G68A 4NTLA 3FV1A 1LAXA 2DE3A 4F22A 3MW0A 3QUJA 4G68B 1FCKA 2V25A 1MH4A 1PC3A 4KFQA 3FIRA 5H8NA 1FQEA 1LCFA 3QXMA 2FYIA 3M3LA 5H8NB 3KN3A 4G4PA 2XXVA 1LAHE 3MBPA 2PX1A 3H7MA 4IO7A 4KYSA 1SQYA 5I2NB 2ZXTA 4OZ9A
chains in the Genus database with same CATH superfamily
3OSRA 2FVZA 1B3GA 3B50A 1FQFA 2Q2AA 2UYFA 5LDZA 2BJJX 3KC1A 2P3VA 1DOTA 3KBRA 4FBPA 1J1NA 4WEDA 2XXIA 4N8YA 4OFLA 1D9YA 1B4ZA 1OQHA 3A3UA 1B5HA 5T3JA 1SW1A 2XWIA 2NOOA 1B3FA 1B7UA 5CM6A 1IXGA 1MS7A 2I3WA 4P0GA 4E0WA 2RCBA 5ET8A 1VFEA 5CBSA 4JSDA 2OZZA 4N4UA 3PUWE 1G0HA 4OTEA 5KDTA 4NQ8A 4NWDA 4UA8A 1FPLA 2O51A 2XXPA 4NN3A 4N15A 2XXTA 5EHMA 4PE5B 3W9WA 2ZZXA 3E78A 4H8JA 4YKPA 3TTMA 4MJOA 5IZ3B 4P1EA 4AB5A 3BFTA 4MNIA 5H8QA 3TCGA 3C36A 5H8SA 3MP8A 1URSA 5J1DA 1RDYA 3LR1A 1DMBA 5H8QB 1NV4A 4R2FA 4HTGA 3PMXA 2GFEA 2V84A 3VLVA 2OLBA 4GOTA 3N5LA 5FHOA 2DWHA 3TDJA 3PGFA 3PPPA 4XEQA 5ICQA 1B40A 4GX3A 1B3HA 3MAMA 4GL8A 1M5BA 1PBQA 1ZTYA 1IMCA 5H8FB 5I56B 1Y1MA 3CVGA 2DVZA 2H98A 4LZ8A 4H5GA 3RPLA 4GLIA 1KA1A 2NUVA 2R8TA 3SEXA 4N13A 3IB1A 4MBPA 3RNNA 3DM0A 4BDMA 4RPOA 2RINA 1WDNA 3FXUA 1SYIA 2F3BA 3PMVA 4XKRA 4N17A 3T22A 5ELVA 2HXWA 4FIMA 4R74A 1ZBMA 3PPQA 2CZIA 1FTOA 2ONSA 2MKZA 3OO8A 1EH3A 3UK4A 1SI1A 4H5FA 2XXHA 3T9XB 4KYEA 2WYPA 5DT6A 3EHTA 4HE2A 3UGWA 2Y7IA 2QS1A 5AA2D 2GRVA 2ZYOA 3AXFA 1MQIA 3RUMA 5FHNA 1FQAA 4ZECA 3KBZA 2UVIA 4PC9A 3O29A 5I3SA 4EQ7A 4N91A 2VPNA 2Q74A 2Z23A 1EYIA 1BK4A 3QK6A 4PAFA 4I9DA 4OENA 4XFEA 1SBPA 3K0VA 3OSQA 3RT8A 4PF8A 1BP5A 4BDOA 1AWBA 1G0IA 5DEXA 1VE4A 2THIA 4RPNA 1TWYA 1SD3A 1IUDA 3MSTA 1MXXA 1FPDA 1ZMGA 5DEXB 2B3BA 3FV2A 1Y9UA 2DP8A 1I69A 4QRZA 1YZ0A 1FBEA 4GL0A 3UP9A 1FTJA 4THIA 5DVIA 4KYDA 1SI0A 3G3IA 4RA1A 4QSCA 2ALUA 4R72A 3IO4A 3FVNA 5FTIA 2GHAA 3LUYA 4DCXA 1FBHA 3T1BA 4RYAA 4Q5TA 4R75A 3S9MC 4P3LA 2P2AA 1LGBC 3UA8A 3KJ7A 2PCRA 2HAUA 3TUSA 4YICA 4LA9A 4OERA 5JK4A 4F31B 1NV6A 1EZPA 1P1OA 1OQGA 1S7YA 3DP8A 3FJ7A 3K1PA 2ZYMA 3GXAA 1HSJA 4MF3A 3H6TA 2O68A 3O28A 1DPPA 1HSLA 2DWIA 1FBPA 4KPTA 4YB6A 2B65A 2VHAA 4I8CA 1BLFA 3QYTA 1O64A 5ET7A 4GWUA 3LVUA 3TTNA 1R6ZA 2QRYA 1B9JA 3KJTA 1LLSA 3JYRA 4F3SA 4PE3A 1CNQA 4MH5A 4P11A 3TKDA 1NUXA 1POTA 5EHSA 1URGA 1JNFA 4JVDA 3HN0A 3SKPA 5CMBA 1P1WA 2I48A 3DRFA 1AMFA 4XIGQ 3FD3A 3K6UA 3N94A 4TLMB 3OEKA 3H6WA 4F1VA 1A8EA 4AB6A 5KCJA 4H1XA 3IORA 1A54A 1LSTA 1B1HA 2Y84A 4FEBA 1OIBA 3E9XA 2PBWA 3HHGA 3IFCA 4U4XA 1Y3PA 1DSNA 4UABA 5KCJB 4LQ2A 4R6YA 2Q89A 4X8RA 4LQ5A 1QUJA 4NHBA 3KEIA 3QSLA 4RNSA 5ICTA 1GGGA 3RQTA 2D3IA 3M3FA 5LOMA 4OESA 2HFBA 5I2KB 4R9FA 3VXBA 3IOVA 2XX7A 2X26A 5EQ8A 4OFOA 2DQVA 4IO5A 2HQ0A 4O7MA 1Y20A 4N6DA 1LBVA 5JTYA 1LBXA 4LZ5A 4N6PA 1UIUA 2O1MA 1N7WA 1AL3A 2R9JA 2NWJA 3IO6A 4ZEIA 4F18A 5ESYA 3HSTA 1H43A 3R7XA 1JVXA 4X48A 5AA1A 1XHYA 3LV0A 3O2AA 2WOKA 1USYE 4NAPA 4TQUQ 3ODBA 1YCJA 3CRBA 2F35A 1SDXA 1QGXA 2R71A 4IB2A 1B05A 3PUYE 1UQWA 4AQ4A 1FPEA 4YMAA 3O9PA 4O8MA 4HCWA 1AH5A 1MPBA 3GYYA 4NF0A 2GQ1A 1FJ9A 4GWZA 4QFPA 3HPIA 3Q28A 3B6WA 1US5A 4MAGA 3ROJA 1YYZA 2DSFA 5H8HA 2I0CA 2HZLA 1N84A 3S2VA 3OMBA 5H8HB 1FBFA 2CZLA 4KQPA 3RLFE 3WAFA 1BIYA 3QIMA 2G29A 4YU0A 4HXVA 4QF9A 4AS4A 5AA2A 1MPCA 2Y7PA 5I84A 3VE1B 4L17A 3G3KA 4HW8A 4OA4A 3RYDA 4MFIA 3U93A 3H4ZA 3C9HA 4QHQA 1KZ8A 3K4UA 5FHMA 3ZKLA 4GF8A 1WVJA 4U1OA 5A5XA 2F97A 1GTKA 3U65A 4U21A 3U94A 4GVOA 4F39A 2V93A 3O66A 5A5XB 5EYGA 3PMWA 4UACA 4MEVA 1D4NA 3PUZE 1WODA 2QFLA 3S9EA 1ZIUA 4JWYA 2FIXA 3DRKA 2PFYA 4R2BA 3A3CA 2H9BA 1VSOA 2A5TA 5DW8A 1NFTA 4O3AA 1JEVA 2O1LA 1JETA 4OEVA 2P3NA 1H3DA 3KG2A 1O7TA 3QAXA 3GBBA 4F3BA 3IB0A 4OVSA 1M5CA 2ZNSA 2I0BA 3HO7A 1R9LA 2FHYA 5IM2A 2F78A 1IXCA 1NMUA 3FVOA 4Q0CA 4Z7EA 4PFWA 1NKXA 5FTHA 3CI8A 3K6WA 2Q2CA 4QSDA 4MLVA 2OWZA 2ESNA 1T0KA 2XXYA 4DI4B 4X1BA 2XXXA 4YZZA 3HHFA 3GLBA 1DTZA 3LBSA 5KDTB 3QMFA 2ZNUA 4YB5A 1B52A 4NMYA 2P1SA 3C35A 3LSWA 4OANA 3PAMA 1IIWA 1LEVA 1R9QA 4MNPA 4F2OA 4DXCA 1PB8A 2YJPA 1LAFE 3IL1B 2QPQA 3OD7A 2DXYA 4PFYA 3V5AA 1LBYA 1N0TA 3GZGA 3OOAA 4RXLA 2F7CA 1N04A 5CMCA 3N26A 1EZOA 2XWKA 1INPA 3KZGA 1XVYA 3MPLA 3DP6A 1FQCA 4FATA 4GD5A 3HV1A 4PBHA 4MX6A 2F8DA 4H8IA 1D9QA 1N7XA 4EF2A 2QVUA 1LBWA 1RDZA 4ZS9A 3EF7A 3PV0E 3K1MA 2DE4A 3MP1A 4BDQA 1JW4A 1MH3A 1FPJA 2ABHA 3THIA 1K9ZA 1M5EA 3L6GA 3EPEA 3RPLB 4FAJA 1VFDA 2CZKA 5IAIA 4XKPA 3PD9A 1BTJA 4G68C 1OLAA 3FZVA 1QJMA 4R6KA 1F9BA 4NF4A 1LCTA 1OLCA 1N3WA 1XS5A 4MMPA 4N07A 4XTCQ 2O69A 2ZZWA 4P0IA 5ISUA 1PB7A 3MC2A 2HEUA 1FTMA 4MLQA 4RY1A 5F24A 4G8HA 2XXKA 4PFUA 2QL3A 3BIHA 3O6HA 5B7DA 3M3KA 5L9OA 1PDAA 1A99A 1FTAA 4WKMA 2UVHA 2H4IA 3E13X 3UORA 4ZZAA 1B51A 3H3GA 2O84X 2PT2A 2I4BA 4G77A 4TOZA 1EU8A 5J16A 4ZEKA 1MG1A 2Q9TA 2A5SA 1XC1A 1QKBA 1N76A 2QMXA 2XHDA 3MQ9A 2NVUB 3PUXE 2PT1A 3VFJA 4PAIA 3MZ9A 1H45A 3LSXA 4H65A 2B3FA 2XXWA 3Q25A 4N81A 4QFKA 1I6AA 4GXAA 4YKIA 4GIZA 3PPOA 3QUFA 1L5TA 3TTKA 1MY3A 1MXYA 1VR5A 3ZKKA 3SESA 3CG3A 2DOJA 1MY4A 3B7DA 3SEUA 1YAEA 3TCHA 2RCAA 3RTWB 3EKIA 3KSXA 4DXBA 3T93B 1IMDA 1NUYA 2V3QA 3WAEA 3DLNA 3G7WA 1N3XA 1TT1A 5CMMA 5ITOA 4OETA 3EHUA 1MXWA 3FJMA 1QKAA 4ONYA 3DELB 4OYVA 4OWDA 3E3KA 4QFNA 4HS7A 1SPIA 1FPGA 5I59A 4PFRA 3T0JA 1SVXB 3KGCA 4DLDA 3VVDA 4I40A 2Y5LA 4F3GA 3PPRA 2F34A 4JXIA 4YMBA 4G2ZA 3T9UA 1XVXA 1M5DA 1JEUA 1TFAA 4FE8A 3USDA 3A29A 3FTOA 3MVYA 3OO9A 2F7AA 3KOSA 1IQ7A 4ESWA 1ELJA 5TPAA 3RN8A 1UTBA 4PTKA 3IOTA 2Q88A 3KOTA 4YB7A 3CFLA 3L6HA 2GHBA 5TPAB 2DWAA 1UTBB 4ISUA 4P47A 1YTVA 4NG7A 2P0SA 1LFGA 1SW2A 3SZPA 2BJIA 1B6HA 3MYUA 3KN7A 3MZ1A 2QVRA 1IXIA 2VD3A 4WEPA 3B8BA 3ILUB 1Y3QA 1LB9A 4P9KA 4MNCA 3ONMA 3C33A 4WXJA 4BDLA 2H25A 2Q8MA 4KHZE 5EQ7A 2WBDA 1B0LA 5LTCA 1NH8A 4NF6A 4ECFA 2UVJA 1IMAA 1MRPA 1EYKA 2XD3A 4I3EA 2QS2A 3B6TA 5I7IA 1AOVA 1PBPA 2X7QA 3TELA 2XWOA 2AIXA 3C31A 3TQLA 1MQGA 3SETA 1IMBA 3DP4A 1RYOA 4PETA 3I5OA 3E4RA 1FPKA 2HZKA 4RK2A 3PD8A 1FPBA 4NF5A 4U1ZA 4ZE9A 5L8DA 1B1XA 1NNKA 5BUUA 3EQ1A 4OXVA 3CFZA 1ZU0A 1Y3NA 4EXLA 1I6QA 2DVCA 1ZLQA 1P1QA 3IK6B 3SERA 1H44A 4LP2B 1NUZA 2OWTA 4NGUA 3C32A 4H0WA 3MWBA 3SEWA 5JTYB 2Q8JA 4OFJA 3H03A 2Z8EA 3CFXA 3LC8A 3F11A 5EQ9A 2KR0A 3IJXB 4O7IA 5K2YA 1FPFA 3JZJA 4OVRA 1DPEA 4H67A 4JVCA 5I58A 3MJNA 4H45A 1NV0A 2VGQA 1FBGA 1K9YA 2X7PA 5AA4A 1USYH 5I58B 3S9LC 2F5XA 2AYSA 1DCUA 2DWJA 1MM7A 4QFLA 1XT8A 3CSGA 2VP1A 5AA4B 3K01A 4P8BA 3TODA 3U92A 4DE8A 3VVFA 3FBPA 2Z22A 2V3UA 2E1SA 4IO4A 5HPQA 1LBCA 3PPNA 4FEDA 4PFBA 5BWJA 5FBPA 4F19A 3IR1A 4FJPA 2Z8DA 4G61A 4ELOA 4NX1A 2FNCA 2GH9A 4F1YA 5EYHA 1EYJA 5K2XA 1PEBA 1A55A 1A40A 1S9TA 4DZ1A 1SW4A 3SDFA 3FATA 2ZYKA 3MVZA 2VD2A 3LSLA 4LUBA 3BKIB 4G8NA 4O3CA 1LFHA 4JWOA 3ILTB 2Z8FA 5AA2B 2ZNTA 5ET5A 2I6EA 1H76A 3O97A 3O6IA 3A09A 2I4CA 2RC7A 4GX6A 4JWXA 4F29A 1MY2A 4JB7A 1MDP1 4QBAA 5TU0A 1IZ1A 4ELPA 1IMFA 4PQJA 1QUKA 2XXQA 4NE4A 4OEUA 5L9MA 4MIJA 3DRHA 4ELRA 5DVJA 1FBDA 1B32A 1I6BA 2WOPA 3FXRA 3MPKA 3UN6A 3G3FA 4ESXA 1S50A 4R73A 4LZ7A 3TFLA 1P1NA 4OHNA 3CR9A 1QUIA 3DRJA 4YAHX 4OVJA 3TMGA 2XXRA 1P99A 2ZYNA 3BFUA 3S4UA 1MPDA 4OVQA 1IEJA 4ZEFA 4KCCA 3R6UA 4JDFA 5EQAA 5ET6A 5I2NA 1Q9DA 3T9VA 4NEDA 3VXCA 1LB8A 1MQDA 4IGRA 1FW0A 3I3VA 2A5TB 3KC0A 4FORA 5CBRA 1LFIA 1DTGA 1RDXA 2PVUA 3ISPA 4LVQA 3KN8A 4PFTA 4IY6A 4X9TA 5HBCA 1DBZA 3OELA 4XXUA 1O63A 2DE2A 4Q30B 4ND9A 1GVCA 2F7BA 3H6VA 2PFZA 5AA3A 3K1NA 4I1DA 1B3LA 4JVIA 3D1RA 3O6GA 4OVTA 1R1NA 2WEFA 3M8UA 2PMSA 3Q27A 2OCUA 2RKMA 3OEMA 5EYFA 3VVEA 1CE2A 2H99A 3TZAA 4IO2A 3LUZA 1FTLA 3PU5A 3D4CA 1JW1A 2H5YA 4GBVA 1TXFA 4PF6A 2HXRA 4OVPA 4F2QA 1JW5A 4DDDA 4PDDA 4HCYA 5IZZA 1FQDA 2RC9A 1D9VA 2HHMA 4RK9A 5IZ3A 4I3YA 4NF8A 3U8QA 1SYHA 2ONKE 5JEIA 4PAKA 1GR2A 2LAOA 4ZDMA 3H6UA 4FECA 3VLUA 3TYHA 5I57A 1QW0A 4NF8B 3H06B 2QSXA 1NNPA 3I6VA 3VDFA 4I62A 1HSEA 5I57B 4BDNA 1ANFA 4IR8A 4POXA 4JBZA 3IB2A 4LATA 4O94A 2F6PA 2UXAA 4QXDA 3K00A 4X1DA 3O6PA 3EHSA 2CMOA 2KLFA 4EDPA 3R26A 3FASA 2OBGA 4Z0IA 3CIJA 2L5VA 3RYBA 5H8FA 5I56A 4PGPA 4XKQA 1Y4CA 5A5LA 5CC2A 4M1VA 4N8GA 3TTLA 1B5JA 1FPIA 5F7VA 3W15C 5IKBA 4GXSB 2JJKA 1LAGE 2O6AA 4KI0E 5F1QA 2F36A 4GQOA 4K3FA 5DVFA 4KCDA 3S9NC 2AL5A 3DRIA 4C0RA 4NF4B 3V8XB 1ATGA 2ZZVA 2PYYA 4E0XA 1UIVA 2W7YA 1D3KA 2RF1A 2DS9A 3B6QA 4EF1A 2WBBA 2CEYA 3Q29A 4XF5A 3TQWA 1JP4A 1Y4TA 4OMBA 2XD2A 3RYAA 2WOLA 4IY5A 1ZJLA 1MXUA 4G8MA 2VOZA 2DXRA 2RC8A 4NWCA 3RT6B 3IFAA 1FQBA 4C1UA 2O7UA 1Q1KA 1A7LA 4ZE8A 1NV3A 3FVGA 4ZEBA 1NNFA 4GWSA 4GWWA 1FSAA 2D21A 1NUWA 1OMPA 2HAVA 1MQJA 1B46A 1FBCA 1XOCA 4IO3A 1YXIA 4ZZEA 5DYHA 4KXPA 2QS4A 1B0HA 2XX8A 2WKYA 3T9HB 4U23A 3Q26A 1P1UA 4GFRA 5DTBA 1CB6A 3IOUA 5L9SA 2XX9A 1VDWA 2Y7KA 3GBAA 2FIEA 2QVVA 3TAJA 4EQBA 1QULA 1TFDA 2DDKA 2I58A 4KD5A 3BBRA 2OWSA 2B4MA 3MZBA 4EUOA 3FVKA 1M5FA 4GWOA 4F3PA 3C34A 1MY1A 3TPAA 3RTFB 4MCOA 5B70A 2ZMBA 1MQHA 4C1TA 2YLNA 4U4SA 3V89B 2DYXA 1B4HA 3FXQA 3KFMA 2IEEA 4GRKA 1NL5A 3VLWA 2XXUA 2FBPA 2XA5A 1OVBA 3SEYA 3LSFB 1XI6A 4DI3D 4ZEDA 5I59B 1EZ9A 4XKNA 1NNTA 1US4A 2Y7RA 1LBZA 4KR5A 1B7HA 2G93A 5AE4A 3OO6A 4PBQA 2AL4A 2WX9A 3E79A 3MVWA 4YKKA 4OQOA 4GWYA 3ZS6A 2ANJA 3MUQA 3P7IA 4GWXA 3EN3A 2OJTA 4P1LA 4IO6A 1JVYA 1POY1 3NOHA 3IAZA 1AIVA 4BLAA 2QJEA 3JV9A 4EQ9A 4P56A 4BDRA 3OENA 1RYXA 2F3DA 3G3HA 4DCYA 2R6GE 3CSBA 4O3BA 3IJOB 5CMKA 2REJA 1IXHA 4HE0A 2V3TA 1OVTA 2UYEA 4NF6B 1FRPA 1Q35A 1YPNA 5CRYA 1B5IA 4MHFA 2OX3A 4GX4A 5IZ1A 2V4CA 3FJGA 4DXUA 3K6VA 3CHGA 3IOWA 1FJ6A 1Z7ME 2CEXA 1IMEA 2O7IA 2QS3A 1LBBA 5KZTA 2NXOA 1QVSA 3N6UA 4R9GA 2E0SA 2VPOA 1GV8A 5I5PA 1NV2A 2ONRA 3RPWA 5IGAA 3TEPA 3MVXA 1NV5A 3MP6A 4LONB 5I2KA 4NF5B 4QFOA 1UTHA 4R6HA 4H46A 1BKAA 4Q8RA 4HE1A 1MDQA 4TLLB 4U22A 3K2DA 3G3GA 3OO7A 4RJZA 1MXVA 1UTHB 4PGNA 4ELQA 3K02A 3OXNA 2FA7A 1DK4A 2F6GA 2REGA 3T66A 2Y5KA 3U72A 1NH7A 1KWHA 3CG1A 3ZSFA 2IA4A 3FGSA 4DIGA 4QSEA 4U2RA 3VV5A 2YPNA 1MXZA 1Z7NE 2UVGA 5CI5A 1KA0A 1B7ZA 2HCAA 3T96B 3BIGA 1B3EA 3TTRA 2M8CA 1A8FA 2QMWA 5M2VA 2Y7WA 5ITPA 2VT5A 1FTKA 2I49A 4POWA 1SW5A 1NV1A 3U1OA 4EXKA 3FUZA 3W9VA 3D4GA 4M4GA 4JSOA 2B4LA 2I3VA 1II5A 3N6TA 2WYKA 3V83A 4YKJA 4AS5A 1IITA 5HM4B 1ZKBA 1RKMA 4GBWA 3RY3A 4H6DA 3HCQA 5TP9A 4PCDA 1MM6A 3PUVE 2D5WA 3G3JA 3KSJA 3UIFA 3TCFA 3K6XA 1JQFA 4F1UA 5TP9B 4IGTA 3SEVA 1URDA 3ECRA 1MY0A 4PP0A 3IX1A 4PDHA 1B58A 1Y1ZA 2OK2A 1PB9A 3HFUA 3DRGA 1B2HA 3C4MA 3RGYA 4G68A 3FXBA 4NTLA 4X04A 4N6KA 3FV1A 1LAXA 2DE3A 4LN5A 4F22A 3MW0A 3QUJA 4G68B 1FCKA 2V25A 2KQZA 1MH4A 1NI9A 1PC3A 4KFQA 3FIRA 5H8NA 1FQEA 1LCFA 3QXMA 2FYIA 1NV7A 3M3LA 5H8NB 2HPGA 3KN3A 4PFIA 4G4PA 3PTYA 2CZHA 2XXVA 1LAHE 3MBPA 2PX1A 3H7MA 4IO7A 4KYSA 1SQYA 2XWVA 5I2NB 2ZXTA 4OZ9A
chains in the Genus database with same CATH topology
3OSRA 1B3GA 1FQFA 2Q2AA 2UYFA 2BJJX 3KBRA 1DOTA 1J1NA 4WEDA 2XXIA 4OFLA 1D9YA 1B4ZA 1OQHA 3A3UA 1B5HA 1SW1A 2NOOA 1B3FA 1B7UA 5CM6A 1IXGA 1MS7A 2I3WA 4P0GA 4E0WA 2RCBA 1VFEA 5CBSA 4JSDA 2OZZA 3PUWE 4OTEA 5KDTA 4NWDA 4UA8A 2O51A 2XXPA 2XXTA 5EHMA 4PE5B 3W9WA 4H8JA 4YKPA 3TTMA 4AB5A 3BFTA 5H8QA 3TCGA 3C36A 5H8SA 3MP8A 1URSA 5J1DA 3LR1A 1DMBA 5H8QB 4R2FA 4HTGA 3PMXA 2GFEA 2V84A 3VLVA 2OLBA 4GOTA 3N5LA 5FHOA 2DWHA 3TDJA 3PGFA 3PPPA 5ICQA 1B40A 1B3HA 3MAMA 4GL8A 1M5BA 1PBQA 1ZTYA 5H8FB 5I56B 1Y1MA 3CVGA 2DVZA 2H98A 4LZ8A 4H5GA 4GLIA 2NUVA 3SEXA 4N13A 3IB1A 4MBPA 3RNNA 3DM0A 4BDMA 4RPOA 2RINA 1WDNA 3FXUA 1SYIA 3PMVA 4XKRA 3T22A 5ELVA 2HXWA 4FIMA 4R74A 1ZBMA 3PPQA 1FTOA 2ONSA 3OO8A 1EH3A 3UK4A 1SI1A 4H5FA 2XXHA 3T9XB 4KYEA 5DT6A 3EHTA 3UGWA 2Y7IA 2QS1A 5AA2D 2GRVA 2ZYOA 3AXFA 1MQIA 3RUMA 5FHNA 1FQAA 4ZECA 2UVIA 3O29A 4EQ7A 2Z23A 3QK6A 4I9DA 4OENA 1SBPA 3K0VA 3OSQA 3RT8A 1BP5A 4BDOA 5DEXA 1VE4A 2THIA 4RPNA 1TWYA 1SD3A 1IUDA 1MXXA 1ZMGA 5DEXB 2B3BA 3FV2A 1Y9UA 2DP8A 1I69A 4QRZA 4GL0A 3UP9A 1FTJA 4THIA 5DVIA 4KYDA 1SI0A 3G3IA 4RA1A 4QSCA 2ALUA 4R72A 3IO4A 3FVNA 5FTIA 2GHAA 3LUYA 4DCXA 4RYAA 4Q5TA 4R75A 3S9MC 2P2AA 1LGBC 3UA8A 3KJ7A 3TUSA 2HAUA 4YICA 4LA9A 4OERA 5JK4A 4F31B 1EZPA 1P1OA 1OQGA 1S7YA 3DP8A 3FJ7A 3K1PA 2ZYMA 3GXAA 1HSJA 4MF3A 3H6TA 2O68A 3O28A 1DPPA 1HSLA 2DWIA 4KPTA 4YB6A 2B65A 2VHAA 4I8CA 1BLFA 3QYTA 1O64A 3LVUA 3TTNA 1R6ZA 2QRYA 1B9JA 3KJTA 1LLSA 3JYRA 4F3SA 4MH5A 4P11A 3TKDA 1POTA 5EHSA 1URGA 1JNFA 3HN0A 3SKPA 5CMBA 1P1WA 2I48A 3DRFA 1AMFA 4XIGQ 3FD3A 3K6UA 3N94A 4TLMB 3OEKA 3H6WA 4F1VA 1A8EA 4AB6A 5KCJA 4H1XA 3IORA 1A54A 1LSTA 1B1HA 2Y84A 4FEBA 1OIBA 3E9XA 2PBWA 3HHGA 4U4XA 1Y3PA 1DSNA 5KCJB 4LQ2A 4R6YA 2Q89A 4LQ5A 1QUJA 3KEIA 3QSLA 4RNSA 5ICTA 1GGGA 3RQTA 2D3IA 3M3FA 5LOMA 4OESA 2HFBA 5I2KB 4R9FA 3VXBA 3IOVA 2XX7A 2X26A 4OFOA 2DQVA 4IO5A 2HQ0A 1Y20A 5JTYA 4LZ5A 4N6PA 1UIUA 2O1MA 1N7WA 1AL3A 2R9JA 2NWJA 3IO6A 4ZEIA 4F18A 3HSTA 1H43A 3R7XA 1JVXA 4X48A 5AA1A 1XHYA 3O2AA 2WOKA 1USYE 4TQUQ 3ODBA 1YCJA 3CRBA 2F35A 1SDXA 2R71A 4IB2A 1B05A 3PUYE 1UQWA 4AQ4A 4YMAA 3O9PA 4HCWA 1AH5A 1MPBA 4QFPA 3HPIA 3Q28A 3B6WA 1US5A 2DSFA 5H8HA 2I0CA 2HZLA 1N84A 3S2VA 3OMBA 5H8HB 2CZLA 4KQPA 3RLFE 3WAFA 1BIYA 3QIMA 2G29A 4YU0A 4QF9A 5AA2A 1MPCA 2Y7PA 5I84A 3VE1B 4L17A 3G3KA 4HW8A 4MFIA 3U93A 3H4ZA 3C9HA 4QHQA 3K4UA 5FHMA 3ZKLA 4GF8A 1WVJA 4U1OA 5A5XA 2F97A 1GTKA 4U21A 3U94A 4GVOA 4F39A 2V93A 3O66A 5A5XB 3PMWA 4UACA 1D4NA 3PUZE 1WODA 3S9EA 1ZIUA 4JWYA 3DRKA 4R2BA 3A3CA 2H9BA 1VSOA 2A5TA 1NFTA 4O3AA 1JEVA 2O1LA 1JETA 4OEVA 1H3DA 3KG2A 1O7TA 3QAXA 3GBBA 4F3BA 3IB0A 1M5CA 2ZNSA 2I0BA 3HO7A 1R9LA 2F78A 1IXCA 1NMUA 3FVOA 4Q0CA 4Z7EA 4PFWA 1NKXA 5FTHA 3CI8A 3K6WA 2Q2CA 4QSDA 4MLVA 2ESNA 1T0KA 2XXYA 4X1BA 2XXXA 4YZZA 3HHFA 3GLBA 1DTZA 3LBSA 5KDTB 2ZNUA 4YB5A 1B52A 4NMYA 2P1SA 3C35A 3LSWA 3PAMA 1IIWA 1R9QA 4F2OA 4DXCA 1PB8A 2YJPA 1LAFE 3IL1B 2QPQA 3OD7A 2DXYA 4PFYA 3V5AA 3GZGA 1N0TA 3OOAA 4RXLA 2F7CA 1N04A 5CMCA 3N26A 1EZOA 3KZGA 1XVYA 3MPLA 3DP6A 1FQCA 4FATA 4GD5A 3HV1A 2F8DA 4H8IA 1N7XA 4EF2A 4ZS9A 3EF7A 3PV0E 3K1MA 2DE4A 3MP1A 4BDQA 1JW4A 1MH3A 2ABHA 3THIA 1M5EA 3L6GA 3EPEA 4FAJA 1VFDA 5IAIA 4XKPA 3PD9A 1BTJA 4G68C 1OLAA 3FZVA 1QJMA 4R6KA 1F9BA 4NF4A 1LCTA 1OLCA 1N3WA 1XS5A 4N07A 4XTCQ 2O69A 4P0IA 5ISUA 1PB7A 3MC2A 2HEUA 1FTMA 4MLQA 4RY1A 4G8HA 4PFUA 2QL3A 3O6HA 5B7DA 3M3KA 5L9OA 1PDAA 1A99A 4WKMA 2UVHA 2H4IA 3E13X 3UORA 4ZZAA 1B51A 3H3GA 2O84X 2PT2A 2I4BA 4G77A 4TOZA 1EU8A 4ZEKA 1MG1A 2Q9TA 2A5SA 1XC1A 1QKBA 1N76A 2QMXA 2XHDA 3MQ9A 2NVUB 3PUXE 2PT1A 3VFJA 3MZ9A 1H45A 3LSXA 4H65A 2B3FA 2XXWA 3Q25A 4YKIA 4QFKA 1I6AA 4GXAA 4GIZA 3PPOA 3QUFA 1L5TA 3TTKA 1MY3A 1MXYA 1VR5A 3ZKKA 3SESA 3CG3A 2DOJA 1MY4A 3B7DA 3SEUA 1YAEA 3TCHA 2RCAA 3RTWB 3KSXA 4DXBA 3T93B 2V3QA 3WAEA 3DLNA 3G7WA 1N3XA 1TT1A 5CMMA 5ITOA 4OETA 3EHUA 1MXWA 3FJMA 1QKAA 4ONYA 3DELB 4OYVA 4OWDA 3E3KA 4QFNA 4HS7A 5I59A 1SVXB 3KGCA 4DLDA 3VVDA 4F3GA 3PPRA 2F34A 4JXIA 4YMBA 4G2ZA 3T9UA 1XVXA 1M5DA 1JEUA 1TFAA 4FE8A 3USDA 3FTOA 3MVYA 3OO9A 2F7AA 3KOSA 1IQ7A 4ESWA 1ELJA 5TPAA 3RN8A 1UTBA 3IOTA 2Q88A 3KOTA 4YB7A 3CFLA 3L6HA 2GHBA 5TPAB 2DWAA 1UTBB 4ISUA 1YTVA 2P0SA 1LFGA 1SW2A 1B6HA 3KN7A 3MZ1A 1IXIA 2VD3A 4WEPA 3ILUB 1Y3QA 1LB9A 3ONMA 3C33A 4WXJA 4BDLA 2H25A 4KHZE 1B0LA 1NH8A 4NF6A 4ECFA 2UVJA 1MRPA 2XD3A 2QS2A 3B6TA 1AOVA 1PBPA 2X7QA 3TELA 2AIXA 3C31A 3TQLA 1MQGA 3SETA 3DP4A 1RYOA 4PETA 3I5OA 3E4RA 2HZKA 4RK2A 3PD8A 4NF5A 4U1ZA 4ZE9A 5L8DA 1B1XA 1NNKA 5BUUA 3EQ1A 4OXVA 3CFZA 1ZU0A 1Y3NA 4EXLA 1I6QA 2DVCA 1ZLQA 1P1QA 3IK6B 3SERA 1H44A 4LP2B 2OWTA 3C32A 4H0WA 3MWBA 3SEWA 5JTYB 2Q8JA 4OFJA 3H03A 2Z8EA 3CFXA 3LC8A 3F11A 3IJXB 5K2YA 3JZJA 1DPEA 4H67A 5I58A 3MJNA 2VGQA 2X7PA 5AA4A 1USYH 5I58B 3S9LC 2F5XA 2AYSA 2DWJA 1MM7A 4QFLA 1XT8A 3CSGA 2VP1A 5AA4B 3K01A 3TODA 3U92A 4DE8A 3VVFA 2Z22A 2V3UA 2E1SA 4IO4A 5HPQA 1LBCA 3PPNA 4FEDA 5BWJA 4F19A 3IR1A 4FJPA 2Z8DA 4ELOA 2FNCA 2GH9A 4F1YA 5K2XA 1PEBA 1A55A 1A40A 1S9TA 4DZ1A 1SW4A 3SDFA 3FATA 2ZYKA 3MVZA 2VD2A 3LSLA 4LUBA 3BKIB 4G8NA 4O3CA 1LFHA 4JWOA 3ILTB 2Z8FA 5AA2B 2ZNTA 2I6EA 1H76A 3O97A 3O6IA 3A09A 2I4CA 2RC7A 4JWXA 4F29A 1MY2A 4JB7A 1MDP1 5TU0A 1IZ1A 4ELPA 4PQJA 1QUKA 2XXQA 4NE4A 4OEUA 5L9MA 4ELRA 3DRHA 5DVJA 1B32A 1I6BA 2WOPA 3FXRA 3MPKA 3UN6A 3G3FA 4ESXA 1S50A 4R73A 4LZ7A 3TFLA 1P1NA 4OHNA 3CR9A 1QUIA 3DRJA 4YAHX 4OVJA 3TMGA 2XXRA 1P99A 2ZYNA 3BFUA 3S4UA 1MPDA 1IEJA 4ZEFA 4KCCA 3R6UA 4JDFA 5I2NA 3T9VA 4NEDA 3VXCA 1LB8A 1MQDA 4IGRA 1FW0A 3I3VA 2A5TB 4FORA 5CBRA 1LFIA 1DTGA 2PVUA 4LVQA 3KN8A 4PFTA 4IY6A 4X9TA 5HBCA 3OELA 4XXUA 1O63A 2DE2A 4Q30B 4ND9A 1GVCA 2F7BA 3H6VA 5AA3A 3K1NA 4I1DA 1B3LA 3O6GA 1R1NA 3M8UA 2PMSA 3Q27A 2OCUA 2RKMA 3OEMA 5EYFA 3VVEA 1CE2A 2H99A 3TZAA 4IO2A 1FTLA 3PU5A 3D4CA 1JW1A 2H5YA 1TXFA 4F2QA 1JW5A 4DDDA 4HCYA 1FQDA 2RC9A 1D9VA 4RK9A 4NF8A 3U8QA 1SYHA 2ONKE 5JEIA 1GR2A 2LAOA 4ZDMA 3H6UA 4FECA 3VLUA 3TYHA 5I57A 1QW0A 4NF8B 3H06B 2QSXA 1NNPA 3I6VA 3VDFA 4I62A 1HSEA 5I57B 4BDNA 1ANFA 4POXA 4JBZA 3IB2A 4LATA 2F6PA 2UXAA 3K00A 4X1DA 3O6PA 3EHSA 2CMOA 2KLFA 4EDPA 3R26A 3FASA 2OBGA 4Z0IA 3CIJA 3RYBA 5H8FA 5I56A 4XKQA 1Y4CA 5CC2A 4M1VA 3TTLA 1B5JA 5F7VA 3W15C 5IKBA 4GXSB 1LAGE 2O6AA 4KI0E 5F1QA 2F36A 4GQOA 4K3FA 5DVFA 4KCDA 3S9NC 2AL5A 3DRIA 4C0RA 4NF4B 3V8XB 1ATGA 2PYYA 4E0XA 1UIVA 2W7YA 1D3KA 2RF1A 2DS9A 3B6QA 4EF1A 3Q29A 3TQWA 1Y4TA 4OMBA 2XD2A 3RYAA 2WOLA 4IY5A 1ZJLA 1MXUA 4G8MA 2VOZA 2DXRA 2RC8A 4NWCA 3RT6B 1FQBA 4C1UA 2O7UA 1Q1KA 1A7LA 4ZE8A 3FVGA 4ZEBA 1NNFA 2D21A 1OMPA 2HAVA 1MQJA 1B46A 1XOCA 4IO3A 4ZZEA 5DYHA 2QS4A 1B0HA 2XX8A 2WKYA 3T9HB 4U23A 3Q26A 1P1UA 4GFRA 5DTBA 1CB6A 3IOUA 5L9SA 2XX9A 2Y7KA 3GBAA 3TAJA 4EQBA 1QULA 1TFDA 2I58A 4KD5A 3BBRA 2OWSA 2B4MA 3MZBA 4EUOA 3FVKA 1M5FA 4GWOA 4F3PA 3C34A 1MY1A 3TPAA 3RTFB 5B70A 2ZMBA 1MQHA 4C1TA 2YLNA 4U4SA 3V89B 2DYXA 1B4HA 3FXQA 3KFMA 2IEEA 4GRKA 1NL5A 3VLWA 2XXUA 1OVBA 3SEYA 3LSFB 4ZEDA 5I59B 1EZ9A 4XKNA 1NNTA 1US4A 2Y7RA 4KR5A 1B7HA 2G93A 5AE4A 3OO6A 2AL4A 3MVWA 4YKKA 4OQOA 3ZS6A 2ANJA 3MUQA 3P7IA 3EN3A 2OJTA 4IO6A 1JVYA 1POY1 3IAZA 1AIVA 4BLAA 2QJEA 3JV9A 4EQ9A 4BDRA 3OENA 1RYXA 3G3HA 4DCYA 2R6GE 3CSBA 4O3BA 3IJOB 5CMKA 2REJA 1IXHA 2V3TA 1OVTA 2UYEA 4NF6B 1Q35A 1YPNA 5CRYA 1B5IA 3FJGA 4DXUA 3K6VA 3CHGA 3IOWA 1Z7ME 2O7IA 2QS3A 1LBBA 5KZTA 2NXOA 1QVSA 3N6UA 4R9GA 2E0SA 1GV8A 2ONRA 3RPWA 3TEPA 3MVXA 4LONB 3MP6A 5I2KA 4NF5B 4QFOA 1UTHA 4R6HA 1BKAA 4Q8RA 1MDQA 4TLLB 4U22A 3K2DA 3G3GA 3OO7A 4RJZA 1MXVA 1UTHB 4ELQA 3K02A 3OXNA 2FA7A 2F6GA 2REGA 3T66A 3U72A 1NH7A 1KWHA 3CG1A 3ZSFA 2IA4A 3FGSA 4DIGA 4QSEA 4U2RA 3VV5A 2YPNA 1MXZA 1Z7NE 2UVGA 5CI5A 1B7ZA 2HCAA 3T96B 1B3EA 3TTRA 2M8CA 1A8FA 2QMWA 5M2VA 2Y7WA 5ITPA 1FTKA 2I49A 4POWA 1SW5A 3U1OA 4EXKA 3FUZA 3W9VA 3D4GA 4M4GA 4JSOA 2B4LA 2I3VA 1II5A 3N6TA 3V83A 4YKJA 1IITA 5HM4B 1ZKBA 1RKMA 3RY3A 4H6DA 3HCQA 5TP9A 1MM6A 3PUVE 2D5WA 3G3JA 3KSJA 3UIFA 3TCFA 3K6XA 1JQFA 4F1UA 5TP9B 4IGTA 3SEVA 1URDA 3ECRA 1MY0A 4PP0A 3IX1A 1B58A 1Y1ZA 2OK2A 1PB9A 3DRGA 1B2HA 3C4MA 3RGYA 4G68A 4NTLA 3FV1A 1LAXA 2DE3A 4F22A 3MW0A 3QUJA 4G68B 1FCKA 2V25A 1MH4A 1PC3A 4KFQA 3FIRA 5H8NA 1FQEA 1LCFA 3QXMA 2FYIA 3M3LA 5H8NB 3KN3A 4G4PA 2XXVA 1LAHE 3MBPA 2PX1A 3H7MA 4IO7A 4KYSA 1SQYA 5I2NB 2ZXTA 4OZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSR A;  1B3G A;  1FQF A;  2Q2A A;  2UYF A;  2BJJ X;  3KBR A;  1DOT A;  1J1N A;  4WED A;  2XXI A;  4OFL A;  1D9Y A;  1B4Z A;  1OQH A;  3A3U A;  1B5H A;  1SW1 A;  2NOO A;  1B3F A;  1B7U A;  5CM6 A;  1IXG A;  1MS7 A;  2I3W A;  4P0G A;  4E0W A;  2RCB A;  1VFE A;  5CBS A;  4JSD A;  2OZZ A;  3PUW E;  4OTE A;  5KDT A;  4NWD A;  4UA8 A;  2O51 A;  2XXP A;  2XXT A;  5EHM A;  4PE5 B;  3W9W A;  4H8J A;  4YKP A;  3TTM A;  4AB5 A;  3BFT A;  5H8Q A;  3TCG A;  3C36 A;  5H8S A;  3MP8 A;  1URS A;  5J1D A;  3LR1 A;  1DMB A;  5H8Q B;  4R2F A;  4HTG A;  3PMX A;  2GFE A;  2V84 A;  3VLV A;  2OLB A;  4GOT A;  3N5L A;  5FHO A;  2DWH A;  3TDJ A;  3PGF A;  3PPP A;  5ICQ A;  1B40 A;  1B3H A;  3MAM A;  4GL8 A;  1M5B A;  1PBQ A;  1ZTY A;  5H8F B;  5I56 B;  1Y1M A;  3CVG A;  2DVZ A;  2H98 A;  4LZ8 A;  4H5G A;  4GLI A;  2NUV A;  3SEX A;  4N13 A;  3IB1 A;  4MBP A;  3RNN A;  3DM0 A;  4BDM A;  4RPO A;  2RIN A;  1WDN A;  3FXU A;  1SYI A;  3PMV A;  4XKR A;  3T22 A;  5ELV A;  2HXW A;  4FIM A;  4R74 A;  1ZBM A;  3PPQ A;  1FTO A;  2ONS A;  3OO8 A;  1EH3 A;  3UK4 A;  1SI1 A;  4H5F A;  2XXH A;  3T9X B;  4KYE A;  5DT6 A;  3EHT A;  3UGW A;  2Y7I A;  2QS1 A;  5AA2 D;  2GRV A;  2ZYO A;  3AXF A;  1MQI A;  3RUM A;  5FHN A;  1FQA A;  4ZEC A;  2UVI A;  3O29 A;  4EQ7 A;  2Z23 A;  3QK6 A;  4I9D A;  4OEN A;  1SBP A;  3K0V A;  3OSQ A;  3RT8 A;  1BP5 A;  4BDO A;  5DEX A;  1VE4 A;  2THI A;  4RPN A;  1TWY A;  1SD3 A;  1IUD A;  1MXX A;  1ZMG A;  5DEX B;  2B3B A;  3FV2 A;  1Y9U A;  2DP8 A;  1I69 A;  4QRZ A;  4GL0 A;  3UP9 A;  1FTJ A;  4THI A;  5DVI A;  4KYD A;  1SI0 A;  3G3I A;  4RA1 A;  4QSC A;  2ALU A;  4R72 A;  3IO4 A;  3FVN A;  5FTI A;  2GHA A;  3LUY A;  4DCX A;  4RYA A;  4Q5T A;  4R75 A;  3S9M C;  2P2A A;  1LGB C;  3UA8 A;  3KJ7 A;  3TUS A;  2HAU A;  4YIC A;  4LA9 A;  4OER A;  5JK4 A;  4F31 B;  1EZP A;  1P1O A;  1OQG A;  1S7Y A;  3DP8 A;  3FJ7 A;  3K1P A;  2ZYM A;  3GXA A;  1HSJ A;  4MF3 A;  3H6T A;  2O68 A;  3O28 A;  1DPP A;  1HSL A;  2DWI A;  4KPT A;  4YB6 A;  2B65 A;  2VHA A;  4I8C A;  1BLF A;  3QYT A;  1O64 A;  3LVU A;  3TTN A;  1R6Z A;  2QRY A;  1B9J A;  3KJT A;  1LLS A;  3JYR A;  4F3S A;  4MH5 A;  4P11 A;  3TKD A;  1POT A;  5EHS A;  1URG A;  1JNF A;  3HN0 A;  3SKP A;  5CMB A;  1P1W A;  2I48 A;  3DRF A;  1AMF A;  4XIG Q;  3FD3 A;  3K6U A;  3N94 A;  4TLM B;  3OEK A;  3H6W A;  4F1V A;  1A8E A;  4AB6 A;  5KCJ A;  4H1X A;  3IOR A;  1A54 A;  1LST A;  1B1H A;  2Y84 A;  4FEB A;  1OIB A;  3E9X A;  2PBW A;  3HHG A;  4U4X A;  1Y3P A;  1DSN A;  5KCJ B;  4LQ2 A;  4R6Y A;  2Q89 A;  4LQ5 A;  1QUJ A;  3KEI A;  3QSL A;  4RNS A;  5ICT A;  1GGG A;  3RQT A;  2D3I A;  3M3F A;  5LOM A;  4OES A;  2HFB A;  5I2K B;  4R9F A;  3VXB A;  3IOV A;  2XX7 A;  2X26 A;  4OFO A;  2DQV A;  4IO5 A;  2HQ0 A;  1Y20 A;  5JTY A;  4LZ5 A;  4N6P A;  1UIU A;  2O1M A;  1N7W A;  1AL3 A;  2R9J A;  2NWJ A;  3IO6 A;  4ZEI A;  4F18 A;  3HST A;  1H43 A;  3R7X A;  1JVX A;  4X48 A;  5AA1 A;  1XHY A;  3O2A A;  2WOK A;  1USY E;  4TQU Q;  3ODB A;  1YCJ A;  3CRB A;  2F35 A;  1SDX A;  2R71 A;  4IB2 A;  1B05 A;  3PUY E;  1UQW A;  4AQ4 A;  4YMA A;  3O9P A;  4HCW A;  1AH5 A;  1MPB A;  4QFP A;  3HPI A;  3Q28 A;  3B6W A;  1US5 A;  2DSF A;  5H8H A;  2I0C A;  2HZL A;  1N84 A;  3S2V A;  3OMB A;  5H8H B;  2CZL A;  4KQP A;  3RLF E;  3WAF A;  1BIY A;  3QIM A;  2G29 A;  4YU0 A;  4QF9 A;  5AA2 A;  1MPC A;  2Y7P A;  5I84 A;  3VE1 B;  4L17 A;  3G3K A;  4HW8 A;  4MFI A;  3U93 A;  3H4Z A;  3C9H A;  4QHQ A;  3K4U A;  5FHM A;  3ZKL A;  4GF8 A;  1WVJ A;  4U1O A;  5A5X A;  2F97 A;  1GTK A;  4U21 A;  3U94 A;  4GVO A;  4F39 A;  2V93 A;  3O66 A;  5A5X B;  3PMW A;  4UAC A;  1D4N A;  3PUZ E;  1WOD A;  3S9E A;  1ZIU A;  4JWY A;  3DRK A;  4R2B A;  3A3C A;  2H9B A;  1VSO A;  2A5T A;  1NFT A;  4O3A A;  1JEV A;  2O1L A;  1JET A;  4OEV A;  1H3D A;  3KG2 A;  1O7T A;  3QAX A;  3GBB A;  4F3B A;  3IB0 A;  1M5C A;  2ZNS A;  2I0B A;  3HO7 A;  1R9L A;  2F78 A;  1IXC A;  1NMU A;  3FVO A;  4Q0C A;  4Z7E A;  4PFW A;  1NKX A;  5FTH A;  3CI8 A;  3K6W A;  2Q2C A;  4QSD A;  4MLV A;  2ESN A;  1T0K A;  2XXY A;  4X1B A;  2XXX A;  4YZZ A;  3HHF A;  3GLB A;  1DTZ A;  3LBS A;  5KDT B;  2ZNU A;  4YB5 A;  1B52 A;  4NMY A;  2P1S A;  3C35 A;  3LSW A;  3PAM A;  1IIW A;  1R9Q A;  4F2O A;  4DXC A;  1PB8 A;  2YJP A;  1LAF E;  3IL1 B;  2QPQ A;  3OD7 A;  2DXY A;  4PFY A;  3V5A A;  3GZG A;  1N0T A;  3OOA A;  4RXL A;  2F7C A;  1N04 A;  5CMC A;  3N26 A;  1EZO A;  3KZG A;  1XVY A;  3MPL A;  3DP6 A;  1FQC A;  4FAT A;  4GD5 A;  3HV1 A;  2F8D A;  4H8I A;  1N7X A;  4EF2 A;  4ZS9 A;  3EF7 A;  3PV0 E;  3K1M A;  2DE4 A;  3MP1 A;  4BDQ A;  1JW4 A;  1MH3 A;  2ABH A;  3THI A;  1M5E A;  3L6G A;  3EPE A;  4FAJ A;  1VFD A;  5IAI A;  4XKP A;  3PD9 A;  1BTJ A;  4G68 C;  1OLA A;  3FZV A;  1QJM A;  4R6K A;  1F9B A;  4NF4 A;  1LCT A;  1OLC A;  1N3W A;  1XS5 A;  4N07 A;  4XTC Q;  2O69 A;  4P0I A;  5ISU A;  1PB7 A;  3MC2 A;  2HEU A;  1FTM A;  4MLQ A;  4RY1 A;  4G8H A;  4PFU A;  2QL3 A;  3O6H A;  5B7D A;  3M3K A;  5L9O A;  1PDA A;  1A99 A;  4WKM A;  2UVH A;  2H4I A;  3E13 X;  3UOR A;  4ZZA A;  1B51 A;  3H3G A;  2O84 X;  2PT2 A;  2I4B A;  4G77 A;  4TOZ A;  1EU8 A;  4ZEK A;  1MG1 A;  2Q9T A;  2A5S A;  1XC1 A;  1QKB A;  1N76 A;  2QMX A;  2XHD A;  3MQ9 A;  2NVU B;  3PUX E;  2PT1 A;  3VFJ A;  3MZ9 A;  1H45 A;  3LSX A;  4H65 A;  2B3F A;  2XXW A;  3Q25 A;  4YKI A;  4QFK A;  1I6A A;  4GXA A;  4GIZ A;  3PPO A;  3QUF A;  1L5T A;  3TTK A;  1MY3 A;  1MXY A;  1VR5 A;  3ZKK A;  3SES A;  3CG3 A;  2DOJ A;  1MY4 A;  3B7D A;  3SEU A;  1YAE A;  3TCH A;  2RCA A;  3RTW B;  3KSX A;  4DXB A;  3T93 B;  2V3Q A;  3WAE A;  3DLN A;  3G7W A;  1N3X A;  1TT1 A;  5CMM A;  5ITO A;  4OET A;  3EHU A;  1MXW A;  3FJM A;  1QKA A;  4ONY A;  3DEL B;  4OYV A;  4OWD A;  3E3K A;  4QFN A;  4HS7 A;  5I59 A;  1SVX B;  3KGC A;  4DLD A;  3VVD A;  4F3G A;  3PPR A;  2F34 A;  4JXI A;  4YMB A;  4G2Z A;  3T9U A;  1XVX A;  1M5D A;  1JEU A;  1TFA A;  4FE8 A;  3USD A;  3FTO A;  3MVY A;  3OO9 A;  2F7A A;  3KOS A;  1IQ7 A;  4ESW A;  1ELJ A;  5TPA A;  3RN8 A;  1UTB A;  3IOT A;  2Q88 A;  3KOT A;  4YB7 A;  3CFL A;  3L6H A;  2GHB A;  5TPA B;  2DWA A;  1UTB B;  4ISU A;  1YTV A;  2P0S A;  1LFG A;  1SW2 A;  1B6H A;  3KN7 A;  3MZ1 A;  1IXI A;  2VD3 A;  4WEP A;  3ILU B;  1Y3Q A;  1LB9 A;  3ONM A;  3C33 A;  4WXJ A;  4BDL A;  2H25 A;  4KHZ E;  1B0L A;  1NH8 A;  4NF6 A;  4ECF A;  2UVJ A;  1MRP A;  2XD3 A;  2QS2 A;  3B6T A;  1AOV A;  1PBP A;  2X7Q A;  3TEL A;  2AIX A;  3C31 A;  3TQL A;  1MQG A;  3SET A;  3DP4 A;  1RYO A;  4PET A;  3I5O A;  3E4R A;  2HZK A;  4RK2 A;  3PD8 A;  4NF5 A;  4U1Z A;  4ZE9 A;  5L8D A;  1B1X A;  1NNK A;  5BUU A;  3EQ1 A;  4OXV A;  3CFZ A;  1ZU0 A;  1Y3N A;  4EXL A;  1I6Q A;  2DVC A;  1ZLQ A;  1P1Q A;  3IK6 B;  3SER A;  1H44 A;  4LP2 B;  2OWT A;  3C32 A;  4H0W A;  3MWB A;  3SEW A;  5JTY B;  2Q8J A;  4OFJ A;  3H03 A;  2Z8E A;  3CFX A;  3LC8 A;  3F11 A;  3IJX B;  5K2Y A;  3JZJ A;  1DPE A;  4H67 A;  5I58 A;  3MJN A;  2VGQ A;  2X7P A;  5AA4 A;  1USY H;  5I58 B;  3S9L C;  2F5X A;  2AYS A;  2DWJ A;  1MM7 A;  4QFL A;  1XT8 A;  3CSG A;  2VP1 A;  5AA4 B;  3K01 A;  3TOD A;  3U92 A;  4DE8 A;  3VVF A;  2Z22 A;  2V3U A;  2E1S A;  4IO4 A;  5HPQ A;  1LBC A;  3PPN A;  4FED A;  5BWJ A;  4F19 A;  3IR1 A;  4FJP A;  2Z8D A;  4ELO A;  2FNC A;  2GH9 A;  4F1Y A;  5K2X A;  1PEB A;  1A55 A;  1A40 A;  1S9T A;  4DZ1 A;  1SW4 A;  3SDF A;  3FAT A;  2ZYK A;  3MVZ A;  2VD2 A;  3LSL A;  4LUB A;  3BKI B;  4G8N A;  4O3C A;  1LFH A;  4JWO A;  3ILT B;  2Z8F A;  5AA2 B;  2ZNT A;  2I6E A;  1H76 A;  3O97 A;  3O6I A;  3A09 A;  2I4C A;  2RC7 A;  4JWX A;  4F29 A;  1MY2 A;  4JB7 A;  1MDP 1;  5TU0 A;  1IZ1 A;  4ELP A;  4PQJ A;  1QUK A;  2XXQ A;  4NE4 A;  4OEU A;  5L9M A;  4ELR A;  3DRH A;  5DVJ A;  1B32 A;  1I6B A;  2WOP A;  3FXR A;  3MPK A;  3UN6 A;  3G3F A;  4ESX A;  1S50 A;  4R73 A;  4LZ7 A;  3TFL A;  1P1N A;  4OHN A;  3CR9 A;  1QUI A;  3DRJ A;  4YAH X;  4OVJ A;  3TMG A;  2XXR A;  1P99 A;  2ZYN A;  3BFU A;  3S4U A;  1MPD A;  1IEJ A;  4ZEF A;  4KCC A;  3R6U A;  4JDF A;  5I2N A;  3T9V A;  4NED A;  3VXC A;  1LB8 A;  1MQD A;  4IGR A;  1FW0 A;  3I3V A;  2A5T B;  4FOR A;  5CBR A;  1LFI A;  1DTG A;  2PVU A;  4LVQ A;  3KN8 A;  4PFT A;  4IY6 A;  4X9T A;  5HBC A;  3OEL A;  4XXU A;  1O63 A;  2DE2 A;  4Q30 B;  4ND9 A;  1GVC A;  2F7B A;  3H6V A;  5AA3 A;  3K1N A;  4I1D A;  1B3L A;  3O6G A;  1R1N A;  3M8U A;  2PMS A;  3Q27 A;  2OCU A;  2RKM A;  3OEM A;  5EYF A;  3VVE A;  1CE2 A;  2H99 A;  3TZA A;  4IO2 A;  1FTL A;  3PU5 A;  3D4C A;  1JW1 A;  2H5Y A;  1TXF A;  4F2Q A;  1JW5 A;  4DDD A;  4HCY A;  1FQD A;  2RC9 A;  1D9V A;  4RK9 A;  4NF8 A;  3U8Q A;  1SYH A;  2ONK E;  5JEI A;  1GR2 A;  2LAO A;  4ZDM A;  3H6U A;  4FEC A;  3VLU A;  3TYH A;  5I57 A;  1QW0 A;  4NF8 B;  3H06 B;  2QSX A;  1NNP A;  3I6V A;  3VDF A;  4I62 A;  1HSE A;  5I57 B;  4BDN A;  1ANF A;  4POX A;  4JBZ A;  3IB2 A;  4LAT A;  2F6P A;  2UXA A;  3K00 A;  4X1D A;  3O6P A;  3EHS A;  2CMO A;  2KLF A;  4EDP A;  3R26 A;  3FAS A;  2OBG A;  4Z0I A;  3CIJ A;  3RYB A;  5H8F A;  5I56 A;  4XKQ A;  1Y4C A;  5CC2 A;  4M1V A;  3TTL A;  1B5J A;  5F7V A;  3W15 C;  5IKB A;  4GXS B;  1LAG E;  2O6A A;  4KI0 E;  5F1Q A;  2F36 A;  4GQO A;  4K3F A;  5DVF A;  4KCD A;  3S9N C;  2AL5 A;  3DRI A;  4C0R A;  4NF4 B;  3V8X B;  1ATG A;  2PYY A;  4E0X A;  1UIV A;  2W7Y A;  1D3K A;  2RF1 A;  2DS9 A;  3B6Q A;  4EF1 A;  3Q29 A;  3TQW A;  1Y4T A;  4OMB A;  2XD2 A;  3RYA A;  2WOL A;  4IY5 A;  1ZJL A;  1MXU A;  4G8M A;  2VOZ A;  2DXR A;  2RC8 A;  4NWC A;  3RT6 B;  1FQB A;  4C1U A;  2O7U A;  1Q1K A;  1A7L A;  4ZE8 A;  3FVG A;  4ZEB A;  1NNF A;  2D21 A;  1OMP A;  2HAV A;  1MQJ A;  1B46 A;  1XOC A;  4IO3 A;  4ZZE A;  5DYH A;  2QS4 A;  1B0H A;  2XX8 A;  2WKY A;  3T9H B;  4U23 A;  3Q26 A;  1P1U A;  4GFR A;  5DTB A;  1CB6 A;  3IOU A;  5L9S A;  2XX9 A;  2Y7K A;  3GBA A;  3TAJ A;  4EQB A;  1QUL A;  1TFD A;  2I58 A;  4KD5 A;  3BBR A;  2OWS A;  2B4M A;  3MZB A;  4EUO A;  3FVK A;  1M5F A;  4GWO A;  4F3P A;  3C34 A;  1MY1 A;  3TPA A;  3RTF B;  5B70 A;  2ZMB A;  1MQH A;  4C1T A;  2YLN A;  4U4S A;  3V89 B;  2DYX A;  1B4H A;  3FXQ A;  3KFM A;  2IEE A;  4GRK A;  1NL5 A;  3VLW A;  2XXU A;  1OVB A;  3SEY A;  3LSF B;  4ZED A;  5I59 B;  1EZ9 A;  4XKN A;  1NNT A;  1US4 A;  2Y7R A;  4KR5 A;  1B7H A;  2G93 A;  5AE4 A;  3OO6 A;  2AL4 A;  3MVW A;  4YKK A;  4OQO A;  3ZS6 A;  2ANJ A;  3MUQ A;  3P7I A;  3EN3 A;  2OJT A;  4IO6 A;  1JVY A;  1POY 1;  3IAZ A;  1AIV A;  4BLA A;  2QJE A;  3JV9 A;  4EQ9 A;  4BDR A;  3OEN A;  1RYX A;  3G3H A;  4DCY A;  2R6G E;  3CSB A;  4O3B A;  3IJO B;  5CMK A;  2REJ A;  1IXH A;  2V3T A;  1OVT A;  2UYE A;  4NF6 B;  1Q35 A;  1YPN A;  5CRY A;  1B5I A;  3FJG A;  4DXU A;  3K6V A;  3CHG A;  3IOW A;  1Z7M E;  2O7I A;  2QS3 A;  1LBB A;  5KZT A;  2NXO A;  1QVS A;  3N6U A;  4R9G A;  2E0S A;  1GV8 A;  2ONR A;  3RPW A;  3TEP A;  3MVX A;  4LON B;  3MP6 A;  5I2K A;  4NF5 B;  4QFO A;  1UTH A;  4R6H A;  1BKA A;  4Q8R A;  1MDQ A;  4TLL B;  4U22 A;  3K2D A;  3G3G A;  3OO7 A;  4RJZ A;  1MXV A;  1UTH B;  4ELQ A;  3K02 A;  3OXN A;  2FA7 A;  2F6G A;  2REG A;  3T66 A;  3U72 A;  1NH7 A;  1KWH A;  3CG1 A;  3ZSF A;  2IA4 A;  3FGS A;  4DIG A;  4QSE A;  4U2R A;  3VV5 A;  2YPN A;  1MXZ A;  1Z7N E;  2UVG A;  5CI5 A;  1B7Z A;  2HCA A;  3T96 B;  1B3E A;  3TTR A;  2M8C A;  1A8F A;  2QMW A;  5M2V A;  2Y7W A;  5ITP A;  1FTK A;  2I49 A;  4POW A;  1SW5 A;  3U1O A;  4EXK A;  3FUZ A;  3W9V A;  3D4G A;  4M4G A;  4JSO A;  2B4L A;  2I3V A;  1II5 A;  3N6T A;  3V83 A;  4YKJ A;  1IIT A;  5HM4 B;  1ZKB A;  1RKM A;  3RY3 A;  4H6D A;  3HCQ A;  5TP9 A;  1MM6 A;  3PUV E;  2D5W A;  3G3J A;  3KSJ A;  3UIF A;  3TCF A;  3K6X A;  1JQF A;  4F1U A;  5TP9 B;  4IGT A;  3SEV A;  1URD A;  3ECR A;  1MY0 A;  4PP0 A;  3IX1 A;  1B58 A;  1Y1Z A;  2OK2 A;  1PB9 A;  3DRG A;  1B2H A;  3C4M A;  3RGY A;  4G68 A;  4NTL A;  3FV1 A;  1LAX A;  2DE3 A;  4F22 A;  3MW0 A;  3QUJ A;  4G68 B;  1FCK A;  2V25 A;  1MH4 A;  1PC3 A;  4KFQ A;  3FIR A;  5H8N A;  1FQE A;  1LCF A;  3QXM A;  2FYI A;  3M3L A;  5H8N B;  3KN3 A;  4G4P A;  2XXV A;  1LAH E;  3MBP A;  2PX1 A;  3H7M A;  4IO7 A;  4KYS A;  1SQY A;  5I2N B;  2ZXT A;  4OZ9 A; 
#chains in the Genus database with same CATH topology
 3OSR A;  2FVZ A;  1B3G A;  3B50 A;  1FQF A;  2Q2A A;  2UYF A;  5LDZ A;  2BJJ X;  3KC1 A;  2P3V A;  1DOT A;  3KBR A;  4FBP A;  1J1N A;  4WED A;  2XXI A;  4N8Y A;  4OFL A;  1D9Y A;  1B4Z A;  1OQH A;  3A3U A;  1B5H A;  5T3J A;  1SW1 A;  2XWI A;  2NOO A;  1B3F A;  1B7U A;  5CM6 A;  1IXG A;  1MS7 A;  2I3W A;  4P0G A;  4E0W A;  2RCB A;  5ET8 A;  1VFE A;  5CBS A;  4JSD A;  2OZZ A;  4N4U A;  3PUW E;  1G0H A;  4OTE A;  5KDT A;  4NQ8 A;  4NWD A;  4UA8 A;  1FPL A;  2O51 A;  2XXP A;  4NN3 A;  4N15 A;  2XXT A;  5EHM A;  4PE5 B;  3W9W A;  2ZZX A;  3E78 A;  4H8J A;  4YKP A;  3TTM A;  4MJO A;  5IZ3 B;  4P1E A;  4AB5 A;  3BFT A;  4MNI A;  5H8Q A;  3TCG A;  3C36 A;  5H8S A;  3MP8 A;  1URS A;  5J1D A;  1RDY A;  3LR1 A;  1DMB A;  5H8Q B;  1NV4 A;  4R2F A;  4HTG A;  3PMX A;  2GFE A;  2V84 A;  3VLV A;  2OLB A;  4GOT A;  3N5L A;  5FHO A;  2DWH A;  3TDJ A;  3PGF A;  3PPP A;  4XEQ A;  5ICQ A;  1B40 A;  4GX3 A;  1B3H A;  3MAM A;  4GL8 A;  1M5B A;  1PBQ A;  1ZTY A;  1IMC A;  5H8F B;  5I56 B;  1Y1M A;  3CVG A;  2DVZ A;  2H98 A;  4LZ8 A;  4H5G A;  3RPL A;  4GLI A;  1KA1 A;  2NUV A;  2R8T A;  3SEX A;  4N13 A;  3IB1 A;  4MBP A;  3RNN A;  3DM0 A;  4BDM A;  4RPO A;  2RIN A;  1WDN A;  3FXU A;  1SYI A;  2F3B A;  3PMV A;  4XKR A;  4N17 A;  3T22 A;  5ELV A;  2HXW A;  4FIM A;  4R74 A;  1ZBM A;  3PPQ A;  2CZI A;  1FTO A;  2ONS A;  2MKZ A;  3OO8 A;  1EH3 A;  3UK4 A;  1SI1 A;  4H5F A;  2XXH A;  3T9X B;  4KYE A;  2WYP A;  5DT6 A;  3EHT A;  4HE2 A;  3UGW A;  2Y7I A;  2QS1 A;  5AA2 D;  2GRV A;  2ZYO A;  3AXF A;  1MQI A;  3RUM A;  5FHN A;  1FQA A;  4ZEC A;  3KBZ A;  2UVI A;  4PC9 A;  3O29 A;  5I3S A;  4EQ7 A;  4N91 A;  2VPN A;  2Q74 A;  2Z23 A;  1EYI A;  1BK4 A;  3QK6 A;  4PAF A;  4I9D A;  4OEN A;  4XFE A;  1SBP A;  3K0V A;  3OSQ A;  3RT8 A;  4PF8 A;  1BP5 A;  4BDO A;  1AWB A;  1G0I A;  5DEX A;  1VE4 A;  2THI A;  4RPN A;  1TWY A;  1SD3 A;  1IUD A;  3MST A;  1MXX A;  1FPD A;  1ZMG A;  5DEX B;  2B3B A;  3FV2 A;  1Y9U A;  2DP8 A;  1I69 A;  4QRZ A;  1YZ0 A;  1FBE A;  4GL0 A;  3UP9 A;  1FTJ A;  4THI A;  5DVI A;  4KYD A;  1SI0 A;  3G3I A;  4RA1 A;  4QSC A;  2ALU A;  4R72 A;  3IO4 A;  3FVN A;  5FTI A;  2GHA A;  3LUY A;  4DCX A;  1FBH A;  3T1B A;  4RYA A;  4Q5T A;  4R75 A;  3S9M C;  4P3L A;  2P2A A;  1LGB C;  3UA8 A;  3KJ7 A;  2PCR A;  2HAU A;  3TUS A;  4YIC A;  4LA9 A;  4OER A;  5JK4 A;  4F31 B;  1NV6 A;  1EZP A;  1P1O A;  1OQG A;  1S7Y A;  3DP8 A;  3FJ7 A;  3K1P A;  2ZYM A;  3GXA A;  1HSJ A;  4MF3 A;  3H6T A;  2O68 A;  3O28 A;  1DPP A;  1HSL A;  2DWI A;  1FBP A;  4KPT A;  4YB6 A;  2B65 A;  2VHA A;  4I8C A;  1BLF A;  3QYT A;  1O64 A;  5ET7 A;  4GWU A;  3LVU A;  3TTN A;  1R6Z A;  2QRY A;  1B9J A;  3KJT A;  1LLS A;  3JYR A;  4F3S A;  4PE3 A;  1CNQ A;  4MH5 A;  4P11 A;  3TKD A;  1NUX A;  1POT A;  5EHS A;  1URG A;  1JNF A;  4JVD A;  3HN0 A;  3SKP A;  5CMB A;  1P1W A;  2I48 A;  3DRF A;  1AMF A;  4XIG Q;  3FD3 A;  3K6U A;  3N94 A;  4TLM B;  3OEK A;  3H6W A;  4F1V A;  1A8E A;  4AB6 A;  5KCJ A;  4H1X A;  3IOR A;  1A54 A;  1LST A;  1B1H A;  2Y84 A;  4FEB A;  1OIB A;  3E9X A;  2PBW A;  3HHG A;  3IFC A;  4U4X A;  1Y3P A;  1DSN A;  4UAB A;  5KCJ B;  4LQ2 A;  4R6Y A;  2Q89 A;  4X8R A;  4LQ5 A;  1QUJ A;  4NHB A;  3KEI A;  3QSL A;  4RNS A;  5ICT A;  1GGG A;  3RQT A;  2D3I A;  3M3F A;  5LOM A;  4OES A;  2HFB A;  5I2K B;  4R9F A;  3VXB A;  3IOV A;  2XX7 A;  2X26 A;  5EQ8 A;  4OFO A;  2DQV A;  4IO5 A;  2HQ0 A;  4O7M A;  1Y20 A;  4N6D A;  1LBV A;  5JTY A;  1LBX A;  4LZ5 A;  4N6P A;  1UIU A;  2O1M A;  1N7W A;  1AL3 A;  2R9J A;  2NWJ A;  3IO6 A;  4ZEI A;  4F18 A;  5ESY A;  3HST A;  1H43 A;  3R7X A;  1JVX A;  4X48 A;  5AA1 A;  1XHY A;  3LV0 A;  3O2A A;  2WOK A;  1USY E;  4NAP A;  4TQU Q;  3ODB A;  1YCJ A;  3CRB A;  2F35 A;  1SDX A;  1QGX A;  2R71 A;  4IB2 A;  1B05 A;  3PUY E;  1UQW A;  4AQ4 A;  1FPE A;  4YMA A;  3O9P A;  4O8M A;  4HCW A;  1AH5 A;  1MPB A;  3GYY A;  4NF0 A;  2GQ1 A;  1FJ9 A;  4GWZ A;  4QFP A;  3HPI A;  3Q28 A;  3B6W A;  1US5 A;  4MAG A;  3ROJ A;  1YYZ A;  2DSF A;  5H8H A;  2I0C A;  2HZL A;  1N84 A;  3S2V A;  3OMB A;  5H8H B;  1FBF A;  2CZL A;  4KQP A;  3RLF E;  3WAF A;  1BIY A;  3QIM A;  2G29 A;  4YU0 A;  4HXV A;  4QF9 A;  4AS4 A;  5AA2 A;  1MPC A;  2Y7P A;  5I84 A;  3VE1 B;  4L17 A;  3G3K A;  4HW8 A;  4OA4 A;  3RYD A;  4MFI A;  3U93 A;  3H4Z A;  3C9H A;  4QHQ A;  1KZ8 A;  3K4U A;  5FHM A;  3ZKL A;  4GF8 A;  1WVJ A;  4U1O A;  5A5X A;  2F97 A;  1GTK A;  3U65 A;  4U21 A;  3U94 A;  4GVO A;  4F39 A;  2V93 A;  3O66 A;  5A5X B;  5EYG A;  3PMW A;  4UAC A;  4MEV A;  1D4N A;  3PUZ E;  1WOD A;  2QFL A;  3S9E A;  1ZIU A;  4JWY A;  2FIX A;  3DRK A;  2PFY A;  4R2B A;  3A3C A;  2H9B A;  1VSO A;  2A5T A;  5DW8 A;  1NFT A;  4O3A A;  1JEV A;  2O1L A;  1JET A;  4OEV A;  2P3N A;  1H3D A;  3KG2 A;  1O7T A;  3QAX A;  3GBB A;  4F3B A;  3IB0 A;  4OVS A;  1M5C A;  2ZNS A;  2I0B A;  3HO7 A;  1R9L A;  2FHY A;  5IM2 A;  2F78 A;  1IXC A;  1NMU A;  3FVO A;  4Q0C A;  4Z7E A;  4PFW A;  1NKX A;  5FTH A;  3CI8 A;  3K6W A;  2Q2C A;  4QSD A;  4MLV A;  2OWZ A;  2ESN A;  1T0K A;  2XXY A;  4DI4 B;  4X1B A;  2XXX A;  4YZZ A;  3HHF A;  3GLB A;  1DTZ A;  3LBS A;  5KDT B;  3QMF A;  2ZNU A;  4YB5 A;  1B52 A;  4NMY A;  2P1S A;  3C35 A;  3LSW A;  4OAN A;  3PAM A;  1IIW A;  1LEV A;  1R9Q A;  4MNP A;  4F2O A;  4DXC A;  1PB8 A;  2YJP A;  1LAF E;  3IL1 B;  2QPQ A;  3OD7 A;  2DXY A;  4PFY A;  3V5A A;  1LBY A;  1N0T A;  3GZG A;  3OOA A;  4RXL A;  2F7C A;  1N04 A;  5CMC A;  3N26 A;  1EZO A;  2XWK A;  1INP A;  3KZG A;  1XVY A;  3MPL A;  3DP6 A;  1FQC A;  4FAT A;  4GD5 A;  3HV1 A;  4PBH A;  4MX6 A;  2F8D A;  4H8I A;  1D9Q A;  1N7X A;  4EF2 A;  2QVU A;  1LBW A;  1RDZ A;  4ZS9 A;  3EF7 A;  3PV0 E;  3K1M A;  2DE4 A;  3MP1 A;  4BDQ A;  1JW4 A;  1MH3 A;  1FPJ A;  2ABH A;  3THI A;  1K9Z A;  1M5E A;  3L6G A;  3EPE A;  3RPL B;  4FAJ A;  1VFD A;  2CZK A;  5IAI A;  4XKP A;  3PD9 A;  1BTJ A;  4G68 C;  1OLA A;  3FZV A;  1QJM A;  4R6K A;  1F9B A;  4NF4 A;  1LCT A;  1OLC A;  1N3W A;  1XS5 A;  4MMP A;  4N07 A;  4XTC Q;  2O69 A;  2ZZW A;  4P0I A;  5ISU A;  1PB7 A;  3MC2 A;  2HEU A;  1FTM A;  4MLQ A;  4RY1 A;  5F24 A;  4G8H A;  2XXK A;  4PFU A;  2QL3 A;  3BIH A;  3O6H A;  5B7D A;  3M3K A;  5L9O A;  1PDA A;  1A99 A;  1FTA A;  4WKM A;  2UVH A;  2H4I A;  3E13 X;  3UOR A;  4ZZA A;  1B51 A;  3H3G A;  2O84 X;  2PT2 A;  2I4B A;  4G77 A;  4TOZ A;  1EU8 A;  5J16 A;  4ZEK A;  1MG1 A;  2Q9T A;  2A5S A;  1XC1 A;  1QKB A;  1N76 A;  2QMX A;  2XHD A;  3MQ9 A;  2NVU B;  3PUX E;  2PT1 A;  3VFJ A;  4PAI A;  3MZ9 A;  1H45 A;  3LSX A;  4H65 A;  2B3F A;  2XXW A;  3Q25 A;  4N81 A;  4QFK A;  1I6A A;  4GXA A;  4YKI A;  4GIZ A;  3PPO A;  3QUF A;  1L5T A;  3TTK A;  1MY3 A;  1MXY A;  1VR5 A;  3ZKK A;  3SES A;  3CG3 A;  2DOJ A;  1MY4 A;  3B7D A;  3SEU A;  1YAE A;  3TCH A;  2RCA A;  3RTW B;  3EKI A;  3KSX A;  4DXB A;  3T93 B;  1IMD A;  1NUY A;  2V3Q A;  3WAE A;  3DLN A;  3G7W A;  1N3X A;  1TT1 A;  5CMM A;  5ITO A;  4OET A;  3EHU A;  1MXW A;  3FJM A;  1QKA A;  4ONY A;  3DEL B;  4OYV A;  4OWD A;  3E3K A;  4QFN A;  4HS7 A;  1SPI A;  1FPG A;  5I59 A;  4PFR A;  3T0J A;  1SVX B;  3KGC A;  4DLD A;  3VVD A;  4I40 A;  2Y5L A;  4F3G A;  3PPR A;  2F34 A;  4JXI A;  4YMB A;  4G2Z A;  3T9U A;  1XVX A;  1M5D A;  1JEU A;  1TFA A;  4FE8 A;  3USD A;  3A29 A;  3FTO A;  3MVY A;  3OO9 A;  2F7A A;  3KOS A;  1IQ7 A;  4ESW A;  1ELJ A;  5TPA A;  3RN8 A;  1UTB A;  4PTK A;  3IOT A;  2Q88 A;  3KOT A;  4YB7 A;  3CFL A;  3L6H A;  2GHB A;  5TPA B;  2DWA A;  1UTB B;  4ISU A;  4P47 A;  1YTV A;  4NG7 A;  2P0S A;  1LFG A;  1SW2 A;  3SZP A;  2BJI A;  1B6H A;  3MYU A;  3KN7 A;  3MZ1 A;  2QVR A;  1IXI A;  2VD3 A;  4WEP A;  3B8B A;  3ILU B;  1Y3Q A;  1LB9 A;  4P9K A;  4MNC A;  3ONM A;  3C33 A;  4WXJ A;  4BDL A;  2H25 A;  2Q8M A;  4KHZ E;  5EQ7 A;  2WBD A;  1B0L A;  5LTC A;  1NH8 A;  4NF6 A;  4ECF A;  2UVJ A;  1IMA A;  1MRP A;  1EYK A;  2XD3 A;  4I3E A;  2QS2 A;  3B6T A;  5I7I A;  1AOV A;  1PBP A;  2X7Q A;  3TEL A;  2XWO A;  2AIX A;  3C31 A;  3TQL A;  1MQG A;  3SET A;  1IMB A;  3DP4 A;  1RYO A;  4PET A;  3I5O A;  3E4R A;  1FPK A;  2HZK A;  4RK2 A;  3PD8 A;  1FPB A;  4NF5 A;  4U1Z A;  4ZE9 A;  5L8D A;  1B1X A;  1NNK A;  5BUU A;  3EQ1 A;  4OXV A;  3CFZ A;  1ZU0 A;  1Y3N A;  4EXL A;  1I6Q A;  2DVC A;  1ZLQ A;  1P1Q A;  3IK6 B;  3SER A;  1H44 A;  4LP2 B;  1NUZ A;  2OWT A;  4NGU A;  3C32 A;  4H0W A;  3MWB A;  3SEW A;  5JTY B;  2Q8J A;  4OFJ A;  3H03 A;  2Z8E A;  3CFX A;  3LC8 A;  3F11 A;  5EQ9 A;  2KR0 A;  3IJX B;  4O7I A;  5K2Y A;  1FPF A;  3JZJ A;  4OVR A;  1DPE A;  4H67 A;  4JVC A;  5I58 A;  3MJN A;  4H45 A;  1NV0 A;  2VGQ A;  1FBG A;  1K9Y A;  2X7P A;  5AA4 A;  1USY H;  5I58 B;  3S9L C;  2F5X A;  2AYS A;  1DCU A;  2DWJ A;  1MM7 A;  4QFL A;  1XT8 A;  3CSG A;  2VP1 A;  5AA4 B;  3K01 A;  4P8B A;  3TOD A;  3U92 A;  4DE8 A;  3VVF A;  3FBP A;  2Z22 A;  2V3U A;  2E1S A;  4IO4 A;  5HPQ A;  1LBC A;  3PPN A;  4FED A;  4PFB A;  5BWJ A;  5FBP A;  4F19 A;  3IR1 A;  4FJP A;  2Z8D A;  4G61 A;  4ELO A;  4NX1 A;  2FNC A;  2GH9 A;  4F1Y A;  5EYH A;  1EYJ A;  5K2X A;  1PEB A;  1A55 A;  1A40 A;  1S9T A;  4DZ1 A;  1SW4 A;  3SDF A;  3FAT A;  2ZYK A;  3MVZ A;  2VD2 A;  3LSL A;  4LUB A;  3BKI B;  4G8N A;  4O3C A;  1LFH A;  4JWO A;  3ILT B;  2Z8F A;  5AA2 B;  2ZNT A;  5ET5 A;  2I6E A;  1H76 A;  3O97 A;  3O6I A;  3A09 A;  2I4C A;  2RC7 A;  4GX6 A;  4JWX A;  4F29 A;  1MY2 A;  4JB7 A;  1MDP 1;  4QBA A;  5TU0 A;  1IZ1 A;  4ELP A;  1IMF A;  4PQJ A;  1QUK A;  2XXQ A;  4NE4 A;  4OEU A;  5L9M A;  4MIJ A;  3DRH A;  4ELR A;  5DVJ A;  1FBD A;  1B32 A;  1I6B A;  2WOP A;  3FXR A;  3MPK A;  3UN6 A;  3G3F A;  4ESX A;  1S50 A;  4R73 A;  4LZ7 A;  3TFL A;  1P1N A;  4OHN A;  3CR9 A;  1QUI A;  3DRJ A;  4YAH X;  4OVJ A;  3TMG A;  2XXR A;  1P99 A;  2ZYN A;  3BFU A;  3S4U A;  1MPD A;  4OVQ A;  1IEJ A;  4ZEF A;  4KCC A;  3R6U A;  4JDF A;  5EQA A;  5ET6 A;  5I2N A;  1Q9D A;  3T9V A;  4NED A;  3VXC A;  1LB8 A;  1MQD A;  4IGR A;  1FW0 A;  3I3V A;  2A5T B;  3KC0 A;  4FOR A;  5CBR A;  1LFI A;  1DTG A;  1RDX A;  2PVU A;  3ISP A;  4LVQ A;  3KN8 A;  4PFT A;  4IY6 A;  4X9T A;  5HBC A;  1DBZ A;  3OEL A;  4XXU A;  1O63 A;  2DE2 A;  4Q30 B;  4ND9 A;  1GVC A;  2F7B A;  3H6V A;  2PFZ A;  5AA3 A;  3K1N A;  4I1D A;  1B3L A;  4JVI A;  3D1R A;  3O6G A;  4OVT A;  1R1N A;  2WEF A;  3M8U A;  2PMS A;  3Q27 A;  2OCU A;  2RKM A;  3OEM A;  5EYF A;  3VVE A;  1CE2 A;  2H99 A;  3TZA A;  4IO2 A;  3LUZ A;  1FTL A;  3PU5 A;  3D4C A;  1JW1 A;  2H5Y A;  4GBV A;  1TXF A;  4PF6 A;  2HXR A;  4OVP A;  4F2Q A;  1JW5 A;  4DDD A;  4PDD A;  4HCY A;  5IZZ A;  1FQD A;  2RC9 A;  1D9V A;  2HHM A;  4RK9 A;  5IZ3 A;  4I3Y A;  4NF8 A;  3U8Q A;  1SYH A;  2ONK E;  5JEI A;  4PAK A;  1GR2 A;  2LAO A;  4ZDM A;  3H6U A;  4FEC A;  3VLU A;  3TYH A;  5I57 A;  1QW0 A;  4NF8 B;  3H06 B;  2QSX A;  1NNP A;  3I6V A;  3VDF A;  4I62 A;  1HSE A;  5I57 B;  4BDN A;  1ANF A;  4IR8 A;  4POX A;  4JBZ A;  3IB2 A;  4LAT A;  4O94 A;  2F6P A;  2UXA A;  4QXD A;  3K00 A;  4X1D A;  3O6P A;  3EHS A;  2CMO A;  2KLF A;  4EDP A;  3R26 A;  3FAS A;  2OBG A;  4Z0I A;  3CIJ A;  2L5V A;  3RYB A;  5H8F A;  5I56 A;  4PGP A;  4XKQ A;  1Y4C A;  5A5L A;  5CC2 A;  4M1V A;  4N8G A;  3TTL A;  1B5J A;  1FPI A;  5F7V A;  3W15 C;  5IKB A;  4GXS B;  2JJK A;  1LAG E;  2O6A A;  4KI0 E;  5F1Q A;  2F36 A;  4GQO A;  4K3F A;  5DVF A;  4KCD A;  3S9N C;  2AL5 A;  3DRI A;  4C0R A;  4NF4 B;  3V8X B;  1ATG A;  2ZZV A;  2PYY A;  4E0X A;  1UIV A;  2W7Y A;  1D3K A;  2RF1 A;  2DS9 A;  3B6Q A;  4EF1 A;  2WBB A;  2CEY A;  3Q29 A;  4XF5 A;  3TQW A;  1JP4 A;  1Y4T A;  4OMB A;  2XD2 A;  3RYA A;  2WOL A;  4IY5 A;  1ZJL A;  1MXU A;  4G8M A;  2VOZ A;  2DXR A;  2RC8 A;  4NWC A;  3RT6 B;  3IFA A;  1FQB A;  4C1U A;  2O7U A;  1Q1K A;  1A7L A;  4ZE8 A;  1NV3 A;  3FVG A;  4ZEB A;  1NNF A;  4GWS A;  4GWW A;  1FSA A;  2D21 A;  1NUW A;  1OMP A;  2HAV A;  1MQJ A;  1B46 A;  1FBC A;  1XOC A;  4IO3 A;  1YXI A;  4ZZE A;  5DYH A;  4KXP A;  2QS4 A;  1B0H A;  2XX8 A;  2WKY A;  3T9H B;  4U23 A;  3Q26 A;  1P1U A;  4GFR A;  5DTB A;  1CB6 A;  3IOU A;  5L9S A;  2XX9 A;  1VDW A;  2Y7K A;  3GBA A;  2FIE A;  2QVV A;  3TAJ A;  4EQB A;  1QUL A;  1TFD A;  2DDK A;  2I58 A;  4KD5 A;  3BBR A;  2OWS A;  2B4M A;  3MZB A;  4EUO A;  3FVK A;  1M5F A;  4GWO A;  4F3P A;  3C34 A;  1MY1 A;  3TPA A;  3RTF B;  4MCO A;  5B70 A;  2ZMB A;  1MQH A;  4C1T A;  2YLN A;  4U4S A;  3V89 B;  2DYX A;  1B4H A;  3FXQ A;  3KFM A;  2IEE A;  4GRK A;  1NL5 A;  3VLW A;  2XXU A;  2FBP A;  2XA5 A;  1OVB A;  3SEY A;  3LSF B;  1XI6 A;  4DI3 D;  4ZED A;  5I59 B;  1EZ9 A;  4XKN A;  1NNT A;  1US4 A;  2Y7R A;  1LBZ A;  4KR5 A;  1B7H A;  2G93 A;  5AE4 A;  3OO6 A;  4PBQ A;  2AL4 A;  2WX9 A;  3E79 A;  3MVW A;  4YKK A;  4OQO A;  4GWY A;  3ZS6 A;  2ANJ A;  3MUQ A;  3P7I A;  4GWX A;  3EN3 A;  2OJT A;  4P1L A;  4IO6 A;  1JVY A;  1POY 1;  3NOH A;  3IAZ A;  1AIV A;  4BLA A;  2QJE A;  3JV9 A;  4EQ9 A;  4P56 A;  4BDR A;  3OEN A;  1RYX A;  2F3D A;  3G3H A;  4DCY A;  2R6G E;  3CSB A;  4O3B A;  3IJO B;  5CMK A;  2REJ A;  1IXH A;  4HE0 A;  2V3T A;  1OVT A;  2UYE A;  4NF6 B;  1FRP A;  1Q35 A;  1YPN A;  5CRY A;  1B5I A;  4MHF A;  2OX3 A;  4GX4 A;  5IZ1 A;  2V4C A;  3FJG A;  4DXU A;  3K6V A;  3CHG A;  3IOW A;  1FJ6 A;  1Z7M E;  2CEX A;  1IME A;  2O7I A;  2QS3 A;  1LBB A;  5KZT A;  2NXO A;  1QVS A;  3N6U A;  4R9G A;  2E0S A;  2VPO A;  1GV8 A;  5I5P A;  1NV2 A;  2ONR A;  3RPW A;  5IGA A;  3TEP A;  3MVX A;  1NV5 A;  3MP6 A;  4LON B;  5I2K A;  4NF5 B;  4QFO A;  1UTH A;  4R6H A;  4H46 A;  1BKA A;  4Q8R A;  4HE1 A;  1MDQ A;  4TLL B;  4U22 A;  3K2D A;  3G3G A;  3OO7 A;  4RJZ A;  1MXV A;  1UTH B;  4PGN A;  4ELQ A;  3K02 A;  3OXN A;  2FA7 A;  1DK4 A;  2F6G A;  2REG A;  3T66 A;  2Y5K A;  3U72 A;  1NH7 A;  1KWH A;  3CG1 A;  3ZSF A;  2IA4 A;  3FGS A;  4DIG A;  4QSE A;  4U2R A;  3VV5 A;  2YPN A;  1MXZ A;  1Z7N E;  2UVG A;  5CI5 A;  1KA0 A;  1B7Z A;  2HCA A;  3T96 B;  3BIG A;  1B3E A;  3TTR A;  2M8C A;  1A8F A;  2QMW A;  5M2V A;  2Y7W A;  5ITP A;  2VT5 A;  1FTK A;  2I49 A;  4POW A;  1SW5 A;  1NV1 A;  3U1O A;  4EXK A;  3FUZ A;  3W9V A;  3D4G A;  4M4G A;  4JSO A;  2B4L A;  2I3V A;  1II5 A;  3N6T A;  2WYK A;  3V83 A;  4YKJ A;  4AS5 A;  1IIT A;  5HM4 B;  1ZKB A;  1RKM A;  4GBW A;  3RY3 A;  4H6D A;  3HCQ A;  5TP9 A;  4PCD A;  1MM6 A;  3PUV E;  2D5W A;  3G3J A;  3KSJ A;  3UIF A;  3TCF A;  3K6X A;  1JQF A;  4F1U A;  5TP9 B;  4IGT A;  3SEV A;  1URD A;  3ECR A;  1MY0 A;  4PP0 A;  3IX1 A;  4PDH A;  1B58 A;  1Y1Z A;  2OK2 A;  1PB9 A;  3HFU A;  3DRG A;  1B2H A;  3C4M A;  3RGY A;  4G68 A;  3FXB A;  4NTL A;  4X04 A;  4N6K A;  3FV1 A;  1LAX A;  2DE3 A;  4LN5 A;  4F22 A;  3MW0 A;  3QUJ A;  4G68 B;  1FCK A;  2V25 A;  2KQZ A;  1MH4 A;  1NI9 A;  1PC3 A;  4KFQ A;  3FIR A;  5H8N A;  1FQE A;  1LCF A;  3QXM A;  2FYI A;  1NV7 A;  3M3L A;  5H8N B;  2HPG A;  3KN3 A;  4PFI A;  4G4P A;  3PTY A;  2CZH A;  2XXV A;  1LAH E;  3MBP A;  2PX1 A;  3H7M A;  4IO7 A;  4KYS A;  1SQY A;  2XWV A;  5I2N B;  2ZXT A;  4OZ9 A; 
#chains in the Genus database with same CATH homology
 3OSR A;  1B3G A;  1FQF A;  2Q2A A;  2UYF A;  2BJJ X;  3KBR A;  1DOT A;  1J1N A;  4WED A;  2XXI A;  4OFL A;  1D9Y A;  1B4Z A;  1OQH A;  3A3U A;  1B5H A;  1SW1 A;  2NOO A;  1B3F A;  1B7U A;  5CM6 A;  1IXG A;  1MS7 A;  2I3W A;  4P0G A;  4E0W A;  2RCB A;  1VFE A;  5CBS A;  4JSD A;  2OZZ A;  3PUW E;  4OTE A;  5KDT A;  4NWD A;  4UA8 A;  2O51 A;  2XXP A;  2XXT A;  5EHM A;  4PE5 B;  3W9W A;  4H8J A;  4YKP A;  3TTM A;  4AB5 A;  3BFT A;  5H8Q A;  3TCG A;  3C36 A;  5H8S A;  3MP8 A;  1URS A;  5J1D A;  3LR1 A;  1DMB A;  5H8Q B;  4R2F A;  4HTG A;  3PMX A;  2GFE A;  2V84 A;  3VLV A;  2OLB A;  4GOT A;  3N5L A;  5FHO A;  2DWH A;  3TDJ A;  3PGF A;  3PPP A;  5ICQ A;  1B40 A;  1B3H A;  3MAM A;  4GL8 A;  1M5B A;  1PBQ A;  1ZTY A;  5H8F B;  5I56 B;  1Y1M A;  3CVG A;  2DVZ A;  2H98 A;  4LZ8 A;  4H5G A;  4GLI A;  2NUV A;  3SEX A;  4N13 A;  3IB1 A;  4MBP A;  3RNN A;  3DM0 A;  4BDM A;  4RPO A;  2RIN A;  1WDN A;  3FXU A;  1SYI A;  3PMV A;  4XKR A;  3T22 A;  5ELV A;  2HXW A;  4FIM A;  4R74 A;  1ZBM A;  3PPQ A;  1FTO A;  2ONS A;  3OO8 A;  1EH3 A;  3UK4 A;  1SI1 A;  4H5F A;  2XXH A;  3T9X B;  4KYE A;  5DT6 A;  3EHT A;  3UGW A;  2Y7I A;  2QS1 A;  5AA2 D;  2GRV A;  2ZYO A;  3AXF A;  1MQI A;  3RUM A;  5FHN A;  1FQA A;  4ZEC A;  2UVI A;  3O29 A;  4EQ7 A;  2Z23 A;  3QK6 A;  4I9D A;  4OEN A;  1SBP A;  3K0V A;  3OSQ A;  3RT8 A;  1BP5 A;  4BDO A;  5DEX A;  1VE4 A;  2THI A;  4RPN A;  1TWY A;  1SD3 A;  1IUD A;  1MXX A;  1ZMG A;  5DEX B;  2B3B A;  3FV2 A;  1Y9U A;  2DP8 A;  1I69 A;  4QRZ A;  4GL0 A;  3UP9 A;  1FTJ A;  4THI A;  5DVI A;  4KYD A;  1SI0 A;  3G3I A;  4RA1 A;  4QSC A;  2ALU A;  4R72 A;  3IO4 A;  3FVN A;  5FTI A;  2GHA A;  3LUY A;  4DCX A;  4RYA A;  4Q5T A;  4R75 A;  3S9M C;  2P2A A;  1LGB C;  3UA8 A;  3KJ7 A;  3TUS A;  2HAU A;  4YIC A;  4LA9 A;  4OER A;  5JK4 A;  4F31 B;  1EZP A;  1P1O A;  1OQG A;  1S7Y A;  3DP8 A;  3FJ7 A;  3K1P A;  2ZYM A;  3GXA A;  1HSJ A;  4MF3 A;  3H6T A;  2O68 A;  3O28 A;  1DPP A;  1HSL A;  2DWI A;  4KPT A;  4YB6 A;  2B65 A;  2VHA A;  4I8C A;  1BLF A;  3QYT A;  1O64 A;  3LVU A;  3TTN A;  1R6Z A;  2QRY A;  1B9J A;  3KJT A;  1LLS A;  3JYR A;  4F3S A;  4MH5 A;  4P11 A;  3TKD A;  1POT A;  5EHS A;  1URG A;  1JNF A;  3HN0 A;  3SKP A;  5CMB A;  1P1W A;  2I48 A;  3DRF A;  1AMF A;  4XIG Q;  3FD3 A;  3K6U A;  3N94 A;  4TLM B;  3OEK A;  3H6W A;  4F1V A;  1A8E A;  4AB6 A;  5KCJ A;  4H1X A;  3IOR A;  1A54 A;  1LST A;  1B1H A;  2Y84 A;  4FEB A;  1OIB A;  3E9X A;  2PBW A;  3HHG A;  4U4X A;  1Y3P A;  1DSN A;  5KCJ B;  4LQ2 A;  4R6Y A;  2Q89 A;  4LQ5 A;  1QUJ A;  3KEI A;  3QSL A;  4RNS A;  5ICT A;  1GGG A;  3RQT A;  2D3I A;  3M3F A;  5LOM A;  4OES A;  2HFB A;  5I2K B;  4R9F A;  3VXB A;  3IOV A;  2XX7 A;  2X26 A;  4OFO A;  2DQV A;  4IO5 A;  2HQ0 A;  1Y20 A;  5JTY A;  4LZ5 A;  4N6P A;  1UIU A;  2O1M A;  1N7W A;  1AL3 A;  2R9J A;  2NWJ A;  3IO6 A;  4ZEI A;  4F18 A;  3HST A;  1H43 A;  3R7X A;  1JVX A;  4X48 A;  5AA1 A;  1XHY A;  3O2A A;  2WOK A;  1USY E;  4TQU Q;  3ODB A;  1YCJ A;  3CRB A;  2F35 A;  1SDX A;  2R71 A;  4IB2 A;  1B05 A;  3PUY E;  1UQW A;  4AQ4 A;  4YMA A;  3O9P A;  4HCW A;  1AH5 A;  1MPB A;  4QFP A;  3HPI A;  3Q28 A;  3B6W A;  1US5 A;  2DSF A;  5H8H A;  2I0C A;  2HZL A;  1N84 A;  3S2V A;  3OMB A;  5H8H B;  2CZL A;  4KQP A;  3RLF E;  3WAF A;  1BIY A;  3QIM A;  2G29 A;  4YU0 A;  4QF9 A;  5AA2 A;  1MPC A;  2Y7P A;  5I84 A;  3VE1 B;  4L17 A;  3G3K A;  4HW8 A;  4MFI A;  3U93 A;  3H4Z A;  3C9H A;  4QHQ A;  3K4U A;  5FHM A;  3ZKL A;  4GF8 A;  1WVJ A;  4U1O A;  5A5X A;  2F97 A;  1GTK A;  4U21 A;  3U94 A;  4GVO A;  4F39 A;  2V93 A;  3O66 A;  5A5X B;  3PMW A;  4UAC A;  1D4N A;  3PUZ E;  1WOD A;  3S9E A;  1ZIU A;  4JWY A;  3DRK A;  4R2B A;  3A3C A;  2H9B A;  1VSO A;  2A5T A;  1NFT A;  4O3A A;  1JEV A;  2O1L A;  1JET A;  4OEV A;  1H3D A;  3KG2 A;  1O7T A;  3QAX A;  3GBB A;  4F3B A;  3IB0 A;  1M5C A;  2ZNS A;  2I0B A;  3HO7 A;  1R9L A;  2F78 A;  1IXC A;  1NMU A;  3FVO A;  4Q0C A;  4Z7E A;  4PFW A;  1NKX A;  5FTH A;  3CI8 A;  3K6W A;  2Q2C A;  4QSD A;  4MLV A;  2ESN A;  1T0K A;  2XXY A;  4X1B A;  2XXX A;  4YZZ A;  3HHF A;  3GLB A;  1DTZ A;  3LBS A;  5KDT B;  2ZNU A;  4YB5 A;  1B52 A;  4NMY A;  2P1S A;  3C35 A;  3LSW A;  3PAM A;  1IIW A;  1R9Q A;  4F2O A;  4DXC A;  1PB8 A;  2YJP A;  1LAF E;  3IL1 B;  2QPQ A;  3OD7 A;  2DXY A;  4PFY A;  3V5A A;  3GZG A;  1N0T A;  3OOA A;  4RXL A;  2F7C A;  1N04 A;  5CMC A;  3N26 A;  1EZO A;  3KZG A;  1XVY A;  3MPL A;  3DP6 A;  1FQC A;  4FAT A;  4GD5 A;  3HV1 A;  2F8D A;  4H8I A;  1N7X A;  4EF2 A;  4ZS9 A;  3EF7 A;  3PV0 E;  3K1M A;  2DE4 A;  3MP1 A;  4BDQ A;  1JW4 A;  1MH3 A;  2ABH A;  3THI A;  1M5E A;  3L6G A;  3EPE A;  4FAJ A;  1VFD A;  5IAI A;  4XKP A;  3PD9 A;  1BTJ A;  4G68 C;  1OLA A;  3FZV A;  1QJM A;  4R6K A;  1F9B A;  4NF4 A;  1LCT A;  1OLC A;  1N3W A;  1XS5 A;  4N07 A;  4XTC Q;  2O69 A;  4P0I A;  5ISU A;  1PB7 A;  3MC2 A;  2HEU A;  1FTM A;  4MLQ A;  4RY1 A;  4G8H A;  4PFU A;  2QL3 A;  3O6H A;  5B7D A;  3M3K A;  5L9O A;  1PDA A;  1A99 A;  4WKM A;  2UVH A;  2H4I A;  3E13 X;  3UOR A;  4ZZA A;  1B51 A;  3H3G A;  2O84 X;  2PT2 A;  2I4B A;  4G77 A;  4TOZ A;  1EU8 A;  4ZEK A;  1MG1 A;  2Q9T A;  2A5S A;  1XC1 A;  1QKB A;  1N76 A;  2QMX A;  2XHD A;  3MQ9 A;  2NVU B;  3PUX E;  2PT1 A;  3VFJ A;  3MZ9 A;  1H45 A;  3LSX A;  4H65 A;  2B3F A;  2XXW A;  3Q25 A;  4YKI A;  4QFK A;  1I6A A;  4GXA A;  4GIZ A;  3PPO A;  3QUF A;  1L5T A;  3TTK A;  1MY3 A;  1MXY A;  1VR5 A;  3ZKK A;  3SES A;  3CG3 A;  2DOJ A;  1MY4 A;  3B7D A;  3SEU A;  1YAE A;  3TCH A;  2RCA A;  3RTW B;  3KSX A;  4DXB A;  3T93 B;  2V3Q A;  3WAE A;  3DLN A;  3G7W A;  1N3X A;  1TT1 A;  5CMM A;  5ITO A;  4OET A;  3EHU A;  1MXW A;  3FJM A;  1QKA A;  4ONY A;  3DEL B;  4OYV A;  4OWD A;  3E3K A;  4QFN A;  4HS7 A;  5I59 A;  1SVX B;  3KGC A;  4DLD A;  3VVD A;  4F3G A;  3PPR A;  2F34 A;  4JXI A;  4YMB A;  4G2Z A;  3T9U A;  1XVX A;  1M5D A;  1JEU A;  1TFA A;  4FE8 A;  3USD A;  3FTO A;  3MVY A;  3OO9 A;  2F7A A;  3KOS A;  1IQ7 A;  4ESW A;  1ELJ A;  5TPA A;  3RN8 A;  1UTB A;  3IOT A;  2Q88 A;  3KOT A;  4YB7 A;  3CFL A;  3L6H A;  2GHB A;  5TPA B;  2DWA A;  1UTB B;  4ISU A;  1YTV A;  2P0S A;  1LFG A;  1SW2 A;  1B6H A;  3KN7 A;  3MZ1 A;  1IXI A;  2VD3 A;  4WEP A;  3ILU B;  1Y3Q A;  1LB9 A;  3ONM A;  3C33 A;  4WXJ A;  4BDL A;  2H25 A;  4KHZ E;  1B0L A;  1NH8 A;  4NF6 A;  4ECF A;  2UVJ A;  1MRP A;  2XD3 A;  2QS2 A;  3B6T A;  1AOV A;  1PBP A;  2X7Q A;  3TEL A;  2AIX A;  3C31 A;  3TQL A;  1MQG A;  3SET A;  3DP4 A;  1RYO A;  4PET A;  3I5O A;  3E4R A;  2HZK A;  4RK2 A;  3PD8 A;  4NF5 A;  4U1Z A;  4ZE9 A;  5L8D A;  1B1X A;  1NNK A;  5BUU A;  3EQ1 A;  4OXV A;  3CFZ A;  1ZU0 A;  1Y3N A;  4EXL A;  1I6Q A;  2DVC A;  1ZLQ A;  1P1Q A;  3IK6 B;  3SER A;  1H44 A;  4LP2 B;  2OWT A;  3C32 A;  4H0W A;  3MWB A;  3SEW A;  5JTY B;  2Q8J A;  4OFJ A;  3H03 A;  2Z8E A;  3CFX A;  3LC8 A;  3F11 A;  3IJX B;  5K2Y A;  3JZJ A;  1DPE A;  4H67 A;  5I58 A;  3MJN A;  2VGQ A;  2X7P A;  5AA4 A;  1USY H;  5I58 B;  3S9L C;  2F5X A;  2AYS A;  2DWJ A;  1MM7 A;  4QFL A;  1XT8 A;  3CSG A;  2VP1 A;  5AA4 B;  3K01 A;  3TOD A;  3U92 A;  4DE8 A;  3VVF A;  2Z22 A;  2V3U A;  2E1S A;  4IO4 A;  5HPQ A;  1LBC A;  3PPN A;  4FED A;  5BWJ A;  4F19 A;  3IR1 A;  4FJP A;  2Z8D A;  4ELO A;  2FNC A;  2GH9 A;  4F1Y A;  5K2X A;  1PEB A;  1A55 A;  1A40 A;  1S9T A;  4DZ1 A;  1SW4 A;  3SDF A;  3FAT A;  2ZYK A;  3MVZ A;  2VD2 A;  3LSL A;  4LUB A;  3BKI B;  4G8N A;  4O3C A;  1LFH A;  4JWO A;  3ILT B;  2Z8F A;  5AA2 B;  2ZNT A;  2I6E A;  1H76 A;  3O97 A;  3O6I A;  3A09 A;  2I4C A;  2RC7 A;  4JWX A;  4F29 A;  1MY2 A;  4JB7 A;  1MDP 1;  5TU0 A;  1IZ1 A;  4ELP A;  4PQJ A;  1QUK A;  2XXQ A;  4NE4 A;  4OEU A;  5L9M A;  4ELR A;  3DRH A;  5DVJ A;  1B32 A;  1I6B A;  2WOP A;  3FXR A;  3MPK A;  3UN6 A;  3G3F A;  4ESX A;  1S50 A;  4R73 A;  4LZ7 A;  3TFL A;  1P1N A;  4OHN A;  3CR9 A;  1QUI A;  3DRJ A;  4YAH X;  4OVJ A;  3TMG A;  2XXR A;  1P99 A;  2ZYN A;  3BFU A;  3S4U A;  1MPD A;  1IEJ A;  4ZEF A;  4KCC A;  3R6U A;  4JDF A;  5I2N A;  3T9V A;  4NED A;  3VXC A;  1LB8 A;  1MQD A;  4IGR A;  1FW0 A;  3I3V A;  2A5T B;  4FOR A;  5CBR A;  1LFI A;  1DTG A;  2PVU A;  4LVQ A;  3KN8 A;  4PFT A;  4IY6 A;  4X9T A;  5HBC A;  3OEL A;  4XXU A;  1O63 A;  2DE2 A;  4Q30 B;  4ND9 A;  1GVC A;  2F7B A;  3H6V A;  5AA3 A;  3K1N A;  4I1D A;  1B3L A;  3O6G A;  1R1N A;  3M8U A;  2PMS A;  3Q27 A;  2OCU A;  2RKM A;  3OEM A;  5EYF A;  3VVE A;  1CE2 A;  2H99 A;  3TZA A;  4IO2 A;  1FTL A;  3PU5 A;  3D4C A;  1JW1 A;  2H5Y A;  1TXF A;  4F2Q A;  1JW5 A;  4DDD A;  4HCY A;  1FQD A;  2RC9 A;  1D9V A;  4RK9 A;  4NF8 A;  3U8Q A;  1SYH A;  2ONK E;  5JEI A;  1GR2 A;  2LAO A;  4ZDM A;  3H6U A;  4FEC A;  3VLU A;  3TYH A;  5I57 A;  1QW0 A;  4NF8 B;  3H06 B;  2QSX A;  1NNP A;  3I6V A;  3VDF A;  4I62 A;  1HSE A;  5I57 B;  4BDN A;  1ANF A;  4POX A;  4JBZ A;  3IB2 A;  4LAT A;  2F6P A;  2UXA A;  3K00 A;  4X1D A;  3O6P A;  3EHS A;  2CMO A;  2KLF A;  4EDP A;  3R26 A;  3FAS A;  2OBG A;  4Z0I A;  3CIJ A;  3RYB A;  5H8F A;  5I56 A;  4XKQ A;  1Y4C A;  5CC2 A;  4M1V A;  3TTL A;  1B5J A;  5F7V A;  3W15 C;  5IKB A;  4GXS B;  1LAG E;  2O6A A;  4KI0 E;  5F1Q A;  2F36 A;  4GQO A;  4K3F A;  5DVF A;  4KCD A;  3S9N C;  2AL5 A;  3DRI A;  4C0R A;  4NF4 B;  3V8X B;  1ATG A;  2PYY A;  4E0X A;  1UIV A;  2W7Y A;  1D3K A;  2RF1 A;  2DS9 A;  3B6Q A;  4EF1 A;  3Q29 A;  3TQW A;  1Y4T A;  4OMB A;  2XD2 A;  3RYA A;  2WOL A;  4IY5 A;  1ZJL A;  1MXU A;  4G8M A;  2VOZ A;  2DXR A;  2RC8 A;  4NWC A;  3RT6 B;  1FQB A;  4C1U A;  2O7U A;  1Q1K A;  1A7L A;  4ZE8 A;  3FVG A;  4ZEB A;  1NNF A;  2D21 A;  1OMP A;  2HAV A;  1MQJ A;  1B46 A;  1XOC A;  4IO3 A;  4ZZE A;  5DYH A;  2QS4 A;  1B0H A;  2XX8 A;  2WKY A;  3T9H B;  4U23 A;  3Q26 A;  1P1U A;  4GFR A;  5DTB A;  1CB6 A;  3IOU A;  5L9S A;  2XX9 A;  2Y7K A;  3GBA A;  3TAJ A;  4EQB A;  1QUL A;  1TFD A;  2I58 A;  4KD5 A;  3BBR A;  2OWS A;  2B4M A;  3MZB A;  4EUO A;  3FVK A;  1M5F A;  4GWO A;  4F3P A;  3C34 A;  1MY1 A;  3TPA A;  3RTF B;  5B70 A;  2ZMB A;  1MQH A;  4C1T A;  2YLN A;  4U4S A;  3V89 B;  2DYX A;  1B4H A;  3FXQ A;  3KFM A;  2IEE A;  4GRK A;  1NL5 A;  3VLW A;  2XXU A;  1OVB A;  3SEY A;  3LSF B;  4ZED A;  5I59 B;  1EZ9 A;  4XKN A;  1NNT A;  1US4 A;  2Y7R A;  4KR5 A;  1B7H A;  2G93 A;  5AE4 A;  3OO6 A;  2AL4 A;  3MVW A;  4YKK A;  4OQO A;  3ZS6 A;  2ANJ A;  3MUQ A;  3P7I A;  3EN3 A;  2OJT A;  4IO6 A;  1JVY A;  1POY 1;  3IAZ A;  1AIV A;  4BLA A;  2QJE A;  3JV9 A;  4EQ9 A;  4BDR A;  3OEN A;  1RYX A;  3G3H A;  4DCY A;  2R6G E;  3CSB A;  4O3B A;  3IJO B;  5CMK A;  2REJ A;  1IXH A;  2V3T A;  1OVT A;  2UYE A;  4NF6 B;  1Q35 A;  1YPN A;  5CRY A;  1B5I A;  3FJG A;  4DXU A;  3K6V A;  3CHG A;  3IOW A;  1Z7M E;  2O7I A;  2QS3 A;  1LBB A;  5KZT A;  2NXO A;  1QVS A;  3N6U A;  4R9G A;  2E0S A;  1GV8 A;  2ONR A;  3RPW A;  3TEP A;  3MVX A;  4LON B;  3MP6 A;  5I2K A;  4NF5 B;  4QFO A;  1UTH A;  4R6H A;  1BKA A;  4Q8R A;  1MDQ A;  4TLL B;  4U22 A;  3K2D A;  3G3G A;  3OO7 A;  4RJZ A;  1MXV A;  1UTH B;  4ELQ A;  3K02 A;  3OXN A;  2FA7 A;  2F6G A;  2REG A;  3T66 A;  3U72 A;  1NH7 A;  1KWH A;  3CG1 A;  3ZSF A;  2IA4 A;  3FGS A;  4DIG A;  4QSE A;  4U2R A;  3VV5 A;  2YPN A;  1MXZ A;  1Z7N E;  2UVG A;  5CI5 A;  1B7Z A;  2HCA A;  3T96 B;  1B3E A;  3TTR A;  2M8C A;  1A8F A;  2QMW A;  5M2V A;  2Y7W A;  5ITP A;  1FTK A;  2I49 A;  4POW A;  1SW5 A;  3U1O A;  4EXK A;  3FUZ A;  3W9V A;  3D4G A;  4M4G A;  4JSO A;  2B4L A;  2I3V A;  1II5 A;  3N6T A;  3V83 A;  4YKJ A;  1IIT A;  5HM4 B;  1ZKB A;  1RKM A;  3RY3 A;  4H6D A;  3HCQ A;  5TP9 A;  1MM6 A;  3PUV E;  2D5W A;  3G3J A;  3KSJ A;  3UIF A;  3TCF A;  3K6X A;  1JQF A;  4F1U A;  5TP9 B;  4IGT A;  3SEV A;  1URD A;  3ECR A;  1MY0 A;  4PP0 A;  3IX1 A;  1B58 A;  1Y1Z A;  2OK2 A;  1PB9 A;  3DRG A;  1B2H A;  3C4M A;  3RGY A;  4G68 A;  4NTL A;  3FV1 A;  1LAX A;  2DE3 A;  4F22 A;  3MW0 A;  3QUJ A;  4G68 B;  1FCK A;  2V25 A;  1MH4 A;  1PC3 A;  4KFQ A;  3FIR A;  5H8N A;  1FQE A;  1LCF A;  3QXM A;  2FYI A;  3M3L A;  5H8N B;  3KN3 A;  4G4P A;  2XXV A;  1LAH E;  3MBP A;  2PX1 A;  3H7M A;  4IO7 A;  4KYS A;  1SQY A;  5I2N B;  2ZXT A;  4OZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...