1B1HA

Oligo-peptide binding protein/tripeptide (lys hpe lys) complex
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
517
structure length
517
Chain Sequence
b'ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
molecule tags Signaling protein
source organism Salmonella typhimurium
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
total genus 189
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b1hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b1hA02
3EPEA 2UVGA 4KI0E 3O6GA 3DRHA 3OMBA 5FHOA 4PFWA 3M3KA 3LR1A 4AB5A 3IOWA 1TFDA 5EYFA 2V3UA 4NF6A 1B3LA 2F8DA 4MH5A 4LA9A 2R6GE 4KQPA 4KYDA 3T22A 1B4HA 3L6GA 1LAFE 1QKAA 4Q5TA 2B3BA 1MQIA 1JETA 4I8CA 4PFYA 3FVKA 1HSLA 3V5AA 3HHGA 1MY1A 4YB7A 4H0WA 3PMWA 2XXRA 1B3GA 3O28A 4DCXA 4GOTA 3C35A 1ZLQA 2IEEA 3FIRA 3VLUA 4ZZAA 4ECFA 4KD5A 2QS2A 1Q1KA 4XKNA 1SW1A 3MC2A 3R7XA 3BFTA 2I0CA 1LSTA 3C31A 3F11A 3MVZA 3RQTA 1BTJA 1XVXA 2H9BA 3PPRA 1B32A 2UVJA 4KCDA 5CBSA 2B65A 3KJTA 3V89B 1SI0A 4ZE9A 2NWJA 3BBRA 3I6VA 4P0GA 2ONRA 5H8NA 1N84A 1WVJA 3DP6A 4FEDA 3MPLA 5JK4A 3EN3A 1DTGA 3PUYE 1Y4CA 4U4SA 2H98A 3CSGA 3UA8A 5A5XB 2OZZA 1FQEA 1MPCA 2ZNSA 1IZ1A 4KCCA 5I59B 4U23A 2A5SA 4EUOA 5AA4A 1N3XA 4AB6A 1M5CA 5DVIA 3FZVA 1N04A 4RPOA 1A8EA 4Z7EA 1H3DA 2A5TA 3OO9A 1SW4A 1FQBA 4QFOA 2O1LA 4POXA 2DE3A 4C0RA 2AL5A 2O6AA 1J1NA 5IKBA 2F7CA 5I2NA 2DQVA 2RC9A 4GQOA 1ATGA 2O7IA 3MW0A 4WEDA 1JVYA 1ZIUA 2V84A 3TQLA 5I2NB 2E0SA 3DELB 1LAXA 4IO2A 1N0TA 4R73A 1NNFA 1H43A 1MY2A 5JTYB 1I6BA 5L9OA 4GL0A 3T96B 5I59A 1A54A 3B6TA 2OWTA 3LUYA 4IO4A 3LSFB 4NF8B 1CB6A 2XD2A 4OXVA 3OEKA 1H45A 1B05A 3O6PA 2CMOA 5ICQA 2QMWA 3FJGA 3RN8A 1ZBMA 2XXQA 1R6ZA 3TTRA 5AE4A 4R72A 1FTOA 1PDAA 3EHSA 3K2DA 5AA4B 1YCJA 2RC7A 3H4ZA 3TKDA 3GBAA 2G29A 2F97A 4OETA 3B6QA 1HSJA 1MQGA 1QUKA 1LFHA 2WOKA 5CM6A 3E13X 1FQDA 2ONSA 3MP1A 2QPQA 4IO6A 2B4LA 3CR9A 5F1QA 4R9GA 2VHAA 5EHSA 3RNNA 3MZ9A 3PUXE 3MBPA 3H3GA 3U93A 1F9BA 4BDMA 3O2AA 2F7AA 3K6XA 1OLAA 1LFIA 4MF3A 4G68B 2DE2A 3HCQA 1GVCA 1POTA 1AH5A 2DE4A 3ZS6A 2W7YA 4F31B 3OENA 4GRKA 3PD9A 1LAHE 3K6VA 5BWJA 3N6UA 4ZEDA 2I3WA 4NE4A 4GXAA 2HCAA 2UVIA 3IJOB 1LLSA 1PC3A 3O66A 4ND9A 4NWDA 4N07A 4RXLA 4JSOA 3KSXA 2XXHA 4X9TA 4ZEFA 5AA1A 2RC8A 4M1VA 5L9MA 1TXFA 2Q89A 3RYBA 4FJPA 3B7DA 1B4ZA 4RJZA 1QUIA 4O3CA 3VXCA 5LOMA 1OQGA 2VP1A 1RKMA 4H6DA 2QS3A 4P0IA 2Q8JA 3M3LA 4MLQA 4R2FA 1TWYA 2I4CA 1SQYA 3TEPA 3LSLA 4DIGA 1A99A 1NMUA 1ELJA 3SEWA 4PFTA 2UYFA 3S9NC 1O7TA 4IY6A 1USYH 3Q29A 2RKMA 1OVTA 4F3SA 1MPBA 4GVOA 3FASA 4G77A 1MM6A 3MP8A 4YICA 4FE8A 4N6PA 3OOAA 5TU0A 4U21A 2WOLA 3MQ9A 4XKPA 2QS4A 5KCJB 4RYAA 3QIMA 4R6HA 3G3FA 4NMYA 4YMBA 1PBQA 1EH3A 1MY4A 3H6WA 5AA2A 3IB0A 1IIWA 4KR5A 4C1UA 3EHTA 1Z7ME 4U4XA 1MY3A 4XKRA 4NTLA 1JVXA 1I69A 4YZZA 3VVEA 1PB8A 3FVNA 4M4GA 5B70A 3KG2A 1P99A 2HEUA 1CE2A 4LONB 1AL3A 4NEDA 4I1DA 2UYEA 5DYHA 4PE5B 2QS1A 3O97A 4LQ2A 3K1NA 1B9JA 1XC1A 3OSRA 4JSDA 4OFLA 2XXVA 5ELVA 5JTYA 4GFRA 2OJTA 1LB8A 1GTKA 2REJA 1MDQA 1YAEA 4R6YA 4F19A 4G4PA 3RTFB 5H8HB 4NF5B 4LZ8A 5TP9B 3BFUA 3FUZA 4XTCQ 1PEBA 3RLFE 1R9QA 3W15C 3H6VA 2AYSA 4QSEA 3DRJA 4EQ9A 4IGTA 4FORA 1MXYA 2XX7A 4XXUA 3VLWA 4IO3A 4OZ9A 3VXBA 1USYE 3LSXA 3UIFA 2ABHA 2XX8A 3TODA 4QFKA 3IL1B 3EQ1A 4YAHX 4I9DA 1LBBA 3MVXA 1BLFA 2P0SA 4IY5A 4HW8A 1DTZA 4ONYA 1P1UA 3FTOA 3K02A 4F2OA 2DWIA 4G68C 2ZNTA 1B3HA 1MG1A 3VV5A 4AQ4A 3IB1A 1PBPA 2DOJA 4TQUQ 3PUZE 3EF7A 5I2KB 3SERA 2I0BA 1B51A 4R6KA 1B5IA 4U22A 4BDLA 1QUJA 4E0WA 1EU8A 5H8NB 2HZKA 3FXQA 3HV1A 3O6HA 3ZSFA 3I5OA 1IUDA 3U92A 3G3JA 1QKBA 4YB6A 3D4CA 5HBCA 4C1TA 5ITPA 4YU0A 3Q25A 3TQWA 3Q28A 3PPPA 2RINA 1IXCA 1AOVA 4GD5A 5CMBA 2O51A 1IXGA 3OELA 2Q9TA 3T9HB 4PFUA 2ZYKA 1B2HA 5EHMA 2H25A 2Z8FA 3O6IA 3LBSA 3PMXA 4H8IA 1LAGE 3PUVE 1B6HA 4F2QA 2R9JA 1BKAA 1Y3PA 2Y84A 4IGRA 4RK9A 3VFJA 1H44A 3H06B 3Q27A 4OTEA 2RF1A 3TCGA 5I84A 3DP8A 5ICTA 3CFZA 1Y20A 3H7MA 4XKQA 4ZDMA 2M8CA 1XT8A 1YPNA 1Y3QA 1A7LA 2ANJA 3C4MA 4EF2A 1UQWA 4MBPA 4EQBA 2Y7PA 3IOVA 1D3KA 5KDTA 1FQAA 2XXWA 3KN7A 4X1DA 4BDQA 5AA2D 2XXPA 3CSBA 3CRBA 4F39A 2Y7RA 1R1NA 2DXYA 3K00A 1XHYA 1UIUA 3OO8A 3TDJA 1LBCA 4DXBA 3OD7A 3BKIB 3R6UA 1I6QA 2O84X 2PMSA 4ZS9A 4F1UA 3S9LC 4GL8A 4R2BA 3H03A 2DVCA 3PPOA 3N6TA 4H8JA 4YKJA 3TAJA 1B5HA 3PPNA 4RPNA 4R74A 4OVJA 2XHDA 2QSXA 2REGA 3VDFA 4EQ7A 2V3QA 1A55A 4LUBA 3MJNA 3CIJA 1B7HA 4ESXA 4U2RA 1B52A 2FNCA 2NVUB 3G3HA 5J1DA 4N13A 3O9PA 4BLAA 1DMBA 3K0VA 2THIA 1B7ZA 1LCTA 1IITA 4YKPA 3T9XB 1NNPA 2HFBA 3QUJA 1NNTA 1US4A 1SDXA 3A3CA 3FJ7A 4FEBA 5CI5A 1MQJA 1NH8A 1Y9UA 2ZYNA 5ISUA 2VD2A 3PGFA 3QYTA 1S7YA 4OWDA 3MAMA 4G2ZA 4QSCA 1OMPA 1PB9A 1SW5A 2QL3A 4FIMA 3TTKA 3CG1A 3IOUA 2YPNA 3JZJA 1URSA 1OVBA 2LAOA 1URGA 2Z8EA 2PT1A 3W9VA 3C36A 1II5A 3WAEA 1N7WA 4PETA 1AIVA 1MXUA 4GLIA 5HM4B 4ISUA 3KOTA 2QJEA 3HHFA 3PPQA 1B7UA 1M5DA 5FTHA 1SYHA 3SEXA 2UXAA 2HXWA 3K6WA 2E1SA 5CRYA 4OESA 3ILTB 3IB2A 1XOCA 1PB7A 1MQHA 2Q2CA 4THIA 2WOPA 3USDA 1JEVA 2NXOA 1MXWA 3HN0A 4JDFA 4QFPA 3KOSA 5DEXB 4BDNA 4LVQA 4DZ1A 4KFQA 1EZOA 1B1XA 3MVYA 3GZGA 3E4RA 3UK4A 1MXVA 1OLCA 4ESWA 3IR1A 3RT8A 2Q88A 3KN3A 3KN8A 5I2KA 2O1MA 1M5FA 4HTGA 4MFIA 4NF6B 3S9EA 2NOOA 1O64A 2IA4A 2RCAA 4MLVA 3RUMA 4DE8A 4ZE8A 2XD3A 4OFJA 2R71A 4Z0IA 2H4IA 1SD3A 4I62A 5M2VA 4TOZA 1P1WA 4RY1A 4YKKA 2Z22A 3KSJA 1MDP1 2DWJA 3EHUA 4QHQA 4X1BA 3DRGA 3K1PA 5I58B 4LP2B 3M3FA 4JXIA 4UA8A 3VVDA 4DDDA 4R75A 2B4MA 3VE1B 4ZECA 3KFMA 5HPQA 1FTLA 2Y7WA 3A09A 3CG3A 3FV2A 5TP9A 1ANFA 1AMFA 2F6GA 1LCFA 2I48A 3FXRA 3H6UA 2X7QA 2ZXTA 3CFXA 4G8HA 4O3BA 2D21A 3E3KA 3FGSA 1UTHA 4OQOA 3FATA 1RYOA 5AA2B 1UTBB 2PX1A 3JV9A 3CI8A 2AIXA 2V25A 4IO7A 4FAJA 3MPKA 1GR2A 1LFGA 4H65A 3PMVA 3TMGA 3UN6A 2ZNUA 5CMCA 4EF1A 4GIZA 4LQ5A 4QSDA 2Y7KA 3MP6A 3TELA 4ELPA 4ZEIA 4IB2A 4UACA 2OBGA 1JW4A 3D4GA 4WKMA 5TPAB 1N7XA 5I58A 1Y4TA 2H99A 2DP8A 3K01A 2OLBA 1WODA 2Z8DA 4YMAA 1EZ9A 2P1SA 2V3TA 3IX1A 1GGGA 3GBBA 3HO7A 1P1NA 4L17A 2I49A 4PQJA 5DVJA 1IEJA 3T9UA 2VGQA 3TTMA 3HPIA 1BP5A 1Q35A 3W9WA 2GFEA 2G93A 3U94A 1DOTA 4F3PA 2GHAA 2YLNA 1LB9A 4JWOA 5KCJA 1B3FA 1SVXB 1VR5A 4ZZEA 2I3VA 2I6EA 3T66A 3VVFA 1Y1ZA 3DRIA 1B0HA 1FTKA 1SYIA 4DCYA 1YTVA 1ZMGA 2F34A 5KDTB 4NF4B 3OSQA 2D3IA 2AL4A 2Z23A 2BJJX 2HZLA 2KLFA 3DP4A 2GH9A 4H5GA 4QRZA 1B0LA 3SETA 3DRKA 2F78A 4KYSA 3TCHA 1JW5A 4OERA 3U8QA 3RT6B 2ZMBA 2NUVA 3RYAA 1N76A 2O69A 3MZBA 5CBRA 1MPDA 4H5FA 2Q2AA 1D4NA 5CC2A 1NH7A 3SDFA 3UP9A 4OEUA 3N26A 4O3AA 4POWA 1ZJLA 3FD3A 1M5BA 2XX9A 2P2AA 3C32A 1M5EA 2DXRA 2Y7IA 3PU5A 1SBPA 3LC8A 2WKYA 4HCYA 3OXNA 3IAZA 4OYVA 4YKIA 3UORA 3C34A 1ZTYA 2ESNA 3FJMA 3L6HA 4G68A 4HCWA 4LZ5A 3V8XB 3GLBA 5DTBA 4E0XA 3S2VA 1B40A 4TLMB 1TT1A 1O63A 2X26A 1VFDA 3AXFA 5DVFA 1LGBC 3C33A 3SEYA 4NF5A 5BUUA 1S9TA 2ALUA 2DS9A 2QRYA 3CFLA 5IAIA 3SKPA 4R9FA 1IQ7A 3WAFA 1MQDA 3IO6A 4TLLB 1T0KA 2XXXA 1B1HA 3IO4A 3RTWB 3JYRA 1D9VA 3K6UA 1FQFA 4GXSB 2FA7A 3O29A 3IJXB 3SESA 5F7VA 1NFTA 3LSWA 3KEIA 3ONMA 4LATA 3U1OA 4GF8A 4G8MA 1EZPA 1POY1 5KZTA 3A3UA 1D9YA 4DLDA 1NKXA 1B46A 3ILUB 2V93A 1SW2A 1Y1MA 3DLNA 1UTBA 2OCUA 3MZ1A 4F18A 5I56B 4F1YA 4JWYA 2HAVA 2ZYOA 3CHGA 4RNSA 4WXJA 1SI1A 4H67A 4RK2A 2PYYA 2QMXA 5A5XA 1US5A 3GXAA 1MM7A 1MXZA 4Q8RA 4ELQA 5H8FA 1S50A 1H76A 2OWSA 1VFEA 1FTJA 1IXIA 3IK6B 4K3FA 4KPTA 5FTIA 3UGWA 3VLVA 3S9MC 1FTMA 1QVSA 3TZAA 2A5TB 2DWHA 3TTLA 2PVUA 3H6TA 2YJPA 4EDPA 3T93B 1P1OA 2VD3A 3IORA 3RPWA 2F35A 2XXTA 3G3GA 1Y3NA 3OO7A 4Q30B 4U1OA 5ITOA 3SEVA 5H8QA 4EXLA 4F29A 1B5JA 5AA3A 2HAUA 1MH3A 4OFOA 1DPEA 3FVOA 1JW1A 1JQFA 2F7BA 4OEVA 4JWXA 4FECA 1IXHA 1MY0A 2DWAA 2H5YA 3G3KA 4KHZE 3QK6A 1ZU0A 1P1QA 4HS7A 2DVZA 3THIA 4ELRA 3PUWE 3QUFA 1KWHA 2PBWA 5B7DA 3KGCA 4RA1A 1OQHA 3KBRA 5JEIA 3TYHA 3M8UA 3MWBA 3K4UA 1MH4A 4XIGQ 2PT2A 2DYXA 5DEXA 4ZEBA 3KZGA 4JBZA 1JEUA 3TCFA 2XXUA 3KJ7A 2HQ0A 4JB7A 4P11A 3ZKLA 4DXUA 4F22A 1RYXA 2ZYMA 4F3GA 3DM0A 1UIVA 2ONKE 4WEPA 3ZKKA 1XVYA 4KYEA 5K2YA 4NF4A 1R9LA 1I6AA 2UVHA 4F1VA 4EXKA 5L9SA 2X7PA 3R26A 5DT6A 4OENA 3OEMA 4H1XA 1FQCA 3MVWA 5FHNA 5H8QB 1GV8A 1Z7NE 1QW0A 1MS7A 2VOZA 3CVGA 4PP0A 5K2XA 3T9VA 3I3VA 3ODBA 4QFNA 4G8NA 4GWOA 4ZEKA 1NL5A 3G7WA 4X48A 1MXXA 3N5LA 1MRPA 3SEUA 5L8DA 1WDNA 5H8FB 1HSEA 5FHMA 5H8HA 3RGYA 2CZLA 4BDOA 3B6WA 3TUSA 3FXUA 2GHBA 4OHNA 2O68A 4OMBA 4BDRA 4DXCA 5I57A 1XS5A 2DSFA 5TPAA 1TFAA 1B3EA 2I4BA 3QXMA 2FYIA 3U72A 2OK2A 3DRFA 5I56A 3V83A 2F5XA 3TTNA 3RY3A 2F6PA 3QAXA 2D5WA 3S4UA 1NNKA 4QF9A 1N3WA 4NF8A 4IO5A 3OO6A 3P7IA 1UTHB 3TPAA 3LVUA 5CMKA 3C9HA 2F36A 5CMMA 1QJMA 1JNFA 1VSOA 2RCBA 3E9XA 4Q0CA 3PAMA 5I57B 1BIYA 4NWCA 5H8SA 2XXIA 3N94A 3PV0E 2I58A 4ELOA 1URDA 3MUQA 4YB5A 4FATA 3FV1A 1OIBA 4U1ZA 3Q26A 2O7UA 1VE4A 3IOTA 1DSNA 1B58A 3QSLA 2XXYA 1A8FA 1FW0A 3TFLA 4F3BA 1A40A 1L5TA 1QULA 3FVGA 3PD8A 3HSTA 4LZ7A 1DPPA 2GRVA 4QFLA 2B3FA 3ECRA 1FCKA 3K1MA 1ZKBA 3G3IA
chains in the Genus database with same CATH superfamily
4PTKA 4KYDA 2B3BA 1JETA 4PFYA 1HSLA 3HHGA 4YB7A 4H0WA 2XXRA 3C35A 1FBCA 3MC2A 3R7XA 3C31A 3U1OA 3RQTA 4KCDA 3KJTA 2NWJA 3BBRA 3I6VA 1N84A 3PUYE 4GWZA 4EUOA 5AA4A 4PE3A 5ET6A 1N04A 1A8EA 4O8MA 1SW4A 2DE3A 4GQOA 2V84A 1I6BA 3T96B 1RDYA 1NUYA 4IO4A 1CB6A 1B05A 3O6PA 2CMOA 3FJGA 3RN8A 2XXQA 3TTRA 1FTOA 1YCJA 2RC7A 3H4ZA 2G29A 4OETA 1LFHA 1HSJA 1QUKA 2WOKA 3E13X 5EHSA 1FRPA 4NG7A 3MZ9A 3H3GA 1NV7A 4GRKA 5BWJA 4ZEDA 4GXAA 3IJOB 4MNIA 3O66A 2XXHA 3B7DA 1B4ZA 4RJZA 1QUIA 2QS3A 2I4CA 1IMDA 1IMFA 4PFTA 1USYH 1OVTA 4F3SA 1MM6A 5TU0A 4U21A 3MQ9A 2QS4A 1FBPA 4NMYA 4YMBA 1EH3A 1MY4A 2XA5A 3IB0A 1MY3A 4LN5A 3VVEA 5LTCA 2HEUA 1CE2A 4NEDA 5DYHA 2QS1A 3O97A 2FHYA 1B9JA 1NUXA 4PDDA 2REJA 2F3BA 4G4PA 5H8HB 1FJ6A 4QSEA 3VLWA 2ABHA 1FBFA 2XX8A 3TODA 4QFKA 3IL1B 4YAHX 1LBBA 1BLFA 4IY5A 1AOVA 2DWIA 1NUZA 1PBPA 1B51A 5H8NB 4BDLA 1EU8A 1K9YA 3D4CA 5ITPA 4YU0A 1YZ0A 1Q9DA 1FPIA 3OELA 1B2HA 3PMXA 4H8IA 1LAGE 4F2QA 4IGRA 5ICTA 4NHBA 1FPFA 5LDZA 4GWSA 1FPBA 1Y3QA 1A7LA 3C4MA 1UQWA 5KDTA 2XXWA 3CSBA 5I5PA 2DXYA 3OO8A 1XHYA 3R6UA 1I6QA 2PMSA 3S9LC 4YKJA 4O7MA 3TAJA 3PPNA 4RPNA 4R74A 4OVJA 2REGA 4LUBA 3MJNA 2NVUB 3G3HA 4N13A 3O9PA 2THIA 1B7ZA 1LCTA 4YKPA 1NNPA 1US4A 5I59A 3A3CA 1MQJA 1D9QA 1NH8A 4QSCA 3QYTA 1PB9A 1SW5A 3CG1A 3IOUA 3W9VA 1AIVA 5HM4B 2UXAA 4MNCA 3ILTB 3IB2A 3KOSA 4LVQA 3MVYA 3IR1A 4MFIA 1DCUA 2RCAA 4OFJA 2R71A 1SD3A 3A29A 4RY1A 4YKKA 2VPNA 3KSJA 4PBHA 4LP2B 3M3FA 3FBPA 4DDDA 4R75A 1EYIA 4ZECA 2PCRA 5HPQA 3CG3A 2CZHA 1LCFA 3FXRA 3H6UA 2X7QA 2D21A 1UTHA 3CI8A 2AIXA 4IO7A 3TMGA 1LFGA 5CMCA 4IB2A 2OBGA 3D4GA 1EYJA 2WEFA 2H99A 2V3TA 1GGGA 4PQJA 2I49A 2VGQA 1FTAA 4F3PA 2GHAA 2YLNA 1LB9A 5KCJA 2QVUA 2Y5LA 1YTVA 3EKIA 4DCYA 2F34A 5EQAA 1NV1A 1B0LA 4OERA 3U8QA 1FBHA 1KZ8A 2V4CA 4OEUA 2CZIA 4O3AA 4POWA 4PF8A 4HCYA 3PU5A 2FIXA 3IAZA 1AWBA 4HCWA 2ESNA 4G68A 4LZ5A 3V8XB 5DTBA 3S2VA 1O63A 5DVFA 4NF5A 4N17A 4R9FA 1IQ7A 5FBPA 1MQDA 2XXXA 3JYRA 3K6UA 3O29A 4GF8A 2PFYA 5KZTA 3A3UA 4NAPA 1B46A 1Y1MA 3DLNA 2OCUA 5IZ3A 2ZYOA 4MCOA 4RNSA 2PYYA 3GXAA 3KC1A 4Q8RA 4ELQA 4K3FA 1QVSA 4F31B 5IZZA 3T93B 1P1OA 2F35A 5AA3A 4EXLA 1B5JA 1MH3A 1JW1A 4LONB 4OEVA 3G3KA 1LBZA 2DVZA 5B7DA 3KGCA 4NX1A 4XIGQ 5DEXA 4OVSA 3TCFA 2HQ0A 1RYXA 3DM0A 1UIVA 1XVYA 1I6AA 2UVHA 2X7PA 1GV8A 5H8QB 5DT6A 4H1XA 4DI3D 4G61A 1QW0A 4N91A 1NL5A 3SEUA 5L8DA 2CZLA 4OHNA 1XS5A 1B3EA 2FYIA 3U72A 2OK2A 3DRFA 3V83A 2F5XA 3TTNA 2F6PA 2D5WA 5CMKA 3C9HA 2F36A 1FBEA 5CMMA 1VSOA 4Q0CA 5I57B 1BIYA 4YB5A 3Q26A 3IOTA 2XXYA 1QULA 3HSTA 3ECRA 3K1MA 1ZKBA 4PAKA 3G3IA 3EPEA 3O6GA 1VDWA 3DRHA 3OMBA 4NF6A 1B3LA 4XFEA 3T22A 1LAFE 1QKAA 4PGPA 3KBZA 4Q5TA 1MQIA 4I8CA 3FVKA 3V5AA 3U65A 2IEEA 3VLUA 4KD5A 2QS2A 1SW1A 2P3VA 3U93A 3BFTA 2CEYA 2I0CA 4H45A 4MIJA 4P0GA 2ONRA 1WVJA 3DP6A 2WBBA 3MPLA 3PTYA 4NF0A 1MPCA 2ZNSA 4KCCA 5I59B 4U23A 5IZ3B 1M5CA 3FZVA 4RPOA 4Z7EA 2A5TA 3OO9A 5IKBA 2F7CA 4GX6A 4WEDA 4GWYA 3TQLA 1LAXA 4IO2A 4R73A 1NNFA 1H43A 5JTYB 1A54A 4N15A 4NF8B 2QVRA 2XD2A 4OXVA 1H45A 1R6ZA 1LBYA 5AA4B 3B6QA 3RNNA 3PUXE 2F7AA 1OLAA 2DE2A 2W7YA 3PD9A 1LAHE 4QXDA 3N6UA 2UVIA 1PC3A 4X9TA 4N07A 4ZEFA 4M1VA 5LOMA 1RKMA 4OANA 1K9ZA 4MLQA 1A99A 1ELJA 2OWZA 2RKMA 1MPBA 4YICA 4G77A 4FE8A 3OOAA 2WOLA 3QIMA 4R6HA 1NV3A 5AA2A 4C1UA 4GX3A 3EHTA 4NTLA 4YZZA 1P99A 3ISPA 5EQ7A 3K1NA 3QMFA 5ELVA 4JSDA 2XXVA 1LB8A 1GTKA 3RPLA 1MDQA 3RTFB 4JVCA 5TP9B 2AYSA 4IGTA 4FORA 1MXYA 3LSXA 3EQ1A 4I9DA 5B70A 4F2OA 4ONYA 2ZZXA 2ZNTA 1B3HA 4AQ4A 3SERA 1NV6A 4U22A 2P3NA 2HZKA 3FXQA 3ZSFA 3I5OA 3U92A 5IGAA 3Q25A 3TQWA 2RINA 1G0HA 2ZYKA 5EHMA 3PUVE 2R9JA 1Y3PA 4RK9A 5I84A 3DP8A 2FVZA 3KC0A 4ZDMA 1LBVA 4EQBA 2Y7PA 3IOVA 4PFRA 4BDQA 3CRBA 3ROJA 2Y7RA 4DXBA 4ZS9A 4MMPA 2DVCA 3PPOA 3N6TA 4H8JA 1B5HA 1B52A 4XEQA 5J1DA 1DMBA 3K0VA 3QUJA 1NNTA 1Y9UA 1OMPA 2QL3A 1JP4A 2PT1A 3WAEA 2QJEA 1B7UA 1M5DA 1FBGA 1XOCA 1MQHA 2WOPA 2NXOA 4JDFA 3GZGA 3E4RA 3E79A 3RT8A 3KN8A 3S9EA 2IA4A 4MLVA 2H4IA 4I62A 4TOZA 2Z22A 2DWJA 4QHQA 2CZKA 5I58B 4UA8A 3VE1B 5TP9A 1ANFA 2I48A 3RYDA 3E3KA 1RYOA 1UTBB 2PX1A 2V25A 1NI9A 4GIZA 2Y7KA 1N7XA 1Y4TA 2DP8A 3K01A 1WODA 3NOHA 4PF6A 1IEJA 4I3EA 3W9WA 2GFEA 3B8BA 1B3FA 1SPIA 1VR5A 4ZZEA 3VVFA 1FTKA 1B0HA 2D3IA 2BJJX 2Z23A 2KLFA 3DP4A 4H5GA 2F78A 1YXIA 2NUVA 1N76A 2O69A 3MZBA 1MPDA 2Q2AA 1D4NA 2XX9A 2DXRA 2Y7IA 3OXNA 3C34A 3GLBA 1TT1A 2X26A 1VFDA 4N8GA 4HE1A 1NUWA 1T0KA 3IO4A 4GXSB 3ONMA 3KEIA 1FBDA 4GBWA 1NKXA 4PAIA 4PAFA 3MZ1A 4F18A 5I56B 4WXJA 4JWYA 3CHGA 2WYPA 1H76A 4PC9A 1VFEA 1FTJA 3UGWA 3VLVA 3S9MC 1FTMA 2A5TB 4EDPA 2PVUA 3H6TA 2YJPA 2XXTA 5ITOA 3OO7A 4U1OA 2HAUA 2F7BA 4FECA 1ZU0A 1P1QA 1DBZA 1OQHA 5JEIA 3M8UA 2PT2A 2DYXA 1QGXA 3KZGA 3KJ7A 4F22A 4JB7A 4P3LA 4NF4A 1R9LA 5FHNA 4P9KA 1MS7A 4PP0A 1BK4A 4GWOA 4ZEKA 5H8FB 3RGYA 3TUSA 5H8HA 3B6WA 2O68A 2DSFA 1CNQA 5TPAA 1G0IA 2I4BA 4PCDA 2Y5KA 2KQZA 1N3WA 4NF8A 3PAMA 2XXIA 3N94A 4ELOA 2F3DA 1URDA 4P1EA 3FV1A 1OIBA 1NV5A 3QSLA 3TFLA 1FW0A 4F3BA 3PD8A 3FVGA 4LZ7A 2B3FA 3O28A 3ILUB 4KI0E 4PFWA 1LEVA 3M3KA 3LR1A 3IOWA 1TFDA 5EYFA 4HE2A 3BIHA 4MH5A 4KQPA 3PMWA 4GOTA 4DCXA 1ZLQA 4ZZAA 1Q1KA 3F11A 3MVZA 2H9BA 2XXKA 1B32A 3V89B 1SI0A 3FXBA 4U4SA 2OZZA 5ET7A 2A5SA 4POXA 5I7IA 4C0RA 1FQBA 2O1LA 2O6AA 5I2NA 2DQVA 2RC9A 1ATGA 3MW0A 1IMAA 4H46A 1MY2A 5L9OA 3B6TA 3LUYA 3OEKA 1NV2A 2L5VA 2QMWA 4MHFA 5AE4A 1MQGA 1FPEA 4PDHA 5CM6A 3MP1A 4R9GA 4IO6A 5F1QA 3MYUA 2VHAA 3D1RA 4BDMA 3K6XA 4G68B 3HCQA 3ZS6A 5F24A 3K6VA 4AS5A 4NE4A 2I3WA 2HCAA 5DVIA 4RXLA 4ECFA 5AA1A 1INPA 2Q74A 5L9MA 1TXFA 2HHMA 4O3CA 1OQGA 2Q8JA 4P0IA 3M3LA 4OVTA 4FBPA 1SQYA 4JVDA 4DIGA 3SEWA 2UYFA 4QBAA 3S9NC 3SZPA 3MP8A 5KCJB 4XKPA 4MNPA 1PBQA 1IIWA 4U4XA 4XKRA 1JVXA 3FVNA 1AL3A 4O7IA 1XC1A 5JTYA 4GFRA 4R6YA 1YAEA 4DI4B 4XTCQ 3RLFE 1PEBA 1R9QA 4KXPA 3H6VA 3DRJA 4EQ9A 4IO3A 4OZ9A 3VXBA 3UIFA 4HW8A 1FSAA 3FTOA 1IMCA 2GQ1A 3VV5A 1MG1A 3IB1A 1NV0A 4TQUQ 3EF7A 2I0BA 1NV4A 3O6HA 1IUDA 3G3JA 5HBCA 4C1TA 2XWKA 3PPPA 4GD5A 5CMBA 1IXGA 4PFUA 2QFLA 2H25A 2Z8FA 3O6IA 3LBSA 1BKAA 2Y84A 1H44A 3H06B 4OTEA 2RF1A 3CFZA 1Y20A 3H7MA 4XKQA 1XT8A 1YPNA 3KN7A 4X1DA 1R1NA 2KR0A 1UIUA 3TDJA 1LBCA 3OD7A 3BKIB 2PFZA 3GYYA 4GL8A 2XHDA 4EQ7A 2V3QA 3CIJA 2VPOA 4BLAA 3T9XB 1IITA 5CI5A 4FEBA 2ZYNA 5ISUA 2VD2A 1S7YA 3MAMA 2YPNA 1OVBA 2LAOA 1URGA 2Z8EA 2ZZVA 2R8TA 1N7WA 5EYHA 1MXUA 4ISUA 3KOTA 3HHFA 3PPQA 1SYHA 2HXWA 2E1SA 5CRYA 4OESA 4PGNA 1XI6A 3USDA 1JEVA 4GWUA 3HN0A 4KFQA 4P56A 1EZOA 3UK4A 1MXVA 4XF5A 4ESWA 5I2KA 2O1MA 4HTGA 1O64A 3RUMA 4ZE8A 4I40A 4Z0IA 5M2VA 4X1BA 3K1PA 4JXIA 3VVDA 3KFMA 3FV2A 1RDXA 1EYKA 4G8HA 4OQOA 3FATA 3UN6A 3PMVA 2ZNUA 5DW8A 3TELA 3MP6A 5KDTB 4ZEIA 4UACA 4WKMA 2BJIA 4YMAA 4PBQA 4GWWA 5DVJA 3HPIA 1BP5A 1Q35A 4MEVA 3U94A 1DOTA 4JWOA 1SVXB 2I3VA 3T66A 1Y1ZA 1SYIA 4NF4B 5T3JA 2HZLA 5EQ8A 4QRZA 5ET5A 3TCHA 1JW5A 3RT6B 2ZMBA 4OVPA 3RYAA 5CBRA 3BIGA 5CC2A 1NH7A 2P2AA 3C32A 1SBPA 3LC8A 4P47A 3L6HA 5IZ1A 4E0XA 1B40A 3C33A 5BUUA 1S9TA 2ALUA 2DS9A 3CFLA 3WAFA 4TLLB 1B1HA 3RTWB 1FQFA 2FA7A 5F7VA 4LATA 4G8MA 4DLDA 4O94A 3E78A 1UTBA 1FPLA 2HAVA 1SI1A 4RK2A 5A5XA 1MXZA 5H8FA 1S50A 2OWSA 1IXIA 3TZAA 2DWHA 4OVQA 3TTLA 3IORA 3RPWA 3SEVA 4OFOA 4MX6A 4R2BA 1JQFA 4JWXA 2H5YA 3THIA 4HS7A 4ELRA 4PFBA 3QUFA 1KWHA 2PBWA 2FIEA 3KBRA 3LUZA 3TYHA 3K4UA 1MH4A 4P11A 4JBZA 3ZKLA 4MAGA 3ZKKA 5K2YA 4F1VA 4EXKA 5L9SA 3R26A 4OENA 3OEMA 1FQCA 3MVWA 1Z7NE 1FPKA 2VOZA 3ODBA 4G8NA 4X48A 3G7WA 3N5LA 1WDNA 1HSEA 4BDOA 3FXUA 4DXCA 2XWVA 1TFAA 2ZZWA 5I56A 3S4UA 1FPGA 4QF9A 4IO5A 3LVUA 1JNFA 3E9XA 4NWCA 5H8SA 3PV0E 2I58A 4JVIA 3MUQA 4FATA 1VE4A 1A8FA 1A40A 1L5TA 4QFLA 1FCKA 3KSXA 4X04A 2RC8A 2UVGA 4HE0A 5FHOA 4AB5A 2V3UA 2F8DA 4LA9A 2R6GE 1B4HA 3L6GA 1FJ9A 1MY1A 5EQ9A 1KA1A 1B3GA 3FIRA 4XKNA 1LBXA 1LSTA 4NN3A 1BTJA 1XVXA 3PPRA 2UVJA 5CBSA 2B65A 4ZE9A 5H8NA 4FEDA 5JK4A 3EN3A 1DTGA 1Y4CA 2H98A 3CSGA 3UA8A 2HXRA 5A5XB 1FQEA 1IZ1A 1N3XA 4AB6A 1H3DA 4QFOA 2AL5A 1J1NA 2FBPA 2O7IA 1ZIUA 1JVYA 2E0SA 3DELB 1N0TA 4GL0A 2HPGA 2OWTA 3LSFB 2CEXA 4GX4A 5ICQA 5I3SA 1ZBMA 4R72A 3EHSA 1PDAA 3K2DA 3TKDA 3GBAA 2F97A 1FQDA 2ONSA 2QPQA 2B4LA 3CR9A 4GBVA 3MBPA 1F9BA 3O2AA 4MF3A 1LFIA 1GVCA 1POTA 1AH5A 2DE4A 3OENA 1LLSA 4NWDA 4ND9A 4JSOA 4FJPA 2Q89A 3RYBA 2MKZA 3VXCA 2VP1A 4H6DA 4R2FA 1TWYA 3TEPA 3LSLA 1NMUA 1O7TA 4IY6A 3Q29A 4GVOA 3FASA 2DDKA 4RYAA 3G3FA 3H6WA 4KR5A 1IMEA 1YYZA 1Z7ME 1I69A 4GWXA 1PB8A 4M4GA 3KG2A 4I1DA 2UYEA 4PE5B 4LQ2A 3OSRA 4OFLA 2OJTA 4F19A 4NF5B 4LZ8A 3BFUA 3FUZA 3W15C 4IR8A 4XXUA 2XX7A 1USYE 4N6DA 3MVXA 2P0SA 3LV0A 1DTZA 1P1UA 3K02A 4G68C 3HFUA 1DK4A 2DOJA 4MJOA 3PUZE 5I2KB 4R6KA 1B5IA 4E0WA 1QUJA 3HV1A 1QKBA 4YB6A 3Q28A 1IXCA 2O51A 4OA4A 2Q9TA 3T9HB 1B6HA 3VFJA 3Q27A 3TCGA 4HXVA 3RPLB 2M8CA 2ANJA 4EF2A 4MBPA 1D3KA 1FQAA 5AA2D 2XXPA 4F39A 3K00A 3MSTA 5IM2A 2O84X 4F1UA 3H03A 3VDFA 2QSXA 2Q8MA 1A55A 1B7HA 4ESXA 4U2RA 2FNCA 1LBWA 2HFBA 3FJ7A 1SDXA 3PGFA 4OWDA 5EYGA 4G2ZA 4FIMA 3TTKA 3JZJA 1URSA 3C36A 1II5A 4PETA 4GLIA 5A5LA 5FTHA 3SEXA 3K6WA 3B50A 1PB7A 4THIA 2Q2CA 1KA0A 1MXWA 4DZ1A 4QFPA 5DEXB 4BDNA 1B1XA 1OLCA 2Q88A 3KN3A 1M5FA 4NF6B 2NOOA 4DE8A 2XD3A 4NGUA 1P1WA 2VT5A 1MDP1 3EHUA 4N8YA 3DRGA 4UABA 1FPJA 2JJKA 2B4MA 1FTLA 2Y7WA 3A09A 2WX9A 1AMFA 2F6GA 2ZXTA 3CFXA 4O3BA 2XWOA 3FGSA 5AA2B 3JV9A 4FAJA 3MPKA 1GR2A 4H65A 4EF1A 4QSDA 4LQ5A 4ELPA 5I58A 2WYKA 1JW4A 5TPAB 2OLBA 2Z8DA 1EZ9A 2P1SA 3IX1A 4L17A 3GBBA 3HO7A 1P1NA 3TTMA 3T9UA 4P8BA 2G93A 2I6EA 3DRIA 3IFCA 1ZMGA 4I3YA 3OSQA 2AL4A 2GH9A 3SETA 3DRKA 4KYSA 3T0JA 4H5FA 3SDFA 3UP9A 3N26A 1ZJLA 3FD3A 5J16A 1M5BA 1M5EA 4YKIA 2WKYA 4OYVA 3UORA 3FJMA 1ZTYA 4N6KA 4TLMB 1IMBA 3AXFA 1LGBC 3SEYA 2OX3A 2QRYA 5IAIA 3SKPA 3T1BA 3IO6A 4PFIA 1D9VA 3IJXB 3SESA 1NFTA 3LSWA 5ET8A 1EZPA 1POY1 1D9YA 2V93A 1SW2A 4OVRA 4F1YA 4AS4A 4H67A 2QMXA 1US5A 1MM7A 5I2NB 4KPTA 3IK6B 5FTIA 2VD3A 3G3GA 4Q30B 1Y3NA 4F29A 5H8QA 4N6PA 1DPEA 3FVOA 1FPDA 4KHZE 1MY0A 1IXHA 2DWAA 3QK6A 3PUWE 4RA1A 3MWBA 1RDZA 4ZEBA 1JEUA 2XXUA 4DXUA 4F3GA 2ZYMA 2ONKE 4WEPA 4KYEA 2WBDA 5K2XA 3CVGA 3T9VA 3I3VA 4QFNA 1MXXA 1MRPA 5FHMA 2GHBA 4BDRA 4OMBA 5I57A 4X8RA 2XWIA 3QXMA 4N4UA 3IFAA 3RY3A 3QAXA 2QVVA 1NNKA 3OO6A 3P7IA 4NQ8A 1UTHB 3TPAA 1QJMA 2RCBA 5ESYA 4P1LA 4N81A 4U1ZA 2O7UA 1DSNA 1B58A 1DPPA 2GRVA
chains in the Genus database with same CATH topology
3EPEA 2UVGA 4KI0E 3O6GA 3DRHA 3OMBA 5FHOA 4PFWA 3M3KA 3LR1A 4AB5A 3IOWA 1TFDA 5EYFA 2V3UA 4NF6A 1B3LA 2F8DA 4MH5A 4LA9A 2R6GE 4KQPA 4KYDA 3T22A 1B4HA 3L6GA 1LAFE 1QKAA 4Q5TA 2B3BA 1MQIA 1JETA 4I8CA 4PFYA 3FVKA 1HSLA 3V5AA 3HHGA 1MY1A 4YB7A 4H0WA 3PMWA 2XXRA 1B3GA 3O28A 4DCXA 4GOTA 3C35A 1ZLQA 2IEEA 3FIRA 3VLUA 4ZZAA 4ECFA 4KD5A 2QS2A 1Q1KA 4XKNA 1SW1A 3MC2A 3R7XA 3BFTA 2I0CA 1LSTA 3C31A 3F11A 3MVZA 3RQTA 1BTJA 1XVXA 2H9BA 3PPRA 1B32A 2UVJA 4KCDA 5CBSA 2B65A 3KJTA 3V89B 1SI0A 4ZE9A 2NWJA 3BBRA 3I6VA 4P0GA 2ONRA 5H8NA 1N84A 1WVJA 3DP6A 4FEDA 3MPLA 5JK4A 3EN3A 1DTGA 3PUYE 1Y4CA 4U4SA 2H98A 3CSGA 3UA8A 5A5XB 2OZZA 1FQEA 1MPCA 2ZNSA 1IZ1A 4KCCA 5I59B 4U23A 2A5SA 4EUOA 5AA4A 1N3XA 4AB6A 1M5CA 5DVIA 3FZVA 1N04A 4RPOA 1A8EA 4Z7EA 1H3DA 2A5TA 3OO9A 1SW4A 1FQBA 4QFOA 2O1LA 4POXA 2DE3A 4C0RA 2AL5A 2O6AA 1J1NA 5IKBA 2F7CA 5I2NA 2DQVA 2RC9A 4GQOA 1ATGA 2O7IA 3MW0A 4WEDA 1JVYA 1ZIUA 2V84A 3TQLA 5I2NB 2E0SA 3DELB 1LAXA 4IO2A 1N0TA 4R73A 1NNFA 1H43A 1MY2A 5JTYB 1I6BA 5L9OA 4GL0A 3T96B 5I59A 1A54A 3B6TA 2OWTA 3LUYA 4IO4A 3LSFB 4NF8B 1CB6A 2XD2A 4OXVA 3OEKA 1H45A 1B05A 3O6PA 2CMOA 5ICQA 2QMWA 3FJGA 3RN8A 1ZBMA 2XXQA 1R6ZA 3TTRA 5AE4A 4R72A 1FTOA 1PDAA 3EHSA 3K2DA 5AA4B 1YCJA 2RC7A 3H4ZA 3TKDA 3GBAA 2G29A 2F97A 4OETA 3B6QA 1HSJA 1MQGA 1QUKA 1LFHA 2WOKA 5CM6A 3E13X 1FQDA 2ONSA 3MP1A 2QPQA 4IO6A 2B4LA 3CR9A 5F1QA 4R9GA 2VHAA 5EHSA 3RNNA 3MZ9A 3PUXE 3MBPA 3H3GA 3U93A 1F9BA 4BDMA 3O2AA 2F7AA 3K6XA 1OLAA 1LFIA 4MF3A 4G68B 2DE2A 3HCQA 1GVCA 1POTA 1AH5A 2DE4A 3ZS6A 2W7YA 4F31B 3OENA 4GRKA 3PD9A 1LAHE 3K6VA 5BWJA 3N6UA 4ZEDA 2I3WA 4NE4A 4GXAA 2HCAA 2UVIA 3IJOB 1LLSA 1PC3A 3O66A 4ND9A 4NWDA 4N07A 4RXLA 4JSOA 3KSXA 2XXHA 4X9TA 4ZEFA 5AA1A 2RC8A 4M1VA 5L9MA 1TXFA 2Q89A 3RYBA 4FJPA 3B7DA 1B4ZA 4RJZA 1QUIA 4O3CA 3VXCA 5LOMA 1OQGA 2VP1A 1RKMA 4H6DA 2QS3A 4P0IA 2Q8JA 3M3LA 4MLQA 4R2FA 1TWYA 2I4CA 1SQYA 3TEPA 3LSLA 4DIGA 1A99A 1NMUA 1ELJA 3SEWA 4PFTA 2UYFA 3S9NC 1O7TA 4IY6A 1USYH 3Q29A 2RKMA 1OVTA 4F3SA 1MPBA 4GVOA 3FASA 4G77A 1MM6A 3MP8A 4YICA 4FE8A 4N6PA 3OOAA 5TU0A 4U21A 2WOLA 3MQ9A 4XKPA 2QS4A 5KCJB 4RYAA 3QIMA 4R6HA 3G3FA 4NMYA 4YMBA 1PBQA 1EH3A 1MY4A 3H6WA 5AA2A 3IB0A 1IIWA 4KR5A 4C1UA 3EHTA 1Z7ME 4U4XA 1MY3A 4XKRA 4NTLA 1JVXA 1I69A 4YZZA 3VVEA 1PB8A 3FVNA 4M4GA 5B70A 3KG2A 1P99A 2HEUA 1CE2A 4LONB 1AL3A 4NEDA 4I1DA 2UYEA 5DYHA 4PE5B 2QS1A 3O97A 4LQ2A 3K1NA 1B9JA 1XC1A 3OSRA 4JSDA 4OFLA 2XXVA 5ELVA 5JTYA 4GFRA 2OJTA 1LB8A 1GTKA 2REJA 1MDQA 1YAEA 4R6YA 4F19A 4G4PA 3RTFB 5H8HB 4NF5B 4LZ8A 5TP9B 3BFUA 3FUZA 4XTCQ 1PEBA 3RLFE 1R9QA 3W15C 3H6VA 2AYSA 4QSEA 3DRJA 4EQ9A 4IGTA 4FORA 1MXYA 2XX7A 4XXUA 3VLWA 4IO3A 4OZ9A 3VXBA 1USYE 3LSXA 3UIFA 2ABHA 2XX8A 3TODA 4QFKA 3IL1B 3EQ1A 4YAHX 4I9DA 1LBBA 3MVXA 1BLFA 2P0SA 4IY5A 4HW8A 1DTZA 4ONYA 1P1UA 3FTOA 3K02A 4F2OA 2DWIA 4G68C 2ZNTA 1B3HA 1MG1A 3VV5A 4AQ4A 3IB1A 1PBPA 2DOJA 4TQUQ 3PUZE 3EF7A 5I2KB 3SERA 2I0BA 1B51A 4R6KA 1B5IA 4U22A 4BDLA 1QUJA 4E0WA 1EU8A 5H8NB 2HZKA 3FXQA 3HV1A 3O6HA 3ZSFA 3I5OA 1IUDA 3U92A 3G3JA 1QKBA 4YB6A 3D4CA 5HBCA 4C1TA 5ITPA 4YU0A 3Q25A 3TQWA 3Q28A 3PPPA 2RINA 1IXCA 1AOVA 4GD5A 5CMBA 2O51A 1IXGA 3OELA 2Q9TA 3T9HB 4PFUA 2ZYKA 1B2HA 5EHMA 2H25A 2Z8FA 3O6IA 3LBSA 3PMXA 4H8IA 1LAGE 3PUVE 1B6HA 4F2QA 2R9JA 1BKAA 1Y3PA 2Y84A 4IGRA 4RK9A 3VFJA 1H44A 3H06B 3Q27A 4OTEA 2RF1A 3TCGA 5I84A 3DP8A 5ICTA 3CFZA 1Y20A 3H7MA 4XKQA 4ZDMA 2M8CA 1XT8A 1YPNA 1Y3QA 1A7LA 2ANJA 3C4MA 4EF2A 1UQWA 4MBPA 4EQBA 2Y7PA 3IOVA 1D3KA 5KDTA 1FQAA 2XXWA 3KN7A 4X1DA 4BDQA 5AA2D 2XXPA 3CSBA 3CRBA 4F39A 2Y7RA 1R1NA 2DXYA 3K00A 1XHYA 1UIUA 3OO8A 3TDJA 1LBCA 4DXBA 3OD7A 3BKIB 3R6UA 1I6QA 2O84X 2PMSA 4ZS9A 4F1UA 3S9LC 4GL8A 4R2BA 3H03A 2DVCA 3PPOA 3N6TA 4H8JA 4YKJA 3TAJA 1B5HA 3PPNA 4RPNA 4R74A 4OVJA 2XHDA 2QSXA 2REGA 3VDFA 4EQ7A 2V3QA 1A55A 4LUBA 3MJNA 3CIJA 1B7HA 4ESXA 4U2RA 1B52A 2FNCA 2NVUB 3G3HA 5J1DA 4N13A 3O9PA 4BLAA 1DMBA 3K0VA 2THIA 1B7ZA 1LCTA 1IITA 4YKPA 3T9XB 1NNPA 2HFBA 3QUJA 1NNTA 1US4A 1SDXA 3A3CA 3FJ7A 4FEBA 5CI5A 1MQJA 1NH8A 1Y9UA 2ZYNA 5ISUA 2VD2A 3PGFA 3QYTA 1S7YA 4OWDA 3MAMA 4G2ZA 4QSCA 1OMPA 1PB9A 1SW5A 2QL3A 4FIMA 3TTKA 3CG1A 3IOUA 2YPNA 3JZJA 1URSA 1OVBA 2LAOA 1URGA 2Z8EA 2PT1A 3W9VA 3C36A 1II5A 3WAEA 1N7WA 4PETA 1AIVA 1MXUA 4GLIA 5HM4B 4ISUA 3KOTA 2QJEA 3HHFA 3PPQA 1B7UA 1M5DA 5FTHA 1SYHA 3SEXA 2UXAA 2HXWA 3K6WA 2E1SA 5CRYA 4OESA 3ILTB 3IB2A 1XOCA 1PB7A 1MQHA 2Q2CA 4THIA 2WOPA 3USDA 1JEVA 2NXOA 1MXWA 3HN0A 4JDFA 4QFPA 3KOSA 5DEXB 4BDNA 4LVQA 4DZ1A 4KFQA 1EZOA 1B1XA 3MVYA 3GZGA 3E4RA 3UK4A 1MXVA 1OLCA 4ESWA 3IR1A 3RT8A 2Q88A 3KN3A 3KN8A 5I2KA 2O1MA 1M5FA 4HTGA 4MFIA 4NF6B 3S9EA 2NOOA 1O64A 2IA4A 2RCAA 4MLVA 3RUMA 4DE8A 4ZE8A 2XD3A 4OFJA 2R71A 4Z0IA 2H4IA 1SD3A 4I62A 5M2VA 4TOZA 1P1WA 4RY1A 4YKKA 2Z22A 3KSJA 1MDP1 2DWJA 3EHUA 4QHQA 4X1BA 3DRGA 3K1PA 5I58B 4LP2B 3M3FA 4JXIA 4UA8A 3VVDA 4DDDA 4R75A 2B4MA 3VE1B 4ZECA 3KFMA 5HPQA 1FTLA 2Y7WA 3A09A 3CG3A 3FV2A 5TP9A 1ANFA 1AMFA 2F6GA 1LCFA 2I48A 3FXRA 3H6UA 2X7QA 2ZXTA 3CFXA 4G8HA 4O3BA 2D21A 3E3KA 3FGSA 1UTHA 4OQOA 3FATA 1RYOA 5AA2B 1UTBB 2PX1A 3JV9A 3CI8A 2AIXA 2V25A 4IO7A 4FAJA 3MPKA 1GR2A 1LFGA 4H65A 3PMVA 3TMGA 3UN6A 2ZNUA 5CMCA 4EF1A 4GIZA 4LQ5A 4QSDA 2Y7KA 3MP6A 3TELA 4ELPA 4ZEIA 4IB2A 4UACA 2OBGA 1JW4A 3D4GA 4WKMA 5TPAB 1N7XA 5I58A 1Y4TA 2H99A 2DP8A 3K01A 2OLBA 1WODA 2Z8DA 4YMAA 1EZ9A 2P1SA 2V3TA 3IX1A 1GGGA 3GBBA 3HO7A 1P1NA 4L17A 2I49A 4PQJA 5DVJA 1IEJA 3T9UA 2VGQA 3TTMA 3HPIA 1BP5A 1Q35A 3W9WA 2GFEA 2G93A 3U94A 1DOTA 4F3PA 2GHAA 2YLNA 1LB9A 4JWOA 5KCJA 1B3FA 1SVXB 1VR5A 4ZZEA 2I3VA 2I6EA 3T66A 3VVFA 1Y1ZA 3DRIA 1B0HA 1FTKA 1SYIA 4DCYA 1YTVA 1ZMGA 2F34A 5KDTB 4NF4B 3OSQA 2D3IA 2AL4A 2Z23A 2BJJX 2HZLA 2KLFA 3DP4A 2GH9A 4H5GA 4QRZA 1B0LA 3SETA 3DRKA 2F78A 4KYSA 3TCHA 1JW5A 4OERA 3U8QA 3RT6B 2ZMBA 2NUVA 3RYAA 1N76A 2O69A 3MZBA 5CBRA 1MPDA 4H5FA 2Q2AA 1D4NA 5CC2A 1NH7A 3SDFA 3UP9A 4OEUA 3N26A 4O3AA 4POWA 1ZJLA 3FD3A 1M5BA 2XX9A 2P2AA 3C32A 1M5EA 2DXRA 2Y7IA 3PU5A 1SBPA 3LC8A 2WKYA 4HCYA 3OXNA 3IAZA 4OYVA 4YKIA 3UORA 3C34A 1ZTYA 2ESNA 3FJMA 3L6HA 4G68A 4HCWA 4LZ5A 3V8XB 3GLBA 5DTBA 4E0XA 3S2VA 1B40A 4TLMB 1TT1A 1O63A 2X26A 1VFDA 3AXFA 5DVFA 1LGBC 3C33A 3SEYA 4NF5A 5BUUA 1S9TA 2ALUA 2DS9A 2QRYA 3CFLA 5IAIA 3SKPA 4R9FA 1IQ7A 3WAFA 1MQDA 3IO6A 4TLLB 1T0KA 2XXXA 1B1HA 3IO4A 3RTWB 3JYRA 1D9VA 3K6UA 1FQFA 4GXSB 2FA7A 3O29A 3IJXB 3SESA 5F7VA 1NFTA 3LSWA 3KEIA 3ONMA 4LATA 3U1OA 4GF8A 4G8MA 1EZPA 1POY1 5KZTA 3A3UA 1D9YA 4DLDA 1NKXA 1B46A 3ILUB 2V93A 1SW2A 1Y1MA 3DLNA 1UTBA 2OCUA 3MZ1A 4F18A 5I56B 4F1YA 4JWYA 2HAVA 2ZYOA 3CHGA 4RNSA 4WXJA 1SI1A 4H67A 4RK2A 2PYYA 2QMXA 5A5XA 1US5A 3GXAA 1MM7A 1MXZA 4Q8RA 4ELQA 5H8FA 1S50A 1H76A 2OWSA 1VFEA 1FTJA 1IXIA 3IK6B 4K3FA 4KPTA 5FTIA 3UGWA 3VLVA 3S9MC 1FTMA 1QVSA 3TZAA 2A5TB 2DWHA 3TTLA 2PVUA 3H6TA 2YJPA 4EDPA 3T93B 1P1OA 2VD3A 3IORA 3RPWA 2F35A 2XXTA 3G3GA 1Y3NA 3OO7A 4Q30B 4U1OA 5ITOA 3SEVA 5H8QA 4EXLA 4F29A 1B5JA 5AA3A 2HAUA 1MH3A 4OFOA 1DPEA 3FVOA 1JW1A 1JQFA 2F7BA 4OEVA 4JWXA 4FECA 1IXHA 1MY0A 2DWAA 2H5YA 3G3KA 4KHZE 3QK6A 1ZU0A 1P1QA 4HS7A 2DVZA 3THIA 4ELRA 3PUWE 3QUFA 1KWHA 2PBWA 5B7DA 3KGCA 4RA1A 1OQHA 3KBRA 5JEIA 3TYHA 3M8UA 3MWBA 3K4UA 1MH4A 4XIGQ 2PT2A 2DYXA 5DEXA 4ZEBA 3KZGA 4JBZA 1JEUA 3TCFA 2XXUA 3KJ7A 2HQ0A 4JB7A 4P11A 3ZKLA 4DXUA 4F22A 1RYXA 2ZYMA 4F3GA 3DM0A 1UIVA 2ONKE 4WEPA 3ZKKA 1XVYA 4KYEA 5K2YA 4NF4A 1R9LA 1I6AA 2UVHA 4F1VA 4EXKA 5L9SA 2X7PA 3R26A 5DT6A 4OENA 3OEMA 4H1XA 1FQCA 3MVWA 5FHNA 5H8QB 1GV8A 1Z7NE 1QW0A 1MS7A 2VOZA 3CVGA 4PP0A 5K2XA 3T9VA 3I3VA 3ODBA 4QFNA 4G8NA 4GWOA 4ZEKA 1NL5A 3G7WA 4X48A 1MXXA 3N5LA 1MRPA 3SEUA 5L8DA 1WDNA 5H8FB 1HSEA 5FHMA 5H8HA 3RGYA 2CZLA 4BDOA 3B6WA 3TUSA 3FXUA 2GHBA 4OHNA 2O68A 4OMBA 4BDRA 4DXCA 5I57A 1XS5A 2DSFA 5TPAA 1TFAA 1B3EA 2I4BA 3QXMA 2FYIA 3U72A 2OK2A 3DRFA 5I56A 3V83A 2F5XA 3TTNA 3RY3A 2F6PA 3QAXA 2D5WA 3S4UA 1NNKA 4QF9A 1N3WA 4NF8A 4IO5A 3OO6A 3P7IA 1UTHB 3TPAA 3LVUA 5CMKA 3C9HA 2F36A 5CMMA 1QJMA 1JNFA 1VSOA 2RCBA 3E9XA 4Q0CA 3PAMA 5I57B 1BIYA 4NWCA 5H8SA 2XXIA 3N94A 3PV0E 2I58A 4ELOA 1URDA 3MUQA 4YB5A 4FATA 3FV1A 1OIBA 4U1ZA 3Q26A 2O7UA 1VE4A 3IOTA 1DSNA 1B58A 3QSLA 2XXYA 1A8FA 1FW0A 3TFLA 4F3BA 1A40A 1L5TA 1QULA 3FVGA 3PD8A 3HSTA 4LZ7A 1DPPA 2GRVA 4QFLA 2B3FA 3ECRA 1FCKA 3K1MA 1ZKBA 3G3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPE A;  2UVG A;  4KI0 E;  3O6G A;  3DRH A;  3OMB A;  5FHO A;  4PFW A;  3M3K A;  3LR1 A;  4AB5 A;  3IOW A;  1TFD A;  5EYF A;  2V3U A;  4NF6 A;  1B3L A;  2F8D A;  4MH5 A;  4LA9 A;  2R6G E;  4KQP A;  4KYD A;  3T22 A;  1B4H A;  3L6G A;  1LAF E;  1QKA A;  4Q5T A;  2B3B A;  1MQI A;  1JET A;  4I8C A;  4PFY A;  3FVK A;  1HSL A;  3V5A A;  3HHG A;  1MY1 A;  4YB7 A;  4H0W A;  3PMW A;  2XXR A;  1B3G A;  3O28 A;  4DCX A;  4GOT A;  3C35 A;  1ZLQ A;  2IEE A;  3FIR A;  3VLU A;  4ZZA A;  4ECF A;  4KD5 A;  2QS2 A;  1Q1K A;  4XKN A;  1SW1 A;  3MC2 A;  3R7X A;  3BFT A;  2I0C A;  1LST A;  3C31 A;  3F11 A;  3MVZ A;  3RQT A;  1BTJ A;  1XVX A;  2H9B A;  3PPR A;  1B32 A;  2UVJ A;  4KCD A;  5CBS A;  2B65 A;  3KJT A;  3V89 B;  1SI0 A;  4ZE9 A;  2NWJ A;  3BBR A;  3I6V A;  4P0G A;  2ONR A;  5H8N A;  1N84 A;  1WVJ A;  3DP6 A;  4FED A;  3MPL A;  5JK4 A;  3EN3 A;  1DTG A;  3PUY E;  1Y4C A;  4U4S A;  2H98 A;  3CSG A;  3UA8 A;  5A5X B;  2OZZ A;  1FQE A;  1MPC A;  2ZNS A;  1IZ1 A;  4KCC A;  5I59 B;  4U23 A;  2A5S A;  4EUO A;  5AA4 A;  1N3X A;  4AB6 A;  1M5C A;  5DVI A;  3FZV A;  1N04 A;  4RPO A;  1A8E A;  4Z7E A;  1H3D A;  2A5T A;  3OO9 A;  1SW4 A;  1FQB A;  4QFO A;  2O1L A;  4POX A;  2DE3 A;  4C0R A;  2AL5 A;  2O6A A;  1J1N A;  5IKB A;  2F7C A;  5I2N A;  2DQV A;  2RC9 A;  4GQO A;  1ATG A;  2O7I A;  3MW0 A;  4WED A;  1JVY A;  1ZIU A;  2V84 A;  3TQL A;  5I2N B;  2E0S A;  3DEL B;  1LAX A;  4IO2 A;  1N0T A;  4R73 A;  1NNF A;  1H43 A;  1MY2 A;  5JTY B;  1I6B A;  5L9O A;  4GL0 A;  3T96 B;  5I59 A;  1A54 A;  3B6T A;  2OWT A;  3LUY A;  4IO4 A;  3LSF B;  4NF8 B;  1CB6 A;  2XD2 A;  4OXV A;  3OEK A;  1H45 A;  1B05 A;  3O6P A;  2CMO A;  5ICQ A;  2QMW A;  3FJG A;  3RN8 A;  1ZBM A;  2XXQ A;  1R6Z A;  3TTR A;  5AE4 A;  4R72 A;  1FTO A;  1PDA A;  3EHS A;  3K2D A;  5AA4 B;  1YCJ A;  2RC7 A;  3H4Z A;  3TKD A;  3GBA A;  2G29 A;  2F97 A;  4OET A;  3B6Q A;  1HSJ A;  1MQG A;  1QUK A;  1LFH A;  2WOK A;  5CM6 A;  3E13 X;  1FQD A;  2ONS A;  3MP1 A;  2QPQ A;  4IO6 A;  2B4L A;  3CR9 A;  5F1Q A;  4R9G A;  2VHA A;  5EHS A;  3RNN A;  3MZ9 A;  3PUX E;  3MBP A;  3H3G A;  3U93 A;  1F9B A;  4BDM A;  3O2A A;  2F7A A;  3K6X A;  1OLA A;  1LFI A;  4MF3 A;  4G68 B;  2DE2 A;  3HCQ A;  1GVC A;  1POT A;  1AH5 A;  2DE4 A;  3ZS6 A;  2W7Y A;  4F31 B;  3OEN A;  4GRK A;  3PD9 A;  1LAH E;  3K6V A;  5BWJ A;  3N6U A;  4ZED A;  2I3W A;  4NE4 A;  4GXA A;  2HCA A;  2UVI A;  3IJO B;  1LLS A;  1PC3 A;  3O66 A;  4ND9 A;  4NWD A;  4N07 A;  4RXL A;  4JSO A;  3KSX A;  2XXH A;  4X9T A;  4ZEF A;  5AA1 A;  2RC8 A;  4M1V A;  5L9M A;  1TXF A;  2Q89 A;  3RYB A;  4FJP A;  3B7D A;  1B4Z A;  4RJZ A;  1QUI A;  4O3C A;  3VXC A;  5LOM A;  1OQG A;  2VP1 A;  1RKM A;  4H6D A;  2QS3 A;  4P0I A;  2Q8J A;  3M3L A;  4MLQ A;  4R2F A;  1TWY A;  2I4C A;  1SQY A;  3TEP A;  3LSL A;  4DIG A;  1A99 A;  1NMU A;  1ELJ A;  3SEW A;  4PFT A;  2UYF A;  3S9N C;  1O7T A;  4IY6 A;  1USY H;  3Q29 A;  2RKM A;  1OVT A;  4F3S A;  1MPB A;  4GVO A;  3FAS A;  4G77 A;  1MM6 A;  3MP8 A;  4YIC A;  4FE8 A;  4N6P A;  3OOA A;  5TU0 A;  4U21 A;  2WOL A;  3MQ9 A;  4XKP A;  2QS4 A;  5KCJ B;  4RYA A;  3QIM A;  4R6H A;  3G3F A;  4NMY A;  4YMB A;  1PBQ A;  1EH3 A;  1MY4 A;  3H6W A;  5AA2 A;  3IB0 A;  1IIW A;  4KR5 A;  4C1U A;  3EHT A;  1Z7M E;  4U4X A;  1MY3 A;  4XKR A;  4NTL A;  1JVX A;  1I69 A;  4YZZ A;  3VVE A;  1PB8 A;  3FVN A;  4M4G A;  5B70 A;  3KG2 A;  1P99 A;  2HEU A;  1CE2 A;  4LON B;  1AL3 A;  4NED A;  4I1D A;  2UYE A;  5DYH A;  4PE5 B;  2QS1 A;  3O97 A;  4LQ2 A;  3K1N A;  1B9J A;  1XC1 A;  3OSR A;  4JSD A;  4OFL A;  2XXV A;  5ELV A;  5JTY A;  4GFR A;  2OJT A;  1LB8 A;  1GTK A;  2REJ A;  1MDQ A;  1YAE A;  4R6Y A;  4F19 A;  4G4P A;  3RTF B;  5H8H B;  4NF5 B;  4LZ8 A;  5TP9 B;  3BFU A;  3FUZ A;  4XTC Q;  1PEB A;  3RLF E;  1R9Q A;  3W15 C;  3H6V A;  2AYS A;  4QSE A;  3DRJ A;  4EQ9 A;  4IGT A;  4FOR A;  1MXY A;  2XX7 A;  4XXU A;  3VLW A;  4IO3 A;  4OZ9 A;  3VXB A;  1USY E;  3LSX A;  3UIF A;  2ABH A;  2XX8 A;  3TOD A;  4QFK A;  3IL1 B;  3EQ1 A;  4YAH X;  4I9D A;  1LBB A;  3MVX A;  1BLF A;  2P0S A;  4IY5 A;  4HW8 A;  1DTZ A;  4ONY A;  1P1U A;  3FTO A;  3K02 A;  4F2O A;  2DWI A;  4G68 C;  2ZNT A;  1B3H A;  1MG1 A;  3VV5 A;  4AQ4 A;  3IB1 A;  1PBP A;  2DOJ A;  4TQU Q;  3PUZ E;  3EF7 A;  5I2K B;  3SER A;  2I0B A;  1B51 A;  4R6K A;  1B5I A;  4U22 A;  4BDL A;  1QUJ A;  4E0W A;  1EU8 A;  5H8N B;  2HZK A;  3FXQ A;  3HV1 A;  3O6H A;  3ZSF A;  3I5O A;  1IUD A;  3U92 A;  3G3J A;  1QKB A;  4YB6 A;  3D4C A;  5HBC A;  4C1T A;  5ITP A;  4YU0 A;  3Q25 A;  3TQW A;  3Q28 A;  3PPP A;  2RIN A;  1IXC A;  1AOV A;  4GD5 A;  5CMB A;  2O51 A;  1IXG A;  3OEL A;  2Q9T A;  3T9H B;  4PFU A;  2ZYK A;  1B2H A;  5EHM A;  2H25 A;  2Z8F A;  3O6I A;  3LBS A;  3PMX A;  4H8I A;  1LAG E;  3PUV E;  1B6H A;  4F2Q A;  2R9J A;  1BKA A;  1Y3P A;  2Y84 A;  4IGR A;  4RK9 A;  3VFJ A;  1H44 A;  3H06 B;  3Q27 A;  4OTE A;  2RF1 A;  3TCG A;  5I84 A;  3DP8 A;  5ICT A;  3CFZ A;  1Y20 A;  3H7M A;  4XKQ A;  4ZDM A;  2M8C A;  1XT8 A;  1YPN A;  1Y3Q A;  1A7L A;  2ANJ A;  3C4M A;  4EF2 A;  1UQW A;  4MBP A;  4EQB A;  2Y7P A;  3IOV A;  1D3K A;  5KDT A;  1FQA A;  2XXW A;  3KN7 A;  4X1D A;  4BDQ A;  5AA2 D;  2XXP A;  3CSB A;  3CRB A;  4F39 A;  2Y7R A;  1R1N A;  2DXY A;  3K00 A;  1XHY A;  1UIU A;  3OO8 A;  3TDJ A;  1LBC A;  4DXB A;  3OD7 A;  3BKI B;  3R6U A;  1I6Q A;  2O84 X;  2PMS A;  4ZS9 A;  4F1U A;  3S9L C;  4GL8 A;  4R2B A;  3H03 A;  2DVC A;  3PPO A;  3N6T A;  4H8J A;  4YKJ A;  3TAJ A;  1B5H A;  3PPN A;  4RPN A;  4R74 A;  4OVJ A;  2XHD A;  2QSX A;  2REG A;  3VDF A;  4EQ7 A;  2V3Q A;  1A55 A;  4LUB A;  3MJN A;  3CIJ A;  1B7H A;  4ESX A;  4U2R A;  1B52 A;  2FNC A;  2NVU B;  3G3H A;  5J1D A;  4N13 A;  3O9P A;  4BLA A;  1DMB A;  3K0V A;  2THI A;  1B7Z A;  1LCT A;  1IIT A;  4YKP A;  3T9X B;  1NNP A;  2HFB A;  3QUJ A;  1NNT A;  1US4 A;  1SDX A;  3A3C A;  3FJ7 A;  4FEB A;  5CI5 A;  1MQJ A;  1NH8 A;  1Y9U A;  2ZYN A;  5ISU A;  2VD2 A;  3PGF A;  3QYT A;  1S7Y A;  4OWD A;  3MAM A;  4G2Z A;  4QSC A;  1OMP A;  1PB9 A;  1SW5 A;  2QL3 A;  4FIM A;  3TTK A;  3CG1 A;  3IOU A;  2YPN A;  3JZJ A;  1URS A;  1OVB A;  2LAO A;  1URG A;  2Z8E A;  2PT1 A;  3W9V A;  3C36 A;  1II5 A;  3WAE A;  1N7W A;  4PET A;  1AIV A;  1MXU A;  4GLI A;  5HM4 B;  4ISU A;  3KOT A;  2QJE A;  3HHF A;  3PPQ A;  1B7U A;  1M5D A;  5FTH A;  1SYH A;  3SEX A;  2UXA A;  2HXW A;  3K6W A;  2E1S A;  5CRY A;  4OES A;  3ILT B;  3IB2 A;  1XOC A;  1PB7 A;  1MQH A;  2Q2C A;  4THI A;  2WOP A;  3USD A;  1JEV A;  2NXO A;  1MXW A;  3HN0 A;  4JDF A;  4QFP A;  3KOS A;  5DEX B;  4BDN A;  4LVQ A;  4DZ1 A;  4KFQ A;  1EZO A;  1B1X A;  3MVY A;  3GZG A;  3E4R A;  3UK4 A;  1MXV A;  1OLC A;  4ESW A;  3IR1 A;  3RT8 A;  2Q88 A;  3KN3 A;  3KN8 A;  5I2K A;  2O1M A;  1M5F A;  4HTG A;  4MFI A;  4NF6 B;  3S9E A;  2NOO A;  1O64 A;  2IA4 A;  2RCA A;  4MLV A;  3RUM A;  4DE8 A;  4ZE8 A;  2XD3 A;  4OFJ A;  2R71 A;  4Z0I A;  2H4I A;  1SD3 A;  4I62 A;  5M2V A;  4TOZ A;  1P1W A;  4RY1 A;  4YKK A;  2Z22 A;  3KSJ A;  1MDP 1;  2DWJ A;  3EHU A;  4QHQ A;  4X1B A;  3DRG A;  3K1P A;  5I58 B;  4LP2 B;  3M3F A;  4JXI A;  4UA8 A;  3VVD A;  4DDD A;  4R75 A;  2B4M A;  3VE1 B;  4ZEC A;  3KFM A;  5HPQ A;  1FTL A;  2Y7W A;  3A09 A;  3CG3 A;  3FV2 A;  5TP9 A;  1ANF A;  1AMF A;  2F6G A;  1LCF A;  2I48 A;  3FXR A;  3H6U A;  2X7Q A;  2ZXT A;  3CFX A;  4G8H A;  4O3B A;  2D21 A;  3E3K A;  3FGS A;  1UTH A;  4OQO A;  3FAT A;  1RYO A;  5AA2 B;  1UTB B;  2PX1 A;  3JV9 A;  3CI8 A;  2AIX A;  2V25 A;  4IO7 A;  4FAJ A;  3MPK A;  1GR2 A;  1LFG A;  4H65 A;  3PMV A;  3TMG A;  3UN6 A;  2ZNU A;  5CMC A;  4EF1 A;  4GIZ A;  4LQ5 A;  4QSD A;  2Y7K A;  3MP6 A;  3TEL A;  4ELP A;  4ZEI A;  4IB2 A;  4UAC A;  2OBG A;  1JW4 A;  3D4G A;  4WKM A;  5TPA B;  1N7X A;  5I58 A;  1Y4T A;  2H99 A;  2DP8 A;  3K01 A;  2OLB A;  1WOD A;  2Z8D A;  4YMA A;  1EZ9 A;  2P1S A;  2V3T A;  3IX1 A;  1GGG A;  3GBB A;  3HO7 A;  1P1N A;  4L17 A;  2I49 A;  4PQJ A;  5DVJ A;  1IEJ A;  3T9U A;  2VGQ A;  3TTM A;  3HPI A;  1BP5 A;  1Q35 A;  3W9W A;  2GFE A;  2G93 A;  3U94 A;  1DOT A;  4F3P A;  2GHA A;  2YLN A;  1LB9 A;  4JWO A;  5KCJ A;  1B3F A;  1SVX B;  1VR5 A;  4ZZE A;  2I3V A;  2I6E A;  3T66 A;  3VVF A;  1Y1Z A;  3DRI A;  1B0H A;  1FTK A;  1SYI A;  4DCY A;  1YTV A;  1ZMG A;  2F34 A;  5KDT B;  4NF4 B;  3OSQ A;  2D3I A;  2AL4 A;  2Z23 A;  2BJJ X;  2HZL A;  2KLF A;  3DP4 A;  2GH9 A;  4H5G A;  4QRZ A;  1B0L A;  3SET A;  3DRK A;  2F78 A;  4KYS A;  3TCH A;  1JW5 A;  4OER A;  3U8Q A;  3RT6 B;  2ZMB A;  2NUV A;  3RYA A;  1N76 A;  2O69 A;  3MZB A;  5CBR A;  1MPD A;  4H5F A;  2Q2A A;  1D4N A;  5CC2 A;  1NH7 A;  3SDF A;  3UP9 A;  4OEU A;  3N26 A;  4O3A A;  4POW A;  1ZJL A;  3FD3 A;  1M5B A;  2XX9 A;  2P2A A;  3C32 A;  1M5E A;  2DXR A;  2Y7I A;  3PU5 A;  1SBP A;  3LC8 A;  2WKY A;  4HCY A;  3OXN A;  3IAZ A;  4OYV A;  4YKI A;  3UOR A;  3C34 A;  1ZTY A;  2ESN A;  3FJM A;  3L6H A;  4G68 A;  4HCW A;  4LZ5 A;  3V8X B;  3GLB A;  5DTB A;  4E0X A;  3S2V A;  1B40 A;  4TLM B;  1TT1 A;  1O63 A;  2X26 A;  1VFD A;  3AXF A;  5DVF A;  1LGB C;  3C33 A;  3SEY A;  4NF5 A;  5BUU A;  1S9T A;  2ALU A;  2DS9 A;  2QRY A;  3CFL A;  5IAI A;  3SKP A;  4R9F A;  1IQ7 A;  3WAF A;  1MQD A;  3IO6 A;  4TLL B;  1T0K A;  2XXX A;  1B1H A;  3IO4 A;  3RTW B;  3JYR A;  1D9V A;  3K6U A;  1FQF A;  4GXS B;  2FA7 A;  3O29 A;  3IJX B;  3SES A;  5F7V A;  1NFT A;  3LSW A;  3KEI A;  3ONM A;  4LAT A;  3U1O A;  4GF8 A;  4G8M A;  1EZP A;  1POY 1;  5KZT A;  3A3U A;  1D9Y A;  4DLD A;  1NKX A;  1B46 A;  3ILU B;  2V93 A;  1SW2 A;  1Y1M A;  3DLN A;  1UTB A;  2OCU A;  3MZ1 A;  4F18 A;  5I56 B;  4F1Y A;  4JWY A;  2HAV A;  2ZYO A;  3CHG A;  4RNS A;  4WXJ A;  1SI1 A;  4H67 A;  4RK2 A;  2PYY A;  2QMX A;  5A5X A;  1US5 A;  3GXA A;  1MM7 A;  1MXZ A;  4Q8R A;  4ELQ A;  5H8F A;  1S50 A;  1H76 A;  2OWS A;  1VFE A;  1FTJ A;  1IXI A;  3IK6 B;  4K3F A;  4KPT A;  5FTI A;  3UGW A;  3VLV A;  3S9M C;  1FTM A;  1QVS A;  3TZA A;  2A5T B;  2DWH A;  3TTL A;  2PVU A;  3H6T A;  2YJP A;  4EDP A;  3T93 B;  1P1O A;  2VD3 A;  3IOR A;  3RPW A;  2F35 A;  2XXT A;  3G3G A;  1Y3N A;  3OO7 A;  4Q30 B;  4U1O A;  5ITO A;  3SEV A;  5H8Q A;  4EXL A;  4F29 A;  1B5J A;  5AA3 A;  2HAU A;  1MH3 A;  4OFO A;  1DPE A;  3FVO A;  1JW1 A;  1JQF A;  2F7B A;  4OEV A;  4JWX A;  4FEC A;  1IXH A;  1MY0 A;  2DWA A;  2H5Y A;  3G3K A;  4KHZ E;  3QK6 A;  1ZU0 A;  1P1Q A;  4HS7 A;  2DVZ A;  3THI A;  4ELR A;  3PUW E;  3QUF A;  1KWH A;  2PBW A;  5B7D A;  3KGC A;  4RA1 A;  1OQH A;  3KBR A;  5JEI A;  3TYH A;  3M8U A;  3MWB A;  3K4U A;  1MH4 A;  4XIG Q;  2PT2 A;  2DYX A;  5DEX A;  4ZEB A;  3KZG A;  4JBZ A;  1JEU A;  3TCF A;  2XXU A;  3KJ7 A;  2HQ0 A;  4JB7 A;  4P11 A;  3ZKL A;  4DXU A;  4F22 A;  1RYX A;  2ZYM A;  4F3G A;  3DM0 A;  1UIV A;  2ONK E;  4WEP A;  3ZKK A;  1XVY A;  4KYE A;  5K2Y A;  4NF4 A;  1R9L A;  1I6A A;  2UVH A;  4F1V A;  4EXK A;  5L9S A;  2X7P A;  3R26 A;  5DT6 A;  4OEN A;  3OEM A;  4H1X A;  1FQC A;  3MVW A;  5FHN A;  5H8Q B;  1GV8 A;  1Z7N E;  1QW0 A;  1MS7 A;  2VOZ A;  3CVG A;  4PP0 A;  5K2X A;  3T9V A;  3I3V A;  3ODB A;  4QFN A;  4G8N A;  4GWO A;  4ZEK A;  1NL5 A;  3G7W A;  4X48 A;  1MXX A;  3N5L A;  1MRP A;  3SEU A;  5L8D A;  1WDN A;  5H8F B;  1HSE A;  5FHM A;  5H8H A;  3RGY A;  2CZL A;  4BDO A;  3B6W A;  3TUS A;  3FXU A;  2GHB A;  4OHN A;  2O68 A;  4OMB A;  4BDR A;  4DXC A;  5I57 A;  1XS5 A;  2DSF A;  5TPA A;  1TFA A;  1B3E A;  2I4B A;  3QXM A;  2FYI A;  3U72 A;  2OK2 A;  3DRF A;  5I56 A;  3V83 A;  2F5X A;  3TTN A;  3RY3 A;  2F6P A;  3QAX A;  2D5W A;  3S4U A;  1NNK A;  4QF9 A;  1N3W A;  4NF8 A;  4IO5 A;  3OO6 A;  3P7I A;  1UTH B;  3TPA A;  3LVU A;  5CMK A;  3C9H A;  2F36 A;  5CMM A;  1QJM A;  1JNF A;  1VSO A;  2RCB A;  3E9X A;  4Q0C A;  3PAM A;  5I57 B;  1BIY A;  4NWC A;  5H8S A;  2XXI A;  3N94 A;  3PV0 E;  2I58 A;  4ELO A;  1URD A;  3MUQ A;  4YB5 A;  4FAT A;  3FV1 A;  1OIB A;  4U1Z A;  3Q26 A;  2O7U A;  1VE4 A;  3IOT A;  1DSN A;  1B58 A;  3QSL A;  2XXY A;  1A8F A;  1FW0 A;  3TFL A;  4F3B A;  1A40 A;  1L5T A;  1QUL A;  3FVG A;  3PD8 A;  3HST A;  4LZ7 A;  1DPP A;  2GRV A;  4QFL A;  2B3F A;  3ECR A;  1FCK A;  3K1M A;  1ZKB A;  3G3I A; 
#chains in the Genus database with same CATH topology
 4PTK A;  4KYD A;  2B3B A;  1JET A;  4PFY A;  1HSL A;  3HHG A;  4YB7 A;  4H0W A;  2XXR A;  3C35 A;  1FBC A;  3MC2 A;  3R7X A;  3C31 A;  3U1O A;  3RQT A;  4KCD A;  3KJT A;  2NWJ A;  3BBR A;  3I6V A;  1N84 A;  3PUY E;  4GWZ A;  4EUO A;  5AA4 A;  4PE3 A;  5ET6 A;  1N04 A;  1A8E A;  4O8M A;  1SW4 A;  2DE3 A;  4GQO A;  2V84 A;  1I6B A;  3T96 B;  1RDY A;  1NUY A;  4IO4 A;  1CB6 A;  1B05 A;  3O6P A;  2CMO A;  3FJG A;  3RN8 A;  2XXQ A;  3TTR A;  1FTO A;  1YCJ A;  2RC7 A;  3H4Z A;  2G29 A;  4OET A;  1LFH A;  1HSJ A;  1QUK A;  2WOK A;  3E13 X;  5EHS A;  1FRP A;  4NG7 A;  3MZ9 A;  3H3G A;  1NV7 A;  4GRK A;  5BWJ A;  4ZED A;  4GXA A;  3IJO B;  4MNI A;  3O66 A;  2XXH A;  3B7D A;  1B4Z A;  4RJZ A;  1QUI A;  2QS3 A;  2I4C A;  1IMD A;  1IMF A;  4PFT A;  1USY H;  1OVT A;  4F3S A;  1MM6 A;  5TU0 A;  4U21 A;  3MQ9 A;  2QS4 A;  1FBP A;  4NMY A;  4YMB A;  1EH3 A;  1MY4 A;  2XA5 A;  3IB0 A;  1MY3 A;  4LN5 A;  3VVE A;  5LTC A;  2HEU A;  1CE2 A;  4NED A;  5DYH A;  2QS1 A;  3O97 A;  2FHY A;  1B9J A;  1NUX A;  4PDD A;  2REJ A;  2F3B A;  4G4P A;  5H8H B;  1FJ6 A;  4QSE A;  3VLW A;  2ABH A;  1FBF A;  2XX8 A;  3TOD A;  4QFK A;  3IL1 B;  4YAH X;  1LBB A;  1BLF A;  4IY5 A;  1AOV A;  2DWI A;  1NUZ A;  1PBP A;  1B51 A;  5H8N B;  4BDL A;  1EU8 A;  1K9Y A;  3D4C A;  5ITP A;  4YU0 A;  1YZ0 A;  1Q9D A;  1FPI A;  3OEL A;  1B2H A;  3PMX A;  4H8I A;  1LAG E;  4F2Q A;  4IGR A;  5ICT A;  4NHB A;  1FPF A;  5LDZ A;  4GWS A;  1FPB A;  1Y3Q A;  1A7L A;  3C4M A;  1UQW A;  5KDT A;  2XXW A;  3CSB A;  5I5P A;  2DXY A;  3OO8 A;  1XHY A;  3R6U A;  1I6Q A;  2PMS A;  3S9L C;  4YKJ A;  4O7M A;  3TAJ A;  3PPN A;  4RPN A;  4R74 A;  4OVJ A;  2REG A;  4LUB A;  3MJN A;  2NVU B;  3G3H A;  4N13 A;  3O9P A;  2THI A;  1B7Z A;  1LCT A;  4YKP A;  1NNP A;  1US4 A;  5I59 A;  3A3C A;  1MQJ A;  1D9Q A;  1NH8 A;  4QSC A;  3QYT A;  1PB9 A;  1SW5 A;  3CG1 A;  3IOU A;  3W9V A;  1AIV A;  5HM4 B;  2UXA A;  4MNC A;  3ILT B;  3IB2 A;  3KOS A;  4LVQ A;  3MVY A;  3IR1 A;  4MFI A;  1DCU A;  2RCA A;  4OFJ A;  2R71 A;  1SD3 A;  3A29 A;  4RY1 A;  4YKK A;  2VPN A;  3KSJ A;  4PBH A;  4LP2 B;  3M3F A;  3FBP A;  4DDD A;  4R75 A;  1EYI A;  4ZEC A;  2PCR A;  5HPQ A;  3CG3 A;  2CZH A;  1LCF A;  3FXR A;  3H6U A;  2X7Q A;  2D21 A;  1UTH A;  3CI8 A;  2AIX A;  4IO7 A;  3TMG A;  1LFG A;  5CMC A;  4IB2 A;  2OBG A;  3D4G A;  1EYJ A;  2WEF A;  2H99 A;  2V3T A;  1GGG A;  4PQJ A;  2I49 A;  2VGQ A;  1FTA A;  4F3P A;  2GHA A;  2YLN A;  1LB9 A;  5KCJ A;  2QVU A;  2Y5L A;  1YTV A;  3EKI A;  4DCY A;  2F34 A;  5EQA A;  1NV1 A;  1B0L A;  4OER A;  3U8Q A;  1FBH A;  1KZ8 A;  2V4C A;  4OEU A;  2CZI A;  4O3A A;  4POW A;  4PF8 A;  4HCY A;  3PU5 A;  2FIX A;  3IAZ A;  1AWB A;  4HCW A;  2ESN A;  4G68 A;  4LZ5 A;  3V8X B;  5DTB A;  3S2V A;  1O63 A;  5DVF A;  4NF5 A;  4N17 A;  4R9F A;  1IQ7 A;  5FBP A;  1MQD A;  2XXX A;  3JYR A;  3K6U A;  3O29 A;  4GF8 A;  2PFY A;  5KZT A;  3A3U A;  4NAP A;  1B46 A;  1Y1M A;  3DLN A;  2OCU A;  5IZ3 A;  2ZYO A;  4MCO A;  4RNS A;  2PYY A;  3GXA A;  3KC1 A;  4Q8R A;  4ELQ A;  4K3F A;  1QVS A;  4F31 B;  5IZZ A;  3T93 B;  1P1O A;  2F35 A;  5AA3 A;  4EXL A;  1B5J A;  1MH3 A;  1JW1 A;  4LON B;  4OEV A;  3G3K A;  1LBZ A;  2DVZ A;  5B7D A;  3KGC A;  4NX1 A;  4XIG Q;  5DEX A;  4OVS A;  3TCF A;  2HQ0 A;  1RYX A;  3DM0 A;  1UIV A;  1XVY A;  1I6A A;  2UVH A;  2X7P A;  1GV8 A;  5H8Q B;  5DT6 A;  4H1X A;  4DI3 D;  4G61 A;  1QW0 A;  4N91 A;  1NL5 A;  3SEU A;  5L8D A;  2CZL A;  4OHN A;  1XS5 A;  1B3E A;  2FYI A;  3U72 A;  2OK2 A;  3DRF A;  3V83 A;  2F5X A;  3TTN A;  2F6P A;  2D5W A;  5CMK A;  3C9H A;  2F36 A;  1FBE A;  5CMM A;  1VSO A;  4Q0C A;  5I57 B;  1BIY A;  4YB5 A;  3Q26 A;  3IOT A;  2XXY A;  1QUL A;  3HST A;  3ECR A;  3K1M A;  1ZKB A;  4PAK A;  3G3I A;  3EPE A;  3O6G A;  1VDW A;  3DRH A;  3OMB A;  4NF6 A;  1B3L A;  4XFE A;  3T22 A;  1LAF E;  1QKA A;  4PGP A;  3KBZ A;  4Q5T A;  1MQI A;  4I8C A;  3FVK A;  3V5A A;  3U65 A;  2IEE A;  3VLU A;  4KD5 A;  2QS2 A;  1SW1 A;  2P3V A;  3U93 A;  3BFT A;  2CEY A;  2I0C A;  4H45 A;  4MIJ A;  4P0G A;  2ONR A;  1WVJ A;  3DP6 A;  2WBB A;  3MPL A;  3PTY A;  4NF0 A;  1MPC A;  2ZNS A;  4KCC A;  5I59 B;  4U23 A;  5IZ3 B;  1M5C A;  3FZV A;  4RPO A;  4Z7E A;  2A5T A;  3OO9 A;  5IKB A;  2F7C A;  4GX6 A;  4WED A;  4GWY A;  3TQL A;  1LAX A;  4IO2 A;  4R73 A;  1NNF A;  1H43 A;  5JTY B;  1A54 A;  4N15 A;  4NF8 B;  2QVR A;  2XD2 A;  4OXV A;  1H45 A;  1R6Z A;  1LBY A;  5AA4 B;  3B6Q A;  3RNN A;  3PUX E;  2F7A A;  1OLA A;  2DE2 A;  2W7Y A;  3PD9 A;  1LAH E;  4QXD A;  3N6U A;  2UVI A;  1PC3 A;  4X9T A;  4N07 A;  4ZEF A;  4M1V A;  5LOM A;  1RKM A;  4OAN A;  1K9Z A;  4MLQ A;  1A99 A;  1ELJ A;  2OWZ A;  2RKM A;  1MPB A;  4YIC A;  4G77 A;  4FE8 A;  3OOA A;  2WOL A;  3QIM A;  4R6H A;  1NV3 A;  5AA2 A;  4C1U A;  4GX3 A;  3EHT A;  4NTL A;  4YZZ A;  1P99 A;  3ISP A;  5EQ7 A;  3K1N A;  3QMF A;  5ELV A;  4JSD A;  2XXV A;  1LB8 A;  1GTK A;  3RPL A;  1MDQ A;  3RTF B;  4JVC A;  5TP9 B;  2AYS A;  4IGT A;  4FOR A;  1MXY A;  3LSX A;  3EQ1 A;  4I9D A;  5B70 A;  4F2O A;  4ONY A;  2ZZX A;  2ZNT A;  1B3H A;  4AQ4 A;  3SER A;  1NV6 A;  4U22 A;  2P3N A;  2HZK A;  3FXQ A;  3ZSF A;  3I5O A;  3U92 A;  5IGA A;  3Q25 A;  3TQW A;  2RIN A;  1G0H A;  2ZYK A;  5EHM A;  3PUV E;  2R9J A;  1Y3P A;  4RK9 A;  5I84 A;  3DP8 A;  2FVZ A;  3KC0 A;  4ZDM A;  1LBV A;  4EQB A;  2Y7P A;  3IOV A;  4PFR A;  4BDQ A;  3CRB A;  3ROJ A;  2Y7R A;  4DXB A;  4ZS9 A;  4MMP A;  2DVC A;  3PPO A;  3N6T A;  4H8J A;  1B5H A;  1B52 A;  4XEQ A;  5J1D A;  1DMB A;  3K0V A;  3QUJ A;  1NNT A;  1Y9U A;  1OMP A;  2QL3 A;  1JP4 A;  2PT1 A;  3WAE A;  2QJE A;  1B7U A;  1M5D A;  1FBG A;  1XOC A;  1MQH A;  2WOP A;  2NXO A;  4JDF A;  3GZG A;  3E4R A;  3E79 A;  3RT8 A;  3KN8 A;  3S9E A;  2IA4 A;  4MLV A;  2H4I A;  4I62 A;  4TOZ A;  2Z22 A;  2DWJ A;  4QHQ A;  2CZK A;  5I58 B;  4UA8 A;  3VE1 B;  5TP9 A;  1ANF A;  2I48 A;  3RYD A;  3E3K A;  1RYO A;  1UTB B;  2PX1 A;  2V25 A;  1NI9 A;  4GIZ A;  2Y7K A;  1N7X A;  1Y4T A;  2DP8 A;  3K01 A;  1WOD A;  3NOH A;  4PF6 A;  1IEJ A;  4I3E A;  3W9W A;  2GFE A;  3B8B A;  1B3F A;  1SPI A;  1VR5 A;  4ZZE A;  3VVF A;  1FTK A;  1B0H A;  2D3I A;  2BJJ X;  2Z23 A;  2KLF A;  3DP4 A;  4H5G A;  2F78 A;  1YXI A;  2NUV A;  1N76 A;  2O69 A;  3MZB A;  1MPD A;  2Q2A A;  1D4N A;  2XX9 A;  2DXR A;  2Y7I A;  3OXN A;  3C34 A;  3GLB A;  1TT1 A;  2X26 A;  1VFD A;  4N8G A;  4HE1 A;  1NUW A;  1T0K A;  3IO4 A;  4GXS B;  3ONM A;  3KEI A;  1FBD A;  4GBW A;  1NKX A;  4PAI A;  4PAF A;  3MZ1 A;  4F18 A;  5I56 B;  4WXJ A;  4JWY A;  3CHG A;  2WYP A;  1H76 A;  4PC9 A;  1VFE A;  1FTJ A;  3UGW A;  3VLV A;  3S9M C;  1FTM A;  2A5T B;  4EDP A;  2PVU A;  3H6T A;  2YJP A;  2XXT A;  5ITO A;  3OO7 A;  4U1O A;  2HAU A;  2F7B A;  4FEC A;  1ZU0 A;  1P1Q A;  1DBZ A;  1OQH A;  5JEI A;  3M8U A;  2PT2 A;  2DYX A;  1QGX A;  3KZG A;  3KJ7 A;  4F22 A;  4JB7 A;  4P3L A;  4NF4 A;  1R9L A;  5FHN A;  4P9K A;  1MS7 A;  4PP0 A;  1BK4 A;  4GWO A;  4ZEK A;  5H8F B;  3RGY A;  3TUS A;  5H8H A;  3B6W A;  2O68 A;  2DSF A;  1CNQ A;  5TPA A;  1G0I A;  2I4B A;  4PCD A;  2Y5K A;  2KQZ A;  1N3W A;  4NF8 A;  3PAM A;  2XXI A;  3N94 A;  4ELO A;  2F3D A;  1URD A;  4P1E A;  3FV1 A;  1OIB A;  1NV5 A;  3QSL A;  3TFL A;  1FW0 A;  4F3B A;  3PD8 A;  3FVG A;  4LZ7 A;  2B3F A;  3O28 A;  3ILU B;  4KI0 E;  4PFW A;  1LEV A;  3M3K A;  3LR1 A;  3IOW A;  1TFD A;  5EYF A;  4HE2 A;  3BIH A;  4MH5 A;  4KQP A;  3PMW A;  4GOT A;  4DCX A;  1ZLQ A;  4ZZA A;  1Q1K A;  3F11 A;  3MVZ A;  2H9B A;  2XXK A;  1B32 A;  3V89 B;  1SI0 A;  3FXB A;  4U4S A;  2OZZ A;  5ET7 A;  2A5S A;  4POX A;  5I7I A;  4C0R A;  1FQB A;  2O1L A;  2O6A A;  5I2N A;  2DQV A;  2RC9 A;  1ATG A;  3MW0 A;  1IMA A;  4H46 A;  1MY2 A;  5L9O A;  3B6T A;  3LUY A;  3OEK A;  1NV2 A;  2L5V A;  2QMW A;  4MHF A;  5AE4 A;  1MQG A;  1FPE A;  4PDH A;  5CM6 A;  3MP1 A;  4R9G A;  4IO6 A;  5F1Q A;  3MYU A;  2VHA A;  3D1R A;  4BDM A;  3K6X A;  4G68 B;  3HCQ A;  3ZS6 A;  5F24 A;  3K6V A;  4AS5 A;  4NE4 A;  2I3W A;  2HCA A;  5DVI A;  4RXL A;  4ECF A;  5AA1 A;  1INP A;  2Q74 A;  5L9M A;  1TXF A;  2HHM A;  4O3C A;  1OQG A;  2Q8J A;  4P0I A;  3M3L A;  4OVT A;  4FBP A;  1SQY A;  4JVD A;  4DIG A;  3SEW A;  2UYF A;  4QBA A;  3S9N C;  3SZP A;  3MP8 A;  5KCJ B;  4XKP A;  4MNP A;  1PBQ A;  1IIW A;  4U4X A;  4XKR A;  1JVX A;  3FVN A;  1AL3 A;  4O7I A;  1XC1 A;  5JTY A;  4GFR A;  4R6Y A;  1YAE A;  4DI4 B;  4XTC Q;  3RLF E;  1PEB A;  1R9Q A;  4KXP A;  3H6V A;  3DRJ A;  4EQ9 A;  4IO3 A;  4OZ9 A;  3VXB A;  3UIF A;  4HW8 A;  1FSA A;  3FTO A;  1IMC A;  2GQ1 A;  3VV5 A;  1MG1 A;  3IB1 A;  1NV0 A;  4TQU Q;  3EF7 A;  2I0B A;  1NV4 A;  3O6H A;  1IUD A;  3G3J A;  5HBC A;  4C1T A;  2XWK A;  3PPP A;  4GD5 A;  5CMB A;  1IXG A;  4PFU A;  2QFL A;  2H25 A;  2Z8F A;  3O6I A;  3LBS A;  1BKA A;  2Y84 A;  1H44 A;  3H06 B;  4OTE A;  2RF1 A;  3CFZ A;  1Y20 A;  3H7M A;  4XKQ A;  1XT8 A;  1YPN A;  3KN7 A;  4X1D A;  1R1N A;  2KR0 A;  1UIU A;  3TDJ A;  1LBC A;  3OD7 A;  3BKI B;  2PFZ A;  3GYY A;  4GL8 A;  2XHD A;  4EQ7 A;  2V3Q A;  3CIJ A;  2VPO A;  4BLA A;  3T9X B;  1IIT A;  5CI5 A;  4FEB A;  2ZYN A;  5ISU A;  2VD2 A;  1S7Y A;  3MAM A;  2YPN A;  1OVB A;  2LAO A;  1URG A;  2Z8E A;  2ZZV A;  2R8T A;  1N7W A;  5EYH A;  1MXU A;  4ISU A;  3KOT A;  3HHF A;  3PPQ A;  1SYH A;  2HXW A;  2E1S A;  5CRY A;  4OES A;  4PGN A;  1XI6 A;  3USD A;  1JEV A;  4GWU A;  3HN0 A;  4KFQ A;  4P56 A;  1EZO A;  3UK4 A;  1MXV A;  4XF5 A;  4ESW A;  5I2K A;  2O1M A;  4HTG A;  1O64 A;  3RUM A;  4ZE8 A;  4I40 A;  4Z0I A;  5M2V A;  4X1B A;  3K1P A;  4JXI A;  3VVD A;  3KFM A;  3FV2 A;  1RDX A;  1EYK A;  4G8H A;  4OQO A;  3FAT A;  3UN6 A;  3PMV A;  2ZNU A;  5DW8 A;  3TEL A;  3MP6 A;  5KDT B;  4ZEI A;  4UAC A;  4WKM A;  2BJI A;  4YMA A;  4PBQ A;  4GWW A;  5DVJ A;  3HPI A;  1BP5 A;  1Q35 A;  4MEV A;  3U94 A;  1DOT A;  4JWO A;  1SVX B;  2I3V A;  3T66 A;  1Y1Z A;  1SYI A;  4NF4 B;  5T3J A;  2HZL A;  5EQ8 A;  4QRZ A;  5ET5 A;  3TCH A;  1JW5 A;  3RT6 B;  2ZMB A;  4OVP A;  3RYA A;  5CBR A;  3BIG A;  5CC2 A;  1NH7 A;  2P2A A;  3C32 A;  1SBP A;  3LC8 A;  4P47 A;  3L6H A;  5IZ1 A;  4E0X A;  1B40 A;  3C33 A;  5BUU A;  1S9T A;  2ALU A;  2DS9 A;  3CFL A;  3WAF A;  4TLL B;  1B1H A;  3RTW B;  1FQF A;  2FA7 A;  5F7V A;  4LAT A;  4G8M A;  4DLD A;  4O94 A;  3E78 A;  1UTB A;  1FPL A;  2HAV A;  1SI1 A;  4RK2 A;  5A5X A;  1MXZ A;  5H8F A;  1S50 A;  2OWS A;  1IXI A;  3TZA A;  2DWH A;  4OVQ A;  3TTL A;  3IOR A;  3RPW A;  3SEV A;  4OFO A;  4MX6 A;  4R2B A;  1JQF A;  4JWX A;  2H5Y A;  3THI A;  4HS7 A;  4ELR A;  4PFB A;  3QUF A;  1KWH A;  2PBW A;  2FIE A;  3KBR A;  3LUZ A;  3TYH A;  3K4U A;  1MH4 A;  4P11 A;  4JBZ A;  3ZKL A;  4MAG A;  3ZKK A;  5K2Y A;  4F1V A;  4EXK A;  5L9S A;  3R26 A;  4OEN A;  3OEM A;  1FQC A;  3MVW A;  1Z7N E;  1FPK A;  2VOZ A;  3ODB A;  4G8N A;  4X48 A;  3G7W A;  3N5L A;  1WDN A;  1HSE A;  4BDO A;  3FXU A;  4DXC A;  2XWV A;  1TFA A;  2ZZW A;  5I56 A;  3S4U A;  1FPG A;  4QF9 A;  4IO5 A;  3LVU A;  1JNF A;  3E9X A;  4NWC A;  5H8S A;  3PV0 E;  2I58 A;  4JVI A;  3MUQ A;  4FAT A;  1VE4 A;  1A8F A;  1A40 A;  1L5T A;  4QFL A;  1FCK A;  3KSX A;  4X04 A;  2RC8 A;  2UVG A;  4HE0 A;  5FHO A;  4AB5 A;  2V3U A;  2F8D A;  4LA9 A;  2R6G E;  1B4H A;  3L6G A;  1FJ9 A;  1MY1 A;  5EQ9 A;  1KA1 A;  1B3G A;  3FIR A;  4XKN A;  1LBX A;  1LST A;  4NN3 A;  1BTJ A;  1XVX A;  3PPR A;  2UVJ A;  5CBS A;  2B65 A;  4ZE9 A;  5H8N A;  4FED A;  5JK4 A;  3EN3 A;  1DTG A;  1Y4C A;  2H98 A;  3CSG A;  3UA8 A;  2HXR A;  5A5X B;  1FQE A;  1IZ1 A;  1N3X A;  4AB6 A;  1H3D A;  4QFO A;  2AL5 A;  1J1N A;  2FBP A;  2O7I A;  1ZIU A;  1JVY A;  2E0S A;  3DEL B;  1N0T A;  4GL0 A;  2HPG A;  2OWT A;  3LSF B;  2CEX A;  4GX4 A;  5ICQ A;  5I3S A;  1ZBM A;  4R72 A;  3EHS A;  1PDA A;  3K2D A;  3TKD A;  3GBA A;  2F97 A;  1FQD A;  2ONS A;  2QPQ A;  2B4L A;  3CR9 A;  4GBV A;  3MBP A;  1F9B A;  3O2A A;  4MF3 A;  1LFI A;  1GVC A;  1POT A;  1AH5 A;  2DE4 A;  3OEN A;  1LLS A;  4NWD A;  4ND9 A;  4JSO A;  4FJP A;  2Q89 A;  3RYB A;  2MKZ A;  3VXC A;  2VP1 A;  4H6D A;  4R2F A;  1TWY A;  3TEP A;  3LSL A;  1NMU A;  1O7T A;  4IY6 A;  3Q29 A;  4GVO A;  3FAS A;  2DDK A;  4RYA A;  3G3F A;  3H6W A;  4KR5 A;  1IME A;  1YYZ A;  1Z7M E;  1I69 A;  4GWX A;  1PB8 A;  4M4G A;  3KG2 A;  4I1D A;  2UYE A;  4PE5 B;  4LQ2 A;  3OSR A;  4OFL A;  2OJT A;  4F19 A;  4NF5 B;  4LZ8 A;  3BFU A;  3FUZ A;  3W15 C;  4IR8 A;  4XXU A;  2XX7 A;  1USY E;  4N6D A;  3MVX A;  2P0S A;  3LV0 A;  1DTZ A;  1P1U A;  3K02 A;  4G68 C;  3HFU A;  1DK4 A;  2DOJ A;  4MJO A;  3PUZ E;  5I2K B;  4R6K A;  1B5I A;  4E0W A;  1QUJ A;  3HV1 A;  1QKB A;  4YB6 A;  3Q28 A;  1IXC A;  2O51 A;  4OA4 A;  2Q9T A;  3T9H B;  1B6H A;  3VFJ A;  3Q27 A;  3TCG A;  4HXV A;  3RPL B;  2M8C A;  2ANJ A;  4EF2 A;  4MBP A;  1D3K A;  1FQA A;  5AA2 D;  2XXP A;  4F39 A;  3K00 A;  3MST A;  5IM2 A;  2O84 X;  4F1U A;  3H03 A;  3VDF A;  2QSX A;  2Q8M A;  1A55 A;  1B7H A;  4ESX A;  4U2R A;  2FNC A;  1LBW A;  2HFB A;  3FJ7 A;  1SDX A;  3PGF A;  4OWD A;  5EYG A;  4G2Z A;  4FIM A;  3TTK A;  3JZJ A;  1URS A;  3C36 A;  1II5 A;  4PET A;  4GLI A;  5A5L A;  5FTH A;  3SEX A;  3K6W A;  3B50 A;  1PB7 A;  4THI A;  2Q2C A;  1KA0 A;  1MXW A;  4DZ1 A;  4QFP A;  5DEX B;  4BDN A;  1B1X A;  1OLC A;  2Q88 A;  3KN3 A;  1M5F A;  4NF6 B;  2NOO A;  4DE8 A;  2XD3 A;  4NGU A;  1P1W A;  2VT5 A;  1MDP 1;  3EHU A;  4N8Y A;  3DRG A;  4UAB A;  1FPJ A;  2JJK A;  2B4M A;  1FTL A;  2Y7W A;  3A09 A;  2WX9 A;  1AMF A;  2F6G A;  2ZXT A;  3CFX A;  4O3B A;  2XWO A;  3FGS A;  5AA2 B;  3JV9 A;  4FAJ A;  3MPK A;  1GR2 A;  4H65 A;  4EF1 A;  4QSD A;  4LQ5 A;  4ELP A;  5I58 A;  2WYK A;  1JW4 A;  5TPA B;  2OLB A;  2Z8D A;  1EZ9 A;  2P1S A;  3IX1 A;  4L17 A;  3GBB A;  3HO7 A;  1P1N A;  3TTM A;  3T9U A;  4P8B A;  2G93 A;  2I6E A;  3DRI A;  3IFC A;  1ZMG A;  4I3Y A;  3OSQ A;  2AL4 A;  2GH9 A;  3SET A;  3DRK A;  4KYS A;  3T0J A;  4H5F A;  3SDF A;  3UP9 A;  3N26 A;  1ZJL A;  3FD3 A;  5J16 A;  1M5B A;  1M5E A;  4YKI A;  2WKY A;  4OYV A;  3UOR A;  3FJM A;  1ZTY A;  4N6K A;  4TLM B;  1IMB A;  3AXF A;  1LGB C;  3SEY A;  2OX3 A;  2QRY A;  5IAI A;  3SKP A;  3T1B A;  3IO6 A;  4PFI A;  1D9V A;  3IJX B;  3SES A;  1NFT A;  3LSW A;  5ET8 A;  1EZP A;  1POY 1;  1D9Y A;  2V93 A;  1SW2 A;  4OVR A;  4F1Y A;  4AS4 A;  4H67 A;  2QMX A;  1US5 A;  1MM7 A;  5I2N B;  4KPT A;  3IK6 B;  5FTI A;  2VD3 A;  3G3G A;  4Q30 B;  1Y3N A;  4F29 A;  5H8Q A;  4N6P A;  1DPE A;  3FVO A;  1FPD A;  4KHZ E;  1MY0 A;  1IXH A;  2DWA A;  3QK6 A;  3PUW E;  4RA1 A;  3MWB A;  1RDZ A;  4ZEB A;  1JEU A;  2XXU A;  4DXU A;  4F3G A;  2ZYM A;  2ONK E;  4WEP A;  4KYE A;  2WBD A;  5K2X A;  3CVG A;  3T9V A;  3I3V A;  4QFN A;  1MXX A;  1MRP A;  5FHM A;  2GHB A;  4BDR A;  4OMB A;  5I57 A;  4X8R A;  2XWI A;  3QXM A;  4N4U A;  3IFA A;  3RY3 A;  3QAX A;  2QVV A;  1NNK A;  3OO6 A;  3P7I A;  4NQ8 A;  1UTH B;  3TPA A;  1QJM A;  2RCB A;  5ESY A;  4P1L A;  4N81 A;  4U1Z A;  2O7U A;  1DSN A;  1B58 A;  1DPP A;  2GRV A; 
#chains in the Genus database with same CATH homology
 3EPE A;  2UVG A;  4KI0 E;  3O6G A;  3DRH A;  3OMB A;  5FHO A;  4PFW A;  3M3K A;  3LR1 A;  4AB5 A;  3IOW A;  1TFD A;  5EYF A;  2V3U A;  4NF6 A;  1B3L A;  2F8D A;  4MH5 A;  4LA9 A;  2R6G E;  4KQP A;  4KYD A;  3T22 A;  1B4H A;  3L6G A;  1LAF E;  1QKA A;  4Q5T A;  2B3B A;  1MQI A;  1JET A;  4I8C A;  4PFY A;  3FVK A;  1HSL A;  3V5A A;  3HHG A;  1MY1 A;  4YB7 A;  4H0W A;  3PMW A;  2XXR A;  1B3G A;  3O28 A;  4DCX A;  4GOT A;  3C35 A;  1ZLQ A;  2IEE A;  3FIR A;  3VLU A;  4ZZA A;  4ECF A;  4KD5 A;  2QS2 A;  1Q1K A;  4XKN A;  1SW1 A;  3MC2 A;  3R7X A;  3BFT A;  2I0C A;  1LST A;  3C31 A;  3F11 A;  3MVZ A;  3RQT A;  1BTJ A;  1XVX A;  2H9B A;  3PPR A;  1B32 A;  2UVJ A;  4KCD A;  5CBS A;  2B65 A;  3KJT A;  3V89 B;  1SI0 A;  4ZE9 A;  2NWJ A;  3BBR A;  3I6V A;  4P0G A;  2ONR A;  5H8N A;  1N84 A;  1WVJ A;  3DP6 A;  4FED A;  3MPL A;  5JK4 A;  3EN3 A;  1DTG A;  3PUY E;  1Y4C A;  4U4S A;  2H98 A;  3CSG A;  3UA8 A;  5A5X B;  2OZZ A;  1FQE A;  1MPC A;  2ZNS A;  1IZ1 A;  4KCC A;  5I59 B;  4U23 A;  2A5S A;  4EUO A;  5AA4 A;  1N3X A;  4AB6 A;  1M5C A;  5DVI A;  3FZV A;  1N04 A;  4RPO A;  1A8E A;  4Z7E A;  1H3D A;  2A5T A;  3OO9 A;  1SW4 A;  1FQB A;  4QFO A;  2O1L A;  4POX A;  2DE3 A;  4C0R A;  2AL5 A;  2O6A A;  1J1N A;  5IKB A;  2F7C A;  5I2N A;  2DQV A;  2RC9 A;  4GQO A;  1ATG A;  2O7I A;  3MW0 A;  4WED A;  1JVY A;  1ZIU A;  2V84 A;  3TQL A;  5I2N B;  2E0S A;  3DEL B;  1LAX A;  4IO2 A;  1N0T A;  4R73 A;  1NNF A;  1H43 A;  1MY2 A;  5JTY B;  1I6B A;  5L9O A;  4GL0 A;  3T96 B;  5I59 A;  1A54 A;  3B6T A;  2OWT A;  3LUY A;  4IO4 A;  3LSF B;  4NF8 B;  1CB6 A;  2XD2 A;  4OXV A;  3OEK A;  1H45 A;  1B05 A;  3O6P A;  2CMO A;  5ICQ A;  2QMW A;  3FJG A;  3RN8 A;  1ZBM A;  2XXQ A;  1R6Z A;  3TTR A;  5AE4 A;  4R72 A;  1FTO A;  1PDA A;  3EHS A;  3K2D A;  5AA4 B;  1YCJ A;  2RC7 A;  3H4Z A;  3TKD A;  3GBA A;  2G29 A;  2F97 A;  4OET A;  3B6Q A;  1HSJ A;  1MQG A;  1QUK A;  1LFH A;  2WOK A;  5CM6 A;  3E13 X;  1FQD A;  2ONS A;  3MP1 A;  2QPQ A;  4IO6 A;  2B4L A;  3CR9 A;  5F1Q A;  4R9G A;  2VHA A;  5EHS A;  3RNN A;  3MZ9 A;  3PUX E;  3MBP A;  3H3G A;  3U93 A;  1F9B A;  4BDM A;  3O2A A;  2F7A A;  3K6X A;  1OLA A;  1LFI A;  4MF3 A;  4G68 B;  2DE2 A;  3HCQ A;  1GVC A;  1POT A;  1AH5 A;  2DE4 A;  3ZS6 A;  2W7Y A;  4F31 B;  3OEN A;  4GRK A;  3PD9 A;  1LAH E;  3K6V A;  5BWJ A;  3N6U A;  4ZED A;  2I3W A;  4NE4 A;  4GXA A;  2HCA A;  2UVI A;  3IJO B;  1LLS A;  1PC3 A;  3O66 A;  4ND9 A;  4NWD A;  4N07 A;  4RXL A;  4JSO A;  3KSX A;  2XXH A;  4X9T A;  4ZEF A;  5AA1 A;  2RC8 A;  4M1V A;  5L9M A;  1TXF A;  2Q89 A;  3RYB A;  4FJP A;  3B7D A;  1B4Z A;  4RJZ A;  1QUI A;  4O3C A;  3VXC A;  5LOM A;  1OQG A;  2VP1 A;  1RKM A;  4H6D A;  2QS3 A;  4P0I A;  2Q8J A;  3M3L A;  4MLQ A;  4R2F A;  1TWY A;  2I4C A;  1SQY A;  3TEP A;  3LSL A;  4DIG A;  1A99 A;  1NMU A;  1ELJ A;  3SEW A;  4PFT A;  2UYF A;  3S9N C;  1O7T A;  4IY6 A;  1USY H;  3Q29 A;  2RKM A;  1OVT A;  4F3S A;  1MPB A;  4GVO A;  3FAS A;  4G77 A;  1MM6 A;  3MP8 A;  4YIC A;  4FE8 A;  4N6P A;  3OOA A;  5TU0 A;  4U21 A;  2WOL A;  3MQ9 A;  4XKP A;  2QS4 A;  5KCJ B;  4RYA A;  3QIM A;  4R6H A;  3G3F A;  4NMY A;  4YMB A;  1PBQ A;  1EH3 A;  1MY4 A;  3H6W A;  5AA2 A;  3IB0 A;  1IIW A;  4KR5 A;  4C1U A;  3EHT A;  1Z7M E;  4U4X A;  1MY3 A;  4XKR A;  4NTL A;  1JVX A;  1I69 A;  4YZZ A;  3VVE A;  1PB8 A;  3FVN A;  4M4G A;  5B70 A;  3KG2 A;  1P99 A;  2HEU A;  1CE2 A;  4LON B;  1AL3 A;  4NED A;  4I1D A;  2UYE A;  5DYH A;  4PE5 B;  2QS1 A;  3O97 A;  4LQ2 A;  3K1N A;  1B9J A;  1XC1 A;  3OSR A;  4JSD A;  4OFL A;  2XXV A;  5ELV A;  5JTY A;  4GFR A;  2OJT A;  1LB8 A;  1GTK A;  2REJ A;  1MDQ A;  1YAE A;  4R6Y A;  4F19 A;  4G4P A;  3RTF B;  5H8H B;  4NF5 B;  4LZ8 A;  5TP9 B;  3BFU A;  3FUZ A;  4XTC Q;  1PEB A;  3RLF E;  1R9Q A;  3W15 C;  3H6V A;  2AYS A;  4QSE A;  3DRJ A;  4EQ9 A;  4IGT A;  4FOR A;  1MXY A;  2XX7 A;  4XXU A;  3VLW A;  4IO3 A;  4OZ9 A;  3VXB A;  1USY E;  3LSX A;  3UIF A;  2ABH A;  2XX8 A;  3TOD A;  4QFK A;  3IL1 B;  3EQ1 A;  4YAH X;  4I9D A;  1LBB A;  3MVX A;  1BLF A;  2P0S A;  4IY5 A;  4HW8 A;  1DTZ A;  4ONY A;  1P1U A;  3FTO A;  3K02 A;  4F2O A;  2DWI A;  4G68 C;  2ZNT A;  1B3H A;  1MG1 A;  3VV5 A;  4AQ4 A;  3IB1 A;  1PBP A;  2DOJ A;  4TQU Q;  3PUZ E;  3EF7 A;  5I2K B;  3SER A;  2I0B A;  1B51 A;  4R6K A;  1B5I A;  4U22 A;  4BDL A;  1QUJ A;  4E0W A;  1EU8 A;  5H8N B;  2HZK A;  3FXQ A;  3HV1 A;  3O6H A;  3ZSF A;  3I5O A;  1IUD A;  3U92 A;  3G3J A;  1QKB A;  4YB6 A;  3D4C A;  5HBC A;  4C1T A;  5ITP A;  4YU0 A;  3Q25 A;  3TQW A;  3Q28 A;  3PPP A;  2RIN A;  1IXC A;  1AOV A;  4GD5 A;  5CMB A;  2O51 A;  1IXG A;  3OEL A;  2Q9T A;  3T9H B;  4PFU A;  2ZYK A;  1B2H A;  5EHM A;  2H25 A;  2Z8F A;  3O6I A;  3LBS A;  3PMX A;  4H8I A;  1LAG E;  3PUV E;  1B6H A;  4F2Q A;  2R9J A;  1BKA A;  1Y3P A;  2Y84 A;  4IGR A;  4RK9 A;  3VFJ A;  1H44 A;  3H06 B;  3Q27 A;  4OTE A;  2RF1 A;  3TCG A;  5I84 A;  3DP8 A;  5ICT A;  3CFZ A;  1Y20 A;  3H7M A;  4XKQ A;  4ZDM A;  2M8C A;  1XT8 A;  1YPN A;  1Y3Q A;  1A7L A;  2ANJ A;  3C4M A;  4EF2 A;  1UQW A;  4MBP A;  4EQB A;  2Y7P A;  3IOV A;  1D3K A;  5KDT A;  1FQA A;  2XXW A;  3KN7 A;  4X1D A;  4BDQ A;  5AA2 D;  2XXP A;  3CSB A;  3CRB A;  4F39 A;  2Y7R A;  1R1N A;  2DXY A;  3K00 A;  1XHY A;  1UIU A;  3OO8 A;  3TDJ A;  1LBC A;  4DXB A;  3OD7 A;  3BKI B;  3R6U A;  1I6Q A;  2O84 X;  2PMS A;  4ZS9 A;  4F1U A;  3S9L C;  4GL8 A;  4R2B A;  3H03 A;  2DVC A;  3PPO A;  3N6T A;  4H8J A;  4YKJ A;  3TAJ A;  1B5H A;  3PPN A;  4RPN A;  4R74 A;  4OVJ A;  2XHD A;  2QSX A;  2REG A;  3VDF A;  4EQ7 A;  2V3Q A;  1A55 A;  4LUB A;  3MJN A;  3CIJ A;  1B7H A;  4ESX A;  4U2R A;  1B52 A;  2FNC A;  2NVU B;  3G3H A;  5J1D A;  4N13 A;  3O9P A;  4BLA A;  1DMB A;  3K0V A;  2THI A;  1B7Z A;  1LCT A;  1IIT A;  4YKP A;  3T9X B;  1NNP A;  2HFB A;  3QUJ A;  1NNT A;  1US4 A;  1SDX A;  3A3C A;  3FJ7 A;  4FEB A;  5CI5 A;  1MQJ A;  1NH8 A;  1Y9U A;  2ZYN A;  5ISU A;  2VD2 A;  3PGF A;  3QYT A;  1S7Y A;  4OWD A;  3MAM A;  4G2Z A;  4QSC A;  1OMP A;  1PB9 A;  1SW5 A;  2QL3 A;  4FIM A;  3TTK A;  3CG1 A;  3IOU A;  2YPN A;  3JZJ A;  1URS A;  1OVB A;  2LAO A;  1URG A;  2Z8E A;  2PT1 A;  3W9V A;  3C36 A;  1II5 A;  3WAE A;  1N7W A;  4PET A;  1AIV A;  1MXU A;  4GLI A;  5HM4 B;  4ISU A;  3KOT A;  2QJE A;  3HHF A;  3PPQ A;  1B7U A;  1M5D A;  5FTH A;  1SYH A;  3SEX A;  2UXA A;  2HXW A;  3K6W A;  2E1S A;  5CRY A;  4OES A;  3ILT B;  3IB2 A;  1XOC A;  1PB7 A;  1MQH A;  2Q2C A;  4THI A;  2WOP A;  3USD A;  1JEV A;  2NXO A;  1MXW A;  3HN0 A;  4JDF A;  4QFP A;  3KOS A;  5DEX B;  4BDN A;  4LVQ A;  4DZ1 A;  4KFQ A;  1EZO A;  1B1X A;  3MVY A;  3GZG A;  3E4R A;  3UK4 A;  1MXV A;  1OLC A;  4ESW A;  3IR1 A;  3RT8 A;  2Q88 A;  3KN3 A;  3KN8 A;  5I2K A;  2O1M A;  1M5F A;  4HTG A;  4MFI A;  4NF6 B;  3S9E A;  2NOO A;  1O64 A;  2IA4 A;  2RCA A;  4MLV A;  3RUM A;  4DE8 A;  4ZE8 A;  2XD3 A;  4OFJ A;  2R71 A;  4Z0I A;  2H4I A;  1SD3 A;  4I62 A;  5M2V A;  4TOZ A;  1P1W A;  4RY1 A;  4YKK A;  2Z22 A;  3KSJ A;  1MDP 1;  2DWJ A;  3EHU A;  4QHQ A;  4X1B A;  3DRG A;  3K1P A;  5I58 B;  4LP2 B;  3M3F A;  4JXI A;  4UA8 A;  3VVD A;  4DDD A;  4R75 A;  2B4M A;  3VE1 B;  4ZEC A;  3KFM A;  5HPQ A;  1FTL A;  2Y7W A;  3A09 A;  3CG3 A;  3FV2 A;  5TP9 A;  1ANF A;  1AMF A;  2F6G A;  1LCF A;  2I48 A;  3FXR A;  3H6U A;  2X7Q A;  2ZXT A;  3CFX A;  4G8H A;  4O3B A;  2D21 A;  3E3K A;  3FGS A;  1UTH A;  4OQO A;  3FAT A;  1RYO A;  5AA2 B;  1UTB B;  2PX1 A;  3JV9 A;  3CI8 A;  2AIX A;  2V25 A;  4IO7 A;  4FAJ A;  3MPK A;  1GR2 A;  1LFG A;  4H65 A;  3PMV A;  3TMG A;  3UN6 A;  2ZNU A;  5CMC A;  4EF1 A;  4GIZ A;  4LQ5 A;  4QSD A;  2Y7K A;  3MP6 A;  3TEL A;  4ELP A;  4ZEI A;  4IB2 A;  4UAC A;  2OBG A;  1JW4 A;  3D4G A;  4WKM A;  5TPA B;  1N7X A;  5I58 A;  1Y4T A;  2H99 A;  2DP8 A;  3K01 A;  2OLB A;  1WOD A;  2Z8D A;  4YMA A;  1EZ9 A;  2P1S A;  2V3T A;  3IX1 A;  1GGG A;  3GBB A;  3HO7 A;  1P1N A;  4L17 A;  2I49 A;  4PQJ A;  5DVJ A;  1IEJ A;  3T9U A;  2VGQ A;  3TTM A;  3HPI A;  1BP5 A;  1Q35 A;  3W9W A;  2GFE A;  2G93 A;  3U94 A;  1DOT A;  4F3P A;  2GHA A;  2YLN A;  1LB9 A;  4JWO A;  5KCJ A;  1B3F A;  1SVX B;  1VR5 A;  4ZZE A;  2I3V A;  2I6E A;  3T66 A;  3VVF A;  1Y1Z A;  3DRI A;  1B0H A;  1FTK A;  1SYI A;  4DCY A;  1YTV A;  1ZMG A;  2F34 A;  5KDT B;  4NF4 B;  3OSQ A;  2D3I A;  2AL4 A;  2Z23 A;  2BJJ X;  2HZL A;  2KLF A;  3DP4 A;  2GH9 A;  4H5G A;  4QRZ A;  1B0L A;  3SET A;  3DRK A;  2F78 A;  4KYS A;  3TCH A;  1JW5 A;  4OER A;  3U8Q A;  3RT6 B;  2ZMB A;  2NUV A;  3RYA A;  1N76 A;  2O69 A;  3MZB A;  5CBR A;  1MPD A;  4H5F A;  2Q2A A;  1D4N A;  5CC2 A;  1NH7 A;  3SDF A;  3UP9 A;  4OEU A;  3N26 A;  4O3A A;  4POW A;  1ZJL A;  3FD3 A;  1M5B A;  2XX9 A;  2P2A A;  3C32 A;  1M5E A;  2DXR A;  2Y7I A;  3PU5 A;  1SBP A;  3LC8 A;  2WKY A;  4HCY A;  3OXN A;  3IAZ A;  4OYV A;  4YKI A;  3UOR A;  3C34 A;  1ZTY A;  2ESN A;  3FJM A;  3L6H A;  4G68 A;  4HCW A;  4LZ5 A;  3V8X B;  3GLB A;  5DTB A;  4E0X A;  3S2V A;  1B40 A;  4TLM B;  1TT1 A;  1O63 A;  2X26 A;  1VFD A;  3AXF A;  5DVF A;  1LGB C;  3C33 A;  3SEY A;  4NF5 A;  5BUU A;  1S9T A;  2ALU A;  2DS9 A;  2QRY A;  3CFL A;  5IAI A;  3SKP A;  4R9F A;  1IQ7 A;  3WAF A;  1MQD A;  3IO6 A;  4TLL B;  1T0K A;  2XXX A;  1B1H A;  3IO4 A;  3RTW B;  3JYR A;  1D9V A;  3K6U A;  1FQF A;  4GXS B;  2FA7 A;  3O29 A;  3IJX B;  3SES A;  5F7V A;  1NFT A;  3LSW A;  3KEI A;  3ONM A;  4LAT A;  3U1O A;  4GF8 A;  4G8M A;  1EZP A;  1POY 1;  5KZT A;  3A3U A;  1D9Y A;  4DLD A;  1NKX A;  1B46 A;  3ILU B;  2V93 A;  1SW2 A;  1Y1M A;  3DLN A;  1UTB A;  2OCU A;  3MZ1 A;  4F18 A;  5I56 B;  4F1Y A;  4JWY A;  2HAV A;  2ZYO A;  3CHG A;  4RNS A;  4WXJ A;  1SI1 A;  4H67 A;  4RK2 A;  2PYY A;  2QMX A;  5A5X A;  1US5 A;  3GXA A;  1MM7 A;  1MXZ A;  4Q8R A;  4ELQ A;  5H8F A;  1S50 A;  1H76 A;  2OWS A;  1VFE A;  1FTJ A;  1IXI A;  3IK6 B;  4K3F A;  4KPT A;  5FTI A;  3UGW A;  3VLV A;  3S9M C;  1FTM A;  1QVS A;  3TZA A;  2A5T B;  2DWH A;  3TTL A;  2PVU A;  3H6T A;  2YJP A;  4EDP A;  3T93 B;  1P1O A;  2VD3 A;  3IOR A;  3RPW A;  2F35 A;  2XXT A;  3G3G A;  1Y3N A;  3OO7 A;  4Q30 B;  4U1O A;  5ITO A;  3SEV A;  5H8Q A;  4EXL A;  4F29 A;  1B5J A;  5AA3 A;  2HAU A;  1MH3 A;  4OFO A;  1DPE A;  3FVO A;  1JW1 A;  1JQF A;  2F7B A;  4OEV A;  4JWX A;  4FEC A;  1IXH A;  1MY0 A;  2DWA A;  2H5Y A;  3G3K A;  4KHZ E;  3QK6 A;  1ZU0 A;  1P1Q A;  4HS7 A;  2DVZ A;  3THI A;  4ELR A;  3PUW E;  3QUF A;  1KWH A;  2PBW A;  5B7D A;  3KGC A;  4RA1 A;  1OQH A;  3KBR A;  5JEI A;  3TYH A;  3M8U A;  3MWB A;  3K4U A;  1MH4 A;  4XIG Q;  2PT2 A;  2DYX A;  5DEX A;  4ZEB A;  3KZG A;  4JBZ A;  1JEU A;  3TCF A;  2XXU A;  3KJ7 A;  2HQ0 A;  4JB7 A;  4P11 A;  3ZKL A;  4DXU A;  4F22 A;  1RYX A;  2ZYM A;  4F3G A;  3DM0 A;  1UIV A;  2ONK E;  4WEP A;  3ZKK A;  1XVY A;  4KYE A;  5K2Y A;  4NF4 A;  1R9L A;  1I6A A;  2UVH A;  4F1V A;  4EXK A;  5L9S A;  2X7P A;  3R26 A;  5DT6 A;  4OEN A;  3OEM A;  4H1X A;  1FQC A;  3MVW A;  5FHN A;  5H8Q B;  1GV8 A;  1Z7N E;  1QW0 A;  1MS7 A;  2VOZ A;  3CVG A;  4PP0 A;  5K2X A;  3T9V A;  3I3V A;  3ODB A;  4QFN A;  4G8N A;  4GWO A;  4ZEK A;  1NL5 A;  3G7W A;  4X48 A;  1MXX A;  3N5L A;  1MRP A;  3SEU A;  5L8D A;  1WDN A;  5H8F B;  1HSE A;  5FHM A;  5H8H A;  3RGY A;  2CZL A;  4BDO A;  3B6W A;  3TUS A;  3FXU A;  2GHB A;  4OHN A;  2O68 A;  4OMB A;  4BDR A;  4DXC A;  5I57 A;  1XS5 A;  2DSF A;  5TPA A;  1TFA A;  1B3E A;  2I4B A;  3QXM A;  2FYI A;  3U72 A;  2OK2 A;  3DRF A;  5I56 A;  3V83 A;  2F5X A;  3TTN A;  3RY3 A;  2F6P A;  3QAX A;  2D5W A;  3S4U A;  1NNK A;  4QF9 A;  1N3W A;  4NF8 A;  4IO5 A;  3OO6 A;  3P7I A;  1UTH B;  3TPA A;  3LVU A;  5CMK A;  3C9H A;  2F36 A;  5CMM A;  1QJM A;  1JNF A;  1VSO A;  2RCB A;  3E9X A;  4Q0C A;  3PAM A;  5I57 B;  1BIY A;  4NWC A;  5H8S A;  2XXI A;  3N94 A;  3PV0 E;  2I58 A;  4ELO A;  1URD A;  3MUQ A;  4YB5 A;  4FAT A;  3FV1 A;  1OIB A;  4U1Z A;  3Q26 A;  2O7U A;  1VE4 A;  3IOT A;  1DSN A;  1B58 A;  3QSL A;  2XXY A;  1A8F A;  1FW0 A;  3TFL A;  4F3B A;  1A40 A;  1L5T A;  1QUL A;  3FVG A;  3PD8 A;  3HST A;  4LZ7 A;  1DPP A;  2GRV A;  4QFL A;  2B3F A;  3ECR A;  1FCK A;  3K1M A;  1ZKB A;  3G3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...