1B1HA

Oligo-peptide binding protein/tripeptide (lys hpe lys) complex
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
total genus 189
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b1hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b1hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b1hA02
3PUYE 1LSTA 1VSOA 4IO3A 1AIVA 4RA1A 1TFDA 1QUKA 1B9JA 1N0TA 1URGA 4Z0IA 3R6UA 4IY6A 3AXFA 5TU0A 1SDXA 3GXAA 1VR5A 1S9TA 4YKJA 1N76A 3OSQA 2XD3A 2E1SA 3MUQA 4F3PA 1OLCA 2I58A 3N6TA 1OQHA 4H67A 4FE8A 5ICTA 2B4MA 1JVXA 4DLDA 1TT1A 2D3IA 3ECRA 4U4SA 4GRKA 3S4UA 4PE5B 4YICA 3ILUB 2O84X 1VFEA 4UA8A 4ELRA 5B70A 5KCJA 1LAFE 3MVXA 1UTHA 2PX1A 3IR1A 4LZ8A 4P11A 2O7UA 3Q27A 3N5LA 4KYEA 3TMGA 2V93A 1B58A 1MXWA 1DMBA 1XVYA 2DVZA 3CSBA 5FTHA 4U1OA 2Z23A 1NNPA 3FJMA 5JTYA 1ANFA 5CM6A 1ZTYA 1NNTA 5FHMA 3N26A 4U21A 3FVKA 4FJPA 3K02A 4JXIA 2H99A 3O2AA 4ZE8A 2UVIA 2Q89A 1AL3A 4HTGA 4BDRA 2NOOA 4HS7A 5H8SA 3SESA 4OFJA 1D3KA 2Z8FA 4Q8RA 4KYDA 1JEVA 2GH9A 3BFTA 4U22A 4YU0A 1A40A 1ZIUA 2XXTA 1POTA 1A7LA 3WAFA 1EZPA 3KN7A 3DP4A 3PU5A 3FV2A 4THIA 2XHDA 5I2NB 4FORA 4DXCA 4KD5A 4KCDA 4PFTA 1RKMA 1PB9A 1BLFA 4C0RA 1OIBA 4JDFA 4F29A 2XXUA 2OBGA 1LB9A 3H3GA 1XHYA 1SBPA 1P1NA 5ISUA 3KOSA 1JNFA 4GXAA 4PQJA 1XVXA 5HBCA 1MPBA 5H8NB 3CHGA 3UORA 3HCQA 2VD2A 2O69A 3O28A 3EHTA 3CVGA 4BDMA 4FEBA 3H6UA 1YCJA 1N3XA 1UTBA 2H98A 2WKYA 3PPOA 1MM7A 1MQJA 4GLIA 3G3IA 5H8QB 1I6AA 3WAEA 3V83A 4R6HA 2I48A 3EN3A 1MY1A 1IXHA 2QS4A 2LAOA 3FJ7A 3SERA 3H4ZA 4DE8A 3PPPA 3G3KA 5TPAB 3TYHA 2E0SA 1NNFA 3GZGA 3FTOA 3SDFA 3MQ9A 3MJNA 2VHAA 3PUZE 3LSLA 4TLMB 1AMFA 1N84A 1B40A 4XKQA 1XC1A 1JW4A 4FECA 4O3BA 3SETA 2RCBA 2OJTA 3DP6A 3TFLA 2O7IA 2I3WA 5A5XA 5JK4A 2GFEA 2R6GE 3FZVA 1TXFA 3P7IA 4UACA 2ALUA 3CRBA 3W9VA 1B5HA 3IJOB 5I59B 5I58A 1TWYA 1B7UA 4NF6A 2UVHA 4R72A 1ZLQA 2WOLA 4QFLA 4MBPA 3MP1A 2PT2A 1D4NA 2I4BA 1Y1ZA 2GHAA 1CB6A 3E4RA 4K3FA 4MH5A 1ATGA 2XXIA 3C36A 2D21A 4TLLB 4YAHX 2HAVA 3EF7A 4G8NA 2XXHA 1IUDA 1Y1MA 2WOKA 1MXYA 2Y7WA 4ZECA 2ZNSA 5K2XA 4ZEKA 3SEYA 2W7YA 3OO9A 3MBPA 4X48A 4DCXA 1Y3NA 4POWA 3KBRA 1B7HA 2ESNA 3TDJA 5KCJB 3IOTA 4LVQA 5TP9B 2O51A 3OOAA 1P1WA 3DLNA 5DT6A 2F78A 1MQGA 2VD3A 5AA2D 1B0LA 2QS1A 1ZU0A 1Z7ME 4ESWA 4ISUA 4TOZA 1JW1A 1N04A 3HN0A 3M3KA 3SEWA 3CG3A 3OEMA 4KYSA 3V8XB 3W9WA 4OZ9A 1LAXA 3OD7A 3IORA 2F6PA 3K1PA 3PUWE 5I59A 2YLNA 2P0SA 3PPQA 3V5AA 4U4XA 3KN8A 2NWJA 4EF2A 3MZ9A 1SW5A 5JEIA 3Q28A 4H1XA 1GTKA 4U2RA 1GV8A 5AA2A 1S50A 3VV5A 2Z8EA 2IEEA 5FHOA 1D9VA 4H6DA 2H5YA 2X7QA 1B3GA 2I49A 3K0VA 3TQLA 2DS9A 3E3KA 3PGFA 1HSLA 2IA4A 1H76A 3M3LA 4M4GA 3QIMA 1IEJA 2VP1A 3KJTA 1J1NA 2REJA 3K6VA 4YKPA 1FCKA 3HHGA 4E0XA 4OEUA 1Y3QA 2DWAA 4QFPA 1IXIA 2XX7A 4NF8B 1Y4TA 3DRKA 2AL4A 2ZNTA 1H45A 2Q2CA 1WVJA 2DYXA 4XKPA 2ZXTA 3EQ1A 3H6TA 3OMBA 4LUBA 4OENA 1ZKBA 3MPLA 2O6AA 4NWCA 4QHQA 3UP9A 4ZEDA 2I3VA 3VFJA 3Q26A 1NH8A 4NTLA 5CBRA 1PB8A 5I57B 3PMXA 5AA1A 3ODBA 4F18A 4X1BA 1Y3PA 1IIWA 3U94A 3G3FA 5H8HA 3IL1B 2DWIA 3VLUA 1P99A 3FD3A 2Q9TA 4DCYA 5EHSA 1M5EA 1GGGA 1SQYA 2UVGA 3RY3A 2XXQA 1IITA 1IZ1A 1WODA 3OO6A 2NVUB 3S9EA 2F35A 2ABHA 1FQCA 1P1OA 2UVJA 3KZGA 1POY1 3VVDA 2HZLA 4I9DA 2H4IA 4NEDA 4TQUQ 3HHFA 3OXNA 1N7XA 1LBCA 1USYH 2DWJA 2RC9A 3RNNA 3VDFA 3VVEA 3T9XB 4EF1A 3TCFA 1DTGA 3FVGA 3VE1B 2B4LA 2RKMA 1B3EA 4IY5A 1NFTA 3IB0A 4P0GA 4RNSA 1Y9UA 2R71A 3H6WA 4O3AA 4L17A 2B3BA 2A5SA 3C32A 1FTJA 3FUZA 3D4CA 4NF6B 4YB7A 2B3FA 4GF8A 1A54A 1WDNA 3T66A 4DXUA 1US4A 1MPDA 1SI0A 2PBWA 3MZ1A 1UQWA 2XXRA 2QS3A 1LFIA 3K1NA 3IB1A 4FEDA 1II5A 2PMSA 1R9LA 2V84A 4XTCQ 4XIGQ 3G7WA 4FATA 3MVZA 3RQTA 1D9YA 2F5XA 1EZOA 4OVJA 4U1ZA 4IB2A 2QSXA 2ZYOA 4ZDMA 5I56B 1B4HA 1Y20A 1UTHB 4KHZE 4IO7A 4R74A 5DVIA 5F7VA 3S2VA 1I6BA 3FV1A 4QSDA 1B05A 3RYAA 3N94A 4F19A 2PVUA 4GL0A 1A8FA 5CMCA 1MDP1 2H25A 2Y7IA 1S7YA 1IXGA 4PETA 4I62A 3LR1A 5I2NA 3Q25A 5FHNA 5AA4B 1B46A 3TODA 4LATA 3FVOA 5DTBA 1B52A 3QUFA 3QAXA 3SEVA 1B1XA 1BIYA 3EPEA 4QRZA 2I0CA 4YKKA 3FXUA 1OMPA 2QRYA 4ZEBA 4IO2A 5BUUA 4F3BA 4F31B 3THIA 2XX8A 1B3LA 4YB6A 3A3UA 4F2OA 2CZLA 4AB5A 4YKIA 4GVOA 1B4ZA 3K6XA 1DOTA 1DTZA 2ONKE 4BDLA 4XKRA 1F9BA 2NUVA 2UYFA 1IQ7A 1Q1KA 2UYEA 3B6WA 2B65A 3E9XA 3KOTA 1MXVA 1B3HA 4QSEA 3SEXA 4ZEIA 1I6QA 3PAMA 3RUMA 4GD5A 3U93A 3ZKKA 2F8DA 3C4MA 4IGRA 3CFXA 2F7BA 2DWHA 2G93A 2M8CA 3ZKLA 1LAHE 4DXBA 4F2QA 3PMVA 4JB7A 5TPAA 1R6ZA 1JEUA 4G68A 3M3FA 4DZ1A 2DOJA 2DXRA 3CFLA 3T22A 3G3JA 5I56A 3K1MA 3BBRA 4KI0E 4X1DA 1PC3A 4OTEA 1A55A 3R26A 5I2KA 3OO7A 2THIA 3PPRA 1USYE 3IO4A 1EH3A 4GQOA 4Q0CA 4RPNA 4F1YA 1FQDA 2ONSA 3GLBA 3D4GA 3KSXA 3PPNA 2Y7RA 4O3CA 5CMBA 1LB8A 3UN6A 3TCHA 4QF9A 1MDQA 1B7ZA 3MP6A 4R2BA 1JVYA 3G3HA 1XT8A 3H7MA 2DE3A 5CC2A 1MXXA 1BP5A 2CMOA 1NMUA 3CIJA 4GXSB 3IO6A 4LA9A 2Z22A 3UK4A 1HSEA 1GR2A 1LBBA 5ITPA 4FAJA 1RYXA 4EQ7A 4LONB 3S9NC 3QXMA 4NF5A 2QMWA 4P0IA 3A09A 1B32A 3T9VA 4YMBA 3IOUA 1PBQA 1VE4A 1M5DA 2RC7A 4HCWA 3T93B 1MH4A 1NNKA 1UTBB 4ELQA 2KLFA 1H44A 1OLAA 4GFRA 2Q8JA 3SEUA 1O64A 4ONYA 2AYSA 2DE2A 3TTLA 1LLSA 2RF1A 1N3WA 1LFGA 1ZBMA 1O63A 1Y4CA 3HPIA 5DYHA 2R9JA 4ZS9A 2DVCA 2OWSA 4OFLA 3KJ7A 2VOZA 4XKNA 1SW4A 3PD8A 4R73A 4WXJA 1R9QA 3MVYA 1SD3A 1MRPA 3C31A 2HXWA 5KZTA 3HV1A 4R6YA 3IK6B 2O1LA 1MQHA 3B6QA 4OETA 1H3DA 1PB7A 3C9HA 3E13X 1Q35A 3K6UA 3K6WA 1QVSA 5DEXA 4EXLA 4LQ2A 3FASA 2XXWA 3CG1A 4H8JA 4JBZA 2XX9A 2F97A 2XXVA 1QKBA 1SW1A 3I5OA 2ZYKA 5H8FA 4RPOA 1UIUA 3DRFA 4F1VA 3DELB 2O68A 1ELJA 4OHNA 5AE4A 1US5A 3I6VA 3RPWA 1Z7NE 5M2VA 4ZZAA 3B7DA 2DQVA 4RYAA 2F36A 5HPQA 4LQ5A 3QK6A 3FXRA 4QFOA 3KSJA 2HFBA 2Y7KA 3DP8A 5ICQA 1A99A 2YPNA 4OQOA 1YTVA 5JTYB 1SI1A 2F7AA 5I2KB 4F39A 4GL8A 4OYVA 3DRHA 5EYFA 5I57A 3IOWA 1QW0A 2O1MA 4EXKA 3HO7A 3RYBA 1B0HA 5HM4B 1M5BA 3LUYA 4EDPA 1LFHA 3H06B 1JETA 4AB6A 3O9PA 3V89B 3PMWA 4OEVA 3CSGA 3FIRA 5H8FB 3OENA 5DVJA 4LZ7A 1ZJLA 3O97A 2V3QA 5DEXB 3T9UA 2ANJA 2QMXA 3JV9A 4C1UA 1MQDA 2F6GA 3FJGA 3TPAA 1FQAA 2DE4A 2OZZA 3EHUA 3O66A 4R6KA 5CI5A 4NF4B 3M8UA 3MZBA 1N7WA 3OELA 5I84A 2RINA 4H5FA 2YJPA 4OWDA 3LSWA 5H8QA 2Q2AA 4LP2B 1B3FA 4OXVA 4RY1A 3USDA 3L6GA 1FQBA 3PD9A 4EQ9A 1P1UA 4N07A 3OEKA 1O7TA 4OERA 4GIZA 1B6HA 2RC8A 4JWYA 5H8HB 4OFOA 4AQ4A 3DRIA 4G8MA 4N6PA 3ILTB 4IO5A 1LGBC 4FIMA 1MH3A 3CFZA 4PFYA 2BJJX 3LSFB 3O6HA 4EUOA 5DVFA 2DXYA 4I8CA 2HEUA 3K4UA 3TQWA 1CE2A 3B6TA 3S9MC 3MP8A 1URDA 3FXQA 5A5XB 1QJMA 2X7PA 3G3GA 3KFMA 3C33A 4NF8A 5IKBA 2HAUA 2NXOA 4BDNA 4I1DA 2FNCA 4QSCA 4MLVA 3H03A 4RK2A 3MVWA 1PEBA 4M1VA 1YPNA 3TTRA 1P1QA 4IGTA 3PUVE 1SVXB 1KWHA 3RT8A 2VGQA 1MPCA 2QS2A 5L8DA 1FTKA 4G8HA 4GWOA 4U23A 4JSDA 1L5TA 4ECFA 4YB5A 3IB2A 1BTJA 3IX1A 5CRYA 4KQPA 5ITOA 2A5TB 3RN8A 2X26A 1T0KA 1FTOA 2G29A 3I3VA 1NL5A 1EZ9A 4G2ZA 4ELPA 3TEPA 4G77A 2PT1A 3U92A 1XS5A 4NE4A 4RJZA 5CBSA 2H9BA 4R9GA 4H0WA 4KCCA 3SKPA 3TELA 4KFQA 1MQIA 2F7CA 2D5WA 1DPPA 1DSNA 2FA7A 2RCAA 3U8QA 5CMKA 3PUXE 3VXCA 5TP9A 5FTIA 1B1HA 4ZE9A 3TUSA 3OSRA 3Q29A 5IAIA 4QFKA 3ONMA 4G68B 2OLBA 3L6HA 3O6IA 4G68C 1NH7A 1MS7A 2OWTA 1SW2A 4KR5A 2OK2A 5AA3A 1I69A 3VLWA 4PFWA 2QL3A 4H5GA 5AA2B 2ZYMA 2HZKA 3S9LC 1OVTA 4POXA 3IJXB 4JWOA 3KGCA 4R75A 5K2YA 1B5IA 1HSJA 3LBSA 3LSXA 1LCTA 1TFAA 3DRGA 4Q30B 3KG2A 1A8EA 3CI8A 3FVNA 3TCGA 1M5FA 1JW5A 3HSTA 3JZJA 4NF4A 3RTFB 2Z8DA 2AIXA 4H8IA 4G4PA 3RT6B 1MXZA 3QYTA 1B2HA 2DSFA 1LAGE 5H8NA 4WKMA 3O6GA 5KDTA 2I6EA 5EHMA 4ESXA 2UXAA 3DRJA 4HCYA 1GVCA 3H6VA 4MLQA 2WOPA 4ZEFA 3DM0A 3R7XA 3F11A 3T96B 3IAZA 3RTWB 4F1UA 3UA8A 2ZNUA 2V3TA 5L9MA 1SYHA 2P1SA 3RLFE 3TAJA 4OESA 4BLAA 4F3SA 1RYOA 3RGYA 4Z7EA 1IXCA 2XD2A 5KDTB 1FW0A 1ZMGA 4GOTA 4MFIA 3TZAA 1DPEA 1MY2A 4NWDA 2ONRA 1MY4A 1SYIA 2ZYNA 4WEPA 3N6UA 1MM6A 1UIVA 4EQBA 1FTMA 3ZS6A 3EHSA 4ND9A 1VFDA 2V25A 2Y7PA 3TTKA 1PBPA 5I58B 2HQ0A 5L9OA 1MY0A 2A5TA 2GHBA 4KPTA 4NMYA 3MPKA 3K01A 2V3UA 2XXPA 4XXUA 2OCUA 1OVBA 1PDAA 4NF5B 1QUJA 4DIGA 1QULA 2XXYA 1QKAA 4BDOA 4YZZA 3O29A 3A3CA 1B5JA 1JQFA 3CR9A 1M5CA 4Q5TA 4X9TA 1B51A 2FYIA 3VVFA 4BDQA 2I0BA 3BKIB 4HW8A 2Q88A 4PP0A 3GBAA 1YAEA 2XXXA 3BFUA 3K00A 3MWBA 3TTMA 3U72A 3UIFA 5LOMA 3MW0A 1AH5A 3QUJA 1FQEA 2ZMBA 4R2FA 1LCFA 3VLVA 2I4CA 4C1TA 2QPQA 1MG1A 4E0WA 3KEIA 4LZ5A 5L9SA 4DDDA 2DP8A 2QJEA 2REGA 2GRVA 3FATA 3FGSA 4OMBA 3UGWA 3QSLA 1FQFA 1MY3A 3MC2A 4JWXA 1OQGA 4RK9A 5B7DA 3U1OA 5BWJA 4F22A 3LVUA 1QUIA 4MF3A 4RXLA 1URSA 4YMAA 5AA4A 3VXBA 3JYRA 1AOVA 1BKAA 3W15C 4ZZEA 3KN3A 1MXUA 1R1NA 4H65A 2P2AA 1NKXA 5ELVA 2Y84A 3TKDA 1EU8A 2F34A 3O6PA 1FTLA 3LC8A 3K2DA 4R9FA 3T9HB 4JSOA 1XOCA 2PYYA 3OO8A 5CMMA 4IO4A 4ELOA 4N13A 5J1DA 3TTNA 4WEDA 4IO6A 2HCAA 4F3GA 3GBBA 3PV0E 4QFNA 3C34A 3MAMA 3ZSFA 2AL5A 1H43A 4PFUA 5F1QA 3IOVA 3C35A
chains in the Genus database with same CATH superfamily
4MJOA 4IO3A 1B9JA 4IY6A 5TU0A 1SDXA 3GXAA 1S9TA 5I7IA 4HE1A 2XD3A 3MUQA 2I58A 3N6TA 4DLDA 4GRKA 3ILUB 4ELRA 1VFEA 3MVXA 1UTHA 2PX1A 4ESWA 4KYEA 5FTHA 4OVTA 1NNTA 5FHMA 3N26A 2H99A 2UVIA 2FIEA 4FBPA 4OFJA 1A7LA 3KN7A 5I2NB 2VT5A 4DXCA 4KD5A 2XWIA 4PE3A 1PB9A 4C0RA 4PBHA 4F29A 2OBGA 1LB9A 1XHYA 1SBPA 3KOSA 3CHGA 2VD2A 2O69A 4BDMA 2WKYA 4GLIA 1I6AA 3V83A 1MY1A 3PPPA 3SDFA 2VHAA 4TLMB 1N84A 4PGPA 4O3BA 1KZ8A 2I3WA 5A5XA 1KA0A 2ALUA 3IJOB 5I58A 2UVHA 2WOLA 4MBPA 2GHAA 4K3FA 3C36A 2D21A 2XXHA 2WOKA 4ZEKA 2W7YA 3OO9A 4POWA 2O51A 1P1WA 3DLNA 2R8TA 4P1LA 4TOZA 1JW1A 1N04A 3SEWA 4KYSA 2P0SA 3PPQA 3V5AA 5JEIA 1GTKA 4U2RA 2IEEA 3TQLA 2X7QA 4PF6A 4I3EA 1HSLA 3ROJA 3HHGA 2DWAA 4QFPA 1IXIA 2XX7A 1WVJA 2DYXA 2ZXTA 5ET8A 2O6AA 1NH8A 3PMXA 5AA1A 3ODBA 1IIWA 3IL1B 5EHSA 3U72A 1SQYA 1GGGA 2UVGA 1IITA 3KZGA 4NQ8A 2HZLA 2H4IA 4NEDA 3HHFA 3OXNA 1NUWA 3VVEA 3VE1B 2XA5A 4RNSA 1Y9UA 4L17A 2A5SA 4YB7A 2CEXA 4GF8A 1WDNA 1MPDA 2PBWA 1UQWA 1LFIA 2V84A 4MCOA 1NUYA 3RQTA 1EZOA 4OVJA 4U1ZA 5EQ8A 5I56B 1B4HA 1Y20A 5DVIA 3S2VA 5AA3A 3RYAA 4GL0A 5CMCA 1QGXA 2OX3A 3QAXA 1BIYA 4YKKA 3THIA 4MMPA 1B4ZA 3K6XA 2ONKE 3E9XA 4YMAA 3B6WA 1INPA 3MYUA 1I6QA 3ZKKA 4P3LA 4F2QA 3PMVA 4JB7A 5TPAA 4DZ1A 2DOJA 3CFLA 5I56A 3R26A 3OO7A 3PPRA 3KSXA 3D4GA 5CMBA 4R2BA 2DE3A 2CMOA 4GXSB 3UK4A 4DI4B 1HSEA 1LBBA 5ITPA 4FAJA 1RYXA 4EQ7A 4LONB 3QXMA 3A09A 1NNKA 1OLAA 5EQAA 3TTLA 2RF1A 3RPLB 4PAIA 3QMFA 1LFGA 3KC1A 4ZS9A 2VOZA 4XKNA 1SD3A 5K2XA 1H3DA 1FBEA 1Q35A 4LQ2A 3CG1A 2JJKA 2XX9A 1SW1A 1UIUA 3DRFA 4PTKA 4F1VA 4OHNA 5M2VA 3PTYA 4LQ5A 3QK6A 2L5VA 1A99A 2YPNA 5EQ9A 1SI1A 1QW0A 3LUYA 3O9PA 3V89B 3PMWA 4OEVA 3OENA 2QMXA 1FQAA 3O66A 3M8UA 4AS4A 3MZBA 4PAFA 4OXVA 1FQBA 4AQ4A 4PFYA 2BJJX 3LSFB 3MP8A 5A5XB 2Y5KA 3G3GA 1YXIA 4BDNA 4M1VA 3TTRA 4MNIA 5ET5A 1SVXB 4MNPA 2PFZA 4YB5A 1FSAA 1BTJA 3IX1A 4KQPA 2G29A 3I3VA 1NL5A 4MNCA 4ELPA 4NE4A 4R9GA 2V4CA 3U8QA 4N8GA 3PUXE 3VXCA 4ZE9A 2ZZWA 5IAIA 4NG7A 5J16A 2OLBA 3O6IA 4PFWA 2QL3A 4H5GA 1OVTA 4POXA 3FVNA 2Z8DA 4N6DA 2I6EA 4ESXA 3DRJA 4HCYA 3H6VA 4P47A 3IAZA 3RTWB 2WBBA 4F3SA 5KDTB 1FW0A 5EYHA 1MY2A 4WEPA 1SYIA 1AWBA 3ZS6A 3EHSA 5I58B 2HQ0A 5L9OA 2A5TA 4NAPA 2V3UA 4XXUA 4DIGA 1QULA 1QKAA 1SPIA 4PF8A 1B5JA 4AS5A 2FYIA 4HW8A 2Q88A 4PP0A 3GBAA 2XXXA 3UIFA 3TEPA 5ESYA 1FQEA 2ZMBA 3VLVA 1RDXA 3FATA 4MAGA 1FQFA 5BWJA 1OQGA 1QUIA 4RXLA 1AOVA 1MXUA 2Y84A 2F34A 4QBAA 1NV3A 5J1DA 5CMMA 4O7MA 4N13A 3TTNA 4WEDA 4IO6A 4F3GA 3MAMA 2AL5A 5F1QA 4BDOA 1AIVA 1QUKA 1G0HA 1VR5A 2FIXA 1N76A 3OSQA 1EYJA 4F3PA 1OLCA 5ICTA 2B4MA 1JVXA 1TT1A 4U4SA 2F3BA 2O7UA 3TMGA 2V93A 1B58A 2DVZA 3CSBA 4U1OA 3FJMA 1NNPA 3FVKA 4FJPA 3K02A 2FHYA 2Q89A 4HS7A 3SESA 1D3KA 4KYDA 4U22A 4YU0A 1ZIUA 2XXTA 3WAFA 1EZPA 3DP4A 4THIA 4KCDA 1RKMA 1BLFA 1FPLA 1P1NA 5ISUA 4GXAA 1XVXA 3UORA 4NHBA 3CVGA 3H6UA 1YCJA 1UTBA 2H98A 1MM7A 1MQJA 2I48A 2QS4A 2LAOA 3MJNA 2PFYA 3D1RA 4FECA 2RCBA 2OJTA 2GFEA 2R6GE 4UACA 3W9VA 3CRBA 5I59B 5IZZA 2PT2A 2I4BA 4PAKA 3EF7A 4G8NA 2ZNSA 4I40A 2F78A 1MQGA 1Z7ME 3W9WA 3V8XB 4MHFA 1LAXA 3OD7A 3IORA 3PUWE 4U4XA 1FPFA 1GV8A 5AA2A 5FHOA 1D9VA 3K0VA 1B3GA 4OVRA 3E3KA 3PGFA 1IEJA 2VP1A 1J1NA 2WEFA 3K6VA 4YKPA 1Y3QA 4DI3D 3DRKA 2XWKA 3EQ1A 1H45A 4P9KA 3OMBA 4XKPA 3MPLA 4NWCA 4ZEDA 3Q26A 5I57B 4F18A 5H8HA 3VLUA 4G61A 1P99A 2XXQA 1WODA 2F35A 1FQCA 1P1OA 2UVJA 1POY1 4I9DA 3RNNA 3TCFA 4GWXA 3FVGA 4I3YA 4IY5A 1NFTA 4PDHA 2B3BA 3D4CA 4NF6B 4DXUA 1SI0A 2QS3A 4HE2A 1II5A 2PMSA 1R9LA 1NUXA 4XIGQ 4FATA 1YYZA 4PDDA 2HPGA 2QSXA 1UTHB 4R74A 3BIHA 3LR1A 3ISPA 5FHNA 5AA4B 1B46A 2I0CA 4ZEBA 1B3LA 3A3UA 2CZLA 4YKIA 1DOTA 1F9BA 2UYFA 4QSEA 3KOTA 3SEXA 4ZEIA 3RUMA 4GD5A 2VPNA 3C4MA 2F7BA 2M8CA 3ZKLA 3EKIA 1R6ZA 3T22A 3G3JA 3BBRA 4HXVA 5I2KA 2THIA 4PBQA 1EH3A 3GLBA 2Y7RA 3TCHA 1MDQA 1B7ZA 4XF5A 4KXPA 1XT8A 3H7MA 1MXXA 1BP5A 3CIJA 3IO6A 2Z22A 3S9NC 4NF5A 1PBQA 2XWOA 2KLFA 4P56A 4N81A 2Q8JA 4ONYA 2AYSA 2DE2A 4GX3A 2CZKA 5IM2A 2DVCA 2OWSA 5ET6A 1SW4A 4R73A 1MRPA 4R6YA 3IK6B 2O1LA 3K6WA 4OETA 1PB7A 1QVSA 3FXBA 4JBZA 4H8JA 2F97A 1K9ZA 3B50A 3DELB 2O68A 5IZ3A 3I6VA 3SZPA 3B7DA 4RYAA 2F36A 5HPQA 3FXRA 1FRPA 4H45A 5JTYB 2HFBA 1YTVA 4GBWA 5EYFA 4H46A 2O1MA 4EXKA 1FBDA 5HM4B 3FIRA 5H8FB 2HXRA 3JV9A 2QVUA 2DE4A 2OZZA 1N7WA 3OELA 4OWDA 4EQ9A 1B3FA 3L6GA 3PD9A 4N07A 3OEKA 4GIZA 1B6HA 2RC8A 4OFOA 4NX1A 1DBZA 4G8MA 4FIMA 2DXYA 2HEUA 1Q9DA 3TQWA 3FXQA 2X7PA 5IKBA 4I1DA 2FNCA 4QSCA 2CZIA 1PEBA 3T1BA 1P1QA 1KWHA 3RT8A 1MPCA 4ECFA 4GWOA 1L5TA 5ITOA 1LEVA 2H9BA 4KCCA 1MQIA 1DPPA 1DSNA 4NGUA 5TP9A 5I5PA 3ONMA 5ET7A 1MS7A 4KR5A 2OK2A 3S9LC 5AA2B 3IJXB 3KGCA 1FJ6A 1TFAA 3KG2A 3TCGA 1M5FA 1NV5A 5IZ1A 4GBVA 2DSFA 4MLQA 2WOPA 3DM0A 3F11A 4F1UA 2ZNUA 3RLFE 4OESA 4BLAA 1RYOA 1IXCA 2XD2A 1ZMGA 4MFIA 1MM6A 2V25A 4KPTA 1NV4A 4NMYA 1OVBA 2XXYA 3A3CA 3CR9A 4BDQA 4X9TA 3BKIB 3K00A 1YAEA 3MWBA 3BFUA 3TTMA 5LOMA 3MW0A 1AH5A 3QUJA 2I4CA 4C1TA 3KEIA 5L9SA 2DP8A 2QJEA 1MY3A 5F24A 2MKZA 4F22A 3LVUA 5AA4A 4ZZEA 5ELVA 2HHMA 3O6PA 3LC8A 4R9FA 4N6KA 2HCAA 3GBBA 2F3DA 1H43A 4NF4B 3IOVA 3PUYE 1LSTA 4RA1A 1URGA 2QVVA 4Z0IA 3AXFA 4OVSA 2E1SA 3ECRA 3T0JA 4PE5B 4YICA 5B70A 2O84X 1LAFE 3IR1A 4LZ8A 3N5LA 2Y5LA 3NOHA 1NV0A 4N17A 3LV0A 2WYPA 2Z23A 4JVCA 5CM6A 4U21A 1LBXA 4BDRA 3O2AA 4ZE8A 1AL3A 2GH9A 2CEYA 1A40A 3FV2A 4FORA 1OIBA 2XXUA 4PQJA 5HBCA 3HCQA 3A29A 3EHTA 1N3XA 3PPOA 1FJ9A 3G3IA 5T3JA 1NV6A 1FPDA 4R6HA 3FJ7A 3H4ZA 4DE8A 5TPAB 3G3KA 3TYHA 1NNFA 3FTOA 3MQ9A 5I3SA 3PUZE 3LSLA 1AMFA 1B40A 1XC1A 1JW4A 1LBWA 3DP6A 5JK4A 2O7IA 1RDYA 1TXFA 3P7IA 1B5HA 1TWYA 1B7UA 4NF6A 4R72A 4QFLA 3MP1A 4MH5A 2XXIA 4TLLB 4YAHX 2HAVA 1Y1MA 1MXYA 4JVDA 4X48A 4DCXA 3KBRA 3TDJA 5KCJB 5TP9B 3OOAA 5DT6A 2VD3A 1B0LA 3M3KA 3OEMA 4OZ9A 3K1PA 5I59A 3MZ9A 1SW5A 1S50A 2Z8EA 4OANA 4H6DA 2H5YA 2I49A 4GWUA 2DS9A 2IA4A 1H76A 3QIMA 3KJTA 1FCKA 4E0XA 4OEUA 3LUZA 4NF8B 2FBPA 3H6TA 3UP9A 1ZKBA 2I3VA 4NTLA 4GWSA 1PB8A 1Y3PA 3G3FA 2ZZXA 2Q9TA 3RY3A 1IZ1A 3VDFA 2RC9A 1LBCA 4EF1A 2FVZA 1DTGA 2B4LA 1B3EA 3IB0A 1A54A 3T66A 1FBHA 4PCDA 2XXRA 3K1NA 3IB1A 4FEDA 4UABA 5EYGA 3G7WA 3MVZA 4IB2A 4ZDMA 4KHZE 4IO7A 3U65A 5F7VA 2QVRA 2PVUA 1A8FA 1FPGA 1S7YA 5I2NA 4I62A 4LATA 5DTBA 1B52A 3QUFA 3SEVA 1B1XA 3EPEA 4OVQA 4QRZA 3FXUA 1OMPA 4IO2A 5BUUA 4F31B 4GX4A 4QXDA 1DTZA 2PCRA 4XKRA 2UYEA 1Q1KA 1B3HA 2CZHA 2F8DA 3CFXA 2G93A 2DWHA 1RDZA 2DXRA 1FBCA 3K1MA 4OTEA 1FBPA 1USYE 3IO4A 1BK4A 4GQOA 1IMAA 1FQDA 2ONSA 3PPNA 1LB8A 3MP6A 1FBFA 1GR2A 4P0IA 4YMBA 3IOUA 3T93B 4GWWA 1UTBB 1H44A 3SEUA 4XEQA 1N3WA 4JVIA 1ZBMA 1Y4CA 2R9JA 4OFLA 3KJ7A 3PD8A 3C31A 2XWVA 5KZTA 3C9HA 3B6QA 3K6UA 5DEXA 2XXWA 2KR0A 1FBGA 4NF0A 2ZYKA 3I5OA 3MSTA 3RPWA 1Z7NE 4ZZAA 4QFOA 3KSJA 2Y7KA 2P3VA 2F7AA 5I2KB 4F39A 4OYVA 3DRHA 3IOWA 4MX6A 3HO7A 4P1EA 1LFHA 3H06B 3CSGA 2V3QA 4XFEA 3T9UA 2ANJA 1MQDA 3FJGA 4R6KA 5CI5A 3EHUA 5I84A 2RINA 4H5FA 2YJPA 3LSWA 4RY1A 1P1UA 1O7TA 5H8HB 1FPBA 4N6PA 4IO5A 1LGBC 1FTAA 3O6HA 1EYIA 4EUOA 4I8CA 1CE2A 3B6TA 3S9MC 1URDA 3KFMA 3C33A 2HAUA 4RK2A 2Q74A 4IGTA 4X04A 5L8DA 4U23A 4JSDA 3IB2A 5CRYA 1T0KA 3RN8A 1EZ9A 3U92A 1G0IA 2PT1A 1XS5A 3TELA 4KFQA 2F7CA 5FTIA 1EYKA 3Q29A 4QFKA 4G68B 4MIJA 4G68C 2OWTA 5DW8A 1SW2A 1LBYA 3VLWA 4JWOA 3DRGA 3JZJA 3HSTA 4NF4A 3RTFB 2GQ1A 4H8IA 3RT6B 1MXZA 3QYTA 1B2HA 1LAGE 5KDTA 2WX9A 5EHMA 1GVCA 3R7XA 3UA8A 2V3TA 5L9MA 3RGYA 4GOTA 4HE0A 3TZAA 1NV7A 1DPEA 4NWDA 2ONRA 2ZYNA 3N6UA 1UIVA 4ND9A 1PBPA 1MY0A 2GHBA 4N8YA 3K01A 2XXPA 2OCUA 4NF5B 3O29A 1JQFA 1DK4A 1M5CA 1B51A 2I0BA 4OA4A 1IMDA 4R2FA 3KBZA 1XI6A 1LCFA 4E0WA 1MG1A 1DCUA 2REGA 2GRVA 3UGWA 4OMBA 3IFAA 3QSLA 3MC2A 4RK9A 3U1OA 1FPEA 4MF3A 4O94A 3W15C 2VPOA 1IMEA 3GYYA 3KN3A 4N15A 4H65A 2P2AA 1NKXA 3TKDA 1FTLA 3K2DA 3RYDA 3OO8A 4IO4A 4PFIA 3ZSFA 1VSOA 1TFDA 1N0TA 3R6UA 4GWZA 4YKJA 1OQHA 4FE8A 3KC0A 2D3IA 3S4UA 4UA8A 5KCJA 3HFUA 4P11A 3Q27A 5LDZA 3BIGA 1MXWA 1DMBA 1XVYA 5JTYA 4NN3A 1ANFA 1ZTYA 4P8BA 4JXIA 4HTGA 2NOOA 4O8MA 5H8SA 2Z8FA 4Q8RA 1JEVA 3BFTA 1POTA 2P3NA 3PU5A 2XHDA 1IMBA 1FPIA 4PFTA 4JDFA 3H3GA 1JNFA 1MPBA 5H8NB 3O28A 4FEBA 1IMCA 5H8QB 3WAEA 3EN3A 1IXHA 3SERA 3E79A 2E0SA 3GZGA 4XKQA 3SETA 4PFBA 3TFLA 3FZVA 1ZLQA 1D4NA 1Y1ZA 1CB6A 3E4RA 5IGAA 1ATGA 1IUDA 2Y7WA 3SEYA 4ZECA 3MBPA 1Y3NA 4N91A 1B7HA 2ESNA 3IOTA 4LVQA 5AA2D 2QS1A 1ZU0A 4ISUA 3HN0A 4MEVA 3CG3A 2F6PA 2YLNA 3KN8A 2NWJA 3Q28A 4H1XA 3VV5A 4DXBA 1LBVA 2OWZA 3M3LA 4M4GA 2REJA 1VDWA 1Y4TA 2AL4A 2ZNTA 2Q2CA 4LUBA 4XTCQ 4OENA 4QHQA 3VFJA 2XXKA 5CBRA 1LBZA 4X1BA 3U94A 2DWIA 3FD3A 4DCYA 1M5EA 3OO6A 2NVUB 3S9EA 2ABHA 3VVDA 4TQUQ 1N7XA 1USYH 2DWJA 3T9XB 2RKMA 4P0GA 2R71A 3H6WA 4O3AA 3C32A 1FTJA 3FUZA 4X8RA 2B3FA 1US4A 3MZ1A 3IFCA 1D9YA 2F5XA 2ZYOA 4PFRA 1I6BA 3FV1A 4QSDA 1B05A 3N94A 4PC9A 4F19A 1MDP1 2H25A 2Y7IA 1IXGA 4PETA 3Q25A 3TODA 3FVOA 1JP4A 2QRYA 4F3BA 2XX8A 4YB6A 4F2OA 4AB5A 4GVOA 2DDKA 4BDLA 4H67A 2NUVA 1IQ7A 4C1UA 2B65A 1MXVA 3PAMA 3U93A 4IGRA 1LAHE 1NUZA 1JEUA 4G68A 3M3FA 1NI9A 4KI0E 4X1DA 1PC3A 1A55A 2ZZVA 4RPNA 4F1YA 4O3CA 3UN6A 4QF9A 1JVYA 3G3HA 5CC2A 1CNQA 1NMUA 4LA9A 1NV2A 2QMWA 5A5LA 1B32A 3T9VA 1VE4A 1M5DA 2RC7A 4HCWA 1MH4A 4ELQA 4GFRA 1O64A 1LLSA 3HPIA 1O63A 4WXJA 1R9QA 3MVYA 2HXWA 3HV1A 5IZ3B 3LSXA 1MQHA 1FPKA 3E13X 4EXLA 3FASA 2QFLA 2XXVA 1QKBA 3E78A 5H8FA 4RPOA 1ELJA 5AE4A 1US5A 2DQVA 4Q0CA 3SKPA 4EF2A 3DP8A 4OQOA 5ICQA 3FBPA 4GL8A 5I57A 4PGNA 4N4UA 3RYBA 1B0HA 1M5BA 5EQ7A 4EDPA 1JETA 4AB6A 2Q8MA 5DVJA 4LZ7A 1ZJLA 3O97A 5DEXB 1IMFA 5DYHA 2F6GA 3TPAA 4IR8A 5H8QA 3USDA 2Q2AA 4LP2B 4JWYA 4OERA 4GX6A 3DRIA 3ILTB 1MH3A 3CFZA 4O7IA 5DVFA 3K4UA 4LN5A 1QJMA 4NF8A 2NXOA 4MLVA 3H03A 3MVWA 1YPNA 3PUVE 2VGQA 2QS2A 4G8HA 1FTKA 1YZ0A 2A5TB 2X26A 1FTOA 1D9QA 4G2ZA 4G77A 2WBDA 4RJZA 5CBSA 4H0WA 2D5WA 2RCAA 2FA7A 5CMKA 1B1HA 2WYKA 3TUSA 3OSRA 3L6HA 1NH7A 1I69A 2ZYMA 2HZKA 5FBPA 1KA1A 4R75A 5K2YA 1B5IA 1HSJA 3LBSA 4Q30B 1LCTA 1A8EA 3CI8A 1JW5A 2AIXA 4G4PA 5LTCA 5H8NA 4WKMA 3O6GA 2UXAA 4ZEFA 3T96B 1K9YA 3TAJA 1SYHA 2P1SA 4Z7EA 3RPLA 1MY4A 4GWYA 4EQBA 1FTMA 1VFDA 2Y7PA 3TTKA 3MPKA 2KQZA 1PDAA 1QUJA 4YZZA 4Q5TA 3VVFA 1NV1A 4OVPA 2QPQA 4LZ5A 4DDDA 3FGSA 4JWXA 5B7DA 1URSA 3VXBA 3JYRA 1BKAA 1R1NA 1EU8A 3T9HB 4JSOA 1XOCA 2PYYA 3B8BA 4ELOA 3PV0E 4QFNA 3C34A 4PFUA 2BJIA 1FPJA 3C35A
chains in the Genus database with same CATH topology
3PUYE 1LSTA 1VSOA 4IO3A 1AIVA 4RA1A 1TFDA 1QUKA 1B9JA 1N0TA 1URGA 4Z0IA 3R6UA 4IY6A 3AXFA 5TU0A 1SDXA 3GXAA 1VR5A 1S9TA 4YKJA 1N76A 3OSQA 2XD3A 2E1SA 3MUQA 4F3PA 1OLCA 2I58A 3N6TA 1OQHA 4H67A 4FE8A 5ICTA 2B4MA 1JVXA 4DLDA 1TT1A 2D3IA 3ECRA 4U4SA 4GRKA 3S4UA 4PE5B 4YICA 3ILUB 2O84X 1VFEA 4UA8A 4ELRA 5B70A 5KCJA 1LAFE 3MVXA 1UTHA 2PX1A 3IR1A 4LZ8A 4P11A 2O7UA 3Q27A 3N5LA 4KYEA 3TMGA 2V93A 1B58A 1MXWA 1DMBA 1XVYA 2DVZA 3CSBA 5FTHA 4U1OA 2Z23A 1NNPA 3FJMA 5JTYA 1ANFA 5CM6A 1ZTYA 1NNTA 5FHMA 3N26A 4U21A 3FVKA 4FJPA 3K02A 4JXIA 2H99A 3O2AA 4ZE8A 2UVIA 2Q89A 1AL3A 4HTGA 4BDRA 2NOOA 4HS7A 5H8SA 3SESA 4OFJA 1D3KA 2Z8FA 4Q8RA 4KYDA 1JEVA 2GH9A 3BFTA 4U22A 4YU0A 1A40A 1ZIUA 2XXTA 1POTA 1A7LA 3WAFA 1EZPA 3KN7A 3DP4A 3PU5A 3FV2A 4THIA 2XHDA 5I2NB 4FORA 4DXCA 4KD5A 4KCDA 4PFTA 1RKMA 1PB9A 1BLFA 4C0RA 1OIBA 4JDFA 4F29A 2XXUA 2OBGA 1LB9A 3H3GA 1XHYA 1SBPA 1P1NA 5ISUA 3KOSA 1JNFA 4GXAA 4PQJA 1XVXA 5HBCA 1MPBA 5H8NB 3CHGA 3UORA 3HCQA 2VD2A 2O69A 3O28A 3EHTA 3CVGA 4BDMA 4FEBA 3H6UA 1YCJA 1N3XA 1UTBA 2H98A 2WKYA 3PPOA 1MM7A 1MQJA 4GLIA 3G3IA 5H8QB 1I6AA 3WAEA 3V83A 4R6HA 2I48A 3EN3A 1MY1A 1IXHA 2QS4A 2LAOA 3FJ7A 3SERA 3H4ZA 4DE8A 3PPPA 3G3KA 5TPAB 3TYHA 2E0SA 1NNFA 3GZGA 3FTOA 3SDFA 3MQ9A 3MJNA 2VHAA 3PUZE 3LSLA 4TLMB 1AMFA 1N84A 1B40A 4XKQA 1XC1A 1JW4A 4FECA 4O3BA 3SETA 2RCBA 2OJTA 3DP6A 3TFLA 2O7IA 2I3WA 5A5XA 5JK4A 2GFEA 2R6GE 3FZVA 1TXFA 3P7IA 4UACA 2ALUA 3CRBA 3W9VA 1B5HA 3IJOB 5I59B 5I58A 1TWYA 1B7UA 4NF6A 2UVHA 4R72A 1ZLQA 2WOLA 4QFLA 4MBPA 3MP1A 2PT2A 1D4NA 2I4BA 1Y1ZA 2GHAA 1CB6A 3E4RA 4K3FA 4MH5A 1ATGA 2XXIA 3C36A 2D21A 4TLLB 4YAHX 2HAVA 3EF7A 4G8NA 2XXHA 1IUDA 1Y1MA 2WOKA 1MXYA 2Y7WA 4ZECA 2ZNSA 5K2XA 4ZEKA 3SEYA 2W7YA 3OO9A 3MBPA 4X48A 4DCXA 1Y3NA 4POWA 3KBRA 1B7HA 2ESNA 3TDJA 5KCJB 3IOTA 4LVQA 5TP9B 2O51A 3OOAA 1P1WA 3DLNA 5DT6A 2F78A 1MQGA 2VD3A 5AA2D 1B0LA 2QS1A 1ZU0A 1Z7ME 4ESWA 4ISUA 4TOZA 1JW1A 1N04A 3HN0A 3M3KA 3SEWA 3CG3A 3OEMA 4KYSA 3V8XB 3W9WA 4OZ9A 1LAXA 3OD7A 3IORA 2F6PA 3K1PA 3PUWE 5I59A 2YLNA 2P0SA 3PPQA 3V5AA 4U4XA 3KN8A 2NWJA 4EF2A 3MZ9A 1SW5A 5JEIA 3Q28A 4H1XA 1GTKA 4U2RA 1GV8A 5AA2A 1S50A 3VV5A 2Z8EA 2IEEA 5FHOA 1D9VA 4H6DA 2H5YA 2X7QA 1B3GA 2I49A 3K0VA 3TQLA 2DS9A 3E3KA 3PGFA 1HSLA 2IA4A 1H76A 3M3LA 4M4GA 3QIMA 1IEJA 2VP1A 3KJTA 1J1NA 2REJA 3K6VA 4YKPA 1FCKA 3HHGA 4E0XA 4OEUA 1Y3QA 2DWAA 4QFPA 1IXIA 2XX7A 4NF8B 1Y4TA 3DRKA 2AL4A 2ZNTA 1H45A 2Q2CA 1WVJA 2DYXA 4XKPA 2ZXTA 3EQ1A 3H6TA 3OMBA 4LUBA 4OENA 1ZKBA 3MPLA 2O6AA 4NWCA 4QHQA 3UP9A 4ZEDA 2I3VA 3VFJA 3Q26A 1NH8A 4NTLA 5CBRA 1PB8A 5I57B 3PMXA 5AA1A 3ODBA 4F18A 4X1BA 1Y3PA 1IIWA 3U94A 3G3FA 5H8HA 3IL1B 2DWIA 3VLUA 1P99A 3FD3A 2Q9TA 4DCYA 5EHSA 1M5EA 1GGGA 1SQYA 2UVGA 3RY3A 2XXQA 1IITA 1IZ1A 1WODA 3OO6A 2NVUB 3S9EA 2F35A 2ABHA 1FQCA 1P1OA 2UVJA 3KZGA 1POY1 3VVDA 2HZLA 4I9DA 2H4IA 4NEDA 4TQUQ 3HHFA 3OXNA 1N7XA 1LBCA 1USYH 2DWJA 2RC9A 3RNNA 3VDFA 3VVEA 3T9XB 4EF1A 3TCFA 1DTGA 3FVGA 3VE1B 2B4LA 2RKMA 1B3EA 4IY5A 1NFTA 3IB0A 4P0GA 4RNSA 1Y9UA 2R71A 3H6WA 4O3AA 4L17A 2B3BA 2A5SA 3C32A 1FTJA 3FUZA 3D4CA 4NF6B 4YB7A 2B3FA 4GF8A 1A54A 1WDNA 3T66A 4DXUA 1US4A 1MPDA 1SI0A 2PBWA 3MZ1A 1UQWA 2XXRA 2QS3A 1LFIA 3K1NA 3IB1A 4FEDA 1II5A 2PMSA 1R9LA 2V84A 4XTCQ 4XIGQ 3G7WA 4FATA 3MVZA 3RQTA 1D9YA 2F5XA 1EZOA 4OVJA 4U1ZA 4IB2A 2QSXA 2ZYOA 4ZDMA 5I56B 1B4HA 1Y20A 1UTHB 4KHZE 4IO7A 4R74A 5DVIA 5F7VA 3S2VA 1I6BA 3FV1A 4QSDA 1B05A 3RYAA 3N94A 4F19A 2PVUA 4GL0A 1A8FA 5CMCA 1MDP1 2H25A 2Y7IA 1S7YA 1IXGA 4PETA 4I62A 3LR1A 5I2NA 3Q25A 5FHNA 5AA4B 1B46A 3TODA 4LATA 3FVOA 5DTBA 1B52A 3QUFA 3QAXA 3SEVA 1B1XA 1BIYA 3EPEA 4QRZA 2I0CA 4YKKA 3FXUA 1OMPA 2QRYA 4ZEBA 4IO2A 5BUUA 4F3BA 4F31B 3THIA 2XX8A 1B3LA 4YB6A 3A3UA 4F2OA 2CZLA 4AB5A 4YKIA 4GVOA 1B4ZA 3K6XA 1DOTA 1DTZA 2ONKE 4BDLA 4XKRA 1F9BA 2NUVA 2UYFA 1IQ7A 1Q1KA 2UYEA 3B6WA 2B65A 3E9XA 3KOTA 1MXVA 1B3HA 4QSEA 3SEXA 4ZEIA 1I6QA 3PAMA 3RUMA 4GD5A 3U93A 3ZKKA 2F8DA 3C4MA 4IGRA 3CFXA 2F7BA 2DWHA 2G93A 2M8CA 3ZKLA 1LAHE 4DXBA 4F2QA 3PMVA 4JB7A 5TPAA 1R6ZA 1JEUA 4G68A 3M3FA 4DZ1A 2DOJA 2DXRA 3CFLA 3T22A 3G3JA 5I56A 3K1MA 3BBRA 4KI0E 4X1DA 1PC3A 4OTEA 1A55A 3R26A 5I2KA 3OO7A 2THIA 3PPRA 1USYE 3IO4A 1EH3A 4GQOA 4Q0CA 4RPNA 4F1YA 1FQDA 2ONSA 3GLBA 3D4GA 3KSXA 3PPNA 2Y7RA 4O3CA 5CMBA 1LB8A 3UN6A 3TCHA 4QF9A 1MDQA 1B7ZA 3MP6A 4R2BA 1JVYA 3G3HA 1XT8A 3H7MA 2DE3A 5CC2A 1MXXA 1BP5A 2CMOA 1NMUA 3CIJA 4GXSB 3IO6A 4LA9A 2Z22A 3UK4A 1HSEA 1GR2A 1LBBA 5ITPA 4FAJA 1RYXA 4EQ7A 4LONB 3S9NC 3QXMA 4NF5A 2QMWA 4P0IA 3A09A 1B32A 3T9VA 4YMBA 3IOUA 1PBQA 1VE4A 1M5DA 2RC7A 4HCWA 3T93B 1MH4A 1NNKA 1UTBB 4ELQA 2KLFA 1H44A 1OLAA 4GFRA 2Q8JA 3SEUA 1O64A 4ONYA 2AYSA 2DE2A 3TTLA 1LLSA 2RF1A 1N3WA 1LFGA 1ZBMA 1O63A 1Y4CA 3HPIA 5DYHA 2R9JA 4ZS9A 2DVCA 2OWSA 4OFLA 3KJ7A 2VOZA 4XKNA 1SW4A 3PD8A 4R73A 4WXJA 1R9QA 3MVYA 1SD3A 1MRPA 3C31A 2HXWA 5KZTA 3HV1A 4R6YA 3IK6B 2O1LA 1MQHA 3B6QA 4OETA 1H3DA 1PB7A 3C9HA 3E13X 1Q35A 3K6UA 3K6WA 1QVSA 5DEXA 4EXLA 4LQ2A 3FASA 2XXWA 3CG1A 4H8JA 4JBZA 2XX9A 2F97A 2XXVA 1QKBA 1SW1A 3I5OA 2ZYKA 5H8FA 4RPOA 1UIUA 3DRFA 4F1VA 3DELB 2O68A 1ELJA 4OHNA 5AE4A 1US5A 3I6VA 3RPWA 1Z7NE 5M2VA 4ZZAA 3B7DA 2DQVA 4RYAA 2F36A 5HPQA 4LQ5A 3QK6A 3FXRA 4QFOA 3KSJA 2HFBA 2Y7KA 3DP8A 5ICQA 1A99A 2YPNA 4OQOA 1YTVA 5JTYB 1SI1A 2F7AA 5I2KB 4F39A 4GL8A 4OYVA 3DRHA 5EYFA 5I57A 3IOWA 1QW0A 2O1MA 4EXKA 3HO7A 3RYBA 1B0HA 5HM4B 1M5BA 3LUYA 4EDPA 1LFHA 3H06B 1JETA 4AB6A 3O9PA 3V89B 3PMWA 4OEVA 3CSGA 3FIRA 5H8FB 3OENA 5DVJA 4LZ7A 1ZJLA 3O97A 2V3QA 5DEXB 3T9UA 2ANJA 2QMXA 3JV9A 4C1UA 1MQDA 2F6GA 3FJGA 3TPAA 1FQAA 2DE4A 2OZZA 3EHUA 3O66A 4R6KA 5CI5A 4NF4B 3M8UA 3MZBA 1N7WA 3OELA 5I84A 2RINA 4H5FA 2YJPA 4OWDA 3LSWA 5H8QA 2Q2AA 4LP2B 1B3FA 4OXVA 4RY1A 3USDA 3L6GA 1FQBA 3PD9A 4EQ9A 1P1UA 4N07A 3OEKA 1O7TA 4OERA 4GIZA 1B6HA 2RC8A 4JWYA 5H8HB 4OFOA 4AQ4A 3DRIA 4G8MA 4N6PA 3ILTB 4IO5A 1LGBC 4FIMA 1MH3A 3CFZA 4PFYA 2BJJX 3LSFB 3O6HA 4EUOA 5DVFA 2DXYA 4I8CA 2HEUA 3K4UA 3TQWA 1CE2A 3B6TA 3S9MC 3MP8A 1URDA 3FXQA 5A5XB 1QJMA 2X7PA 3G3GA 3KFMA 3C33A 4NF8A 5IKBA 2HAUA 2NXOA 4BDNA 4I1DA 2FNCA 4QSCA 4MLVA 3H03A 4RK2A 3MVWA 1PEBA 4M1VA 1YPNA 3TTRA 1P1QA 4IGTA 3PUVE 1SVXB 1KWHA 3RT8A 2VGQA 1MPCA 2QS2A 5L8DA 1FTKA 4G8HA 4GWOA 4U23A 4JSDA 1L5TA 4ECFA 4YB5A 3IB2A 1BTJA 3IX1A 5CRYA 4KQPA 5ITOA 2A5TB 3RN8A 2X26A 1T0KA 1FTOA 2G29A 3I3VA 1NL5A 1EZ9A 4G2ZA 4ELPA 3TEPA 4G77A 2PT1A 3U92A 1XS5A 4NE4A 4RJZA 5CBSA 2H9BA 4R9GA 4H0WA 4KCCA 3SKPA 3TELA 4KFQA 1MQIA 2F7CA 2D5WA 1DPPA 1DSNA 2FA7A 2RCAA 3U8QA 5CMKA 3PUXE 3VXCA 5TP9A 5FTIA 1B1HA 4ZE9A 3TUSA 3OSRA 3Q29A 5IAIA 4QFKA 3ONMA 4G68B 2OLBA 3L6HA 3O6IA 4G68C 1NH7A 1MS7A 2OWTA 1SW2A 4KR5A 2OK2A 5AA3A 1I69A 3VLWA 4PFWA 2QL3A 4H5GA 5AA2B 2ZYMA 2HZKA 3S9LC 1OVTA 4POXA 3IJXB 4JWOA 3KGCA 4R75A 5K2YA 1B5IA 1HSJA 3LBSA 3LSXA 1LCTA 1TFAA 3DRGA 4Q30B 3KG2A 1A8EA 3CI8A 3FVNA 3TCGA 1M5FA 1JW5A 3HSTA 3JZJA 4NF4A 3RTFB 2Z8DA 2AIXA 4H8IA 4G4PA 3RT6B 1MXZA 3QYTA 1B2HA 2DSFA 1LAGE 5H8NA 4WKMA 3O6GA 5KDTA 2I6EA 5EHMA 4ESXA 2UXAA 3DRJA 4HCYA 1GVCA 3H6VA 4MLQA 2WOPA 4ZEFA 3DM0A 3R7XA 3F11A 3T96B 3IAZA 3RTWB 4F1UA 3UA8A 2ZNUA 2V3TA 5L9MA 1SYHA 2P1SA 3RLFE 3TAJA 4OESA 4BLAA 4F3SA 1RYOA 3RGYA 4Z7EA 1IXCA 2XD2A 5KDTB 1FW0A 1ZMGA 4GOTA 4MFIA 3TZAA 1DPEA 1MY2A 4NWDA 2ONRA 1MY4A 1SYIA 2ZYNA 4WEPA 3N6UA 1MM6A 1UIVA 4EQBA 1FTMA 3ZS6A 3EHSA 4ND9A 1VFDA 2V25A 2Y7PA 3TTKA 1PBPA 5I58B 2HQ0A 5L9OA 1MY0A 2A5TA 2GHBA 4KPTA 4NMYA 3MPKA 3K01A 2V3UA 2XXPA 4XXUA 2OCUA 1OVBA 1PDAA 4NF5B 1QUJA 4DIGA 1QULA 2XXYA 1QKAA 4BDOA 4YZZA 3O29A 3A3CA 1B5JA 1JQFA 3CR9A 1M5CA 4Q5TA 4X9TA 1B51A 2FYIA 3VVFA 4BDQA 2I0BA 3BKIB 4HW8A 2Q88A 4PP0A 3GBAA 1YAEA 2XXXA 3BFUA 3K00A 3MWBA 3TTMA 3U72A 3UIFA 5LOMA 3MW0A 1AH5A 3QUJA 1FQEA 2ZMBA 4R2FA 1LCFA 3VLVA 2I4CA 4C1TA 2QPQA 1MG1A 4E0WA 3KEIA 4LZ5A 5L9SA 4DDDA 2DP8A 2QJEA 2REGA 2GRVA 3FATA 3FGSA 4OMBA 3UGWA 3QSLA 1FQFA 1MY3A 3MC2A 4JWXA 1OQGA 4RK9A 5B7DA 3U1OA 5BWJA 4F22A 3LVUA 1QUIA 4MF3A 4RXLA 1URSA 4YMAA 5AA4A 3VXBA 3JYRA 1AOVA 1BKAA 3W15C 4ZZEA 3KN3A 1MXUA 1R1NA 4H65A 2P2AA 1NKXA 5ELVA 2Y84A 3TKDA 1EU8A 2F34A 3O6PA 1FTLA 3LC8A 3K2DA 4R9FA 3T9HB 4JSOA 1XOCA 2PYYA 3OO8A 5CMMA 4IO4A 4ELOA 4N13A 5J1DA 3TTNA 4WEDA 4IO6A 2HCAA 4F3GA 3GBBA 3PV0E 4QFNA 3C34A 3MAMA 3ZSFA 2AL5A 1H43A 4PFUA 5F1QA 3IOVA 3C35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUY E;  1LST A;  1VSO A;  4IO3 A;  1AIV A;  4RA1 A;  1TFD A;  1QUK A;  1B9J A;  1N0T A;  1URG A;  4Z0I A;  3R6U A;  4IY6 A;  3AXF A;  5TU0 A;  1SDX A;  3GXA A;  1VR5 A;  1S9T A;  4YKJ A;  1N76 A;  3OSQ A;  2XD3 A;  2E1S A;  3MUQ A;  4F3P A;  1OLC A;  2I58 A;  3N6T A;  1OQH A;  4H67 A;  4FE8 A;  5ICT A;  2B4M A;  1JVX A;  4DLD A;  1TT1 A;  2D3I A;  3ECR A;  4U4S A;  4GRK A;  3S4U A;  4PE5 B;  4YIC A;  3ILU B;  2O84 X;  1VFE A;  4UA8 A;  4ELR A;  5B70 A;  5KCJ A;  1LAF E;  3MVX A;  1UTH A;  2PX1 A;  3IR1 A;  4LZ8 A;  4P11 A;  2O7U A;  3Q27 A;  3N5L A;  4KYE A;  3TMG A;  2V93 A;  1B58 A;  1MXW A;  1DMB A;  1XVY A;  2DVZ A;  3CSB A;  5FTH A;  4U1O A;  2Z23 A;  1NNP A;  3FJM A;  5JTY A;  1ANF A;  5CM6 A;  1ZTY A;  1NNT A;  5FHM A;  3N26 A;  4U21 A;  3FVK A;  4FJP A;  3K02 A;  4JXI A;  2H99 A;  3O2A A;  4ZE8 A;  2UVI A;  2Q89 A;  1AL3 A;  4HTG A;  4BDR A;  2NOO A;  4HS7 A;  5H8S A;  3SES A;  4OFJ A;  1D3K A;  2Z8F A;  4Q8R A;  4KYD A;  1JEV A;  2GH9 A;  3BFT A;  4U22 A;  4YU0 A;  1A40 A;  1ZIU A;  2XXT A;  1POT A;  1A7L A;  3WAF A;  1EZP A;  3KN7 A;  3DP4 A;  3PU5 A;  3FV2 A;  4THI A;  2XHD A;  5I2N B;  4FOR A;  4DXC A;  4KD5 A;  4KCD A;  4PFT A;  1RKM A;  1PB9 A;  1BLF A;  4C0R A;  1OIB A;  4JDF A;  4F29 A;  2XXU A;  2OBG A;  1LB9 A;  3H3G A;  1XHY A;  1SBP A;  1P1N A;  5ISU A;  3KOS A;  1JNF A;  4GXA A;  4PQJ A;  1XVX A;  5HBC A;  1MPB A;  5H8N B;  3CHG A;  3UOR A;  3HCQ A;  2VD2 A;  2O69 A;  3O28 A;  3EHT A;  3CVG A;  4BDM A;  4FEB A;  3H6U A;  1YCJ A;  1N3X A;  1UTB A;  2H98 A;  2WKY A;  3PPO A;  1MM7 A;  1MQJ A;  4GLI A;  3G3I A;  5H8Q B;  1I6A A;  3WAE A;  3V83 A;  4R6H A;  2I48 A;  3EN3 A;  1MY1 A;  1IXH A;  2QS4 A;  2LAO A;  3FJ7 A;  3SER A;  3H4Z A;  4DE8 A;  3PPP A;  3G3K A;  5TPA B;  3TYH A;  2E0S A;  1NNF A;  3GZG A;  3FTO A;  3SDF A;  3MQ9 A;  3MJN A;  2VHA A;  3PUZ E;  3LSL A;  4TLM B;  1AMF A;  1N84 A;  1B40 A;  4XKQ A;  1XC1 A;  1JW4 A;  4FEC A;  4O3B A;  3SET A;  2RCB A;  2OJT A;  3DP6 A;  3TFL A;  2O7I A;  2I3W A;  5A5X A;  5JK4 A;  2GFE A;  2R6G E;  3FZV A;  1TXF A;  3P7I A;  4UAC A;  2ALU A;  3CRB A;  3W9V A;  1B5H A;  3IJO B;  5I59 B;  5I58 A;  1TWY A;  1B7U A;  4NF6 A;  2UVH A;  4R72 A;  1ZLQ A;  2WOL A;  4QFL A;  4MBP A;  3MP1 A;  2PT2 A;  1D4N A;  2I4B A;  1Y1Z A;  2GHA A;  1CB6 A;  3E4R A;  4K3F A;  4MH5 A;  1ATG A;  2XXI A;  3C36 A;  2D21 A;  4TLL B;  4YAH X;  2HAV A;  3EF7 A;  4G8N A;  2XXH A;  1IUD A;  1Y1M A;  2WOK A;  1MXY A;  2Y7W A;  4ZEC A;  2ZNS A;  5K2X A;  4ZEK A;  3SEY A;  2W7Y A;  3OO9 A;  3MBP A;  4X48 A;  4DCX A;  1Y3N A;  4POW A;  3KBR A;  1B7H A;  2ESN A;  3TDJ A;  5KCJ B;  3IOT A;  4LVQ A;  5TP9 B;  2O51 A;  3OOA A;  1P1W A;  3DLN A;  5DT6 A;  2F78 A;  1MQG A;  2VD3 A;  5AA2 D;  1B0L A;  2QS1 A;  1ZU0 A;  1Z7M E;  4ESW A;  4ISU A;  4TOZ A;  1JW1 A;  1N04 A;  3HN0 A;  3M3K A;  3SEW A;  3CG3 A;  3OEM A;  4KYS A;  3V8X B;  3W9W A;  4OZ9 A;  1LAX A;  3OD7 A;  3IOR A;  2F6P A;  3K1P A;  3PUW E;  5I59 A;  2YLN A;  2P0S A;  3PPQ A;  3V5A A;  4U4X A;  3KN8 A;  2NWJ A;  4EF2 A;  3MZ9 A;  1SW5 A;  5JEI A;  3Q28 A;  4H1X A;  1GTK A;  4U2R A;  1GV8 A;  5AA2 A;  1S50 A;  3VV5 A;  2Z8E A;  2IEE A;  5FHO A;  1D9V A;  4H6D A;  2H5Y A;  2X7Q A;  1B3G A;  2I49 A;  3K0V A;  3TQL A;  2DS9 A;  3E3K A;  3PGF A;  1HSL A;  2IA4 A;  1H76 A;  3M3L A;  4M4G A;  3QIM A;  1IEJ A;  2VP1 A;  3KJT A;  1J1N A;  2REJ A;  3K6V A;  4YKP A;  1FCK A;  3HHG A;  4E0X A;  4OEU A;  1Y3Q A;  2DWA A;  4QFP A;  1IXI A;  2XX7 A;  4NF8 B;  1Y4T A;  3DRK A;  2AL4 A;  2ZNT A;  1H45 A;  2Q2C A;  1WVJ A;  2DYX A;  4XKP A;  2ZXT A;  3EQ1 A;  3H6T A;  3OMB A;  4LUB A;  4OEN A;  1ZKB A;  3MPL A;  2O6A A;  4NWC A;  4QHQ A;  3UP9 A;  4ZED A;  2I3V A;  3VFJ A;  3Q26 A;  1NH8 A;  4NTL A;  5CBR A;  1PB8 A;  5I57 B;  3PMX A;  5AA1 A;  3ODB A;  4F18 A;  4X1B A;  1Y3P A;  1IIW A;  3U94 A;  3G3F A;  5H8H A;  3IL1 B;  2DWI A;  3VLU A;  1P99 A;  3FD3 A;  2Q9T A;  4DCY A;  5EHS A;  1M5E A;  1GGG A;  1SQY A;  2UVG A;  3RY3 A;  2XXQ A;  1IIT A;  1IZ1 A;  1WOD A;  3OO6 A;  2NVU B;  3S9E A;  2F35 A;  2ABH A;  1FQC A;  1P1O A;  2UVJ A;  3KZG A;  1POY 1;  3VVD A;  2HZL A;  4I9D A;  2H4I A;  4NED A;  4TQU Q;  3HHF A;  3OXN A;  1N7X A;  1LBC A;  1USY H;  2DWJ A;  2RC9 A;  3RNN A;  3VDF A;  3VVE A;  3T9X B;  4EF1 A;  3TCF A;  1DTG A;  3FVG A;  3VE1 B;  2B4L A;  2RKM A;  1B3E A;  4IY5 A;  1NFT A;  3IB0 A;  4P0G A;  4RNS A;  1Y9U A;  2R71 A;  3H6W A;  4O3A A;  4L17 A;  2B3B A;  2A5S A;  3C32 A;  1FTJ A;  3FUZ A;  3D4C A;  4NF6 B;  4YB7 A;  2B3F A;  4GF8 A;  1A54 A;  1WDN A;  3T66 A;  4DXU A;  1US4 A;  1MPD A;  1SI0 A;  2PBW A;  3MZ1 A;  1UQW A;  2XXR A;  2QS3 A;  1LFI A;  3K1N A;  3IB1 A;  4FED A;  1II5 A;  2PMS A;  1R9L A;  2V84 A;  4XTC Q;  4XIG Q;  3G7W A;  4FAT A;  3MVZ A;  3RQT A;  1D9Y A;  2F5X A;  1EZO A;  4OVJ A;  4U1Z A;  4IB2 A;  2QSX A;  2ZYO A;  4ZDM A;  5I56 B;  1B4H A;  1Y20 A;  1UTH B;  4KHZ E;  4IO7 A;  4R74 A;  5DVI A;  5F7V A;  3S2V A;  1I6B A;  3FV1 A;  4QSD A;  1B05 A;  3RYA A;  3N94 A;  4F19 A;  2PVU A;  4GL0 A;  1A8F A;  5CMC A;  1MDP 1;  2H25 A;  2Y7I A;  1S7Y A;  1IXG A;  4PET A;  4I62 A;  3LR1 A;  5I2N A;  3Q25 A;  5FHN A;  5AA4 B;  1B46 A;  3TOD A;  4LAT A;  3FVO A;  5DTB A;  1B52 A;  3QUF A;  3QAX A;  3SEV A;  1B1X A;  1BIY A;  3EPE A;  4QRZ A;  2I0C A;  4YKK A;  3FXU A;  1OMP A;  2QRY A;  4ZEB A;  4IO2 A;  5BUU A;  4F3B A;  4F31 B;  3THI A;  2XX8 A;  1B3L A;  4YB6 A;  3A3U A;  4F2O A;  2CZL A;  4AB5 A;  4YKI A;  4GVO A;  1B4Z A;  3K6X A;  1DOT A;  1DTZ A;  2ONK E;  4BDL A;  4XKR A;  1F9B A;  2NUV A;  2UYF A;  1IQ7 A;  1Q1K A;  2UYE A;  3B6W A;  2B65 A;  3E9X A;  3KOT A;  1MXV A;  1B3H A;  4QSE A;  3SEX A;  4ZEI A;  1I6Q A;  3PAM A;  3RUM A;  4GD5 A;  3U93 A;  3ZKK A;  2F8D A;  3C4M A;  4IGR A;  3CFX A;  2F7B A;  2DWH A;  2G93 A;  2M8C A;  3ZKL A;  1LAH E;  4DXB A;  4F2Q A;  3PMV A;  4JB7 A;  5TPA A;  1R6Z A;  1JEU A;  4G68 A;  3M3F A;  4DZ1 A;  2DOJ A;  2DXR A;  3CFL A;  3T22 A;  3G3J A;  5I56 A;  3K1M A;  3BBR A;  4KI0 E;  4X1D A;  1PC3 A;  4OTE A;  1A55 A;  3R26 A;  5I2K A;  3OO7 A;  2THI A;  3PPR A;  1USY E;  3IO4 A;  1EH3 A;  4GQO A;  4Q0C A;  4RPN A;  4F1Y A;  1FQD A;  2ONS A;  3GLB A;  3D4G A;  3KSX A;  3PPN A;  2Y7R A;  4O3C A;  5CMB A;  1LB8 A;  3UN6 A;  3TCH A;  4QF9 A;  1MDQ A;  1B7Z A;  3MP6 A;  4R2B A;  1JVY A;  3G3H A;  1XT8 A;  3H7M A;  2DE3 A;  5CC2 A;  1MXX A;  1BP5 A;  2CMO A;  1NMU A;  3CIJ A;  4GXS B;  3IO6 A;  4LA9 A;  2Z22 A;  3UK4 A;  1HSE A;  1GR2 A;  1LBB A;  5ITP A;  4FAJ A;  1RYX A;  4EQ7 A;  4LON B;  3S9N C;  3QXM A;  4NF5 A;  2QMW A;  4P0I A;  3A09 A;  1B32 A;  3T9V A;  4YMB A;  3IOU A;  1PBQ A;  1VE4 A;  1M5D A;  2RC7 A;  4HCW A;  3T93 B;  1MH4 A;  1NNK A;  1UTB B;  4ELQ A;  2KLF A;  1H44 A;  1OLA A;  4GFR A;  2Q8J A;  3SEU A;  1O64 A;  4ONY A;  2AYS A;  2DE2 A;  3TTL A;  1LLS A;  2RF1 A;  1N3W A;  1LFG A;  1ZBM A;  1O63 A;  1Y4C A;  3HPI A;  5DYH A;  2R9J A;  4ZS9 A;  2DVC A;  2OWS A;  4OFL A;  3KJ7 A;  2VOZ A;  4XKN A;  1SW4 A;  3PD8 A;  4R73 A;  4WXJ A;  1R9Q A;  3MVY A;  1SD3 A;  1MRP A;  3C31 A;  2HXW A;  5KZT A;  3HV1 A;  4R6Y A;  3IK6 B;  2O1L A;  1MQH A;  3B6Q A;  4OET A;  1H3D A;  1PB7 A;  3C9H A;  3E13 X;  1Q35 A;  3K6U A;  3K6W A;  1QVS A;  5DEX A;  4EXL A;  4LQ2 A;  3FAS A;  2XXW A;  3CG1 A;  4H8J A;  4JBZ A;  2XX9 A;  2F97 A;  2XXV A;  1QKB A;  1SW1 A;  3I5O A;  2ZYK A;  5H8F A;  4RPO A;  1UIU A;  3DRF A;  4F1V A;  3DEL B;  2O68 A;  1ELJ A;  4OHN A;  5AE4 A;  1US5 A;  3I6V A;  3RPW A;  1Z7N E;  5M2V A;  4ZZA A;  3B7D A;  2DQV A;  4RYA A;  2F36 A;  5HPQ A;  4LQ5 A;  3QK6 A;  3FXR A;  4QFO A;  3KSJ A;  2HFB A;  2Y7K A;  3DP8 A;  5ICQ A;  1A99 A;  2YPN A;  4OQO A;  1YTV A;  5JTY B;  1SI1 A;  2F7A A;  5I2K B;  4F39 A;  4GL8 A;  4OYV A;  3DRH A;  5EYF A;  5I57 A;  3IOW A;  1QW0 A;  2O1M A;  4EXK A;  3HO7 A;  3RYB A;  1B0H A;  5HM4 B;  1M5B A;  3LUY A;  4EDP A;  1LFH A;  3H06 B;  1JET A;  4AB6 A;  3O9P A;  3V89 B;  3PMW A;  4OEV A;  3CSG A;  3FIR A;  5H8F B;  3OEN A;  5DVJ A;  4LZ7 A;  1ZJL A;  3O97 A;  2V3Q A;  5DEX B;  3T9U A;  2ANJ A;  2QMX A;  3JV9 A;  4C1U A;  1MQD A;  2F6G A;  3FJG A;  3TPA A;  1FQA A;  2DE4 A;  2OZZ A;  3EHU A;  3O66 A;  4R6K A;  5CI5 A;  4NF4 B;  3M8U A;  3MZB A;  1N7W A;  3OEL A;  5I84 A;  2RIN A;  4H5F A;  2YJP A;  4OWD A;  3LSW A;  5H8Q A;  2Q2A A;  4LP2 B;  1B3F A;  4OXV A;  4RY1 A;  3USD A;  3L6G A;  1FQB A;  3PD9 A;  4EQ9 A;  1P1U A;  4N07 A;  3OEK A;  1O7T A;  4OER A;  4GIZ A;  1B6H A;  2RC8 A;  4JWY A;  5H8H B;  4OFO A;  4AQ4 A;  3DRI A;  4G8M A;  4N6P A;  3ILT B;  4IO5 A;  1LGB C;  4FIM A;  1MH3 A;  3CFZ A;  4PFY A;  2BJJ X;  3LSF B;  3O6H A;  4EUO A;  5DVF A;  2DXY A;  4I8C A;  2HEU A;  3K4U A;  3TQW A;  1CE2 A;  3B6T A;  3S9M C;  3MP8 A;  1URD A;  3FXQ A;  5A5X B;  1QJM A;  2X7P A;  3G3G A;  3KFM A;  3C33 A;  4NF8 A;  5IKB A;  2HAU A;  2NXO A;  4BDN A;  4I1D A;  2FNC A;  4QSC A;  4MLV A;  3H03 A;  4RK2 A;  3MVW A;  1PEB A;  4M1V A;  1YPN A;  3TTR A;  1P1Q A;  4IGT A;  3PUV E;  1SVX B;  1KWH A;  3RT8 A;  2VGQ A;  1MPC A;  2QS2 A;  5L8D A;  1FTK A;  4G8H A;  4GWO A;  4U23 A;  4JSD A;  1L5T A;  4ECF A;  4YB5 A;  3IB2 A;  1BTJ A;  3IX1 A;  5CRY A;  4KQP A;  5ITO A;  2A5T B;  3RN8 A;  2X26 A;  1T0K A;  1FTO A;  2G29 A;  3I3V A;  1NL5 A;  1EZ9 A;  4G2Z A;  4ELP A;  3TEP A;  4G77 A;  2PT1 A;  3U92 A;  1XS5 A;  4NE4 A;  4RJZ A;  5CBS A;  2H9B A;  4R9G A;  4H0W A;  4KCC A;  3SKP A;  3TEL A;  4KFQ A;  1MQI A;  2F7C A;  2D5W A;  1DPP A;  1DSN A;  2FA7 A;  2RCA A;  3U8Q A;  5CMK A;  3PUX E;  3VXC A;  5TP9 A;  5FTI A;  1B1H A;  4ZE9 A;  3TUS A;  3OSR A;  3Q29 A;  5IAI A;  4QFK A;  3ONM A;  4G68 B;  2OLB A;  3L6H A;  3O6I A;  4G68 C;  1NH7 A;  1MS7 A;  2OWT A;  1SW2 A;  4KR5 A;  2OK2 A;  5AA3 A;  1I69 A;  3VLW A;  4PFW A;  2QL3 A;  4H5G A;  5AA2 B;  2ZYM A;  2HZK A;  3S9L C;  1OVT A;  4POX A;  3IJX B;  4JWO A;  3KGC A;  4R75 A;  5K2Y A;  1B5I A;  1HSJ A;  3LBS A;  3LSX A;  1LCT A;  1TFA A;  3DRG A;  4Q30 B;  3KG2 A;  1A8E A;  3CI8 A;  3FVN A;  3TCG A;  1M5F A;  1JW5 A;  3HST A;  3JZJ A;  4NF4 A;  3RTF B;  2Z8D A;  2AIX A;  4H8I A;  4G4P A;  3RT6 B;  1MXZ A;  3QYT A;  1B2H A;  2DSF A;  1LAG E;  5H8N A;  4WKM A;  3O6G A;  5KDT A;  2I6E A;  5EHM A;  4ESX A;  2UXA A;  3DRJ A;  4HCY A;  1GVC A;  3H6V A;  4MLQ A;  2WOP A;  4ZEF A;  3DM0 A;  3R7X A;  3F11 A;  3T96 B;  3IAZ A;  3RTW B;  4F1U A;  3UA8 A;  2ZNU A;  2V3T A;  5L9M A;  1SYH A;  2P1S A;  3RLF E;  3TAJ A;  4OES A;  4BLA A;  4F3S A;  1RYO A;  3RGY A;  4Z7E A;  1IXC A;  2XD2 A;  5KDT B;  1FW0 A;  1ZMG A;  4GOT A;  4MFI A;  3TZA A;  1DPE A;  1MY2 A;  4NWD A;  2ONR A;  1MY4 A;  1SYI A;  2ZYN A;  4WEP A;  3N6U A;  1MM6 A;  1UIV A;  4EQB A;  1FTM A;  3ZS6 A;  3EHS A;  4ND9 A;  1VFD A;  2V25 A;  2Y7P A;  3TTK A;  1PBP A;  5I58 B;  2HQ0 A;  5L9O A;  1MY0 A;  2A5T A;  2GHB A;  4KPT A;  4NMY A;  3MPK A;  3K01 A;  2V3U A;  2XXP A;  4XXU A;  2OCU A;  1OVB A;  1PDA A;  4NF5 B;  1QUJ A;  4DIG A;  1QUL A;  2XXY A;  1QKA A;  4BDO A;  4YZZ A;  3O29 A;  3A3C A;  1B5J A;  1JQF A;  3CR9 A;  1M5C A;  4Q5T A;  4X9T A;  1B51 A;  2FYI A;  3VVF A;  4BDQ A;  2I0B A;  3BKI B;  4HW8 A;  2Q88 A;  4PP0 A;  3GBA A;  1YAE A;  2XXX A;  3BFU A;  3K00 A;  3MWB A;  3TTM A;  3U72 A;  3UIF A;  5LOM A;  3MW0 A;  1AH5 A;  3QUJ A;  1FQE A;  2ZMB A;  4R2F A;  1LCF A;  3VLV A;  2I4C A;  4C1T A;  2QPQ A;  1MG1 A;  4E0W A;  3KEI A;  4LZ5 A;  5L9S A;  4DDD A;  2DP8 A;  2QJE A;  2REG A;  2GRV A;  3FAT A;  3FGS A;  4OMB A;  3UGW A;  3QSL A;  1FQF A;  1MY3 A;  3MC2 A;  4JWX A;  1OQG A;  4RK9 A;  5B7D A;  3U1O A;  5BWJ A;  4F22 A;  3LVU A;  1QUI A;  4MF3 A;  4RXL A;  1URS A;  4YMA A;  5AA4 A;  3VXB A;  3JYR A;  1AOV A;  1BKA A;  3W15 C;  4ZZE A;  3KN3 A;  1MXU A;  1R1N A;  4H65 A;  2P2A A;  1NKX A;  5ELV A;  2Y84 A;  3TKD A;  1EU8 A;  2F34 A;  3O6P A;  1FTL A;  3LC8 A;  3K2D A;  4R9F A;  3T9H B;  4JSO A;  1XOC A;  2PYY A;  3OO8 A;  5CMM A;  4IO4 A;  4ELO A;  4N13 A;  5J1D A;  3TTN A;  4WED A;  4IO6 A;  2HCA A;  4F3G A;  3GBB A;  3PV0 E;  4QFN A;  3C34 A;  3MAM A;  3ZSF A;  2AL5 A;  1H43 A;  4PFU A;  5F1Q A;  3IOV A;  3C35 A; 
#chains in the Genus database with same CATH topology
 4MJO A;  4IO3 A;  1B9J A;  4IY6 A;  5TU0 A;  1SDX A;  3GXA A;  1S9T A;  5I7I A;  4HE1 A;  2XD3 A;  3MUQ A;  2I58 A;  3N6T A;  4DLD A;  4GRK A;  3ILU B;  4ELR A;  1VFE A;  3MVX A;  1UTH A;  2PX1 A;  4ESW A;  4KYE A;  5FTH A;  4OVT A;  1NNT A;  5FHM A;  3N26 A;  2H99 A;  2UVI A;  2FIE A;  4FBP A;  4OFJ A;  1A7L A;  3KN7 A;  5I2N B;  2VT5 A;  4DXC A;  4KD5 A;  2XWI A;  4PE3 A;  1PB9 A;  4C0R A;  4PBH A;  4F29 A;  2OBG A;  1LB9 A;  1XHY A;  1SBP A;  3KOS A;  3CHG A;  2VD2 A;  2O69 A;  4BDM A;  2WKY A;  4GLI A;  1I6A A;  3V83 A;  1MY1 A;  3PPP A;  3SDF A;  2VHA A;  4TLM B;  1N84 A;  4PGP A;  4O3B A;  1KZ8 A;  2I3W A;  5A5X A;  1KA0 A;  2ALU A;  3IJO B;  5I58 A;  2UVH A;  2WOL A;  4MBP A;  2GHA A;  4K3F A;  3C36 A;  2D21 A;  2XXH A;  2WOK A;  4ZEK A;  2W7Y A;  3OO9 A;  4POW A;  2O51 A;  1P1W A;  3DLN A;  2R8T A;  4P1L A;  4TOZ A;  1JW1 A;  1N04 A;  3SEW A;  4KYS A;  2P0S A;  3PPQ A;  3V5A A;  5JEI A;  1GTK A;  4U2R A;  2IEE A;  3TQL A;  2X7Q A;  4PF6 A;  4I3E A;  1HSL A;  3ROJ A;  3HHG A;  2DWA A;  4QFP A;  1IXI A;  2XX7 A;  1WVJ A;  2DYX A;  2ZXT A;  5ET8 A;  2O6A A;  1NH8 A;  3PMX A;  5AA1 A;  3ODB A;  1IIW A;  3IL1 B;  5EHS A;  3U72 A;  1SQY A;  1GGG A;  2UVG A;  1IIT A;  3KZG A;  4NQ8 A;  2HZL A;  2H4I A;  4NED A;  3HHF A;  3OXN A;  1NUW A;  3VVE A;  3VE1 B;  2XA5 A;  4RNS A;  1Y9U A;  4L17 A;  2A5S A;  4YB7 A;  2CEX A;  4GF8 A;  1WDN A;  1MPD A;  2PBW A;  1UQW A;  1LFI A;  2V84 A;  4MCO A;  1NUY A;  3RQT A;  1EZO A;  4OVJ A;  4U1Z A;  5EQ8 A;  5I56 B;  1B4H A;  1Y20 A;  5DVI A;  3S2V A;  5AA3 A;  3RYA A;  4GL0 A;  5CMC A;  1QGX A;  2OX3 A;  3QAX A;  1BIY A;  4YKK A;  3THI A;  4MMP A;  1B4Z A;  3K6X A;  2ONK E;  3E9X A;  4YMA A;  3B6W A;  1INP A;  3MYU A;  1I6Q A;  3ZKK A;  4P3L A;  4F2Q A;  3PMV A;  4JB7 A;  5TPA A;  4DZ1 A;  2DOJ A;  3CFL A;  5I56 A;  3R26 A;  3OO7 A;  3PPR A;  3KSX A;  3D4G A;  5CMB A;  4R2B A;  2DE3 A;  2CMO A;  4GXS B;  3UK4 A;  4DI4 B;  1HSE A;  1LBB A;  5ITP A;  4FAJ A;  1RYX A;  4EQ7 A;  4LON B;  3QXM A;  3A09 A;  1NNK A;  1OLA A;  5EQA A;  3TTL A;  2RF1 A;  3RPL B;  4PAI A;  3QMF A;  1LFG A;  3KC1 A;  4ZS9 A;  2VOZ A;  4XKN A;  1SD3 A;  5K2X A;  1H3D A;  1FBE A;  1Q35 A;  4LQ2 A;  3CG1 A;  2JJK A;  2XX9 A;  1SW1 A;  1UIU A;  3DRF A;  4PTK A;  4F1V A;  4OHN A;  5M2V A;  3PTY A;  4LQ5 A;  3QK6 A;  2L5V A;  1A99 A;  2YPN A;  5EQ9 A;  1SI1 A;  1QW0 A;  3LUY A;  3O9P A;  3V89 B;  3PMW A;  4OEV A;  3OEN A;  2QMX A;  1FQA A;  3O66 A;  3M8U A;  4AS4 A;  3MZB A;  4PAF A;  4OXV A;  1FQB A;  4AQ4 A;  4PFY A;  2BJJ X;  3LSF B;  3MP8 A;  5A5X B;  2Y5K A;  3G3G A;  1YXI A;  4BDN A;  4M1V A;  3TTR A;  4MNI A;  5ET5 A;  1SVX B;  4MNP A;  2PFZ A;  4YB5 A;  1FSA A;  1BTJ A;  3IX1 A;  4KQP A;  2G29 A;  3I3V A;  1NL5 A;  4MNC A;  4ELP A;  4NE4 A;  4R9G A;  2V4C A;  3U8Q A;  4N8G A;  3PUX E;  3VXC A;  4ZE9 A;  2ZZW A;  5IAI A;  4NG7 A;  5J16 A;  2OLB A;  3O6I A;  4PFW A;  2QL3 A;  4H5G A;  1OVT A;  4POX A;  3FVN A;  2Z8D A;  4N6D A;  2I6E A;  4ESX A;  3DRJ A;  4HCY A;  3H6V A;  4P47 A;  3IAZ A;  3RTW B;  2WBB A;  4F3S A;  5KDT B;  1FW0 A;  5EYH A;  1MY2 A;  4WEP A;  1SYI A;  1AWB A;  3ZS6 A;  3EHS A;  5I58 B;  2HQ0 A;  5L9O A;  2A5T A;  4NAP A;  2V3U A;  4XXU A;  4DIG A;  1QUL A;  1QKA A;  1SPI A;  4PF8 A;  1B5J A;  4AS5 A;  2FYI A;  4HW8 A;  2Q88 A;  4PP0 A;  3GBA A;  2XXX A;  3UIF A;  3TEP A;  5ESY A;  1FQE A;  2ZMB A;  3VLV A;  1RDX A;  3FAT A;  4MAG A;  1FQF A;  5BWJ A;  1OQG A;  1QUI A;  4RXL A;  1AOV A;  1MXU A;  2Y84 A;  2F34 A;  4QBA A;  1NV3 A;  5J1D A;  5CMM A;  4O7M A;  4N13 A;  3TTN A;  4WED A;  4IO6 A;  4F3G A;  3MAM A;  2AL5 A;  5F1Q A;  4BDO A;  1AIV A;  1QUK A;  1G0H A;  1VR5 A;  2FIX A;  1N76 A;  3OSQ A;  1EYJ A;  4F3P A;  1OLC A;  5ICT A;  2B4M A;  1JVX A;  1TT1 A;  4U4S A;  2F3B A;  2O7U A;  3TMG A;  2V93 A;  1B58 A;  2DVZ A;  3CSB A;  4U1O A;  3FJM A;  1NNP A;  3FVK A;  4FJP A;  3K02 A;  2FHY A;  2Q89 A;  4HS7 A;  3SES A;  1D3K A;  4KYD A;  4U22 A;  4YU0 A;  1ZIU A;  2XXT A;  3WAF A;  1EZP A;  3DP4 A;  4THI A;  4KCD A;  1RKM A;  1BLF A;  1FPL A;  1P1N A;  5ISU A;  4GXA A;  1XVX A;  3UOR A;  4NHB A;  3CVG A;  3H6U A;  1YCJ A;  1UTB A;  2H98 A;  1MM7 A;  1MQJ A;  2I48 A;  2QS4 A;  2LAO A;  3MJN A;  2PFY A;  3D1R A;  4FEC A;  2RCB A;  2OJT A;  2GFE A;  2R6G E;  4UAC A;  3W9V A;  3CRB A;  5I59 B;  5IZZ A;  2PT2 A;  2I4B A;  4PAK A;  3EF7 A;  4G8N A;  2ZNS A;  4I40 A;  2F78 A;  1MQG A;  1Z7M E;  3W9W A;  3V8X B;  4MHF A;  1LAX A;  3OD7 A;  3IOR A;  3PUW E;  4U4X A;  1FPF A;  1GV8 A;  5AA2 A;  5FHO A;  1D9V A;  3K0V A;  1B3G A;  4OVR A;  3E3K A;  3PGF A;  1IEJ A;  2VP1 A;  1J1N A;  2WEF A;  3K6V A;  4YKP A;  1Y3Q A;  4DI3 D;  3DRK A;  2XWK A;  3EQ1 A;  1H45 A;  4P9K A;  3OMB A;  4XKP A;  3MPL A;  4NWC A;  4ZED A;  3Q26 A;  5I57 B;  4F18 A;  5H8H A;  3VLU A;  4G61 A;  1P99 A;  2XXQ A;  1WOD A;  2F35 A;  1FQC A;  1P1O A;  2UVJ A;  1POY 1;  4I9D A;  3RNN A;  3TCF A;  4GWX A;  3FVG A;  4I3Y A;  4IY5 A;  1NFT A;  4PDH A;  2B3B A;  3D4C A;  4NF6 B;  4DXU A;  1SI0 A;  2QS3 A;  4HE2 A;  1II5 A;  2PMS A;  1R9L A;  1NUX A;  4XIG Q;  4FAT A;  1YYZ A;  4PDD A;  2HPG A;  2QSX A;  1UTH B;  4R74 A;  3BIH A;  3LR1 A;  3ISP A;  5FHN A;  5AA4 B;  1B46 A;  2I0C A;  4ZEB A;  1B3L A;  3A3U A;  2CZL A;  4YKI A;  1DOT A;  1F9B A;  2UYF A;  4QSE A;  3KOT A;  3SEX A;  4ZEI A;  3RUM A;  4GD5 A;  2VPN A;  3C4M A;  2F7B A;  2M8C A;  3ZKL A;  3EKI A;  1R6Z A;  3T22 A;  3G3J A;  3BBR A;  4HXV A;  5I2K A;  2THI A;  4PBQ A;  1EH3 A;  3GLB A;  2Y7R A;  3TCH A;  1MDQ A;  1B7Z A;  4XF5 A;  4KXP A;  1XT8 A;  3H7M A;  1MXX A;  1BP5 A;  3CIJ A;  3IO6 A;  2Z22 A;  3S9N C;  4NF5 A;  1PBQ A;  2XWO A;  2KLF A;  4P56 A;  4N81 A;  2Q8J A;  4ONY A;  2AYS A;  2DE2 A;  4GX3 A;  2CZK A;  5IM2 A;  2DVC A;  2OWS A;  5ET6 A;  1SW4 A;  4R73 A;  1MRP A;  4R6Y A;  3IK6 B;  2O1L A;  3K6W A;  4OET A;  1PB7 A;  1QVS A;  3FXB A;  4JBZ A;  4H8J A;  2F97 A;  1K9Z A;  3B50 A;  3DEL B;  2O68 A;  5IZ3 A;  3I6V A;  3SZP A;  3B7D A;  4RYA A;  2F36 A;  5HPQ A;  3FXR A;  1FRP A;  4H45 A;  5JTY B;  2HFB A;  1YTV A;  4GBW A;  5EYF A;  4H46 A;  2O1M A;  4EXK A;  1FBD A;  5HM4 B;  3FIR A;  5H8F B;  2HXR A;  3JV9 A;  2QVU A;  2DE4 A;  2OZZ A;  1N7W A;  3OEL A;  4OWD A;  4EQ9 A;  1B3F A;  3L6G A;  3PD9 A;  4N07 A;  3OEK A;  4GIZ A;  1B6H A;  2RC8 A;  4OFO A;  4NX1 A;  1DBZ A;  4G8M A;  4FIM A;  2DXY A;  2HEU A;  1Q9D A;  3TQW A;  3FXQ A;  2X7P A;  5IKB A;  4I1D A;  2FNC A;  4QSC A;  2CZI A;  1PEB A;  3T1B A;  1P1Q A;  1KWH A;  3RT8 A;  1MPC A;  4ECF A;  4GWO A;  1L5T A;  5ITO A;  1LEV A;  2H9B A;  4KCC A;  1MQI A;  1DPP A;  1DSN A;  4NGU A;  5TP9 A;  5I5P A;  3ONM A;  5ET7 A;  1MS7 A;  4KR5 A;  2OK2 A;  3S9L C;  5AA2 B;  3IJX B;  3KGC A;  1FJ6 A;  1TFA A;  3KG2 A;  3TCG A;  1M5F A;  1NV5 A;  5IZ1 A;  4GBV A;  2DSF A;  4MLQ A;  2WOP A;  3DM0 A;  3F11 A;  4F1U A;  2ZNU A;  3RLF E;  4OES A;  4BLA A;  1RYO A;  1IXC A;  2XD2 A;  1ZMG A;  4MFI A;  1MM6 A;  2V25 A;  4KPT A;  1NV4 A;  4NMY A;  1OVB A;  2XXY A;  3A3C A;  3CR9 A;  4BDQ A;  4X9T A;  3BKI B;  3K00 A;  1YAE A;  3MWB A;  3BFU A;  3TTM A;  5LOM A;  3MW0 A;  1AH5 A;  3QUJ A;  2I4C A;  4C1T A;  3KEI A;  5L9S A;  2DP8 A;  2QJE A;  1MY3 A;  5F24 A;  2MKZ A;  4F22 A;  3LVU A;  5AA4 A;  4ZZE A;  5ELV A;  2HHM A;  3O6P A;  3LC8 A;  4R9F A;  4N6K A;  2HCA A;  3GBB A;  2F3D A;  1H43 A;  4NF4 B;  3IOV A;  3PUY E;  1LST A;  4RA1 A;  1URG A;  2QVV A;  4Z0I A;  3AXF A;  4OVS A;  2E1S A;  3ECR A;  3T0J A;  4PE5 B;  4YIC A;  5B70 A;  2O84 X;  1LAF E;  3IR1 A;  4LZ8 A;  3N5L A;  2Y5L A;  3NOH A;  1NV0 A;  4N17 A;  3LV0 A;  2WYP A;  2Z23 A;  4JVC A;  5CM6 A;  4U21 A;  1LBX A;  4BDR A;  3O2A A;  4ZE8 A;  1AL3 A;  2GH9 A;  2CEY A;  1A40 A;  3FV2 A;  4FOR A;  1OIB A;  2XXU A;  4PQJ A;  5HBC A;  3HCQ A;  3A29 A;  3EHT A;  1N3X A;  3PPO A;  1FJ9 A;  3G3I A;  5T3J A;  1NV6 A;  1FPD A;  4R6H A;  3FJ7 A;  3H4Z A;  4DE8 A;  5TPA B;  3G3K A;  3TYH A;  1NNF A;  3FTO A;  3MQ9 A;  5I3S A;  3PUZ E;  3LSL A;  1AMF A;  1B40 A;  1XC1 A;  1JW4 A;  1LBW A;  3DP6 A;  5JK4 A;  2O7I A;  1RDY A;  1TXF A;  3P7I A;  1B5H A;  1TWY A;  1B7U A;  4NF6 A;  4R72 A;  4QFL A;  3MP1 A;  4MH5 A;  2XXI A;  4TLL B;  4YAH X;  2HAV A;  1Y1M A;  1MXY A;  4JVD A;  4X48 A;  4DCX A;  3KBR A;  3TDJ A;  5KCJ B;  5TP9 B;  3OOA A;  5DT6 A;  2VD3 A;  1B0L A;  3M3K A;  3OEM A;  4OZ9 A;  3K1P A;  5I59 A;  3MZ9 A;  1SW5 A;  1S50 A;  2Z8E A;  4OAN A;  4H6D A;  2H5Y A;  2I49 A;  4GWU A;  2DS9 A;  2IA4 A;  1H76 A;  3QIM A;  3KJT A;  1FCK A;  4E0X A;  4OEU A;  3LUZ A;  4NF8 B;  2FBP A;  3H6T A;  3UP9 A;  1ZKB A;  2I3V A;  4NTL A;  4GWS A;  1PB8 A;  1Y3P A;  3G3F A;  2ZZX A;  2Q9T A;  3RY3 A;  1IZ1 A;  3VDF A;  2RC9 A;  1LBC A;  4EF1 A;  2FVZ A;  1DTG A;  2B4L A;  1B3E A;  3IB0 A;  1A54 A;  3T66 A;  1FBH A;  4PCD A;  2XXR A;  3K1N A;  3IB1 A;  4FED A;  4UAB A;  5EYG A;  3G7W A;  3MVZ A;  4IB2 A;  4ZDM A;  4KHZ E;  4IO7 A;  3U65 A;  5F7V A;  2QVR A;  2PVU A;  1A8F A;  1FPG A;  1S7Y A;  5I2N A;  4I62 A;  4LAT A;  5DTB A;  1B52 A;  3QUF A;  3SEV A;  1B1X A;  3EPE A;  4OVQ A;  4QRZ A;  3FXU A;  1OMP A;  4IO2 A;  5BUU A;  4F31 B;  4GX4 A;  4QXD A;  1DTZ A;  2PCR A;  4XKR A;  2UYE A;  1Q1K A;  1B3H A;  2CZH A;  2F8D A;  3CFX A;  2G93 A;  2DWH A;  1RDZ A;  2DXR A;  1FBC A;  3K1M A;  4OTE A;  1FBP A;  1USY E;  3IO4 A;  1BK4 A;  4GQO A;  1IMA A;  1FQD A;  2ONS A;  3PPN A;  1LB8 A;  3MP6 A;  1FBF A;  1GR2 A;  4P0I A;  4YMB A;  3IOU A;  3T93 B;  4GWW A;  1UTB B;  1H44 A;  3SEU A;  4XEQ A;  1N3W A;  4JVI A;  1ZBM A;  1Y4C A;  2R9J A;  4OFL A;  3KJ7 A;  3PD8 A;  3C31 A;  2XWV A;  5KZT A;  3C9H A;  3B6Q A;  3K6U A;  5DEX A;  2XXW A;  2KR0 A;  1FBG A;  4NF0 A;  2ZYK A;  3I5O A;  3MST A;  3RPW A;  1Z7N E;  4ZZA A;  4QFO A;  3KSJ A;  2Y7K A;  2P3V A;  2F7A A;  5I2K B;  4F39 A;  4OYV A;  3DRH A;  3IOW A;  4MX6 A;  3HO7 A;  4P1E A;  1LFH A;  3H06 B;  3CSG A;  2V3Q A;  4XFE A;  3T9U A;  2ANJ A;  1MQD A;  3FJG A;  4R6K A;  5CI5 A;  3EHU A;  5I84 A;  2RIN A;  4H5F A;  2YJP A;  3LSW A;  4RY1 A;  1P1U A;  1O7T A;  5H8H B;  1FPB A;  4N6P A;  4IO5 A;  1LGB C;  1FTA A;  3O6H A;  1EYI A;  4EUO A;  4I8C A;  1CE2 A;  3B6T A;  3S9M C;  1URD A;  3KFM A;  3C33 A;  2HAU A;  4RK2 A;  2Q74 A;  4IGT A;  4X04 A;  5L8D A;  4U23 A;  4JSD A;  3IB2 A;  5CRY A;  1T0K A;  3RN8 A;  1EZ9 A;  3U92 A;  1G0I A;  2PT1 A;  1XS5 A;  3TEL A;  4KFQ A;  2F7C A;  5FTI A;  1EYK A;  3Q29 A;  4QFK A;  4G68 B;  4MIJ A;  4G68 C;  2OWT A;  5DW8 A;  1SW2 A;  1LBY A;  3VLW A;  4JWO A;  3DRG A;  3JZJ A;  3HST A;  4NF4 A;  3RTF B;  2GQ1 A;  4H8I A;  3RT6 B;  1MXZ A;  3QYT A;  1B2H A;  1LAG E;  5KDT A;  2WX9 A;  5EHM A;  1GVC A;  3R7X A;  3UA8 A;  2V3T A;  5L9M A;  3RGY A;  4GOT A;  4HE0 A;  3TZA A;  1NV7 A;  1DPE A;  4NWD A;  2ONR A;  2ZYN A;  3N6U A;  1UIV A;  4ND9 A;  1PBP A;  1MY0 A;  2GHB A;  4N8Y A;  3K01 A;  2XXP A;  2OCU A;  4NF5 B;  3O29 A;  1JQF A;  1DK4 A;  1M5C A;  1B51 A;  2I0B A;  4OA4 A;  1IMD A;  4R2F A;  3KBZ A;  1XI6 A;  1LCF A;  4E0W A;  1MG1 A;  1DCU A;  2REG A;  2GRV A;  3UGW A;  4OMB A;  3IFA A;  3QSL A;  3MC2 A;  4RK9 A;  3U1O A;  1FPE A;  4MF3 A;  4O94 A;  3W15 C;  2VPO A;  1IME A;  3GYY A;  3KN3 A;  4N15 A;  4H65 A;  2P2A A;  1NKX A;  3TKD A;  1FTL A;  3K2D A;  3RYD A;  3OO8 A;  4IO4 A;  4PFI A;  3ZSF A;  1VSO A;  1TFD A;  1N0T A;  3R6U A;  4GWZ A;  4YKJ A;  1OQH A;  4FE8 A;  3KC0 A;  2D3I A;  3S4U A;  4UA8 A;  5KCJ A;  3HFU A;  4P11 A;  3Q27 A;  5LDZ A;  3BIG A;  1MXW A;  1DMB A;  1XVY A;  5JTY A;  4NN3 A;  1ANF A;  1ZTY A;  4P8B A;  4JXI A;  4HTG A;  2NOO A;  4O8M A;  5H8S A;  2Z8F A;  4Q8R A;  1JEV A;  3BFT A;  1POT A;  2P3N A;  3PU5 A;  2XHD A;  1IMB A;  1FPI A;  4PFT A;  4JDF A;  3H3G A;  1JNF A;  1MPB A;  5H8N B;  3O28 A;  4FEB A;  1IMC A;  5H8Q B;  3WAE A;  3EN3 A;  1IXH A;  3SER A;  3E79 A;  2E0S A;  3GZG A;  4XKQ A;  3SET A;  4PFB A;  3TFL A;  3FZV A;  1ZLQ A;  1D4N A;  1Y1Z A;  1CB6 A;  3E4R A;  5IGA A;  1ATG A;  1IUD A;  2Y7W A;  3SEY A;  4ZEC A;  3MBP A;  1Y3N A;  4N91 A;  1B7H A;  2ESN A;  3IOT A;  4LVQ A;  5AA2 D;  2QS1 A;  1ZU0 A;  4ISU A;  3HN0 A;  4MEV A;  3CG3 A;  2F6P A;  2YLN A;  3KN8 A;  2NWJ A;  3Q28 A;  4H1X A;  3VV5 A;  4DXB A;  1LBV A;  2OWZ A;  3M3L A;  4M4G A;  2REJ A;  1VDW A;  1Y4T A;  2AL4 A;  2ZNT A;  2Q2C A;  4LUB A;  4XTC Q;  4OEN A;  4QHQ A;  3VFJ A;  2XXK A;  5CBR A;  1LBZ A;  4X1B A;  3U94 A;  2DWI A;  3FD3 A;  4DCY A;  1M5E A;  3OO6 A;  2NVU B;  3S9E A;  2ABH A;  3VVD A;  4TQU Q;  1N7X A;  1USY H;  2DWJ A;  3T9X B;  2RKM A;  4P0G A;  2R71 A;  3H6W A;  4O3A A;  3C32 A;  1FTJ A;  3FUZ A;  4X8R A;  2B3F A;  1US4 A;  3MZ1 A;  3IFC A;  1D9Y A;  2F5X A;  2ZYO A;  4PFR A;  1I6B A;  3FV1 A;  4QSD A;  1B05 A;  3N94 A;  4PC9 A;  4F19 A;  1MDP 1;  2H25 A;  2Y7I A;  1IXG A;  4PET A;  3Q25 A;  3TOD A;  3FVO A;  1JP4 A;  2QRY A;  4F3B A;  2XX8 A;  4YB6 A;  4F2O A;  4AB5 A;  4GVO A;  2DDK A;  4BDL A;  4H67 A;  2NUV A;  1IQ7 A;  4C1U A;  2B65 A;  1MXV A;  3PAM A;  3U93 A;  4IGR A;  1LAH E;  1NUZ A;  1JEU A;  4G68 A;  3M3F A;  1NI9 A;  4KI0 E;  4X1D A;  1PC3 A;  1A55 A;  2ZZV A;  4RPN A;  4F1Y A;  4O3C A;  3UN6 A;  4QF9 A;  1JVY A;  3G3H A;  5CC2 A;  1CNQ A;  1NMU A;  4LA9 A;  1NV2 A;  2QMW A;  5A5L A;  1B32 A;  3T9V A;  1VE4 A;  1M5D A;  2RC7 A;  4HCW A;  1MH4 A;  4ELQ A;  4GFR A;  1O64 A;  1LLS A;  3HPI A;  1O63 A;  4WXJ A;  1R9Q A;  3MVY A;  2HXW A;  3HV1 A;  5IZ3 B;  3LSX A;  1MQH A;  1FPK A;  3E13 X;  4EXL A;  3FAS A;  2QFL A;  2XXV A;  1QKB A;  3E78 A;  5H8F A;  4RPO A;  1ELJ A;  5AE4 A;  1US5 A;  2DQV A;  4Q0C A;  3SKP A;  4EF2 A;  3DP8 A;  4OQO A;  5ICQ A;  3FBP A;  4GL8 A;  5I57 A;  4PGN A;  4N4U A;  3RYB A;  1B0H A;  1M5B A;  5EQ7 A;  4EDP A;  1JET A;  4AB6 A;  2Q8M A;  5DVJ A;  4LZ7 A;  1ZJL A;  3O97 A;  5DEX B;  1IMF A;  5DYH A;  2F6G A;  3TPA A;  4IR8 A;  5H8Q A;  3USD A;  2Q2A A;  4LP2 B;  4JWY A;  4OER A;  4GX6 A;  3DRI A;  3ILT B;  1MH3 A;  3CFZ A;  4O7I A;  5DVF A;  3K4U A;  4LN5 A;  1QJM A;  4NF8 A;  2NXO A;  4MLV A;  3H03 A;  3MVW A;  1YPN A;  3PUV E;  2VGQ A;  2QS2 A;  4G8H A;  1FTK A;  1YZ0 A;  2A5T B;  2X26 A;  1FTO A;  1D9Q A;  4G2Z A;  4G77 A;  2WBD A;  4RJZ A;  5CBS A;  4H0W A;  2D5W A;  2RCA A;  2FA7 A;  5CMK A;  1B1H A;  2WYK A;  3TUS A;  3OSR A;  3L6H A;  1NH7 A;  1I69 A;  2ZYM A;  2HZK A;  5FBP A;  1KA1 A;  4R75 A;  5K2Y A;  1B5I A;  1HSJ A;  3LBS A;  4Q30 B;  1LCT A;  1A8E A;  3CI8 A;  1JW5 A;  2AIX A;  4G4P A;  5LTC A;  5H8N A;  4WKM A;  3O6G A;  2UXA A;  4ZEF A;  3T96 B;  1K9Y A;  3TAJ A;  1SYH A;  2P1S A;  4Z7E A;  3RPL A;  1MY4 A;  4GWY A;  4EQB A;  1FTM A;  1VFD A;  2Y7P A;  3TTK A;  3MPK A;  2KQZ A;  1PDA A;  1QUJ A;  4YZZ A;  4Q5T A;  3VVF A;  1NV1 A;  4OVP A;  2QPQ A;  4LZ5 A;  4DDD A;  3FGS A;  4JWX A;  5B7D A;  1URS A;  3VXB A;  3JYR A;  1BKA A;  1R1N A;  1EU8 A;  3T9H B;  4JSO A;  1XOC A;  2PYY A;  3B8B A;  4ELO A;  3PV0 E;  4QFN A;  3C34 A;  4PFU A;  2BJI A;  1FPJ A;  3C35 A; 
#chains in the Genus database with same CATH homology
 3PUY E;  1LST A;  1VSO A;  4IO3 A;  1AIV A;  4RA1 A;  1TFD A;  1QUK A;  1B9J A;  1N0T A;  1URG A;  4Z0I A;  3R6U A;  4IY6 A;  3AXF A;  5TU0 A;  1SDX A;  3GXA A;  1VR5 A;  1S9T A;  4YKJ A;  1N76 A;  3OSQ A;  2XD3 A;  2E1S A;  3MUQ A;  4F3P A;  1OLC A;  2I58 A;  3N6T A;  1OQH A;  4H67 A;  4FE8 A;  5ICT A;  2B4M A;  1JVX A;  4DLD A;  1TT1 A;  2D3I A;  3ECR A;  4U4S A;  4GRK A;  3S4U A;  4PE5 B;  4YIC A;  3ILU B;  2O84 X;  1VFE A;  4UA8 A;  4ELR A;  5B70 A;  5KCJ A;  1LAF E;  3MVX A;  1UTH A;  2PX1 A;  3IR1 A;  4LZ8 A;  4P11 A;  2O7U A;  3Q27 A;  3N5L A;  4KYE A;  3TMG A;  2V93 A;  1B58 A;  1MXW A;  1DMB A;  1XVY A;  2DVZ A;  3CSB A;  5FTH A;  4U1O A;  2Z23 A;  1NNP A;  3FJM A;  5JTY A;  1ANF A;  5CM6 A;  1ZTY A;  1NNT A;  5FHM A;  3N26 A;  4U21 A;  3FVK A;  4FJP A;  3K02 A;  4JXI A;  2H99 A;  3O2A A;  4ZE8 A;  2UVI A;  2Q89 A;  1AL3 A;  4HTG A;  4BDR A;  2NOO A;  4HS7 A;  5H8S A;  3SES A;  4OFJ A;  1D3K A;  2Z8F A;  4Q8R A;  4KYD A;  1JEV A;  2GH9 A;  3BFT A;  4U22 A;  4YU0 A;  1A40 A;  1ZIU A;  2XXT A;  1POT A;  1A7L A;  3WAF A;  1EZP A;  3KN7 A;  3DP4 A;  3PU5 A;  3FV2 A;  4THI A;  2XHD A;  5I2N B;  4FOR A;  4DXC A;  4KD5 A;  4KCD A;  4PFT A;  1RKM A;  1PB9 A;  1BLF A;  4C0R A;  1OIB A;  4JDF A;  4F29 A;  2XXU A;  2OBG A;  1LB9 A;  3H3G A;  1XHY A;  1SBP A;  1P1N A;  5ISU A;  3KOS A;  1JNF A;  4GXA A;  4PQJ A;  1XVX A;  5HBC A;  1MPB A;  5H8N B;  3CHG A;  3UOR A;  3HCQ A;  2VD2 A;  2O69 A;  3O28 A;  3EHT A;  3CVG A;  4BDM A;  4FEB A;  3H6U A;  1YCJ A;  1N3X A;  1UTB A;  2H98 A;  2WKY A;  3PPO A;  1MM7 A;  1MQJ A;  4GLI A;  3G3I A;  5H8Q B;  1I6A A;  3WAE A;  3V83 A;  4R6H A;  2I48 A;  3EN3 A;  1MY1 A;  1IXH A;  2QS4 A;  2LAO A;  3FJ7 A;  3SER A;  3H4Z A;  4DE8 A;  3PPP A;  3G3K A;  5TPA B;  3TYH A;  2E0S A;  1NNF A;  3GZG A;  3FTO A;  3SDF A;  3MQ9 A;  3MJN A;  2VHA A;  3PUZ E;  3LSL A;  4TLM B;  1AMF A;  1N84 A;  1B40 A;  4XKQ A;  1XC1 A;  1JW4 A;  4FEC A;  4O3B A;  3SET A;  2RCB A;  2OJT A;  3DP6 A;  3TFL A;  2O7I A;  2I3W A;  5A5X A;  5JK4 A;  2GFE A;  2R6G E;  3FZV A;  1TXF A;  3P7I A;  4UAC A;  2ALU A;  3CRB A;  3W9V A;  1B5H A;  3IJO B;  5I59 B;  5I58 A;  1TWY A;  1B7U A;  4NF6 A;  2UVH A;  4R72 A;  1ZLQ A;  2WOL A;  4QFL A;  4MBP A;  3MP1 A;  2PT2 A;  1D4N A;  2I4B A;  1Y1Z A;  2GHA A;  1CB6 A;  3E4R A;  4K3F A;  4MH5 A;  1ATG A;  2XXI A;  3C36 A;  2D21 A;  4TLL B;  4YAH X;  2HAV A;  3EF7 A;  4G8N A;  2XXH A;  1IUD A;  1Y1M A;  2WOK A;  1MXY A;  2Y7W A;  4ZEC A;  2ZNS A;  5K2X A;  4ZEK A;  3SEY A;  2W7Y A;  3OO9 A;  3MBP A;  4X48 A;  4DCX A;  1Y3N A;  4POW A;  3KBR A;  1B7H A;  2ESN A;  3TDJ A;  5KCJ B;  3IOT A;  4LVQ A;  5TP9 B;  2O51 A;  3OOA A;  1P1W A;  3DLN A;  5DT6 A;  2F78 A;  1MQG A;  2VD3 A;  5AA2 D;  1B0L A;  2QS1 A;  1ZU0 A;  1Z7M E;  4ESW A;  4ISU A;  4TOZ A;  1JW1 A;  1N04 A;  3HN0 A;  3M3K A;  3SEW A;  3CG3 A;  3OEM A;  4KYS A;  3V8X B;  3W9W A;  4OZ9 A;  1LAX A;  3OD7 A;  3IOR A;  2F6P A;  3K1P A;  3PUW E;  5I59 A;  2YLN A;  2P0S A;  3PPQ A;  3V5A A;  4U4X A;  3KN8 A;  2NWJ A;  4EF2 A;  3MZ9 A;  1SW5 A;  5JEI A;  3Q28 A;  4H1X A;  1GTK A;  4U2R A;  1GV8 A;  5AA2 A;  1S50 A;  3VV5 A;  2Z8E A;  2IEE A;  5FHO A;  1D9V A;  4H6D A;  2H5Y A;  2X7Q A;  1B3G A;  2I49 A;  3K0V A;  3TQL A;  2DS9 A;  3E3K A;  3PGF A;  1HSL A;  2IA4 A;  1H76 A;  3M3L A;  4M4G A;  3QIM A;  1IEJ A;  2VP1 A;  3KJT A;  1J1N A;  2REJ A;  3K6V A;  4YKP A;  1FCK A;  3HHG A;  4E0X A;  4OEU A;  1Y3Q A;  2DWA A;  4QFP A;  1IXI A;  2XX7 A;  4NF8 B;  1Y4T A;  3DRK A;  2AL4 A;  2ZNT A;  1H45 A;  2Q2C A;  1WVJ A;  2DYX A;  4XKP A;  2ZXT A;  3EQ1 A;  3H6T A;  3OMB A;  4LUB A;  4OEN A;  1ZKB A;  3MPL A;  2O6A A;  4NWC A;  4QHQ A;  3UP9 A;  4ZED A;  2I3V A;  3VFJ A;  3Q26 A;  1NH8 A;  4NTL A;  5CBR A;  1PB8 A;  5I57 B;  3PMX A;  5AA1 A;  3ODB A;  4F18 A;  4X1B A;  1Y3P A;  1IIW A;  3U94 A;  3G3F A;  5H8H A;  3IL1 B;  2DWI A;  3VLU A;  1P99 A;  3FD3 A;  2Q9T A;  4DCY A;  5EHS A;  1M5E A;  1GGG A;  1SQY A;  2UVG A;  3RY3 A;  2XXQ A;  1IIT A;  1IZ1 A;  1WOD A;  3OO6 A;  2NVU B;  3S9E A;  2F35 A;  2ABH A;  1FQC A;  1P1O A;  2UVJ A;  3KZG A;  1POY 1;  3VVD A;  2HZL A;  4I9D A;  2H4I A;  4NED A;  4TQU Q;  3HHF A;  3OXN A;  1N7X A;  1LBC A;  1USY H;  2DWJ A;  2RC9 A;  3RNN A;  3VDF A;  3VVE A;  3T9X B;  4EF1 A;  3TCF A;  1DTG A;  3FVG A;  3VE1 B;  2B4L A;  2RKM A;  1B3E A;  4IY5 A;  1NFT A;  3IB0 A;  4P0G A;  4RNS A;  1Y9U A;  2R71 A;  3H6W A;  4O3A A;  4L17 A;  2B3B A;  2A5S A;  3C32 A;  1FTJ A;  3FUZ A;  3D4C A;  4NF6 B;  4YB7 A;  2B3F A;  4GF8 A;  1A54 A;  1WDN A;  3T66 A;  4DXU A;  1US4 A;  1MPD A;  1SI0 A;  2PBW A;  3MZ1 A;  1UQW A;  2XXR A;  2QS3 A;  1LFI A;  3K1N A;  3IB1 A;  4FED A;  1II5 A;  2PMS A;  1R9L A;  2V84 A;  4XTC Q;  4XIG Q;  3G7W A;  4FAT A;  3MVZ A;  3RQT A;  1D9Y A;  2F5X A;  1EZO A;  4OVJ A;  4U1Z A;  4IB2 A;  2QSX A;  2ZYO A;  4ZDM A;  5I56 B;  1B4H A;  1Y20 A;  1UTH B;  4KHZ E;  4IO7 A;  4R74 A;  5DVI A;  5F7V A;  3S2V A;  1I6B A;  3FV1 A;  4QSD A;  1B05 A;  3RYA A;  3N94 A;  4F19 A;  2PVU A;  4GL0 A;  1A8F A;  5CMC A;  1MDP 1;  2H25 A;  2Y7I A;  1S7Y A;  1IXG A;  4PET A;  4I62 A;  3LR1 A;  5I2N A;  3Q25 A;  5FHN A;  5AA4 B;  1B46 A;  3TOD A;  4LAT A;  3FVO A;  5DTB A;  1B52 A;  3QUF A;  3QAX A;  3SEV A;  1B1X A;  1BIY A;  3EPE A;  4QRZ A;  2I0C A;  4YKK A;  3FXU A;  1OMP A;  2QRY A;  4ZEB A;  4IO2 A;  5BUU A;  4F3B A;  4F31 B;  3THI A;  2XX8 A;  1B3L A;  4YB6 A;  3A3U A;  4F2O A;  2CZL A;  4AB5 A;  4YKI A;  4GVO A;  1B4Z A;  3K6X A;  1DOT A;  1DTZ A;  2ONK E;  4BDL A;  4XKR A;  1F9B A;  2NUV A;  2UYF A;  1IQ7 A;  1Q1K A;  2UYE A;  3B6W A;  2B65 A;  3E9X A;  3KOT A;  1MXV A;  1B3H A;  4QSE A;  3SEX A;  4ZEI A;  1I6Q A;  3PAM A;  3RUM A;  4GD5 A;  3U93 A;  3ZKK A;  2F8D A;  3C4M A;  4IGR A;  3CFX A;  2F7B A;  2DWH A;  2G93 A;  2M8C A;  3ZKL A;  1LAH E;  4DXB A;  4F2Q A;  3PMV A;  4JB7 A;  5TPA A;  1R6Z A;  1JEU A;  4G68 A;  3M3F A;  4DZ1 A;  2DOJ A;  2DXR A;  3CFL A;  3T22 A;  3G3J A;  5I56 A;  3K1M A;  3BBR A;  4KI0 E;  4X1D A;  1PC3 A;  4OTE A;  1A55 A;  3R26 A;  5I2K A;  3OO7 A;  2THI A;  3PPR A;  1USY E;  3IO4 A;  1EH3 A;  4GQO A;  4Q0C A;  4RPN A;  4F1Y A;  1FQD A;  2ONS A;  3GLB A;  3D4G A;  3KSX A;  3PPN A;  2Y7R A;  4O3C A;  5CMB A;  1LB8 A;  3UN6 A;  3TCH A;  4QF9 A;  1MDQ A;  1B7Z A;  3MP6 A;  4R2B A;  1JVY A;  3G3H A;  1XT8 A;  3H7M A;  2DE3 A;  5CC2 A;  1MXX A;  1BP5 A;  2CMO A;  1NMU A;  3CIJ A;  4GXS B;  3IO6 A;  4LA9 A;  2Z22 A;  3UK4 A;  1HSE A;  1GR2 A;  1LBB A;  5ITP A;  4FAJ A;  1RYX A;  4EQ7 A;  4LON B;  3S9N C;  3QXM A;  4NF5 A;  2QMW A;  4P0I A;  3A09 A;  1B32 A;  3T9V A;  4YMB A;  3IOU A;  1PBQ A;  1VE4 A;  1M5D A;  2RC7 A;  4HCW A;  3T93 B;  1MH4 A;  1NNK A;  1UTB B;  4ELQ A;  2KLF A;  1H44 A;  1OLA A;  4GFR A;  2Q8J A;  3SEU A;  1O64 A;  4ONY A;  2AYS A;  2DE2 A;  3TTL A;  1LLS A;  2RF1 A;  1N3W A;  1LFG A;  1ZBM A;  1O63 A;  1Y4C A;  3HPI A;  5DYH A;  2R9J A;  4ZS9 A;  2DVC A;  2OWS A;  4OFL A;  3KJ7 A;  2VOZ A;  4XKN A;  1SW4 A;  3PD8 A;  4R73 A;  4WXJ A;  1R9Q A;  3MVY A;  1SD3 A;  1MRP A;  3C31 A;  2HXW A;  5KZT A;  3HV1 A;  4R6Y A;  3IK6 B;  2O1L A;  1MQH A;  3B6Q A;  4OET A;  1H3D A;  1PB7 A;  3C9H A;  3E13 X;  1Q35 A;  3K6U A;  3K6W A;  1QVS A;  5DEX A;  4EXL A;  4LQ2 A;  3FAS A;  2XXW A;  3CG1 A;  4H8J A;  4JBZ A;  2XX9 A;  2F97 A;  2XXV A;  1QKB A;  1SW1 A;  3I5O A;  2ZYK A;  5H8F A;  4RPO A;  1UIU A;  3DRF A;  4F1V A;  3DEL B;  2O68 A;  1ELJ A;  4OHN A;  5AE4 A;  1US5 A;  3I6V A;  3RPW A;  1Z7N E;  5M2V A;  4ZZA A;  3B7D A;  2DQV A;  4RYA A;  2F36 A;  5HPQ A;  4LQ5 A;  3QK6 A;  3FXR A;  4QFO A;  3KSJ A;  2HFB A;  2Y7K A;  3DP8 A;  5ICQ A;  1A99 A;  2YPN A;  4OQO A;  1YTV A;  5JTY B;  1SI1 A;  2F7A A;  5I2K B;  4F39 A;  4GL8 A;  4OYV A;  3DRH A;  5EYF A;  5I57 A;  3IOW A;  1QW0 A;  2O1M A;  4EXK A;  3HO7 A;  3RYB A;  1B0H A;  5HM4 B;  1M5B A;  3LUY A;  4EDP A;  1LFH A;  3H06 B;  1JET A;  4AB6 A;  3O9P A;  3V89 B;  3PMW A;  4OEV A;  3CSG A;  3FIR A;  5H8F B;  3OEN A;  5DVJ A;  4LZ7 A;  1ZJL A;  3O97 A;  2V3Q A;  5DEX B;  3T9U A;  2ANJ A;  2QMX A;  3JV9 A;  4C1U A;  1MQD A;  2F6G A;  3FJG A;  3TPA A;  1FQA A;  2DE4 A;  2OZZ A;  3EHU A;  3O66 A;  4R6K A;  5CI5 A;  4NF4 B;  3M8U A;  3MZB A;  1N7W A;  3OEL A;  5I84 A;  2RIN A;  4H5F A;  2YJP A;  4OWD A;  3LSW A;  5H8Q A;  2Q2A A;  4LP2 B;  1B3F A;  4OXV A;  4RY1 A;  3USD A;  3L6G A;  1FQB A;  3PD9 A;  4EQ9 A;  1P1U A;  4N07 A;  3OEK A;  1O7T A;  4OER A;  4GIZ A;  1B6H A;  2RC8 A;  4JWY A;  5H8H B;  4OFO A;  4AQ4 A;  3DRI A;  4G8M A;  4N6P A;  3ILT B;  4IO5 A;  1LGB C;  4FIM A;  1MH3 A;  3CFZ A;  4PFY A;  2BJJ X;  3LSF B;  3O6H A;  4EUO A;  5DVF A;  2DXY A;  4I8C A;  2HEU A;  3K4U A;  3TQW A;  1CE2 A;  3B6T A;  3S9M C;  3MP8 A;  1URD A;  3FXQ A;  5A5X B;  1QJM A;  2X7P A;  3G3G A;  3KFM A;  3C33 A;  4NF8 A;  5IKB A;  2HAU A;  2NXO A;  4BDN A;  4I1D A;  2FNC A;  4QSC A;  4MLV A;  3H03 A;  4RK2 A;  3MVW A;  1PEB A;  4M1V A;  1YPN A;  3TTR A;  1P1Q A;  4IGT A;  3PUV E;  1SVX B;  1KWH A;  3RT8 A;  2VGQ A;  1MPC A;  2QS2 A;  5L8D A;  1FTK A;  4G8H A;  4GWO A;  4U23 A;  4JSD A;  1L5T A;  4ECF A;  4YB5 A;  3IB2 A;  1BTJ A;  3IX1 A;  5CRY A;  4KQP A;  5ITO A;  2A5T B;  3RN8 A;  2X26 A;  1T0K A;  1FTO A;  2G29 A;  3I3V A;  1NL5 A;  1EZ9 A;  4G2Z A;  4ELP A;  3TEP A;  4G77 A;  2PT1 A;  3U92 A;  1XS5 A;  4NE4 A;  4RJZ A;  5CBS A;  2H9B A;  4R9G A;  4H0W A;  4KCC A;  3SKP A;  3TEL A;  4KFQ A;  1MQI A;  2F7C A;  2D5W A;  1DPP A;  1DSN A;  2FA7 A;  2RCA A;  3U8Q A;  5CMK A;  3PUX E;  3VXC A;  5TP9 A;  5FTI A;  1B1H A;  4ZE9 A;  3TUS A;  3OSR A;  3Q29 A;  5IAI A;  4QFK A;  3ONM A;  4G68 B;  2OLB A;  3L6H A;  3O6I A;  4G68 C;  1NH7 A;  1MS7 A;  2OWT A;  1SW2 A;  4KR5 A;  2OK2 A;  5AA3 A;  1I69 A;  3VLW A;  4PFW A;  2QL3 A;  4H5G A;  5AA2 B;  2ZYM A;  2HZK A;  3S9L C;  1OVT A;  4POX A;  3IJX B;  4JWO A;  3KGC A;  4R75 A;  5K2Y A;  1B5I A;  1HSJ A;  3LBS A;  3LSX A;  1LCT A;  1TFA A;  3DRG A;  4Q30 B;  3KG2 A;  1A8E A;  3CI8 A;  3FVN A;  3TCG A;  1M5F A;  1JW5 A;  3HST A;  3JZJ A;  4NF4 A;  3RTF B;  2Z8D A;  2AIX A;  4H8I A;  4G4P A;  3RT6 B;  1MXZ A;  3QYT A;  1B2H A;  2DSF A;  1LAG E;  5H8N A;  4WKM A;  3O6G A;  5KDT A;  2I6E A;  5EHM A;  4ESX A;  2UXA A;  3DRJ A;  4HCY A;  1GVC A;  3H6V A;  4MLQ A;  2WOP A;  4ZEF A;  3DM0 A;  3R7X A;  3F11 A;  3T96 B;  3IAZ A;  3RTW B;  4F1U A;  3UA8 A;  2ZNU A;  2V3T A;  5L9M A;  1SYH A;  2P1S A;  3RLF E;  3TAJ A;  4OES A;  4BLA A;  4F3S A;  1RYO A;  3RGY A;  4Z7E A;  1IXC A;  2XD2 A;  5KDT B;  1FW0 A;  1ZMG A;  4GOT A;  4MFI A;  3TZA A;  1DPE A;  1MY2 A;  4NWD A;  2ONR A;  1MY4 A;  1SYI A;  2ZYN A;  4WEP A;  3N6U A;  1MM6 A;  1UIV A;  4EQB A;  1FTM A;  3ZS6 A;  3EHS A;  4ND9 A;  1VFD A;  2V25 A;  2Y7P A;  3TTK A;  1PBP A;  5I58 B;  2HQ0 A;  5L9O A;  1MY0 A;  2A5T A;  2GHB A;  4KPT A;  4NMY A;  3MPK A;  3K01 A;  2V3U A;  2XXP A;  4XXU A;  2OCU A;  1OVB A;  1PDA A;  4NF5 B;  1QUJ A;  4DIG A;  1QUL A;  2XXY A;  1QKA A;  4BDO A;  4YZZ A;  3O29 A;  3A3C A;  1B5J A;  1JQF A;  3CR9 A;  1M5C A;  4Q5T A;  4X9T A;  1B51 A;  2FYI A;  3VVF A;  4BDQ A;  2I0B A;  3BKI B;  4HW8 A;  2Q88 A;  4PP0 A;  3GBA A;  1YAE A;  2XXX A;  3BFU A;  3K00 A;  3MWB A;  3TTM A;  3U72 A;  3UIF A;  5LOM A;  3MW0 A;  1AH5 A;  3QUJ A;  1FQE A;  2ZMB A;  4R2F A;  1LCF A;  3VLV A;  2I4C A;  4C1T A;  2QPQ A;  1MG1 A;  4E0W A;  3KEI A;  4LZ5 A;  5L9S A;  4DDD A;  2DP8 A;  2QJE A;  2REG A;  2GRV A;  3FAT A;  3FGS A;  4OMB A;  3UGW A;  3QSL A;  1FQF A;  1MY3 A;  3MC2 A;  4JWX A;  1OQG A;  4RK9 A;  5B7D A;  3U1O A;  5BWJ A;  4F22 A;  3LVU A;  1QUI A;  4MF3 A;  4RXL A;  1URS A;  4YMA A;  5AA4 A;  3VXB A;  3JYR A;  1AOV A;  1BKA A;  3W15 C;  4ZZE A;  3KN3 A;  1MXU A;  1R1N A;  4H65 A;  2P2A A;  1NKX A;  5ELV A;  2Y84 A;  3TKD A;  1EU8 A;  2F34 A;  3O6P A;  1FTL A;  3LC8 A;  3K2D A;  4R9F A;  3T9H B;  4JSO A;  1XOC A;  2PYY A;  3OO8 A;  5CMM A;  4IO4 A;  4ELO A;  4N13 A;  5J1D A;  3TTN A;  4WED A;  4IO6 A;  2HCA A;  4F3G A;  3GBB A;  3PV0 E;  4QFN A;  3C34 A;  3MAM A;  3ZSF A;  2AL5 A;  1H43 A;  4PFU A;  5F1Q A;  3IOV A;  3C35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...