1B1ZA

Streptococcal pyrogenic exotoxin a1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of superantigen streptococcal pyrogenic exotoxin A (SpeA1) by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
molecule keywords PROTEIN (TOXIN)
total genus 58
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b1zA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b1zA02
1DYQA 1JCKB 1AN8A 1PTOB 2AQ3B 4DXFA 1CQVA 1LO5D 1I4HA 1S5CD 1TS5A 5I4DA 1B44D 1BCPF 1BCPB 3R8BA 1YN4A 1PTOC 4C56C 1ET9A 1JWUD 4RFBA 3DWAA 4O1NA 1KLGD 1FNUA 1KTKA 1GOZA 1FNWA 3BVGA 1D5XC 1FNVA 2IJ0A 1V1OA 2R61A 1LTID 3GP7A 2XRQD 3BYYB 1L0XB 4TSSA 1KLUD 1XTCD 2NTTA 1JQYD 4L63B 1SE3A 4UDUC 2ICIA 1TS3A 1HXYD 3BVZA 1FGBD 1MD2D 1SEBD 3BVMA 1RDPD 1S5BD 1SJED 1UUPA 1V1PB 4L6TB 5FKAC 1V1PA 1B1ZA 1BXTA 1EU4A 1S5FD 4NZLB 1S5ED 1D5ZC 1ET6A 3DWPA 4OHJA 1AW7A 1F77A 3DWQA 1QILA 1EEID 1SJHD 1I4QA 4RHRA 1EFID 1JR0D 1T5XD 1SBBB 1CK1A 1TY0A 1G8ZD 1SE4A 3OWEB 1PRTD 1SXTA 4RH6A 4RCOA 2IPKD 3R2TA 1PRTB 3TSSA 1PTOF 1RCVD 1CHPD 2QILA 2G9HD 2XN9C 5D3IB 1STEA 1L0YB 2Z8LA 4RGOS 1PYWD 1HA5A 1PRTC 2O2LD 1LT4D 1LT3D 3O13A 5TSSA 1YN3A 3SEBA 4RHSA 1D6EC 1I4PA 1RD9D 1JWMD 1LT5D 2AQ2B 3EFXD 5ELFA 1UNSA 1JWSD 1LLRD 2WV6D 1TS2A 3V05A 4ZYSA 2J4XA 1LTSD 1EEFD 2NTSA 1BCPD 1PZJD 2TSSA 2QEJC 4RGNA 1M4VA 1LTRD 1HQRD 5ELEA 1BCPC 1PTOD 1PRTF 3URYA 1PZKD 4RGTA 1HTLD 5ELDA 1FD7D 1CHQD 4K6LA 3CHBD 4BWGB 1LTTD 2XRSD 2RDHA 2RDGA 3MC0B 4DXGA 1D5MC 1ENFA 1RF2D 5D3DA 1XXGA 1S5DD 2SEBD 1YN5A 3MFGA 4RGMA 1LTGD 1PZID 1I4GA 1ESFA 1LTAD 2CHBD 3BYTB 1EU3A 1PTOH 5ELBA 1LT6D 1SE2A 1DJRD 3W2DA 1TS4A 2XNAC 3EA6A 4Z9CB 1CT1D 3KLSX 5FK9C 1TY2A 1LTBD 2AQ1B 3R2IA 1EWCA 1I4RA 5ELCA 3BZDB 1I4XA
chains in the Genus database with same CATH superfamily
3C2PA 1OGWA 2PMZE 1UEAB 1YHAA 4A55A 1TWHB 1TQOA 1WMHB 3W3AA 1B44D 3NQTA 3DBRB 3Q3MC 3UIOB 3T56B 1FGUA 3UDXA 3IHPC 1HFGA 2JE6I 1F9QA 3TIXA 4O1NA 5HFYA 3QWZB 4PV1C 3J9CA 2QC8A 4LDTB 1N9WA 1DM0B 1D5XC 3I91A 5EAYA 2VQEQ 3ZXRA 2MCNB 4EE2A 1PYSB 2E75C 3BINA 4XXEA 1OQQA 1T5EA 3NRZA 1XTCD 4MEMA 1WX9A 3I57A 3DHQA 4OXPA 2IGHA 1LXDA 3S1RH 1EZ6A 4A90A 1AE3A 2QEXA 1TS3A 2GBJA 4PS8A 4EKUA 2F3WA 3SHQA 4HJGE 3G6JB 3K5LA 1D8LA 2Y5BB 5J18A 1MD2D 4JL9A 3F8TA 3F2BA 1SEBD 3BVMA 5CGKA 3HOUH 3KUCB 1LYLA 4A3OA 1SJED 3F2CA 3GV6A 3S9WA 3TMPB 2V4IB 3QOLA 1N32L 3A33B 4NW2A 1K28A 2HDLA 4FULA 4GDLB 5FLMH 1KH0A 2ACZB 2I1KA 2HCCA 4FO2A 4OEMB 4L2YA 3Q3FA 1F77A 2ZTEA 3DWQA 2KD0A 4B3ML 4WIPA 4W9HA 4S17A 1YVCA 4WAAA 3KWLA 1T5XD 2K5QA 1S1QB 2BOSA 3OIQA 3RN5A 1YEZA 3OHXC 2H1EA 4LF9L 3EBEA 4WRDA 3CPFA 5IP7H 4OX9Q 2WU2B 5T1IA 3S2DB 1CM9A 4G3XB 4OO1G 1WGGA 1XNRL 1RCVD 1OTRB 2MO0A 3ZJVA 4K7WA 4V190 1FXIA 2HQLA 2ZVNA 1FRDA 1GD7A 3HEJA 3D3RA 1H9KA 3TP6A 1HRJA 2JJQA 2M56B 4QMGA 3K58A 3RT3B 1J8CA 4JV5Q 5C3WA 4CQNA 1WVLA 3X3NA 4IFDJ 2V4DA 4C80A 2B2TC 4GN3B 4PZ6A 4DN4M 3K80C 3VR9B 4AJWA 4JI1L 1TXYA 3J7ZC 3SK6A 1Q81C 3UDGA 1K8AC 1T6BX 1CZWA 5C3EG 1LTRD 2VZKB 4IUNA 1C3TA 3VRBB 4PYUA 2QKIC 1Y1VH 1YZ6A 4BKTA 2FE8A 3I90A 4LFAL 1FD7D 1RJTA 1TWFH 3D4WA 4A3FG 4ZHPA 4K7UA 2I5MX 3MC0B 4H44C 4M8AA 3BY4B 4HDOA 3CCSA 4KZ0A 3NEMA 2GA4B 4PS3A 3ZTCA 5JHBA 1B3AA 1WTRA 2UXCL 1FM0D 1HUNA 1TR5A 2IO0B 2LXJA 1SMYD 1XWEA 1LTAD 4MM3B 5ELNA 2V4LA 4JGHB 1FJGQ 1Q46A 1P3QU 2RD0A 1DJRD 4JI3L 3NS1A 2JZ3B 4G7HC 1OTCA 4ARIA 3PSIA 2DZMA 3B2GA 3HKZE 1K52A 1EWCA 2Q2IA 3AFQA 1IGCA 1NTGA 2INCC 1ZXTA 2Y3AA 4M1UB 5JZEB 2NPTB 2KFKA 4ZRIA 3NOBA 4LNNA 5LMNL 4DV7L 5C1ZA 2AWNA 3RD2A 2A68D 2ZJQA 2EPBA 4BBRG 1QNKA 1UGMA 1KLGD 1HHVA 3BS1A 1X65A 5AZFA 3WA0A 2UXBL 3ZTDA 3HOXG 2JEBI 3MC9A 3BK2A 4MACA 4LUZA 4R1JA 3E3XA 2XRQD 3AQQA 4ZUIA 3I55A 2KLGA 1YQ4B 5C4XB 2HJ8A 3Q3OC 2ENBA 3KUPA 1II3A 2WYQA 2ICIA 1CKMA 2Q2HA 4JCVE 3OW7A 3R7RA 2MJEA 4C7ZA 4K5VA 5D65A 3HVDA 2D0OA 4TQ0A 3TRZA 1UEBA 1E9MA 1S5BD 4JI6Q 2FINB 4X62L 4XDCA 3AU7A 3MJ5A 2XBBC 5BMIA 2MSED 4AUQC 2M2LA 4DV6L 1BXTA 4HIKA 1YJ9A 3KF8B 5IT9L 2CCZA 1JE4A 4E74A 3SK8A 2HIXA 1QB5D 3HUIA 1ET6A 2SNMA 1CSPA 1X9NA 4A3LG 1WJJA 1CUKA 4AP4C 2I2YA 4LF4L 1XLOA 4FF3A 3Q8DA 4G0NB 2EY1A 5IA7A 4IJHA 1Y1WH 3B2FA 4HJ5A 3ZGZA 4JI8Q 1PRTD 4JBKA 3J7A5 1FCCC 2MBEA 4JOIC 1IBKL 2W3RA 1AFPA 4CKCA 3WAPA 4R4TA 1PGAA 2F0NA 2OXPA 2LMCB 2KQ4X 1PRTB 2LVOA 4LFBQ 2K04A 3E0JA 4PMCA 2A5UA 3T8MA 1STEA 4AYBE 3JAML 2MBBB 2DN8A 3I4LA 1PH3A 1VQ6A 2PPHA 3I7FA 1XMOL 3K5MA 1KL9A 2DENB 4A3IG 3I4NB 1LT5D 1PH6A 5IP4D 3IRBA 2MHVA 4C1NI 4R4CA 4BY1G 3RUZA 1MSHA 2HHHL 4P16A 4CKBA 1ZGUB 2TMPA 1P7FA 1QZEA 5FR6A 2K32A 4O42A 1A63A 2H89B 2ZW1A 4GKKL 4YSYB 1E10A 2JZZA 2IT1A 5LL6X 4DUZL 3N1XC 3G7LA 1GC6A 2BYFA 5D6JB 4RGTA 3DEPA 4LF7Q 4GGQA 3GTQB 2M0AA 1N33Q 2XRSD 4JC0A 3DCGA 4HPLB 4BKSA 4CBVA 1EQVA 4ME5A 1TWGH 4KHVA 2L1BA 1SNMA 4RAUC 2F0EA 3HOZH 2IGDA 2F0DA 3NY5A 2K4KA 4K2KA 1IYFA 3ZNHB 1ESFA 1K9MC 4A8XC 3K5OA 1VQAA 4JI7L 3GTQH 4RWSC 1EU3A 4W9DA 4X65L 1YQBA 3HOVB 4JBJA 1IBMQ 1N62A 1WH3A 3U7ZA 2E2DC 3S16B 2L52A 1JT8A 1H9MA 5AJ3L 1TWAB 2WIIB 3N1ZC 2AUJD 2CQOA 2EDGA 3N32A 3EQLC 1SNOA 2QCZA 2KWDA 2I1JA 1TKGA 1CQFA 2O5JC 4TVAB 4ABNA 2QMTA 3T13A 3I8ZA 2MHJA 1HR0L 4UHVA 2K75A 4A3KG 4LNQA 1ZE3D 3DBHB 4KI0A 3VTWA 1JMCA 4HCNB 5EPKA 2B29A 3VR4A 1SYEA 1VZ8A 1C9FA 2EY5A 1RTOA 1WTVA 3N20C 1DOYA 2UUBQ 3I4MB 1N5XA 2IJ0A 2VUMH 1B9MA 3NTHA 3DVGY 4YWGG 4QUCA 1WE6A 3AYHB 4CJ0B 3NVWA 5L95C 3WOEA 4TSSA 3AECB 4KDIC 3OLMD 1GUOA 2Q8IB 4C3JG 5K36G 2OWOA 2KTRB 3OJ4B 1T0RC 1XJVA 1HZBA 4AJYB 3IFWB 1HXYD 4CDFC 5M3FG 4MJSA 4MDKE 4QIWB 5C6AA 4KD3A 1RODA 2RKSA 3SE0A 2DYBA 4J15A 4WJ4A 3NBHA 1R7SA 4L6TB 4EQ5A 1SNQA 1WYDA 3HOWB 4DR7Q 5KRUA 1C76A 1B1ZA 4HN7A 4N9TA 2KVMA 4YWKA 2KX3A 1Z2MA 1SLJA 2DGYA 1MI0A 2B2UA 3U52E 3G48A 3EECA 1MKHA 1VQHA 4KIKB 4XC2A 2WFWA 4K5XA 4OONA 4DU9A 1CMXB 4GLSC 1SR3A 2LWPA 4FXKC 2YTXA 2JXTA 1EIGA 1EZ8A 4A20A 2WXKA 2MQHA 4C3HG 2D62A 2NBUA 3HRZC 1T0QC 1E8XA 3ZO5B 3SD5A 3NVZA 1VQJA 1U4PA 2XN9C 3NBHB 2BB5A 4DV5Q 3QWNA 4C3HH 4BS9A 4RGOS 3A9KB 4G50A 3TEZA 1IPGA 2LSSA 2V9HA 2IX0A 1DXMA 2KEDA 2EYHA 2EOTA 2LZ6A 3DBHI 1KC8C 3H0GG 1YIJA 4L5TA 5E4WC 1D6EC 1I4PA 1WXQA 2EMTA 1WXSA 3HOXH 2J7ZA 2E2IH 2PZTA 2FUG1 3V05A 2MWSB 5NUCA 5C4HA 3HOXB 3FMCA 2YTVA 5D94A 3QA8A 1VQPA 2KN4A 5HI1A 5AFWA 1J19A 1KNAA 4DV0L 1MG8A 1BCPC 3P1HA 2A4ZA 4N58A 3FEWX 3A4RA 3AI5A 2K33A 2CR5A 2ES2A 1O80A 1N34Q 4BY7H 2CU3A 3TBIB 1VMPA 2N1WA 3R7QA 3IBEA 2QF7A 4P72A 3GTMH 3RNFC 1IW7D 3NELA 3P4RB 1D5MC 3T51B 2X6LA 2UXDL 2KWUB 4H02A 1FMAD 3PZDA 3H7PB 2JXXA 3Q69A 2MBHA 3CCVA 5BYSA 1TIID 2LEKA 4B3RL 3R3MA 4HRSA 1YNTE 2Z4HA 2A1AA 3VR8B 2EMSA 3VUYA 2XNAC 2QGQA 4EX5A 3T1HL 1ONLA 1GUGA 3H6MA 1SMYC 1BKBA 1WSPA 2MBQA 1TWCB 1H95A 1UWVA 4TKOB 1HNZQ 4GDLA 1V2YA 1TS5A 3RMHA 4B9WA 2C7MB 3OOCA 1EY4A 2OTLA 2MO1A 4W9KA 1DYQA 1FYCA 2R3ZA 1DZ1A 1BUVT 3JSVA 4IPGA 4ZK9B 4X64L 2VL6A 4Y7NH 2NVXH 1PVOA 2GMIC 2EJFC 1M90C 4FHKA 5BYQA 4DR4L 2NVUI 1Q82C 2IX1A 2X8XX 4LNFA 1PTOC 4X57B 1HZAA 2WGSA 1ZOYB 4YY3Q 2QCPX 3PMFA 1Q86C 3GTGH 3ZIMA 4K2LA 1V8CA 1VJKA 1LTID 3WDNA 2MBOA 1KFYB 2Z6KC 2KO3A 5IGGA 3CSFA 4Y52H 4KKTA 4ARCA 4KLKA 3F1ZA 1ESRA 1XPOA 4NNJB 4JI5Q 2XGTA 1JJCB 3RNUA 2L55A 1JORA 3L7ZC 2NBFA 1Z5SB 2MNAA 1AH9A 4LFCL 4KZCA 1IYVA 4F1SA 2FIFA 1R9TH 3E0EA 3ULJA 5IYBG 2ASQA 4LF6L 4BAXA 4GLXA 4DR1Q 3L08A 4PT5A 3RULA 1EY5A 3ONSA 4NAWB 5DPRA 1DOKA 4DUYQ 3KYCD 4HCEA 2NR2A 2D3CA 2QJLA 1QKZA 4OHJA 1RTNA 1PUTA 3Q8AA 2JT4B 2K52A 4APVA 1N5WA 2K22A 2F0KA 3L0WB 3GTOB 1CK1A 1G8ZD 2OJWA 3CCJA 3KF8A 3TJPA 1JOOA 2K5HA 3PV1A 4IWOA 3VFKA 4MGKE 4J6IA 4DAYB 1E1OA 2NVYB 4FF4A 3TSSA 4A4IA 3ZUNA 1AP0A 2GOWA 3RZFA 1VF7A 4DPGA 1LM8B 2DAJA 3LNNA 2Z0EB 1PRTC 1VCBA 1L4DB 5H92C 3GTLB 4ANUA 3S2HB 3A8IE 3T3NA 2F3VA 3IL8A 4LJPB 4HPMB 1XX8A 4DDGD 3HOYB 4FYDA 1ZKOA 2WXJA 2N7DA 4CJ1B 2BS4B 1E7VA 1YJWA 1DONA 3PV0A 5D2MB 1EIHA 4B95A 1J6QA 1NMFA 2GBMA 2IGGA 5HGQA 3LDZE 1A62A 1EEFD 2WP9B 3PUVA 1PH7A 2EKEC 3KUDB 4YTMB 3DPDA 4KY6A 1YNJD 3W1BA 1PTOD 4WORA 2HD5B 3URYA 1FL0A 1L1OC 2KTFA 2G3QB 2YEPB 3E6ZX 1HTLD 5T8IA 1VQFA 2LHEA 4C3HB 2WP8J 4YSXB 1LTTD 2BKRB 4ZRPA 5FO9B 1N61A 2D5DA 3CC4A 2WLBA 1V80A 1A15A 3S2HH 1OQYA 1FVIA 4IQZA 1PZID 1G6PA 1TYGB 4NMZA 1SNCA 4FJZA 3ERQA 2PLPA 2J53A 2DY7A 4XDXA 1MBYA 3EA6A 4WJNA 5BR8Q 4BBSH 2E8GA 3HIZA 1TZ1A 3EGRA 3RYTA 4MIUA 1D4BA 1V43A 4ZKCB 4KD4A 4A3IH 4ME3A 2AQ3B 1WTXA 4DR6Q 3S2AA 3JC66 3MXNB 2F4VQ 4A3DG 4A93G 2DYMA 2R2OA 2K5WA 3EFUA 5CHWA 3GD7A 1XD3B 1J0GA 1FPYA 1Z9FA 4NDXA 3W5VB 1QF6A 4L1BA 4LDTD 1R4NI 4I6PA 4KDLB 4KGSA 2F0TA 1BMLC 2ON8A 1I94Q 4EQOA 3HOVH 4KSKC 4GOPA 2DHZA 1KRTA 2OTJA 2KECA 1VQ5A 2OOBB 2K6QA 1AYFA 1A3VA 2X6GA 1L0XB 3PQIA 5LMUL 1IYJB 1WGDA 4A3LH 3TP5A 2MP2B 3HG9A 1SE3A 1XLNA 4HSPA 1ASZA 1BDOA 4JPSA 3W1SA 4RM8A 3ULLA 1V5OA 1ZW7A 2JVCA 3H3VH 2K05A 3BVZA 4W9IA 2RDFA 4YTPB 3RLFA 1JB7A 4LF5Q 2LI5A 1V1PB 3VR3A 5KGUA 4X66Q 4GKJL 2JY6A 4DHZB 2F1MA 3KLSA 1TU2B 5CV7A 4DR2Q 1X56A 2KMMA 2RPVA 2CVRA 1G291 1F9RA 4I7AA 5JVH3 5HHDG 4DHJB 2FHTA 4I65A 2EY6A 5CYUA 3KWVA 3MTNB 1B53A 5I2YA 2ATWA 2K0PA 3PVLA 2LGSA 3M7GA 1G6ZA 3RNCC 2RA4A 3K7AH 4FJVB 2XK5A 1STGA 2CFMA 2KZRA 3PIO3 1G2SA 3K7UC 1KXLA 1C1YB 1VDVA 3DBSA 3UQBA 3STBD 3OTOQ 3CW2C 1NE3A 2B3GA 3K7AB 3MFYA 2LASA 1F2YA 1MHWC 2N49A 5D3IB 2EYMA 2E2JH 2RVLA 3ULPA 2JA5H 2GLSA 2O2LD 1LT4D 4A3CH 3KOJA 3PO3G 2L15A 1E0ZA 4DDID 4NXNL 5E6OA 1ML0D 4YHHQ 3T1YL 5JEAH 2AQ2B 2NN6I 2Y5PA 3PUYA 3RCZA 3KBXA 2HT1A 2R92B 4S0RA 5C4XG 3CXCA 1EF1A 2MRPA 1SYDA 1TTNA 2J52A 4RGNA 2WACA 1QZGA 1PH9A 2J42A 4OO1H 2NWGA 4DR5L 2KJXA 2FNJB 4J1MA 2LRWA 3H7SA 4DK1A 5JJIA 5F2DA 3UI3A 5IP7G 3E5SA 3EROA 3K9PB 4OELB 3CCEA 1YNNC 4HJAA 2E2JB 1P0RA 3H1UA 1GKHA 2IHFA 3IG3A 1ZUD2 3T9LA 5C3XA 1S5DD 3DXJC 4BA1I 2D3GA 2J0JA 3K9OB 1SRUA 2XVSA 1MI2A 2ID0A 3CWIA 4W9GA 1I4GA 2N9KA 1TT2A 3VVWB 5ISRA 5FO8B 1GUAB 3ENEA 4GIVA 1Y14B 4US9A 3GV3A 3M4PA 5AEKB 3S14B 5M3FB 1WXAA 3QJZA 1G91A 2WXHA 3DBLB 1C7YA 3ZNGC 2FAZA 3HGBA 4G57A 4KMUC 2A6ED 4XQQA 2MLBA 5GQOA 1U9RA 3DBRI 3PZ7A 2JXMB 1I6VC 1H9SA 2WXFA 3I3CA 1WFQA 5EBDA 1UGJA 1Y8RC 3R8BA 1EQTA 1YN4A 3HP3A 3Q6SA 3A1QA 3A56A 1FNUA 2Q5WD 1KTKA 2PQAA 1OXVA 2D5GA 1E8ZA 4EQNA 3RZDB 1PH2A 2PO4A 3RZWC 1B7YB 1XMQL 4UP7A 5GMVA 3CP0A 1Y69U 1F2RC 3VA7A 1LV9A 3H9DA 3T3OA 3I4MG 2YVCA 3PO3B 4NJ7A 2ZM6L 2WXLA 1WGKA 5C5LA 3I63C 3S15B 1SYFA 3BG3A 4HAEA 3ZQ4A 4BBSG 4A3JB 1GHJA 4HIDA 1X1MA 2DZIA 1UUPA 1EWIA 1A6XA 1GC7A 1K53A 1Q90A 3VA5A 1BOSA 1RFKA 1IGDA 2R2QA 4RF1A 3UGBB 4A3CG 1E8YA 2REXA 4HEA1 2EXZA 4IUUA 2DZKA 3KH0A 4N6EB 3DWPA 1JOQA 2AYOB 3VQIA 3U7DA 1ICWA 2K01A 2ZPNA 3MWYW 3GTPB 2K03A 2VZKD 3AMUA 5IYCH 3HOVG 2F4IA 5M5WH 1SE4A 1E1TA 1NNXA 3NZSA 4DV1L 3UE1A 4FF2A 3EJIA 4A3BH 2DBYA 1YIWA 3AU5A 4GZYC 4HCSA 2MW5A 1U4RA 4WQOB 3U2SC 2BYTA 5AZHA 3PSEB 4MGIE 1K73C 3RD4A 5FJ8G 2O4XA 1LTLA 2LUEA 2BA0A 2KCTA 2PI2E 2OJRA 3TEHB 3R66C 2CU1A 3VYSA 4IC7B 3AE4B 4E3CA 3L4PA 2E5LL 1PDXA 1KD1C 3QCAA 2NVXB 1VRAB 1TWGB 1XLPA 4DV3Q 1V6EA 4LK1C 4DFAA 5JPNC 4JI2L 1YX5B 3B0AA 3MZ5A 4LF8Q 2CW0C 3R3OA 2L0TA 1P9DU 4K1RB 2KJRA 2WXQA 2UU9L 1K0SA 1IUEA 2NYZD 1BCPD 3H8HA 4GOCA 2LJIA 2BCOA 2ALYB 5ELEA 4DNIA 1GAQB 2INPE 3PLUA 2A68C 4RG1A 1N36Q 5IO9A 1L6UA 3MHBA 4X3TA 1L6VA 1VQKA 3I4NG 4L5RC 2LRUA 4HEDA 1QNUA 4K6LA 1SYBA 3CHBD 5JEAJ 1AZQA 4KKIA 2CKHB 4A3GB 4M01A 2PMVA 2ONQA 2NS5A 3PF4A 1YN5A 5COYA 2B3AA 5EE0A 2PIAA 3RZOB 2A5HA 3A9JA 3MJWA 1GPXA 2VS1A 3DHGC 1KNEA 4KHPQ 1IKMA 1EY7A 4Z9CB 1FD6A 3V60A 2CQAA 1SDFA 3CRKC 2VUMB 3Q6BA 2KACA 3N3KB 4C2MH 2Q2TA 1HNXQ 1WD1A 3H3VC 3AU4A 1PGXA 3CMAA 3PRPB 4K7SA 5ELCA 5BN5A 4GNXA 5JJKA 1P98A 1T0SC 3FRPB 2FFKB 2JA7G 4DHJD 3I56A 3AE1B 1RYJA 1LO5D 5T1GA 2VRRB 2SOBA 4BKGA 4UAIA 1LABA 3F2UA 4K8IA 4AH6A 4A3EG 2B76B 3T4AC 4C2MB 3OG5A 3WALA 2E2HH 4XYQA 5HGTA 4R8IA 3PTFC 3ZKJC 3J7YW 5L83A 3JVZX 2LY7A 3L13A 3AEDB 4LUVA 4JI0L 1VDZA 2YLMA 3RNEC 4IALA 2O6VB 3LWUA 4HJ9A 3S14H 1K0RA 2LGIA 4MTKA 1C4QA 3ERSX 4IOCA 1FEHA 4IJLA 5DNFA 4C3IB 1EIFA 1R4MI 1HTPA 2R92H 3Q0AA 2F0WA 1RIPA 1D2BA 2E76C 1M1KC 1HA6A 1RDPD 3TQYA 1KRSA 3BU2A 3LJ3A 3DVNU 3OWFA 2XTIA 1XNQL 2BH8A 5IYCG 1WF9A 3NHEB 1IL8A 3KK7A 1GUNA 4C3IG 2FMCA 4L8JA 4DAVA 1LGRA 5JPMC 5D7GA 4OW0A 4ZCKA 1EY0A 1AE2A 3CCUA 2VZAA 5J1ZA 3V2TA 4X3UA 1TKEA 3QARA 1I3QB 4A3FB 4IUPA 4KKJA 1MGSA 3AE3B 1XQQA 3RR5A 2DWQA 1HUMA 2AHOB 4XDDA 1X55A 1STBA 2MH7A 5IWAQ 1TIFA 1MPEA 1NEKB 3NHHA 2UWQA 1QUQB 4B3TQ 2KFJA 4P7IA 4MTNA 5JJZA 2VQFQ 2DZJA 2WDRB 2LGDA 1HE8A 4UP8A 4MGZE 1KJTA 2J0KA 2LS01 4B08A 1WY8A 4DBGA 2KDEB 2L7RA 5E6NA 3K0YA 2K8BA 2WV6D 3AXCA 4JW0A 1TS2A 4BXXH 2W3SA 3P1MA 4F8MA 1JB3A 2F0VA 2IL8A 2PZUA 1L0WA 2B63H 2OQKA 3TN2A 3W1GA 5H8YE 3RUIB 3A0JA 3A5ZB 3W5OA 2BW2A 1CKNA 3J80c 4FLHA 1A0IA 5EBCA 1K8OA 2BPSA 3KYDD 5J39A 3C3LA 3CU7A 4C1NK 2C35B 4AQYL 4DXGA 1V1QA 3ZLZA 4XYOA 4YT0B 1RF2D 4K0KL 2SEBD 3AB5A 1L0VB 1KIXA 4NQLB 2NVQH 3PZ8A 4G11A 4LCDE 1J5EQ 1FFUA 4DK5A 3OMCA 3BYTB 2L76A 3B9JA 3OPOA 1JICA 3FP9A 1WR6E 4AOFA 4ODGA 1O7LA 1EQQA 1W3SA 2CH4A 4C4VA 4NPSA 4DV2Q 1IP9A 3PIOA 3HKZG 1QJOA 2IWHA 1G51A 2F0OA 3LX0A 4HIOA 5CV5A 2N0SB 3EUB2 5IGDA 4DV4Q 3H3VI 2I0QA 4ZYNA 2N8NA 4PZ8A 2NBWB 3Q22A 4GDKB 3KJPA 2K8HA 3TUOA 4GMVA 2NUCA 4DXFA 4ZRJA 1ASYA 1I4HA 2K9XA 4FF1A 1PH8A 1WI0A 3T16A 1GUTA 3M95A 3P2BA 2B2YC 3IAM1 4GU2A 1XF5L 4C56C 4M0WB 3PO0A 1MIUA 2VB3X 2VUMG 3OAWA 1KDAA 4MNOA 3KDFA 1NY4A 5FLXc 2MP2A 1GOZA 4DGZA 1UZXB 4A3MB 4FA6A 1PA6A 4GNXB 1QZHA 2PE9A 1J7CA 2KVRA 3L10B 3H7PA 3KFUA 2RDBC 4FP5D 1HNWL 1N6ZA 4L63B 1IBLL 2KBNA 1Y1WB 5I6WA 3VR2A 1C9OA 3MXUA 4GOPB 1VQIA 4JPBW 3RNBC 4B3SL 4A3PA 2BS2B 4HPPA 2J7QB 5G5GA 4DNTB 2UUCL 1HTOA 2L1AA 3NJTA 4L23A 2JYOA 5M5XH 1Z7TA 3M4OB 2IZVB 2L12A 2NN6H 1BBWA 4P75A 4J6HA 3RMKC 4NXMQ 1XEEA 4M8NA 1YHQA 1STHA 3ZDMC 5MPOA 4DK3C 2BB6A 3WIMA 4KJOA 4PK1A 2F03A 5E7NA 2PPBC 5JAVA 1SNDA 4KN7C 2B2YA 5KNBA 4A3JH 2GRIA 2OEDA 1X3QA 4RA8A 5C3EB 5I9OA 1QG7A 1PDQA 4JI4L 4OO1I 2BYEA 3AE5B 4MHEA 3IVFA 5C4XH 3A8KE 5LNK1 2SDFA 2R7ZB 3I2ZA 3OWEB 2MJDA 3G6EA 4LNOA 2LVPA 2KDMA 2LUMA 2N7EA 2PTLA 4A3DB 1B2TA 1WM2A 4BBNC 3J7AV 2G9HD 3P42A 3Q3NC 4HMIA 1NYQA 1UBIA 2JA7H 3BJUA 3MA2B 4BBRH 3KW5B 1SE8A 3D4DA 1RKNA 5CV9A 3SK4A 2V0GA 1I50B 4RHSA 1VCIA 4XIGS 2PI2A 3EFXD 2UUAQ 1WI5A 1SIJA 2FCNA 2N78A 1LFDA 1F52A 2ZZPB 2JN4A 4GDKA 1S72A 5K5PA 2ICEC 3H15A 3AE6B 4UPAA 2UYZB 4HWIB 2NTSA 3TEWA 5IY0A 2KHSA 5C3JB 3ZDTA 4YXDB 2JX5A 3A1QB 3AE2B 2KHWB 3UIPB 2ZT9C 3S1QH 4JG2A 4K5WA 4P73A 5ELDA 2N88A 2EYPA 2DY8A 4DR3Q 1K51A 3I4NH 4BVUC 2KCCA 2I5LX 2HCIA 2W9NA 5KNCA 2AL3A 1GUSA 1W6JA 4HK2A 1I50H 2M00A 2NMQA 5JVG3 5C4JB 2HJ1A 4LJZC 5M5YH 1E7ZA 3RLNA 4A3FH 4LTUA 1VF5C 3HOZB 1PGBA 1H9JA 4LWCA 1JWAD 3B6YA 1SE2A 2D0PA 3HOYG 2Z0DB 3ND9A 4JYAL 2E6XA 4MZ9A 2L9HA 4NB3A 1WCMH 1CKNB 5DLQE 2YU9H 3AEVA 3SK5A 5KEEA 1WTHA 4RKBA 1CSQA 2BWFA 4JWSC 1XYIA 2HTHA 1GJZA 1AN8A 1CQVA 2K25A 1EYGA 1B50A 3JAME 1K50A 1WGYA 5CBAE 1Q0WB 3RNAC 2J0MA 4AYBB 3UINB 2B2WA 1U5KA 4CHKA 5J3BA 3TZUA 3VUWA 1SNPA 2KK8A 2IDYA 4NY0A 2VQEL 4LK0M 4ZHOA 3BZCA 4LNKA 3T53B 1WIAA 1KLUD 2NTTA 4BXXG 1JQYD 2FBWB 2ZNVB 2KC2A 1KABA 4NKLA 4YL8A 2M19A 1VD2A 1VQDA 1ENCA 3P4SB 1VR9A 5IT9E 1TWHH 2BDOA 2VXWA 5TR5A 5FLXL 1WFYA 1UE5A 4WJPA 2D3AA 4JOIA 4QL5A 2BE5C 1L5PA 5E6PA 3WCQA 4EUTA 4K3CA 5FOBB 3GDEA 3U9SA 5GAGC 1GNUA 4WAFA 4ITKA 2B63B 2OCEA 4TQUS 1N32Q 1L1OA 1HJPA 1JQ4A 2JEAI 4HROA 4NZLB 1YNJC 2HDMA 3S1NB 2WX1A 1FIQA 2D07B 5IKCM 3V62A 2Y0SE 2BQQA 4B3MQ 4J3OD 2GBKA 2WDTB 2KQ3A 1BUIC 4GSWA 3VH4B 4LF9Q 2C60A 2KJHB 4OX9L 2LD9A 2NB0A 4A3KH 3V6EB 3NBIA 1VQ4A 3DUZA 2MFIA 3R2TA 5JXVA 2JUOA 1V49A 1PH1A 3U4VA 1XNRQ 3Q8FA 4AYBG 2O6VA 1L0YB 4DK0A 5KNDA 3K59A 1PYWD 3GTJB 1WRIA 1HA5A 2LVQA 3WAMA 4HJKA 5LL6S 1WJNA 3AULA 2R92G 4EOYA 1MSGA 4R4QA 4IPCA 5M3FH 3SXHA 1PHJA 2BWES 4NJCA 2JRIB 3RNGC 4ULLA 4JV5L 4LLGM 2M17A 4ANWA 3J80L 3J81i 3S1NH 1HZ5A 5EQ0A 5CHVC 4JI1Q 3SHLA 4ZRQA 1CZGA 2G9DA 1WJUA 3KF6B 4FDBA 2LHDA 2ZXRA 3NTKA 4QUFA 1D7QA 4PYZA 3EIVA 4XT1B 4IDIA 1JMLA 3HRDD 1Q7YC 3GE8C 4MH8A 1S40A 3AE9B 2QSDA 2WWZA 1BT0A 4LFAQ 3X3MA 2O2VA 3A9KA 5KIXA 5FO7B 5A35A 3PO2H 1NR4A 3KVFB 4BKSD 4AQ7A 3EVQA 1CTMA 2R7DA 1ENFA 4V0BA 5G2NA 2UXCQ 3PUZA 5GXGB 5M3MH 1WZ0A 3A9JB 4XYCA 1L2FA 3KQ4A 1STAA 1F2ZA 2KMAA 4II3B 1A5RA 2AWOA 1I6HB 1SYCA 1SROA 2K8CA 1J9OA 1FJGL 3U9OA 1Y8NB 4IUMB 3CCRA 4JI3Q 3EHVA 5IE8A 2N4FA 3FDTA 1SFOH 1F0ZA 1Y1VB 4N8FA 2N1VA 1DGJA 2ZW0A 3AE7B 1GO3E 3R2IA 3A54A 2EYJA 2GVAA 3IKJA 3ZJYC 3QK0A 3U30A 2K5DA 5CC4A 3ZJTA 2JA5G 1JCKB 2DJGC 4BOZB 2G45B 4ZRZA 3WOFA 3RFZB 4XZ4A 5CR3A 2G1EA 1WCMG 4S3SA 4DAMA 4DF7A 5LMNQ 3L9AX 3PCOB 3U50C 4DV7Q 3J7AF 1TWCH 1UBQA 4RFBA 5C0XH 2C9OA 3KDFB 3MXNA 3QO2A 5IT9c 2HDEA 3ZRFA 1RWSA 1AEXA 2FUHB 2UXBQ 1FNVA 2LFNA 4ZOHC 1ISNA 3A8JE 2F0HA 4FXCA 3UE0A 2EELA 1IKLA 1STYA 1X6OA 2WXIA 3GP7A 4J8QA 4P71A 2LXAA 4POGA 1UH6A 1V81A 1IBXA 5EKKA 3MTSA 4DHZE 1Z47A 2LFIA 1OO9B 2Y0SG 3VHTC 2IBIB 1ZPSA 1GM5A 1MHHE 5JHAA 5IYDH 1QWYA 1D1IA 3UF8A 4KKUA 4CHTB 2M1MA 4A3GG 1C48A 4IURA 4QAYA 1H8CA 3I9V1 3CCMA 4JI6L 5IGBA 4X62Q 3I3TB 4I6LB 3WANA 2P5ZX 4DV6Q 1OXSC 5C0XI 1S5FD 1WGRA 3TEXA 2Z6BA 1R9TB 3KUZA 4Q2JA 2KKCA 4X3KA 1D1KA 3DM3A 2NVQB 3AMZA 1I4QA 4RHRA 2I46A 4F7XA 4LF4Q 2JQRB 4TMAB 1SBBB 1TY0A 1W6KA 2EJMA 2KHIA 3CC7A 1PFDA 5CV4A 4JI8L 1QVFA 4NAWA 1B9NA 2WAQE 2G5DA 2FIDA 1IBKQ 2KQ7A 4IUQA 1V86A 3IT4B 3K0XA 3GTLH 1OQRA 4LFBL 4A3MH 1U4LA 5LHY1 4H7BA 4WFN3 2Z8LA 3U4EG 5EDSA 1YJ1A 4RF0A 2A69C 3DHIC 1XMOQ 1A8VA 5TSSA 2NVYH 1YI2A 1JALA 4K6DA 1CA6A 2BTEA 2JA6G 3TBLD 2KEEA 1QOAA 4W9CA 4A3GH 5E4XA 1LLRD 3GTOH 2HHHQ 2IYDB 3NVYA 2EYLA 2KWCA 2H88B 4GKKQ 1F2RI 1QOHA 4DUZQ 2E2HB 1M4VA 4POFA 2CKZB 2JYEA 4LF7L 4A75A 4KTAA 4IO9A 1N33L 2IW3A 1XTDA 2HTME 4K81A 3ICEA 4XTCS 2BA1A 3AN1A 5C44H 2FCMA 3FKYA 3RN9C 3QC8B 1NAPA 1YJNA 1IW7C 3SU8X 5DCNA 1UE7A 2R7ZH 1HTQA 1R4PB 2JA7B 5HURA 2VH1A 2ZTDA 1NBFC 1WZ3A 1VZ7A 1RAXA 1P8LA 4JI7Q 3N52A 1BO0A 2BBCA 2G4SA 4X65Q 1G2TA 1LT6D 1OEYJ 3TP8A 3F2DA 3OW2A 1IBML 3AEAB 4XE0A 5G5HA 4ANXA 4CGYB 1V9JA 3RZOH 4C3IH 3I4OA 3L16A 5AJ3Q 3ZYYX 1ROEA 1LTBD 2DYOA 4BOSC 3NWSA 4FVMA 4EFOA 2F0SA 1F9PA 3C1EA 2F0UA 1DOXA 1W2BA 2I38A 2JF5A 1DGSA 2B2WC 2CH4W 2I5HA 1HR0Q 4HDQA 1S5CD 1NENB 1O7IA 1C4PA 2D3BA 4XQNA 4W9LA 1X54A 1B70B 5IGFA 5M3MB 2KJ6A 3GE3C 3PO2G 2RR9A 1ZYRC 4X3SA 5DPTA 2WKCA 2CHXA 1ZDXA 3BVGA 1F2LA 2RGFA 3I70A 2UUBL 2D2CC 1AWDA 3PF5A 2ZJPA 2A69D 1UWXA 3J81c 1IYUA 3CIRB 3PHXB 3VTUA 2A6EC 4FNFA 1G6JA 3QHTA 4JIOU 2JZPA 5FJ8H 3TS0A 4A3JG 4IOAA 1C0AA 1NVID 2R93G 2L3ZA 4HCPB 4Q5VA 4A3MG 1NBWA 2FMMA 4WWNA 2INNE 1ZXHA 4REZA 4MH0E 4FADA 2WQYB 2WX0A 2WAQG 1ZXIA 3VDZA 1FCLA 1K3BC 2KFKB 1BNZA 1MJCA 3BDCA 1K3RA 1EY8A 2KNBA 4DR7L 3A4SC 1V1PA 4ZKBB 1B4OA 2KOLA 4IM3A 2PW5A 1Q1EA 3KLRA 2OHFA 1KDBA 1NUCA 1FO4A 1YNXA 4N9F4 1HZ9A 3DMUA 4CJ2C 3S1MB 4PMBA 3M4YA 4OL7A 4EEWA 3NENA 2E2IB 1RRBA 5CORA 1E6EB 1J7BA 1KAAA 3NVVA 1AARA 2EYFA 4LJOB 1KLVA 5J22A 1RHPA 2DX5B 2VB2X 1B3QA 1I3QH 1IHZA 2YTYA 3FVQA 1EY6A 5C44G 2KCMA 1PFSA 4HJ7A 1NI2A 2V1CC 1HCZA 4KV6A 4DV5L 1UELA 1WWTA 2V1YA 4KSLC 4GOPC 1EUVB 4P2CB 1ZDVA 3UQAA 3MP9A 2WHIA 1IXRA 5IGCA 1YN3A 2Z9HA 1EUJA 4N59A 1D3ZA 3TCAA 1VQBA 2EVBA 1UNSA 1SYGA 3NQIA 3SDLC 1ACCA 3C0RB 4HTHA 1DOLA 3NTIA 3FAHA 3AEGB 5CMDA 2J4XA 1E7PB 1Q8KA 3NP8A 3B1LX 4OZCA 3N9YC 2TSSA 1IL2A 2QEJC 3CSTA 1EM7A 2L11A 3PLVA 3GB1A 3M4QA 3ZJUA 2CWAA 4DV0Q 4KIKA 3QIAA 2KYWA 1KQSA 1O78A 4IUVA 1Y56A 1PZKD 2L0CA 3DOWA 4QIWE 3ML9A 4ZAIA 4UY8C 3M9BA 3BIID 4RMAA 3J80E 1PYBA 1N34L 4I6NB 2A6HC 5AUKA 2KUMA 2DNFA 3HFZB 3VDYA 2CS4A 3PPAA 2EIFA 3MVVA 1UAPA 4ICUA 1U4MA 1XXGA 2UXDQ 3CQZH 2F52A 5BN3A 4PZ7A 2INDC 2JA8B 4P1BC 2ZTCA 4LW1A 5C5MA 2N9LA 1GJXA 3ZXVA 4KJNA 1N63A 1FXTB 2JPHA 5BN4A 3J81j 3NUCA 4B3RQ 1PTOH 2AX5A 2RSNA 4DXAB 1TS4A 2HUGA 2PYKA 1PXUA 4XWTA 3T1HQ 4CYEA 1JJGA 4LAAA 3KLSX 1DOIA 2O6VD 2JQOA 2MUYA 1HNZL 5JOBA 2B2UC 1WRDB 2KAJA 2JA8G 2JWUA 2H5XA 1PTOB 1V5TA 2EE1A 4GXBA 4CKEA 4X64Q 1SB3C 1Y1VG 2DUDA 2WU5B 2JA6H 5BMGA 4DR4Q 4JK1C 3AE8B 4FHJA 5EPJA 3HKSA 2KA7A 1JWUD 2L4NA 3IAS1 3VYUA 4F7ZA 2PQAB 2MEKA 3Q8CA 4YY3L 5EE9A 1GUWA 1E90A 1C4CA 2AL6A 3GQBA 1NMGA 3DM1A 1JJ2A 1VMCA 2CHWA 2LGXA 4BY7B 1XPUA 5LXIB 3TP7A 2KANA 4G7OC 3HVZA 2EXDA 3CD6A 5EE1A 4A3BG 4WJWA 4L5QA 4LNIA 4W9JA 3Q14C 2GB1A 3K57A 3NZUA 4JI5L 3JW0X 4BFRA 1O7ZA 4OGQC 2Q2UA 4LFCQ 5A2QE 5KHQA 4MN3A 2K50A 3STBC 4DQOC 4QGUA 4XX5A 4A9AA 5FKAC 2RSUA 5DPWA 2F0MA 3QIJA 1VQ8A 4LF6Q 3S17H 1XPRA 4DR1L 4C3JH 1BBXC 4B0MA 5GADC 5LXHA 2BS3B 4DUYL 2H4OA 2C5CA 3S15H 4HMJA 2LJ5A 1DOMA 4P6VF 4ZUJA 3PRMB 3RZDH 1QILA 2RMMA 1EEID 2F0FA 3Q8BA 3IFDA 1RM6C 2F0PA 1LM0A 4IFDI 2X38A 4RH6A 4DWFA 1CFMA 1U4AA 1QUQA 2EYOA 2Q8TA 1DCZA 5JEAG 3QAQA 3W1SC 4CO7A 3PT2B 4KGRA 1HR0W 2K5VA 5ELOA 3MHZA 4ICVA 2PVOD 2SNSA 4RCNA 3N1YC 2DLBA 1LT3D 3AEBB 1E5WA 4IM2A 1LACA 3P20A 1OXTA 1RD9D 2K1FA 3TREA 3E9SA 1YNND 1JWSD 2LMCA 1SIFA 2XEWA 3FILB 2PMZB 1EYDA 1WTWA 1VLBA 1JRPA 2KN5A 1HFNA 2K28A 3BDLA 2Z1CA 2IHEA 1STNA 1NI3A 4GB9A 3PUXA 3JAMi 4HJ8A 2MX2A 3CMEA 5DAUA 3TEYA 1VQ9A 3W1YA 4XWWA 3DVNV 1Q10A 1CKOA 4DKAC 1U0LA 3DEOA 2WDQB 4GN4B 1DD2A 2DNEA 3J80i 3J81L 4R3DA 5D3DA 4EVOA 1TKWB 1F9JA 3OIPA 3GO5A 1QCBD 4JE3B 1I5FA 1Q12A 2MGSA 4DA2A 4JBMA 1SSNA 1WTQA 1PFBA 2WKDA 1QOBA 1EYAA 1K83B 3VAWA 1RL2A 1R4MB 4IOIE 2BT6A 1Y8PB 3UI2A 3APCA 2QA4A 5BR8L 3DBLI 2LXKA 1UD7A 1IBXB 3U58A 1C79A 4UP9A 3TDQA 4YWLA 4JX1C 4IW0A 2OT2A 4ASWC 3MHSD 3S16H 1BF4A 2IX3A 2BKFA 1IZ6A 1A2TA 4TQ1A 2V3NA 2A73B 3DDCB 4DR6L 2EKIA 4FN2A 4TV3A 2F4VL 2IY1B 2MA9B 1OXUA 4ZRKA 1BCPB 3PHWB 2IY5B 4BY7G 3D31A 3SVMA 1YX6B 3M3YH 4A93H 4AS1A 4ZLTF 4MSMB 4HLEA 1VQCA 3HKZB 1I94L 2KCNA 4EQPA 1FNWA 3VH3B 3MC8A 1X3GA 1NSNS 4EZJA 1V1OA 2ZJRA 3PRZA 3WWVA 3GTJH 3CKIB 2KDBA 2YEPF 2N9EB 3BYYB 3ZRCA 5M3MG 1H9RA 1BVSA 1SSOA 5LMUQ 3HK0A 1S4ZA 5C0XJ 4MELA 1V9PA 3C46A 1P7EA 3ITPA 2JA9A 2JWZA 2KX0A 1QVCA 2B2TA 2F0IA 1WXVA 3KLWA 3E56A 1BBUA 3L2PA 2V3PA 1CJEA 1T9HA 3C8YA 3IXSA 4W9EA 1YBYA 4XGAB 2D11A 3D4RA 1FRRA 5D14A 3D32A 4LF5L 4PG3A 2N55A 2R93H 3QR8A 4GKJQ 2A6HD 2B2VA 4X66L 3J81E 1YMHE 3PREA 4DR2L 1OFFA 3P4PB 1YITA 3VRAB 2L32A 4BY1B 4NPNA 2WAQB 4AIMA 2M9VA 5IP9H 4PNYA 4KY7A 4E6IA 2N9XA 4MJSB 4C4VB 3GZNI 3HOUB 2IO2B 4OZAA 3Q3JA 3N30A 2PEAA 4ACFA 1T0YA 1GG3A 4O0AA 4LUOA 2XWJB 3S1RB 1EQRA 3N6RA 1AZPA 3OTOL 4OIJA 4M00A 3K81C 4B9KA 4QF4A 4IUTA 4WJ3M 1WR1A 1ICFB 3TS2A 4JLCA 4OWXB 1SAPA 3I72A 1GVPA 1KDCA 3FILA 3O13A 2WS3B 3P75A 4NXNQ 4YHHL 2KHJA 1JWMD 1SN8A 3T1YQ 3ER0A 3AH7A 5CTRC 2JU6X 2F0GA 1EYCA 3S1MH 1BQQT 3DQVA 2HQEA 2MJ3A 3PUWA 1J8IA 4IWPA 3ML8A 5JH5C 2PNHA 3Q24A 4PS7A 2K7VA 4K8JA 4U673 1E8WA 1LTSD 2W82A 3D6CA 3S2DH 1PFMA 1I6HH 1E7UA 1PZJD 5IYDG 3HM3A 1ZYRD 3P63A 4IM0A 3TL5A 4QB4A 4F88A 5DM73 2L05A 4HKZE 5DEHA 4DR5Q 2YU9B 2Z0SA 1PRTF 3D0FA 1TT5B 1VQMA 2N9PC 3X0WA 4C7YA 3X23A 4A6QA 1UWMA 5I2XA 3NE5B 1VZ6A 4OWTB 1WMHA 3NUHB 1L1OB 5E1FA 3SR6A 5KYLA 1TZOA 1LQBA 1WE7A 2PKOA 2FJ2A 3LXFA 2IO1B 3WAOA 2VNUD 2WNMA 1X3FA 2BVCA 1QVGA 2JA5B 4JWUC 3K8AA 1NDDA 3BK1A 4OWWB 2CJOA 2BDNA 2N3SA 4IN3A 2MJ8A 1PMRA 3W2DA 1YQ3B 4A3BB 1A70A 1S3SG 4OZBA 4NAMA 5C23A 2F0QA 4KY5A 5EJWA 1WGHA 2AQ1B 5E6JA 1X32A 3SGIA 1RFAA 1C8CA 3SFDB 3DWMA 3BZDB 4ALPA 1NYRA 3NWTA 3CMMB 4MT5A 4EGVA 2IO3B 1UE1A 2GI9A 2PJHA 1TKYA 2AUKA 5LMNW 4G7ZC 2DAFA 2D10A 2BH2A 2D9UA 5BMHA 2ZCBA 1YOVB 1MVKA 1A3TA 4HIMA 2NVTB 3VR6A 3CPWA 1HH2P 1NCVA 1CA5A 1EIYB 3W5UB 1XMQQ 3HOWG 3JSVB 2PNRC 1VS0A 1WCMB 2Z59B 2G4DB 5EGTA 2K6DB 2ZM6Q 2B39A 1ILQA 2ZPYA 2ZJDA 4E71A 5IN7A 3HS0C 4CDDC 3ZNID 2Z4IA 4Q0FA 2GVBA 4IZ8A 3MAQA 3MXGA 1Z6HA 2XWBB 5GAHC 2RQXA 1K8RB 1KM7A 1V97A 3NG0A 1YD8U 1QLBB 4GS3A 2KVZA 2BYVE 2D2QA 3HOYH 4A93B 3QQ8B 2HE7A 1WTOA 2L00B 3CCQA 3FPPA 3G4SA 3K5NA 1EU4A 1X3EA 2M0XA 4X6AH 3R93A 3S24A 1OXXK 2XSCA 3I5JC 4QQBX 4IKGA 3NXWA 4HR7B 2GN5A 2JSOA 4P74A 1S3OA 4RM9A 3AB9A 2WXMA 4MSQB 3P4QB 3H6NA 1SJHD 4IWQA 1MJDA 2OQ0A 1JR0D 1WJ6A 1E3PA 1WX7A 3ECIA 3NS8A 2QW7A 1SXTA 3LWEA 4DV1Q 1MFWA 1WJ4A 1N8RC 2WXNA 1HQMC 3GTKH 4C00A 2IPKD 4JQWC 3BWUD 4OIKA 2QDBA 1CHPD 3DWGC 1SE9A 5HY6A 3H0GH 1K8GA 5K36H 3DLLA 3VR5A 3UDIA 4KHZA 4BBNF 2JYTA 4A3DH 2XK5B 3SEBA 2E5LQ 3BZKA 3SFEB 2ZEQA 3HOZG 5IOCA 5C44B 4BBRB 4DV3L 1QT9A 2K6AA 2NZHA 3MXPA 2LKVA 5E3FA 4JI2Q 4WWMA 1ILPA 2AMCB 4LF8L 4P1CC 1TVXA 1J7AA 3VUXA 2B2VC 2FCSA 4C3JB 4B0EA 2B8FA 4RKLA 3AV8A 4B6WA 1C78A 2NPTA 2UU9Q 2NN6G 3CCLA 2KENA 2B8GA 5HKHA 4I7ZC 4IG7B 3ETRA 4K14A 5J2RA 3ALBA 3E9IA 1XT9B 3G71A 1N36L 3H91A 5CV6A 4BBSB 3GZNB 2FCQA 2EZVA 3L17A 4M0WA 4YTNB 4MM3A 5BYRA 4XQJA 4WWPA 1I7HA 2RDHA 1Y8OB 2RDGA 2ZXOA 1KOTA 4HKQA 1A3UA 4RMFA 3TMEA 5M9OA 4L5SA 1JC7A 3M85A 3S1QB 3QJYA 4ZDVA 1Q1BA 3JAMc 3CC2A 5CX3A 3MFGA 4A76A 2C7HA 4II2B 4H13C 2QDLA 2A8VA 1XO3A 3E9HA 1X3PA 4K3BA 3GTGB 1RLFA 3PGEA 2WXOA 4M02A 5CBEE 4KHPL 4A3EB 1EF5A 2UU7A 1NR2A 1CT1D 4U68A 4GLVB 1TY2A 4FXGC 4PQXA 3Q23A 1HNXL 4GN1A 1JOKA 3RN2A 3AM9A 2K5PA 5CV8A 3V96A 3ZNZB 4FXDA 2AEHA 5CHFA 5I4DA 3HHMA 3MEFA 1BCPF 1MHXA 2JRHA 5M5YB 2KMCA 4LMQD 2JP1A 2C5LC 1ZKHA 2WB1G 3DWAA 4M8MA 1E2ZA 4WWOA 3RPFC 1FFVA 2L8JA 4OVVA 1K8MA 4DK6C 1SF0A 5KYIA 1E0BA 2K14A 1TWAH 4W9FA 4JI0Q 5G3LF 5DPSA 2LGYA 3MEHA 2PVGC 5IAAC 1PH5A 1L7YA 2L0FA 4KGTA 4IFDH 4BA2I 5LLIA 4JVZA 3Q8EA 1KF6B 3GTMB 4QJFA 2L83A 3OMGA 1FGBD 4JBWA 5H1SE 2CJNA 4Y7NB 1K83H 1GXDC 2F0JA 2VY3A 1H9SB 3KBGA 5EPLA 2WB1E 1XCTL 4N8X1 2GBRA 3DHHC 4ID6A 3FC4A 2BF8B 1B9RA 2KTRA 1GHKA 5A2QL 4WURA 4YCVA 4YWMA 1EFWA 4TUUA 1XNQQ 1JW9D 1P1AA 4DNRB 3M7NA 2C9WB 3RI7C 1L2NA 2AKWB 1M94A 4R4OA 3KYHC 4QY7A 1JE5A 1S5ED 3OSOA 1D5ZC 5GROA 1HEZE 1EWYC 3I73A 3VXWA 2FXQA 5KHOA 3APFA 3W9CB 4XT3B 2QIEB 5C2TB 1T3QA 1EWHA 1WD0A 2SAKA 1A2UA 2MP1A 3PGZA 3D8GA 2C7NB 4OVUA 1O7YA 2KT7A 4MGYE 2PW7A 1VQGA 4RCOA 5EKIA 5I9PA 1VQNA 5IWAL 1PH4A 3K6OA 3SDZA 1NJIC 4B3TL 1PTOF 3I4MH 3DVGX 2QILA 4IFDG 4R9WA 2VQFL 1F1HA 4USAA 5G3LD 2K39A 2WB1B 2JA8H 4OVZA 1KHIA 4A3KB 2WINB 3NZ3A 1PFNA 1JRUA 1B8AA 3OJ3A 2BGFA 4B9XA 2QDFA 5ELFA 3L0OA 1PQSA 5EKLA 3HOWH 2PE6B 1E2VA 4H0LC 4N9PA 3EN2A 1KAWA 2O5IC 2OEOA 1C77A 2ZVOA 3A55A 1TWFB 4ZYSA 2KXJA 1Y1WG 3ZW3A 4GLAC 3LB8C 2PQEA 1VQLA 2YYZA 2V3SA 2OF1A 1Q1OA 2CHZA 5I6YA 4EZLA 2RSOA 4YIJA 1Q8IA 2HIVA 3D6WA 4YCWA 1XLQA 5FLXE 3IAYA 1CHQD 1N60A 1E22A 3QG1A 4YCUA 3Q2AC 3V3XA 4AQYQ 2R7ZG 3BDOA 3AEEB 4FJYA 2NZOA 4HXDA 3RLOA 3FPUB 1HZ6A 4K0KQ 2E74C 1KRHA 2M4NA 2W55A 3HZXA 3O65B 4WJOA 1VQOA 1R4QB 5JJLA 2F0LA 1WM3A 2PW9A 4F8CB 2ZNVC 1J5EL 1SFOB 3L54A 2R93B 5IODA 2MPMA 1QQRA 3EC8A 2M8SA 3EFCA 5EE3A 5ELBA 5IOIA 1CI3M 2Z6KA 1YJJA 2PZWA 2RCNA 2J0TD 3ABVB 1JWBD 2Y0SB 4DV2L 2Y5CA 2EQSA 3A7LA 3VYRA 4HSVA 3A5UA 4KKSA 4BZAA 2JSVX 1F9SA 4DV4L 1LUZA 2CW0D 3PO2B 1MG4A 3KJOA 1EO6A 5M5XB 2DNCA 1FR3A 4YSZB 2R6GA 3FKIH 2RPQA 3CF6E 4WJQA 1ZEQX 3B08A 1ET9A 3PIP3 2WXRA 3S17B 4EZKA 1Q5WB 4D2KA 3U8ZA 5L37A 1R4NB 3LGJA 3M62B 3TZDA 2JA6B 5IGEA 5IYBH 4TRDA 3HOUG 1F2MA 2HD3A 3A74A 2W54A 2R61A 1EL0A 4KX6B 5BO4B 4GN5A 1WYGA 3V6CB 4A3EH 1HZCA 3PO3H 1EY9A 4ILWA 1QOFA 1HNWQ 2AWTA 2K3UA 1IBLQ 3NPPA 4GNXC 1VQ7A 1H4RA 1QOGA 2PCFB 1YJIA 4G4KA 4ZQ3A 3OYYA 1OEYA 1XCQL 3ND8A 4UDUC 2WXPA 4US8A 3QOJA 2KWVB 5HG2A 1WTPA 4B3SQ 5G55A 2X69A 1HPCA 1V8QA 2K1BA 4DAPA 2NVTH 2RCFA 4NJ6A 3H09A 2UUCQ 4R8NA 2EY2A 3FKIB 1ZP0B 2XIWA 1PLFA 3H94A 1TJEA 4WH4A 1BR9A 3VYTA 1WXMA 1EOVA 1SMXA 4FBJB 2E3TA 4AWJA 4NXML 4IPHA 1MJEA 3GTPH 2CWPA 3AFPA 2QHOA 3AEFB 2GBNA 1Q3LA 2KDFB 1JROA 2NCNA 1AW7A 3CAMA 1WX8A 5IP9G 2O2VB 1WYWB 3FKIG 2KOXA 2F3IA 3U4ZA 2I07B 1EFID 2K5NA 4O2DA 2RHQB 4JI4Q 3IT6B 2KDIA 4H2AA 3NSWA 5C4ZA 5C4JH 2VH2A 2EJGC 1I42A 2BE5D 1E2WA 2WXGA 3L3OC 2KC1A 3M3JA 5J17A 3C19A 3M63B 4NP5A 3KF6A 3GOEA 4NQKE 3ONAB 5C0XG 4R4IA 2YV5A 1TBEA 2L5TA 3GS2A 4QCLA 1YHBA 3CQZB 2WDVB 3PIPA 2UUAL 2RHSB 5DM63 4TKNA 2LXCA 2R7FA 3ZVVA 3PS6A 4KK7A 3JYUA 2A74C 4CDCC 1QE6A 3QB3A 2DJFC 1UF0A 3GTKB 2JK8A 1L4ZB 3VTVA 1EOTA 2RBMA 2RF4A 1HQRD 5M5WB 5GAEC 2NZ1D 3M4OH 4ANVA 5IIFA 3FHWA 3H0GB 4HVBA 2N7JA 3UDFA 4PMWA 4IPDA 1CZPA 1FXAA 4URKA 5FLMG 2IY0B 4BWGB 4WQMA 3P7JA 4DR3L 5AUIA 1VQEA 2KLCA 1GB4A 3IFTA 1UE6A 3C1FA 3A7AB 4F87A 2B63G 1SGHA 1C4AA 1PV4A 1I35A 4DAYA 2MQJA 2VW9A 4RGMA 1LTGD 3NK9A 4CDEC 2ZXPA 3CF5A 3CRLC 3LYYA 4KVGB 2CHBD 3QX1A 1P16A 2NBVB 5FR3A 2ASBA 1ENAA 3V61A 1M8AA 1E24A 1GB1A 2A19A 4KN4C 4A3IB 3APDA 4JYAQ 2Q8RE 3HM6X 1WOCA 5FK9C 3M3YB 1TGZB 2ZCCA 4KV2A 5AZGA 2KQSA 4BY1H 3SR1A 1I4RA 4RNAA 1I4XA 5C3EH
chains in the Genus database with same CATH topology
3C2PA 1UEAB 4A55A 1TWHB 1TQOA 3W3AA 1B44D 3NQTA 3T56B 1HFGA 2JE6I 1F9QA 4O1NA 5HFYA 4PV1C 3J9CA 1DM0B 1D5XC 3I91A 4EE2A 2E75C 4XXEA 1OQQA 1T5EA 3NRZA 1XTCD 3I57A 3DHQA 2IGHA 1EZ6A 4A90A 1TS3A 2F3WA 4HJGE 3G6JB 3K5LA 1MD2D 1SEBD 3BVMA 5CGKA 1SJED 3GV6A 3S9WA 2V4IB 3QOLA 4NW2A 2HDLA 4GDLB 1KH0A 2ACZB 2HCCA 4FO2A 4L2YA 1F77A 3DWQA 4WIPA 3KWLA 1T5XD 2K5QA 2BOSA 3OIQA 3OHXC 2H1EA 4WRDA 2WU2B 5T1IA 3S2DB 1CM9A 4OO1G 1RCVD 3ZJVA 4V190 1FXIA 3HEJA 3D3RA 1H9KA 3TP6A 1HRJA 2M56B 4QMGA 3K58A 5C3WA 4CQNA 1WVLA 3X3NA 4IFDJ 2V4DA 4C80A 2B2TC 4DN4M 3VR9B 3SK6A 1T6BX 1CZWA 1LTRD 2VZKB 4IUNA 3VRBB 2QKIC 2FE8A 3I90A 4ZHPA 1FD7D 1RJTA 3D4WA 3MC0B 4H44C 4M8AA 2GA4B 1B3AA 1WTRA 1FM0D 1HUNA 1TR5A 1SMYD 1XWEA 1LTAD 4MM3B 1DJRD 3NS1A 4G7HC 4ARIA 3B2GA 1K52A 1EWCA 1IGCA 1ZXTA 2Y3AA 4M1UB 2AWNA 2A68D 2EPBA 1QNKA 1KLGD 1HHVA 3BS1A 2JEBI 3BK2A 4MACA 2XRQD 4ZUIA 1YQ4B 5C4XB 2ENBA 3KUPA 1II3A 2ICIA 3OW7A 2MJEA 4C7ZA 4K5VA 5D65A 3HVDA 4TQ0A 1E9MA 1S5BD 2FINB 4XDCA 3AU7A 3MJ5A 5BMIA 2M2LA 1BXTA 5IT9L 1JE4A 3SK8A 1QB5D 3HUIA 1ET6A 2SNMA 2I2YA 1XLOA 4FF3A 2EY1A 3B2FA 3ZGZA 1PRTD 1FCCC 2W3RA 1AFPA 4CKCA 1PGAA 2F0NA 2OXPA 2LMCB 2KQ4X 1PRTB 2K04A 3E0JA 4PMCA 1STEA 3JAML 2DN8A 3I4LA 3K5MA 3I4NB 1LT5D 2MHVA 4C1NI 3RUZA 1MSHA 4P16A 4CKBA 2TMPA 1P7FA 2K32A 4O42A 2H89B 2ZW1A 4YSYB 1E10A 2IT1A 5LL6X 3G7LA 4RGTA 3DEPA 3GTQB 2M0AA 2XRSD 4CBVA 1EQVA 4ME5A 4KHVA 4RAUC 2L1BA 1SNMA 2F0EA 2IGDA 2F0DA 4K2KA 1ESFA 4A8XC 3K5OA 4RWSC 1EU3A 3HOVB 3U7ZA 1N62A 2E2DC 3S16B 2L52A 1H9MA 1TWAB 2WIIB 2AUJD 2EDGA 3EQLC 1SNOA 2KWDA 1TKGA 1CQFA 2O5JC 4ABNA 2QMTA 3T13A 3I8ZA 1ZE3D 4KI0A 5EPKA 3VR4A 1SYEA 1VZ8A 1C9FA 2EY5A 1RTOA 1WTVA 1DOYA 3I4MB 1N5XA 2IJ0A 4YWGG 1B9MA 3NTHA 4QUCA 4CJ0B 3NVWA 3WOEA 4TSSA 3AECB 1GUOA 2Q8IB 4C3JG 5K36G 1HXYD 4QIWB 5C6AA 4KD3A 1RODA 2RKSA 3SE0A 3NBHA 1R7SA 4L6TB 1SNQA 3HOWB 5KRUA 1C76A 1B1ZA 4HN7A 4N9TA 2KVMA 1MI0A 2B2UA 3U52E 4K5XA 4DU9A 4GLSC 4FXKC 2JXTA 1EIGA 1EZ8A 2WXKA 4C3HG 2D62A 3HRZC 3NVZA 1U4PA 2XN9C 2BB5A 3QWNA 4BS9A 4RGOS 3TEZA 2IX0A 1DXMA 2KEDA 2EYHA 2EOTA 1WXQA 5E4WC 1D6EC 1I4PA 2J7ZA 2PZTA 2FUG1 3V05A 5NUCA 5C4HA 3HOXB 3FMCA 2KN4A 5HI1A 5AFWA 1KNAA 4N58A 1BCPC 3P1HA 3FEWX 2K33A 1O80A 2CU3A 3TBIB 1VMPA 2QF7A 1IW7D 3P4RB 1D5MC 3T51B 2X6LA 1FMAD 3Q69A 5BYSA 1TIID 2LEKA 4HRSA 3VR8B 1YNTE 2Z4HA 2XNAC 1ONLA 1GUGA 3H6MA 1SMYC 1WSPA 1TWCB 4TKOB 1TS5A 3RMHA 4B9WA 3OOCA 1EY4A 1DYQA 1FYCA 2R3ZA 1DZ1A 1BUVT 4ZK9B 5BYQA 2EJFC 2IX1A 1PTOC 1ZOYB 2QCPX 3PMFA 4K2LA 1V8CA 1VJKA 1LTID 3WDNA 1KFYB 5IGGA 4ARCA 4KKTA 1ESRA 1JORA 2L55A 3L7ZC 2NBFA 1IYVA 4PT5A 1EY5A 4NAWB 1DOKA 4HCEA 2QJLA 1QKZA 4OHJA 1RTNA 1PUTA 3Q8AA 1N5WA 2K22A 2F0KA 3GTOB 1CK1A 1G8ZD 3KF8A 1JOOA 2NVYB 4FF4A 3TSSA 1AP0A 1VF7A 3LNNA 1PRTC 5H92C 1L4DB 3GTLB 3S2HB 3A8IE 3T3NA 2F3VA 3IL8A 1XX8A 3HOYB 4FYDA 1ZKOA 2WXJA 4CJ1B 2BS4B 1DONA 3PV0A 1EIHA 2IGGA 1EEFD 2WP9B 3PUVA 4YTMB 4KY6A 1YNJD 1PTOD 4WORA 3URYA 2YEPB 3E6ZX 1HTLD 5T8IA 2LHEA 4C3HB 2WP8J 4YSXB 1LTTD 4ZRPA 5FO9B 1N61A 2D5DA 2WLBA 1A15A 4IQZA 1PZID 1TYGB 4NMZA 1SNCA 3ERQA 2PLPA 2J53A 2DY7A 4XDXA 1MBYA 3EA6A 3EGRA 4MIUA 1D4BA 1V43A 4ZKCB 4KD4A 2AQ3B 1WTXA 2DYMA 2K5WA 3GD7A 1QF6A 4NDXA 3W5VB 4L1BA 4KGSA 2F0TA 1BMLC 2ON8A 4EQOA 2KECA 1AYFA 1A3VA 2X6GA 1L0XB 3TP5A 3HG9A 1SE3A 1XLNA 4HSPA 1BDOA 4JPSA 3W1SA 2K05A 3BVZA 2RDFA 4YTPB 3RLFA 1V1PB 3VR3A 5KGUA 2F1MA 3KLSA 1TU2B 5CV7A 2KMMA 2RPVA 2CVRA 1G291 1F9RA 5JVH3 5HHDG 2FHTA 4I65A 2EY6A 5CYUA 3KWVA 1B53A 5I2YA 2K0PA 3M7GA 1G6ZA 2RA4A 1STGA 3PIO3 1G2SA 1VDVA 3MFYA 3K7AB 1F2YA 5D3IB 2EYMA 2RVLA 2O2LD 1LT4D 1E0ZA 1ML0D 5JEAH 2AQ2B 2NN6I 2Y5PA 3PUYA 3KBXA 2R92B 1SYDA 2J52A 4RGNA 2WACA 2J42A 4OO1H 2NWGA 2KJXA 4J1MA 4DK1A 5F2DA 3UI3A 3E5SA 3EROA 2E2JB 1YNNC 1ZUD2 5C3XA 1S5DD 3DXJC 4BA1I 1MI2A 2ID0A 2XVSA 3CWIA 1I4GA 2N9KA 1TT2A 5ISRA 5FO8B 4US9A 3GV3A 3S14B 5M3FB 1G91A 2WXHA 3HGBA 4G57A 4KMUC 2A6ED 4XQQA 3PZ7A 1U9RA 2JXMB 1I6VC 1H9SA 2WXFA 3I3CA 5EBDA 1UGJA 3R8BA 1EQTA 1YN4A 3HP3A 3Q6SA 3A56A 1FNUA 2Q5WD 1KTKA 1OXVA 2D5GA 4EQNA 3RZDB 2PO4A 1Y69U 1F2RC 3VA7A 1LV9A 3T3OA 3PO3B 2WXLA 1WGKA 5C5LA 3S15B 1SYFA 3BG3A 4HAEA 3ZQ4A 4A3JB 1GHJA 1UUPA 1A6XA 1K53A 1Q90A 3VA5A 1BOSA 1RFKA 1IGDA 4RF1A 4HEA1 2EXZA 4IUUA 4N6EB 3DWPA 1JOQA 3VQIA 1ICWA 2K01A 3MWYW 3GTPB 2K03A 2VZKD 3AMUA 2F4IA 1SE4A 4FF2A 3EJIA 2DBYA 2BYTA 4GZYC 4HCSA 3U2SC 1U4RA 3RD4A 2O4XA 2BA0A 3VYSA 3AE4B 3L4PA 1PDXA 2NVXB 1VRAB 1TWGB 1XLPA 4LK1C 4DFAA 5JPNC 3MZ5A 2CW0C 3R3OA 2WXQA 1IUEA 2NYZD 1BCPD 3H8HA 2LJIA 2BCOA 5ELEA 1GAQB 2INPE 2A68C 1L6UA 3MHBA 4X3TA 1L6VA 4HEDA 1QNUA 4K6LA 1SYBA 3CHBD 5JEAJ 1AZQA 4KKIA 4A3GB 2PMVA 2ONQA 1YN5A 5COYA 5EE0A 2PIAA 3RZOB 2A5HA 1GPXA 1KNEA 1IKMA 1EY7A 4Z9CB 1FD6A 2CQAA 1SDFA 3CRKC 2VUMB 2KACA 1WD1A 3H3VC 1PGXA 5ELCA 5BN5A 3FRPB 2FFKB 3AE1B 1RYJA 1LO5D 5T1GA 2SOBA 4UAIA 1LABA 3F2UA 4K8IA 2B76B 3T4AC 4C2MB 4XYQA 5HGTA 4R8IA 3J7YW 2LY7A 3AEDB 1VDZA 4IALA 3LWUA 2LGIA 1C4QA 1FEHA 5DNFA 4C3IB 1HTPA 3Q0AA 2F0WA 1D2BA 1HA6A 2E76C 1RDPD 3OWFA 1IL8A 3KK7A 1GUNA 4C3IG 2FMCA 4L8JA 4DAVA 5JPMC 5D7GA 4OW0A 1EY0A 5J1ZA 4KKJA 3V2TA 4X3UA 1TKEA 1I3QB 4A3FB 4IUPA 1MGSA 3AE3B 2DWQA 1HUMA 4XDDA 1STBA 2MH7A 1MPEA 1NEKB 3NHHA 5JJZA 2WDRB 2LS01 4B08A 3K0YA 2WV6D 1TS2A 2W3SA 3P1MA 4F8MA 1JB3A 2F0VA 2IL8A 2PZUA 3TN2A 5H8YE 2BW2A 5EBCA 1K8OA 5J39A 3C3LA 3CU7A 4C1NK 4DXGA 4XYOA 4YT0B 1RF2D 2SEBD 3AB5A 1L0VB 3PZ8A 1FFUA 3OMCA 3BYTB 3B9JA 3OPOA 1JICA 4ODGA 1O7LA 1QJOA 2IWHA 2F0OA 3LX0A 5CV5A 2N0SB 3EUB2 5IGDA 4GDKB 3Q22A 3TUOA 2NUCA 4DXFA 1I4HA 2K9XA 4FF1A 3T16A 1GUTA 2B2YC 3IAM1 1XF5L 4C56C 3PO0A 2VB3X 1KDAA 1GOZA 4DGZA 4A3MB 1J7CA 4FP5D 4L63B 1Y1WB 5I6WA 3VR2A 3MXUA 2BS2B 5G5GA 4DNTB 2L1AA 4L23A 2JYOA 1Z7TA 3M4OB 2L12A 2NN6H 4J6HA 1XEEA 1STHA 5MPOA 2BB6A 4KJOA 2F03A 2PPBC 5JAVA 1SNDA 4KN7C 2B2YA 5KNBA 2GRIA 2OEDA 1X3QA 4RA8A 5C3EB 5I9OA 1QG7A 1PDQA 3AE5B 4OO1I 5LNK1 4MHEA 3A8KE 2SDFA 2R7ZB 3OWEB 2MJDA 2KDMA 2LUMA 2PTLA 4A3DB 1B2TA 3J7AV 2G9HD 3P42A 4HMIA 1NYQA 3MA2B 3D4DA 1RKNA 5CV9A 3SK4A 2V0GA 1I50B 4RHSA 1VCIA 4XIGS 3EFXD 1SIJA 5K5PA 2ICEC 3AE6B 2NTSA 3TEWA 2KHSA 5C3JB 4YXDB 2JX5A 3AE2B 2ZT9C 4K5WA 5ELDA 2N88A 2EYPA 2DY8A 1K51A 2KCCA 2HCIA 5KNCA 1GUSA 1W6JA 2M00A 2NMQA 5JVG3 5C4JB 4LJZC 4LTUA 1VF5C 3HOZB 1PGBA 1H9JA 1JWAD 1SE2A 3ND9A 2E6XA 2L9HA 3SK5A 5KEEA 4RKBA 4JWSC 1XYIA 1AN8A 1CQVA 1B50A 3JAME 1K50A 5CBAE 4AYBB 2B2WA 3TZUA 1SNPA 2IDYA 4LK0M 4ZHOA 3T53B 1KLUD 2NTTA 1JQYD 2FBWB 1KABA 4NKLA 2M19A 1ENCA 3P4SB 1VR9A 5IT9E 2BDOA 2VXWA 5FLXL 3WCQA 1L5PA 2BE5C 5FOBB 3U9SA 4WAFA 4ITKA 2B63B 4TQUS 1JQ4A 2JEAI 4HROA 4NZLB 1YNJC 2HDMA 3S1NB 1FIQA 4J3OD 2KQ3A 1BUIC 2NB0A 3NBIA 3DUZA 5JXVA 3R2TA 3Q8FA 1L0YB 4DK0A 5KNDA 3K59A 1PYWD 3GTJB 1WRIA 1HA5A 5LL6S 1MSGA 3SXHA 4NJCA 4ULLA 4LLGM 3J80L 1HZ5A 5EQ0A 3SHLA 4ZRQA 1CZGA 2G9DA 2LHDA 2ZXRA 3NTKA 4QUFA 4XT1B 4IDIA 1JMLA 3HRDD 4MH8A 3AE9B 2QSDA 3X3MA 5KIXA 5FO7B 5A35A 1NR4A 4AQ7A 3EVQA 1CTMA 1ENFA 4V0BA 3PUZA 5GXGB 3KQ4A 1STAA 1F2ZA 2AWOA 1I6HB 1SYCA 1J9OA 3U9OA 1Y8NB 3FDTA 1F0ZA 1Y1VB 1DGJA 2ZW0A 3AE7B 3R2IA 3A54A 2EYJA 3IKJA 2K5DA 5CC4A 3ZJTA 1JCKB 4ZRZA 3WOFA 3RFZB 5CR3A 2G1EA 4S3SA 4DF7A 1FRDA 3L9AX 3J7AF 4RFBA 5C0XH 2C9OA 3MXNA 3QO2A 2HDEA 1RWSA 1AEXA 1FNVA 2LFNA 4ZOHC 3A8JE 2F0HA 4FXCA 2EELA 1IKLA 1STYA 2WXIA 3GP7A 4J8QA 1IBXA 5EKKA 3MTSA 1Z47A 2LFIA 1OO9B 1ZPSA 1MHHE 1QWYA 1D1IA 4KKUA 4CHTB 1C48A 4IURA 3I9V1 5IGBA 1OXSC 5C0XI 1S5FD 3TEXA 1R9TB 4Q2JA 4X3KA 1D1KA 2NVQB 3AMZA 1I4QA 4RHRA 2I46A 4F7XA 4TMAB 2JQRB 1SBBB 1TY0A 1W6KA 2EJMA 1PFDA 5CV4A 1B9NA 4IUQA 3IT4B 1OQRA 1U4LA 5LHY1 4H7BA 4WFN3 2Z8LA 3U4EG 4RF0A 2A69C 5TSSA 1JALA 4K6DA 1CA6A 2BTEA 2KEEA 1QOAA 5E4XA 1LLRD 3NVYA 2EYLA 2H88B 1F2RI 1QOHA 2E2HB 1M4VA 2JYEA 4KTAA 2HTME 2IW3A 4XTCS 2BA1A 3AN1A 1NAPA 1IW7C 1R4PB 2JA7B 5HURA 1VZ7A 3N52A 1BO0A 2BBCA 1G2TA 1LT6D 3AEAB 3TP8A 4XE0A 5G5HA 4CGYB 3ZYYX 1ROEA 1LTBD 2DYOA 3NWSA 4FVMA 2F0SA 1F9PA 3C1EA 2F0UA 1DOXA 2I38A 2B2WC 1S5CD 1NENB 1C4PA 4XQNA 5IGFA 5M3MB 1ZYRC 4X3SA 2WKCA 1ZDXA 3BVGA 1F2LA 3I70A 2D2CC 1AWDA 1UWXA 2A69D 1IYUA 3CIRB 2A6EC 4FNFA 2JZPA 1NVID 4Q5VA 2FMMA 2INNE 1ZXHA 4REZA 2WQYB 1FCLA 1ZXIA 1BNZA 3BDCA 1EY8A 1V1PA 4ZKBB 1B4OA 2KOLA 2PW5A 1Q1EA 3KLRA 2OHFA 1KDBA 1NUCA 1FO4A 3DMUA 4CJ2C 3S1MB 4PMBA 3M4YA 4OL7A 2E2IB 5CORA 1E6EB 1J7BA 1KAAA 3NVVA 2EYFA 5J22A 1RHPA 2VB2X 1IHZA 3FVQA 1EY6A 4KV6A 1HCZA 1WWTA 4P2CB 1ZDVA 3MP9A 5IGCA 1YN3A 4N59A 2EVBA 1UNSA 1SYGA 3NQIA 1ACCA 4HTHA 1DOLA 3NTIA 3FAHA 3AEGB 5CMDA 2J4XA 1E7PB 3NP8A 4OZCA 3N9YC 2TSSA 3ZJUA 2QEJC 1EM7A 2L11A 3GB1A 3QIAA 1O78A 4IUVA 1Y56A 1PZKD 2L0CA 4ZAIA 3BIID 3J80E 2A6HC 5AUKA 2KUMA 3MVVA 1UAPA 1U4MA 1XXGA 5BN3A 2JA8B 5C5MA 2N9LA 1GJXA 4KJNA 1N63A 5BN4A 3NUCA 1PTOH 2AX5A 2RSNA 1TS4A 2HUGA 2PYKA 1PXUA 4XWTA 4LAAA 3KLSX 1DOIA 2MUYA 5JOBA 2B2UC 2KAJA 2JWUA 1PTOB 2EE1A 4CKEA 1SB3C 2WU5B 5BMGA 4JK1C 3AE8B 5EPJA 2KA7A 1JWUD 2L4NA 3IAS1 3VYUA 3Q8CA 2MEKA 5EE9A 1GUWA 1C4CA 3GQBA 3DM1A 1VMCA 4BY7B 3TP7A 4G7OC 3HVZA 5EE1A 4WJWA 2GB1A 3K57A 1O7ZA 4OGQC 5A2QE 4MN3A 4DQOC 4A9AA 5FKAC 2F0MA 1BBXC 4B0MA 2BS3B 2H4OA 2C5CA 4HMJA 4P6VF 1DOMA 4ZUJA 1QILA 2RMMA 1EEID 2F0FA 3Q8BA 3IFDA 1RM6C 2F0PA 4IFDI 2X38A 4RH6A 1CFMA 2EYOA 2Q8TA 1DCZA 5JEAG 4KGRA 3MHZA 2PVOD 2SNSA 4RCNA 2DLBA 1LT3D 3AEBB 1LACA 3P20A 1OXTA 1RD9D 3E9SA 1YNND 1JWSD 2LMCA 3FILB 2PMZB 1EYDA 1WTWA 1VLBA 1JRPA 1HFNA 2K28A 3BDLA 2Z1CA 1STNA 1NI3A 3PUXA 5DAUA 3TEYA 4XWWA 1Q10A 3DEOA 2WDQB 1DD2A 2DNEA 3J81L 4R3DA 5D3DA 4EVOA 1TKWB 3OIPA 3GO5A 1QCBD 4JE3B 1Q12A 2MGSA 4DA2A 1SSNA 1WTQA 1PFBA 2WKDA 1QOBA 1EYAA 1K83B 4IOIE 2BT6A 1Y8PB 3UI2A 1IBXB 1C79A 3TDQA 4JX1C 2OT2A 1BF4A 2IX3A 1A2TA 4TQ1A 2V3NA 2A73B 2EKIA 1OXUA 1BCPB 3D31A 3SVMA 4AS1A 4ZLTF 3HKZB 2KCNA 4EQPA 1FNWA 1NSNS 1V1OA 3CKIB 2YEPF 3BYYB 1H9RA 1SSOA 1S4ZA 5C0XJ 3C46A 1P7EA 3ITPA 2F0IA 2B2TA 3E56A 2V3PA 1CJEA 3C8YA 3IXSA 3D4RA 1FRRA 5D14A 2N55A 2A6HD 2B2VA 3J81E 1YMHE 3P4PB 1OFFA 3VRAB 2L32A 4BY1B 2WAQB 2M9VA 4PNYA 4KY7A 4E6IA 3HOUB 4OZAA 2XWJB 3S1RB 3N6RA 1AZPA 4OIJA 4QF4A 4IUTA 1SAPA 3I72A 1KDCA 3FILA 3O13A 2WS3B 3P75A 1JWMD 3AH7A 2JU6X 2F0GA 1EYCA 1BQQT 2HQEA 2MJ3A 3PUWA 1J8IA 3Q24A 2K7VA 4K8JA 4U673 2W82A 1LTSD 1GB4A 3D6CA 1PFMA 3P63A 1PZJD 1ZYRD 4QB4A 4F88A 5DM73 4HKZE 5DEHA 2YU9B 1PRTF 4C7YA 4A6QA 1UWMA 5I2XA 3NE5B 1VZ6A 3SR6A 3NUHB 5E1FA 5KYLA 1TZOA 2PKOA 2FJ2A 3LXFA 2VNUD 2WNMA 2JA5B 4JWUC 3BK1A 2CJOA 2BDNA 4IN3A 2MJ8A 1PMRA 3W2DA 1YQ3B 4A3BB 1A70A 4OZBA 4NAMA 2F0QA 4KY5A 5EJWA 2AQ1B 5E6JA 1X32A 1C8CA 3SFDB 3DWMA 3BZDB 1NYRA 3NWTA 4MT5A 4EGVA 2GI9A 1TKYA 2AUKA 4G7ZC 2D9UA 5BMHA 1MVKA 1A3TA 2NVTB 3VR6A 1NCVA 1CA5A 3W5UB 2PNRC 1WCMB 5EGTA 2B39A 1ILQA 3HS0C 2Z4IA 4Q0FA 4IZ8A 3MAQA 3MXGA 1Z6HA 2XWBB 2RQXA 1V97A 1QLBB 4A93B 1WTOA 3FPPA 3K5NA 1EU4A 3R93A 1OXXK 2XSCA 4IKGA 3NXWA 4HR7B 2JSOA 3AB9A 2WXMA 3P4QB 1SJHD 1JR0D 3LWEA 1SXTA 2WXNA 1HQMC 2IPKD 3BWUD 4OIKA 2QDBA 1CHPD 3DWGC 5K36H 3VR5A 4KHZA 2JYTA 3SEBA 3SFEB 5IOCA 5C44B 4BBRB 1QT9A 2K6AA 3MXPA 2LKVA 5E3FA 4WWMA 1ILPA 1TVXA 1J7AA 4B0EA 2B2VC 4C3JB 2B8FA 4RKLA 3AV8A 1C78A 2NN6G 2B8GA 4I7ZC 3ETRA 4K14A 3H91A 5CV6A 4BBSB 4M0WA 2EZVA 4YTNB 5BYRA 4XQJA 1I7HA 2RDHA 1Y8OB 2RDGA 2ZXOA 4HKQA 1A3UA 3TMEA 5M9OA 3S1QB 1JC7A 3M85A 3QJYA 1Q1BA 3MFGA 4H13C 1XO3A 1X3PA 3GTGB 2WXOA 5CBEE 4A3EB 1NR2A 1CT1D 4U68A 1TY2A 4FXGC 4PQXA 3Q23A 1JOKA 3AM9A 2K5PA 5CV8A 3V96A 4FXDA 5I4DA 1BCPF 1MHXA 5M5YB 4LMQD 2JP1A 3DWAA 1E2ZA 3RPFC 1FFVA 1K8MA 1SF0A 5KYIA 1E0BA 5G3LF 3MEHA 2PVGC 4KGTA 4IFDH 4BA2I 3Q8EA 1KF6B 3GTMB 2L83A 3OMGA 1FGBD 4JBWA 2CJNA 4Y7NB 1GXDC 5EPLA 2F0JA 3KBGA 1H9SB 1XCTL 3FC4A 1B9RA 4ID6A 1GHKA 5A2QL 4WURA 1JW9D 4DNRB 3M7NA 1S5ED 3OSOA 1D5ZC 1HEZE 1EWYC 3I73A 3W9CB 4XT3B 2QIEB 5C2TB 1T3QA 1EWHA 1WD0A 2SAKA 1A2UA 2MP1A 3D8GA 1O7YA 2PW7A 4RCOA 5EKIA 5I9PA 3K6OA 3SDZA 1PTOF 2QILA 4IFDG 4R9WA 4USAA 5G3LD 2WB1B 4OVZA 4A3KB 3NZ3A 2WINB 1PFNA 4B9XA 5ELFA 5EKLA 1E2VA 4H0LC 2O5IC 4N9PA 1C77A 2OEOA 3A55A 1TWFB 4ZYSA 3LB8C 2PQEA 2YYZA 2OF1A 5I6YA 2RSOA 4YIJA 1Q8IA 3D6WA 1XLQA 5FLXE 3IAYA 1CHQD 1N60A 3QG1A 3V3XA 3AEEB 3BDOA 3FPUB 1HZ6A 2E74C 1KRHA 2W55A 3HZXA 1R4QB 2PW9A 2F0LA 1SFOB 2R93B 5IODA 2MPMA 1QQRA 5EE3A 5ELBA 1CI3M 1YJJA 2PZWA 2J0TD 3ABVB 1JWBD 2Y0SB 2Y5CA 3VYRA 3A7LA 4HSVA 4KKSA 2JSVX 1F9SA 2CW0D 3PO2B 5M5XB 2DNCA 1FR3A 4YSZB 2R6GA 1ZEQX 1ET9A 3PIP3 2WXRA 3S17B 4D2KA 3TZDA 2JA6B 5IGEA 4TRDA 1F2MA 2W54A 2R61A 1EL0A 4KX6B 1WYGA 1EY9A 4ILWA 1QOFA 2K3UA 3NPPA 1QOGA 1YJIA 2PCFB 4G4KA 4ZQ3A 1XCQL 2WXPA 3ND8A 4UDUC 4US8A 3QOJA 5HG2A 1WTPA 2X69A 1HPCA 1V8QA 2K1BA 4DAPA 3H09A 4R8NA 2EY2A 3FKIB 1ZP0B 2XIWA 1PLFA 3H94A 1TJEA 4WH4A 1BR9A 3VYTA 2E3TA 3AEFB