1B1ZA

Streptococcal pyrogenic exotoxin a1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
b'DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TOXIN)
publication title Structural basis for the recognition of superantigen streptococcal pyrogenic exotoxin A (SpeA1) by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 58
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b1zA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b1zA02
1LTAD 4RFBA 1BXTA 3W2DA 1EU4A 1ET9A 1JR0D 4DXFA 3MC0B 2AQ1B 3BYYB 1V1PA 3TSSA 1LTBD 1D6EC 1TY2A 1STEA 2AQ3B 2WV6D 4C56C 2CHBD 1FGBD 3R8BA 1PRTF 1SBBB 4DXGA 1L0YB 1YN4A 1SE4A 1FNUA 1RCVD 1JWSD 1V1PB 4RH6A 1PZJD 2SEBD 3EFXD 3GP7A 1LT6D 1PYWD 1S5ED 1PTOH 2O2LD 4RCOA 3URYA 1BCPD 1LT5D 1JWMD 1I4QA 4L63B 4OHJA 1B1ZA 1SJHD 1YN3A 4TSSA 1SE3A 1EEID 1FNWA 1LTTD 3CHBD 1CHQD 1G8ZD 2QEJC 5ELBA 1CHPD 3EA6A 2J4XA 1XXGA 3BVGA 1HXYD 1EU3A 5ELCA 1HTLD 4RGOS 1S5CD 1MD2D 5I4DA 1FNVA 3R2IA 1AN8A 1YN5A 1S5BD 5FKAC 1BCPF 1PTOB 1EFID 1I4GA 1LT4D 1TS3A 1LLRD 1SJED 3V05A 5ELFA 1LTGD 1HA5A 1UUPA 1PRTB 2NTTA 2XRSD 2Z8LA 1T5XD 1PTOC 3BVMA 1L0XB 2NTSA 1LTID 1JQYD 5TSSA 1BCPB 1SEBD 1TS4A 2XRQD 1HQRD 3R2TA 3KLSX 4RHSA 4NZLB 1DJRD 5ELEA 1AW7A 1LO5D 1KTKA 1S5DD 4BWGB 1D5MC 4UDUC 1I4HA 1JCKB 3SEBA 1PZID 1EEFD 4O1NA 1D5ZC 1SE2A 1TS5A 1ESFA 2RDGA 1LTSD 1RD9D 1S5FD 1KLUD 3BZDB 4RHRA 1M4VA 5ELDA 1DYQA 1ET6A 1RF2D 1B44D 1D5XC 1ENFA 4Z9CB 1RDPD 5D3IB 3O13A 4RGMA 1CQVA 4ZYSA 1PTOD 1CT1D 4RGNA 1LT3D 2XNAC 1XTCD 1I4RA 2QILA 2IJ0A 1I4PA 1TY0A 2R61A 4RGTA 2AQ2B 1FD7D 3OWEB 1PRTC 1TS2A 5D3DA 4L6TB 2IPKD 1PRTD 3BVZA 1I4XA 1PZKD 1V1OA 3MFGA 1LTRD 1SXTA 2XN9C 2G9HD 5FK9C 2ICIA 2TSSA 1BCPC 1KLGD 3DWAA 1EWCA 1GOZA 1F77A 3DWPA 4K6LA 1CK1A 2RDHA 1QILA 1UNSA 1PTOF 3BYTB 3DWQA 1JWUD
chains in the Genus database with same CATH superfamily
1V1QA 2UXBL 3AB9A 1GUWA 2PPBC 2KXJA 5C4XG 4FULA 2ZZPB 2Z6BA 4BBRB 4KKSA 3J80E 1TY2A 1STEA 3HRZC 1EL0A 4KY7A 3CCMA 4TV3A 1YQBA 2RHSB 2I46A 2IO2B 2L52A 1L2NA 3GTKH 5IP7G 2RCNA 1KF6B 2KQ7A 3S14H 2K14A 2ES2A 3S1MH 3RZOB 4N9PA 1EF5A 3WOFA 1R4MB 4DV7Q 1E9MA 3UDFA 4K81A 1HZAA 2C7MB 1CM9A 1HZCA 2HD5B 3HHMA 1U0LA 4N9TA 4OONA 4LF7Q 4JPBW 3I4NG 1Q86C 1WXMA 1PYWD 1D2BA 3LYYA 3GTQH 1ZUD2 4JI5L 4GOPC 4KN4C 1FRRA 3IL8A 5HKHA 1D4BA 1YIJA 2EDGA 4JYAQ 1R4QB 1AARA 1BR9A 3ZLZA 1A6XA 3PZ8A 1Y1WH 1UH6A 1S3SG 3P2BA 4G50A 1IYUA 4JOIC 3S15B 3PLUA 3KBXA 1Q81C 1LABA 2WS3B 4DFAA 2D07B 4IWOA 4L1BA 1SROA 3DHGC 1W2BA 4KV2A 3K8AA 1YNXA 4PQXA 4CDCC 1DOXA 1EO6A 4JK1C 4J8QA 4IWPA 4G11A 3V6CB 3CCQA 2VQFL 3DBSA 4OZBA 2F1MA 3A4SC 4LNKA 4YWGG 3TRZA 5BR8L 1K8OA 4ZRPA 3ZTCA 2SNMA 4WAFA 3T9LA 1N32Q 2JZZA 4L2YA 2PPHA 1PHJA 4EZJA 2PYKA 3HGBA 4D2KA 1QVCA 1HJPA 2F0MA 2WFWA 4OELB 1P98A 1XLQA 3W1GA 1ZYRC 3RZDH 3CCUA 2JXTA 2ZW1A 2WXHA 2QCPX 1ZYRD 1MHXA 2AYOB 3WAPA 1M1KC 1GAQB 3A5UA 4HIOA 4C4VA 5LXHA 1JICA 1TWFB 2WXQA 5IO9A 1ICFB 3A9KA 3I57A 1QZHA 1WTPA 4BY7B 2J0JA 4FLHA 4KX6B 4FNFA 1DM0B 2M2LA 1WYDA 1X1MA 4OVZA 1UE7A 2KDFB 1ESFA 1SAPA 1K8GA 3T51B 5KGUA 4U68A 5JPNC 1KRHA 4YSZB 3F8TA 2E2IB 5CV6A 2KZRA 2R7ZG 1ET6A 1RF2D 2MO0A 3KF6B 5A35A 2D3BA 5C2TB 2RSUA 5C3JB 1N33Q 3VA7A 2I5LX 1WJJA 1YBYA 2WLBA 4RGMA 3IFDA 1GHKA 2F0FA 2L15A 3K57A 2OJRA 1WRIA 1WXAA 3TMPB 1J7CA 4L8JA 2KWCA 1S40A 1E3PA 4WRDA 4X62L 3GV6A 1H9SA 4IW0A 2SAKA 4P2CB 2Q5WD 2WXPA 4W9HA 3T53B 4GKJL 3T1YL 3G7LA 3NY5A 1XMQL 3FAHA 4NQKE 3TEHB 4NKLA 4NB3A 4DV5Q 4A3FB 1UGMA 3LDZE 2TSSA 4B0EA 3TUOA 3A1QA 2NPTB 1PH7A 4DV4L 2KX0A 3VXWA 3S16B 1B53A 3HVZA 5LMNL 1IP9A 4HCSA 2MH7A 4PZ7A 4ODGA 2LGIA 3BZCA 3Q6SA 1JWUD 3NVZA 1V9JA 5FJ8G 2W3RA 2MPMA 4X3UA 4A4IA 1NVID 3KDFA 2HQLA 3NRZA 3H9DA 3J80i 1YEZA 3HVDA 4MH8A 4DXGA 4ARIA 1WD1A 3H8HA 3BZKA 4FHKA 1BBXC 1K28A 3NTIA 4LF5Q 2OOBB 2YTYA 4EQPA 2SEBD 2WDTB 3TIXA 3MEFA 3PUWA 4HKZE 1VJKA 1T3QA 4B0MA 4LFCQ 1ZW7A 4OX9L 3M7GA 4QY7A 1JQ4A 4TQUS 2BOSA 4C1NK 5IYCG 1QT9A 4KIKB 5CC4A 2NR2A 3RMKC 3A5ZB 1V9PA 1E1OA 3ZXVA 4BBNF 1ESRA 5D94A 2JRIB 1HNZQ 4X66L 1GM5A 1FL0A 2MEKA 3D4DA 2O4XA 1HTLD 1E7UA 1GKHA 1NTGA 2LFNA 4PNYA 5D6JB 1KRSA 5CHWA 1C4CA 1ZGUB 4CBVA 2CJOA 1NMGA 2CS4A 2JF5A 2K6QA 3AE1B 5HHDG 2FCSA 1U4RA 1V97A 1A62A 3A33B 4OGQC 5JEAH 4HAEA 3RT3B 3FILB 3QHTA 3PRMB 2E76C 1E7PB 2IHFA 2EZVA 1UWVA 3U7DA 2ZTCA 3RLOA 4YWKA 4KY5A 1XF5L 2AEHA 2XRSD 2Z8LA 4E71A 1J8IA 4CHTB 4BY7G 2H1EA 2I1KA 4RMFA 1MIUA 1BQQT 3AU7A 3RPFC 3M95A 1BBUA 1KIXA 1G91A 1C3TA 1PGBA 2ZVNA 4GOCA 4CO7A 4A3DB 2WDVB 5JOBA 3IT4B 3LGJA 2JA7H 1V5OA 1SNOA 4TKOB 1B7YB 4POFA 1YQ3B 1ZXHA 1HPCA 1PFSA 3D8GA 3ER0A 1K51A 3NS1A 3STBC 3X3MA 3M3JA 5CMDA 2IWHA 1R4MI 4JIOU 3MHBA 4FXKC 2JQOA 3P20A 4GDKB 4OW0A 2A68D 1E8ZA 4RKLA 3G48A 2G45B 4ARCA 1KRTA 2LXCA 1II3A 3OSOA 3H15A 3ECIA 1HUNA 1UWMA 4KDLB 5HFYA 1H9RA 1JE5A 2MW5A 1C76A 1XTCD 2YV5A 1YNJC 2F0PA 2C5LC 1EY8A 2R61A 2O2VB 1YNJD 5BYSA 2J42A 2LSSA 2NBFA 3TEYA 2DX5B 2F0DA 2K01A 2KWVB 2HJ1A 2XK5B 1U5KA 4NNJB 3KF6A 3I56A 2KMMA 2IX1A 4WJWA 1WR6E 1UBQA 3DBHB 5M3FH 1XX8A 3AE7B 3RN5A 1NBFC 3C46A 3L16A 1QVGA 1B3AA 3ZJTA 3PLVA 2MGSA 3C1EA 4N8FA 3JVZX 3HK0A 2B63H 3R93A 5LMNW 1JWAD 3ZGZA 3CXCA 1X54A 1VQFA 2UXCQ 3GTGH 2L0CA 1MBYA 2MBBB 1VQOA 2WV6D 4KY6A 1HZ9A 4HMJA 2W82A 4GGQA 1L4ZB 4NW2A 4DV1L 1XYIA 3GTPH 2N4FA 5JVG3 4NDXA 2NPTA 2KACA 4GB9A 1FNUA 2PNRC 1K83B 3K7AB 3DHIC 4RH6A 3PV1A 4A20A 2ICEC 4F7XA 3AFPA 1I35A 4RKBA 3ETRA 4GLSC 2PW9A 2LRWA 4F87A 3L0OA 3VUWA 4CJ0B 1VS0A 2RKSA 2Z6KA 3FEWX 2ATWA 1YN3A 2L0FA 3MXNB 3CHBD 2K0PA 5ELBA 4BBSH 2K9XA 2EYPA 2OQKA 5G3LD 2R92B 1PDQA 5EKLA 3DOWA 3NVVA 3WAMA 1K3BC 1CA5A 4QUCA 3CF6E 5EKIA 4AJYB 3NELA 3NQTA 4MEMA 3M7NA 3JW0X 1ONLA 3Q23A 3PO2H 4PYUA 3AH7A 5IP9H 4DR2Q 3C19A 2KVRA 4KIKA 1PTOB 2A74C 2GLSA 1LT4D 4MM3B 1NEKB 3E5SA 1Q82C 1K8RB 1U4LA 4C3JH 3V2TA 3UINB 4IOIE 4C3IG 1HA5A 4DK0A 1I50H 2N78A 1W3SA 1Y8NB 5T1IA 5DEHA 1TT5B 1I42A 1VQ7A 3M3YH 1K8AC 1PLFA 4HJGE 4MIUA 3TN2A 2RQXA 4A3JH 4C00A 4EE2A 2R93G 1GPXA 4LDTB 3J81j 4XZ4A 1EQTA 4DA2A 2UUBQ 4JBMA 2DY7A 2PZUA 4JL9A 4IPGA 3FILA 4K8JA 5EE9A 1NI3A 3ZXRA 4G4KA 4NMZA 1SYBA 5IWAL 2OXPA 4A3KH 4H2AA 3AEBB 4HN7A 3BINA 2K5NA 3A55A 4FF2A 4M1UB 3UIOB 1PH1A 1FJGQ 1HFNA 3VUYA 4AUQC 4RHRA 4YHHL 2Z59B 1FPYA 1FFUA 3Q2AC 4WIPA 1QQRA 5DNFA 1Q7YC 1K9MC 1C0AA 1V6EA 1CA6A 2EMSA 2O6VB 3QX1A 2PE9A 2R6GA 4R8IA 2C9WB 1E6EB 1EY6A 2WWZA 2XNAC 3RUZA 5I6YA 4V0BA 1QOBA 3B1LX 4OWTB 1QF6A 4N59A 3VH3B 3OWEB 1TU2B 4L6TB 3A56A 4UP8A 3S1NB 2CU3A 4GDKA 3BVZA 1LXDA 1PZKD 4FP5D 3S1RH 5M5YB 4ANVA 3SK4A 1SIFA 5FR3A 4CKEA 1RLFA 2ASQA 4IM2A 2G9HD 4XXEA 1TWGH 1BCPC 5EKKA 5JPMC 4JI0L 4HRSA 4LFBL 2OT2A 4Y52H 1DONA 3DWGC 2IO3B 3N3KB 1L6UA 4POGA 5G5HA 3CPWA 4ID6A 1K53A 3ENEA 4YTMB 3APFA 5JXVA 1EY5A 1HTQA 3NTHA 3NQIA 4C2MH 4P72A 3J9CA 4USAA 4IFDH 2O2VA 1ACCA 1D3ZA 1QUQB 2HHHL 1VF7A 2VUMH 3I3TB 3K6OA 4BS9A 2RA4A 2C9OA 4A8XC 2CHBD 2XK5A 4L5TA 1EYCA 3AN1A 3T8MA 2B2TA 3RULA 1WIAA 2BVCA 1X65A 3BIID 3VR8B 4Y7NH 1I94Q 4IJLA 4JI7L 3CU7A 4AIMA 2GRIA 1E0ZA 4CDEC 1XNQQ 3PREA 3NXWA 2NVYB 2BE5D 3NENA 2ZM6Q 4W9EA 2ZTEA 4MDKE 5C44G 1Z9FA 2KVMA 4K2LA 3HOWG 4HCEA 2PVOD 5FLMH 1OO9B 2HDMA 2KQ4X 3DVGX 4FA6A 1FNWA 3PQIA 3DBRB 2WXKA 1FEHA 5FO9B 1Q46A 3H0GH 2L32A 2L4NA 4BZAA 5IY0A 3S2DB 2JJQA 1EYDA 4K5WA 4XT3B 2PQAA 1LTLA 5ISRA 3RCZA 1Y56A 2Z9HA 2GBNA 4JBJA 1U9RA 4LF8Q 1RHPA 1AN8A 1F2LA 1R7SA 4ZCKA 4QQBX 1VQLA 1S5BD 2D0PA 1ZP0B 3EFUA 5FKAC 5M5XH 4V190 3U9OA 5EAYA 3O65B 3MXNA 1DOYA 4UAIA 1TT2A 3ITPA 4LF6L 4YTNB 4A3BB 2PZTA 4JBWA 4K0KL 2LZ6A 1N34L 3DLLA 2E8GA 2UU9L 4A3EH 4BKTA 4MGZE 1XO3A 4UPAA 1E7VA 2JX5A 4K3BA 1CKNB 4F1SA 3BVMA 1DD2A 3AXCA 3DBHI 4QAYA 1UGJA 2ZNVC 3N20C 1STBA 1IYFA 1XLNA 1WCMG 4A3GG 3S2HH 5C0XH 1Q0WB 1LACA 1ML0D 1MFWA 2JSOA 4FJYA 2J7QB 2K22A 4YCVA 3KLSX 4O2DA 2XBBC 4MM3A 4KHPL 4QB4A 2KHIA 2I2YA 1AH9A 4KJNA 3AV8A 2BA0A 1GG3A 1AE2A 1I5FA 1JJGA 2H89B 3FDTA 1SE2A 2LVOA 3N1ZC 4K7SA 2VH2A 2WKCA 3BZDB 1S5FD 5ELDA 3KWLA 2PO4A 5E1FA 1V49A 4AQYQ 4BKGA 1B44D 1ENFA 3CQZH 1VDZA 3VR2A 1ASZA 3H7SA 4IG7B 3JSVB 2QEXA 3MFYA 1I4RA 4TRDA 2IJ0A 3D4RA 3U30A 2ZXOA 3AE8B 2K5QA 1WWTA 1HZBA 2AQ2B 2GMIC 2JZPA 3KUZA 5HURA 4LMQD 1XCQL 3DQVA 5KNCA 2M8SA 4YSXB 1WY8A 3C0RB 3NEMA 3S2AA 1RAXA 2EKIA 2L55A 1L0WA 2O6VA 2KHWB 3EHVA 3V3XA 4FJVB 1EUJA 3ZJUA 1VQ4A 4E6IA 3W1BA 1SR3A 3Q8BA 2P5ZX 3I4MB 2BWFA 1NBWA 4GDLB 1BXTA 5EQ0A 4ZHPA 1MI2A 2B2VC 2FCQA 2YEPF 4LF9L 2GA4B 3MJ5A 3NHHA 1TWAB 4IZ8A 3TSSA 1LTBD 1HRJA 2XWJB 2AL3A 3AU5A 3Q69A 5IKCM 2N7DA 3R8BA 1C48A 4OZCA 4DR7Q 4MZ9A 2ONQA 4QL5A 2K04A 1JWSD 3K5MA 1SNPA 4A93H 1PVOA 2F0IA 3GZNB 3L3OC 2KAJA 2WXRA 1PFBA 2WKDA 4JV5Q 3EECA 1JT8A 2BS3B 1QUQA 1Y1VG 1S5ED 1J7BA 3A7LA 2KX3A 1KXLA 3ZKJC 1GUNA 1LT5D 4HMIA 4DUYQ 1MVKA 2LVQA 2N8NA 3B6YA 4DR4Q 1WTWA 3I2ZA 2L83A 3MC9A 3HOUH 1MHWC 2EQSA 2K05A 3EA6A 5C1ZA 3QOLA 4A3BG 1CSPA 2E2HB 4X57B 4DDID 3HP3A 1QLBB 3SK6A 4LTUA 3FPPA 3KLSA 4X3KA 1BUVT 3QAQA 4RGOS 5CX3A 3V60A 3KJOA 1XMOQ 3GTLH 4NXNL 1TBEA 1WFYA 1IHZA 4QIWB 3AE9B 1BKBA 2VZKB 1TKEA 3VDYA 2LHDA 4KKUA 5IT9c 2MBHA 3DCGA 1EFID 5D2MB 1I3QB 2BPSA 5I9OA 3W3AA 1CMXB 1MJCA 1LLRD 1STAA 4XDDA 3T56B 3V05A 2JVCA 3DHHC 5H8YE 4LNFA 1B70B 4YWMA 3UDXA 1JRPA 3SK8A 2L1AA 1YNNC 2RHQB 3AE6B 4JI4Q 2JRHA 3MAQA 2E5LQ 1PTOC 1YNND 4B3MQ 4W9CA 5J18A 4OO1I 2XIWA 1PH3A 2D2QA 5DCNA 4K5XA 3D6WA 4RMAA 1GUTA 2KN4A 1HR0L 3L54A 4KVGB 1LQBA 4K8IA 4RA8A 3WDNA 3V62A 3HOZB 3D0FA 4AH6A 1ASYA 4C3HB 2JA8H 1U4AA 1ZXIA 1GUGA 4JBKA 2KWUB 4K7WA 2O5IC 4W9FA 1LO5D 2JA5H 3MC8A 3I63C 1R4NB 3ABVB 1L1OB 1D5MC 1X55A 2F3VA 2PTLA 1CKNA 1HFGA 3D4WA 1DGJA 2I38A 1TWCH 1TKWB 2K5PA 3HOXH 4LF5L 4C4VB 3AEFB 3ZRFA 2V3NA 2WGSA 2MP1A 4QF4A 4B9KA 4DV0L 4PS8A 1F9SA 4A3LG 5E4WC 4II3B 1X3FA 1XNRL 4WWOA 1VQIA 5D3IB 4XC2A 1PH6A 4ZYSA 5K36H 3HOYG 2A5UA 2ACZB 4RGNA 5M5WH 3CC7A 1QZGA 4A3IH 4B3TQ 3CSFA 2NVXH 4W9LA 4BFRA 3DBRI 1XPOA 2CHZA 2OJWA 2LUEA 4B9XA 3HUIA 1HNZL 4P16A 3TP7A 2JP1A 3IAS1 4N6EB 2PIAA 3PMFA 1JORA 2V4DA 1JOQA 1TGZB 3I9V1 4FHJA 4EZLA 1SXTA 2DUDA 4DXAB 3HOVB 2WYQA 3ULLA 4MJSB 1WTVA 2CJNA 4H02A 3L08A 1VQNA 5C4XH 5LMUQ 4C7YA 3U4ZA 3PUXA 2K4KA 5BN3A 2ZW0A 4EEWA 4XIGS 2EE1A 1HA6A 2DAFA 3PO3G 1SFOH 2XSCA 3MWYW 5IP7H 3VYRA 1CFMA 3GTKB 4JQWC 4MT5A 2AQ3B 3S14B 3B08A 1TIID 3EFCA 5LLIA 2B2UC 2GBKA 4MGIE 4HKQA 1NY4A 3NHEB 3PHWB 1J9OA 2RCFA 3OIPA 1G291 3SE0A 3CCRA 5HY6A 5EPKA 2LMCB 2YU9B 2A8VA 3I4NH 4BXXG 4QJFA 2D3AA 5LL6S 1IBML 1N36Q 1VZ6A 1MSHA 2BDNA 5IGBA 3JAME 1HCZA 1YIWA 4GDLA 2BT6A 2KHJA 3T1HQ 2I0QA 2KANA 5DPTA 4TQ0A 4X65Q 5JJLA 5CGKA 1XCTL 1R9TB 2INDC 2O2LD 2V0GA 4DR1Q 4KSKC 4EQNA 1J5EQ 1B1ZA 3FKIG 4IALA 4YY3Q 2KJHB 4ANUA 3KOJA 1YHBA 3RMHA 1LTTD 2KCTA 1Q90A 2OQ0A 1NYRA 4K7UA 2NVQH 2ID0A 1WJ4A 3AEEB 2PW7A 3GTJH 2D62A 2WP8J 3B2FA 2LY7A 2WIIB 4KD3A 4KN7C 5CBEE 5IOCA 3K58A 2MQJA 4LJPB 1IW7C 4DR6Q 3CC4A 4ASWC 4BKSD 1IW7D 2I5MX 5MPOA 3IKJA 3PV0A 2RMMA 2RSOA 3ND8A 3RD2A 4AS1A 2VW9A 2J0MA 2MO1A 1VDVA 1I4GA 2RSNA 2JYTA 4JCVE 4YXDB 4DV2L 1VQGA 1Q8KA 4CDDC 4DK3C 4M01A 3TBIB 3M4YA 4QIWE 3RNEC 3RZDB 1H95A 2LFIA 1X6OA 3WAOA 4NP5A 3WANA 3IVFA 1KAAA 2FBWB 5AZGA 3WCQA 2JXXA 3K5NA 2PJHA 2F0GA 1TYGB 1TS4A 5LNK1 2A6EC 3K80C 1HR0W 1S1QB 5GQOA 3EIVA 1P16A 1S5DD 4LUVA 1GB1A 1C8CA 2KO3A 4E74A 2FIDA 3PCOB 1A63A 2R7ZH 3TDQA 4JI6Q 1F2ZA 5M3MG 1AYFA 1WFQA 2DENB 2VL6A 1E7ZA 3GZNI 2UUAL 4I6NB 2LXKA 2BB5A 3H6NA 1WXQA 2FJ2A 1SSNA 5EE0A 3HZXA 1VQKA 1UEAB 4JW0A 2ZPYA 2CWAA 5HGTA 2QSDA 3SDLC 1X32A 1P9DU 2F0UA 1LT3D 1L1OA 1Y14B 4A3CG 4BBNC 1SF0A 3ONSA 5GAHC 2YTXA 1I4PA 1TY0A 3SVMA 4DBGA 2BF8B 4DUZL 1WGKA 3QK0A 2DN8A 1RKNA 4DHJB 1GXDC 2IX0A 2K25A 1BBWA 5IT9L 4A3MB 2KFJA 4LNIA 4A55A 3DM1A 1K0RA 5DAUA 4PK1A 2L00B 5FJ8H 2LI5A 2MBQA 5GROA 4TQ1A 4XYQA 2A4ZA 3AE2B 5IGEA 3F2CA 3BYTB 1CUKA 1E8WA 2AKWB 2Q2UA 2M4NA 2KECA 1IYVA 5IAAC 2LVPA 2TMPA 2L0TA 1Q1EA 2AL6A 1ENCA 1GJZA 3H6MA 1TWHH 1L5PA 2NZOA 1C4PA 4MJSA 3S15H 4M02A 4DAPA 3W1SC 2D11A 5L95C 4KD4A 1MG8A 1QJOA 3KBGA 4BBRG 2KCMA 4MGYE 3FRPB 5IYCH 3IXSA 1KNAA 4JI8Q 3JAMi 1R4NI 4Q5VA 2UXDQ 3T4AC 1A70A 2B3AA 4S0RA 1HUMA 4IM3A 3SHLA 3V96A 4KV6A 1FJGL 1FGUA 1P1AA 3MXUA 2D10A 1WGGA 1NDDA 2LMCA 2K28A 4MACA 3HIZA 3J7AV 1XXGA 3BVGA 5C3EB 1EU3A 3VRAB 1E5WA 4I6LB 3PUZA 1JJCB 4OVUA 1FNVA 1WTHA 3NP8A 4ULLA 2HIXA 4DV6L 1STGA 1DCZA 1IBLQ 4A75A 3VR9B 4GXBA 2WINB 5IA7A 3J81E 1GO3E 1TWFH 5KYLA 3QR8A 3AU4A 4P6VF 4LW1A 3U7ZA 4A3PA 2FMCA 4IWQA 4BY7H 3OAWA 2YEPB 3ZDTA 5CV9A 4PT5A 5DPWA 2WAQB 3ZIMA 1A2TA 3K0YA 2N88A 4XYCA 2K5HA 1QE6A 5GMVA 2QMTA 4DNIA 3PTFC 3AYHB 2HCIA 2QF7A 2XRQD 3PUYA 1FXTB 1D7QA 4NZLB 2KMAA 2ON8A 1MGSA 1OTRB 2H5XA 4LF4L 2K8CA 3GTMH 4P71A 3ZDMC 1VQ9A 3V61A 1E90A 1KFYB 3RZFA 3MXPA 3R3OA 1QOAA 2CH4W 2PE6B 3IBEA 2G3QB 3H7PB 4B6WA 3NBIA 1I94L 2V1CC 3CAMA 2AWOA 2Y3AA 3RI7C 3VA5A 1YNTE 5E6OA 4C7ZA 2F0VA 1D5XC 2JA9A 1SYDA 5BN5A 4A3MG 1EUVB 5AZHA 5JHAA 1RDPD 3MXGA 1W6JA 1D1KA 3AEAB 4X64L 1WJUA 3KQ4A 3OW2A 2G4DB 3I8ZA 1EZ8A 1WZ0A 1FR3A 2Y5PA 5JH5C 4LAAA 3E0EA 1PRTC 4GN3B 2CHXA 2C35B 5GAGC 1PRTD 1SN8A 1I4XA 3TREA 5M3FB 1ILPA 1V1OA 3Q8CA 5AUIA 4ZYNA 1K50A 2X6LA 4LF8L 1OGWA 1B9RA 2K1BA 2BWES 2YVCA 3NS8A 3H3VI 2ZEQA 3KUCB 5CV5A 2B63B 3I4OA 1CK1A 3STBD 4ALPA 1HEZE 3GDEA 3PRPB 1Y8OB 3GTGB 1FCLA 2EY6A 4UP9A 1LTAD 5D65A 3A8JE 2KEEA 4KJOA 4G57A 4DPGA 4FDBA 2JEBI 3BYYB 3GTPB 1V1PA 4BY1B 3NUHB 2KFKB 1A15A 4A3FG 1ZDXA 5C4JH 1JMCA 4WQOB 2MJ8A 2KQSA 1PH9A 2QA4A 4G7OC 1T5EA 3PGEA 1ISNA 1WF9A 4N9F4 2HCCA 3M4OB 5E6PA 1WGYA 3RFZB 1VQEA 3SD5A 4HPPA 1C4QA 5C3EG 1WM3A 4HR7B 2D5DA 1EYAA 1HNXL 2UXBQ 2BBCA 3NG0A 2K1FA 3U4VA 3KVFB 3EJIA 4WWNA 1GVPA 1U4MA 1FM0D 2IY1B 2UYZB 1VMPA 5LL6X 1SJHD 1TXYA 2RF4A 4G7HC 2IT1A 3CD6A 2FCMA 2X69A 4CDFC 3TEZA 2QDLA 1KM7A 4CYEA 3HEJA 4KDIC 3PO2B 2J4XA 2Q2IA 1I6HH 2NUCA 1LM8B 3VTVA 1HXYD 1EY0A 2LJ5A 2EJFC 1M8AA 2MJEA 4HPMB 2YYZA 2BH2A 3ND9A 4ZK9B 1G6PA 3NK9A 2GB1A 2JQRB 3KK7A 2EKEC 3KYCD 3IAM1 4KKJA 2V4IB 1E0BA 4C3JB 3CRLC 2E6XA 5CV8A 4RF0A 2MJ3A 5AJ3L 2HDLA 2PQAB 4C3IH 2PI2E 3APCA 1I50B 4ILWA 2LS01 5FLXE 2Y0SB 2JWZA 2R2OA 3J81i 3PPAA 3OHXC 3M3YB 2PI2A 3DUZA 2NVTH 5EDSA 1SDFA 2R93H 5KNBA 4GKKL 2NBVB 3GTOH 2DJFC 2NZHA 2WACA 2EYLA 3HKZB 4DAMA 4QGUA 2CVRA 4R9WA 2BYFA 5CHFA 3ULPA 3ERSX 1HTOA 3A4RA 4JWUC 4GIVA 5HGQA 4XQJA 1Q3LA 4A3KB 1X56A 2LEKA 3R7QA 2WAQE 3A54A 1WSPA 1WXSA 2DNCA 3RNUA 2V9HA 3Q14C 2FHTA 2I07B 1N62A 3FP9A 2NN6H 2RVLA 3MVVA 2F0WA 4DR7L 1EOVA 1EEFD 2BCOA 2E75C 2KA7A 1L4DB 2KYWA 2WU2B 3VFKA 3BDLA 4A3DG 3VYTA 2K5DA 4IUQA 1AZPA 2E2JH 3AE4B 4JV5L 1RYJA 1L2FA 2UU7A 5CHVC 3VRBB 4ZDVA 3SGIA 2K39A 4AQ7A 1G6JA 3VR5A 2LUMA 1P3QU 5BYQA 1F52A 5A2QE 2KJXA 3I73A 3S1RB 1KC8C 2BA1A 1BF4A 1YOVB 3H7PA 3IFWB 4MSQB 4P1CC 1F2YA 1TWGB 3M85A 1EFWA 2K52A 4KMUC 4BY1G 3MFGA 1HZ5A 4ANXA 3WWVA 4JGHB 3KW5B 5AZFA 1WZ3A 3Q3OC 2XN9C 1ROEA 2WXLA 4DN4M 2AUJD 2B2WA 1Z5SB 1O7IA 1X3GA 2VNUD 3KYDD 1B2TA 2FXQA 4JWSC 1PFDA 2V4LA 4ZRJA 1BOSA 3A8IE 2FMMA 2F0TA 2VUMB 4KHZA 4ZUIA 5M9OA 3PUVA 3L10B 4HXDA 2WB1B 3BDCA 5BMHA 4X62Q 1DOMA 3T3NA 2AWNA 4ZAIA 1QKZA 3AEDB 3MTSA 4JI4L 4GN5A 3J7YW 4EGVA 2UUCQ 4Y7NB 3KLRA 3T1YQ 1XPUA 1XMQQ 1X9NA 4GKJQ 2F03A 5E6NA 3L0WB 2A73B 1BMLC 3I3CA 2F0OA 1YN4A 3MHSD 2KTFA 1RCVD 3QC8B 3RLNA 2JYOA 5C44H 1OXSC 5LMNQ 3PO2G 2DWQA 5EBCA 4A76A 1SYEA 1N6ZA 1K3RA 1PDXA 3HOWH 2C60A 3VH4B 4GZYC 1NSNS 3HRDD 3EUB2 1PTOH 3KYHC 2KFKA 2QJLA 1SLJA 1ENAA 3CMAA 4LCDE 1BCPD 1YJJA 3H0GB 4W9JA 2ZJRA 1TKGA 4KGSA 1PYSB 1EEID 1SE3A 4IOCA 1YX6B 1DZ1A 3N1XC 1G8ZD 2WXMA 4RAUC 4DDGD 4LFAL 4GNXB 2ZCBA 3DVNV 3NZUA 3PIP3 2Y0SG 2EY1A 2RD0A 1RJTA 3PT2B 1DOIA 1WE6A 3RNBC 2MP2B 3ZTDA 4IUVA 2DZIA 5M5XB 4JX1C 2CQOA 2M9VA 1P7FA 1YN5A 3HKZG 3E6ZX 5EJWA 3S1QH 2FIFA 1WTXA 2LGDA 2KT7A 2WQYB 3UGBB 2R92G 5C6AA 1N60A 1EIGA 3A8KE 1CQFA 4A3EB 2Z6KC 1PH4A 2CWPA 2SOBA 1NJIC 4JI3L 5G3LF 1KL9A 4HCNB 2W54A 2B8FA 1Q8IA 3E56A 4X66Q 3J80c 1WCMH 4A3GH 4KKTA 1C79A 1AWDA 2JE6I 3S2HB 5T8IA 4B3RQ 3UQBA 5LMUL 3KLWA 5AEKB 2NTSA 3OOCA 4LWCA 2PMZB 2N1WA 2AWTA 2J53A 2WXJA 4W9IA 2Y0SE 3PIO3 3CMEA 4ME3A 4WJ4A 1CJEA 3ZNGC 1EWYC 1UBIA 4GS3A 1EIYB 3UI2A 4JI1Q 1TJEA 1E8YA 3IHPC 3HKZE 3OMGA 3JYUA 2KC2A 2V1YA 3OPOA 4G3XB 1OXUA 2EJGC 1O7ZA 5JJKA 2F0EA 2X8XX 3TS2A 1MI0A 4JI2L 3E9IA 1Z6HA 3CQZB 5IGFA 1N36L 4MHEA 2KOXA 3T1HL 2J0TD 4X65L 1DYQA 3Q22A 1K73C 4Z9CB 4DWFA 4ZRIA 5BO4B 3O13A 2HT1A 1C78A 4WFN3 3VQIA 4MNOA 5KHOA 3CF5A 3RN2A 1XEEA 4F8MA 1YJ1A 2LASA 3LXFA 5CR3A 4GOPB 1CKMA 4OWXB 4IUUA 2C5CA 1MJDA 5D3DA 4R8NA 1XWEA 2KDBA 2NCNA 2E3TA 2WHIA 3U52E 3DVGY 5IYBG 4KK7A 4HJ8A 1LTRD 1GJXA 1EWHA 1ZKOA 4GN1A 4HDQA 4AWJA 1JROA 4DR6L 4RF1A 4ICVA 2B2YA 1RM6C 2JXMB 4H44C 2K03A 3DWAA 1F2RI 2KNBA 5G55A 4DV7L 3DWQA 2VZAA 2GVAA 4RFBA 3QWZB 4LF7L 3DHQA 3MJWA 2JA6H 2ZT9C 1BT0A 3N30A 5FLMG 2KQ3A 4G7ZC 4EQOA 1Q12A 2VQEQ 1M90C 1VQ6A 1O80A 4JYAL 1S72A 4HK2A 4OO1G 1RWSA 4A93B 4NJ7A 3H0GG 2W55A 3VUXA 1TQOA 4LJOB 1T6BX 2CR5A 3QB3A 1G2TA 4BOZB 2SDFA 1Y1VH 2W9NA 2WB1E 2J0KA 4FJZA 2IGGA 2EVBA 2F4IA 4EX5A 4DHZB 2GBJA 3AEGB 3ZNHB 1KQSA 1YHAA 1ZXTA 3HOUB 3URYA 5BYRA 1I4QA 4QUFA 5C3WA 3LNNA 4XT1B 5IYDG 4A3BH 1L7YA 1ZEQX 4DV1Q 4M8NA 4UP7A 4ZUJA 1V2YA 2ZCCA 2B2TC 3SR6A 4HJ9A 1QVFA 4HIKA 1N32L 4ME5A 2VXWA 1VF5C 5LXIB 1YHQA 3KUPA 1GUAB 1F9RA 4YWLA 2Z0DB 3Q8FA 3QO2A 1LUZA 1LFDA 2N9EB 1MD2D 1CTMA 2EY2A 4MN3A 1DXMA 2V3SA 4WJOA 3L17A 1OQYA 1YJIA 2CW0C 4ZHOA 1AZQA 2A6HC 1V5TA 2CW0D 3BK1A 1E2ZA 3K0XA 3WOEA 1YQ4B 1VCIA 2ZJDA 1WRDB 2KHSA 4HDOA 4TKNA 4GNXA 1SYFA 3DEPA 5IGGA 2N1VA 1Q1BA 5DLQE 3CRKC 1C1YB 4DKAC 2MP2A 2PMVA 1UUPA 2CCZA 3I90A 3FMCA 3P4PB 1M94A 4IFDI 1L0XB 4J15A 1KDAA 1EZ6A 4JG2A 2JA8B 1SGHA 2WXOA 4MSMB 2K8HA 4IJHA 1T9HA 3A7AB 2JA5B 5HI1A 4IFDJ 5CV4A 2J7ZA 1N33L 5J17A 3J81c 1IUEA 1DJRD 1CZPA 1XLOA 2LJIA 1VQBA 2WXGA 2WX0A 4JE3B 3NBHB 1C7YA 1WX8A 1JC7A 3HOXB 3VTWA 1FXAA 1EYGA 4R4OA 2DYBA 2PMZE 4A3LH 2IO0B 1HNWQ 2V3PA 1IXRA 4HROA 3GE3C 2MHVA 4R3DA 1A8VA 1J0GA 3KJPA 1JB3A 5J1ZA 3HOYH 4ZLTF 2B76B 3LWEA 3K5OA 3CCEA 4OWWB 1F9JA 2WU5B 5M5WB 4DV5L 2CHWA 2IGHA 3QQ8B 4KGRA 3CCVA 4A3IB 2UXDL 1QG7A 1KH0A 1V8CA 1TKYA 1VQHA 5C5LA 1PTOD 2KC1A 5IWAQ 4HJ5A 4NAMA 1KD1C 2JSVX 1FD7D 2K5WA 3RNCC 1OQQA 4PMCA 4DGZA 2BH8A 3I72A 3U58A 3IRBA 4YHHQ 1LYLA 5C4XB 1XLPA 2DNFA 4KZCA 5G2NA 4DK5A 4IDIA 4EFOA 2MBEA 2GI9A 3AQQA 1S4ZA 1KLGD 3PO3H 1GOZA 1IBLL 4LDTD 3DWPA 1SFOB 1WTRA 4Q2JA 4XE0A 1UWXA 3J80L 2AHOB 3TS0A 2R3ZA 4O42A 3U2SC 4DNRB 4XQQA 5IGDA 4GOPA 3PIPA 1YX5B 3TP5A 4HIMA 2QHOA 4UHVA 2EYHA 5C5MA 4LFCL 2JUOA 4C56C 3I4NB 4BXXH 1EQVA 1Q10A 5C0XI 2NBWB 2FNJB 3ULJA 4P75A 1B3QA 2JT4B 3I4MG 4NAWB 3P1MA 3CSTA 3X23A 4JOIA 4LFBQ 1XJVA 5C0XJ 1KHIA 3S17B 3A9JB 4RNAA 3E0JA 4GLAC 2PLPA 2Q8IB 3FKIH 2EELA 3GQBA 4HJKA 3UE0A 3SDZA 4HTHA 2DYMA 2HHHQ 3TP8A 2D5GA 1HTPA 1ZDVA 2OTJA 2NVQB 2Y5CA 1SB3C 2L8JA 5KHQA 1V81A 2PEAA 4YT0B 1CHQD 4MH0E 1CHPD 2D9UA 1UAPA 3DM3A 2C7NB 2DBYA 3PIOA 2WDRB 4DHZE 1PH5A 3S1MB 3H09A 4M8MA 5D14A 5C3XA 1FVIA 1SYGA 4DV3Q 5KNDA 2DAJA 3B0AA 4FF1A 5I4DA 4GMVA 5L37A 1H4RA 1VLBA 4IO9A 2JA8G 3K59A 1Z47A 2Q8TA 3GTQB 4W9KA 4ZRQA 3DBLB 2JA5G 1JOOA 2H4OA 4RG1A 5J39A 3NOBA 5J2RA 4ZKCB 4YIJA 5NUCA 2I1JA 1GD7A 3VDZA 5H1SE 4XGAB 3UE1A 1FFVA 5AUKA 1Y1WB 2BYVE 1E10A 2OEOA 1STYA 3PSEB 5EE3A 1IPGA 4CKCA 1E2VA 2BS4B 1EF1A 1OQRA 1WX7A 3W5UB 1JQYD 3Q3FA 1U4PA 3PHXB 4FADA 3L9AX 5K5PA 5ELEA 1AW7A 4WWPA 3ZQ4A 1QWYA 1S3OA 1DOKA 2IX3A 1KTKA 2R7ZB 1H9MA 4K0KQ 5M3MH 2UWQA 3TEWA 3HFZB 4FBJB 3F2DA 2UU9Q 1VQ8A 3D31A 2IZVB 3AM9A 3FKYA 4R4CA 4X6AH 4CGYB 1YJ9A 5L83A 3ZJYC 1WOCA 2BQQA 1R4PB 3TMEA 2VY3A 2XVSA 2RDGA 3A0JA 3HOZG 2KENA 4C3HG 1RD9D 2LGSA 2WXNA 1ZE3D 4H7BA 2A19A 3PF4A 4BOSC 1IKLA 4DK6C 4A3CH 2ZJPA 3CCSA 2MCNB 2EYMA 5H92C 4HSVA 1MPEA 2KD0A 1PGXA 1CQVA 2FCNA 4LNQA 3NBHA 1FXIA 5J3BA 4KHPQ 1J19A 2FUHB 2LHEA 3OJ4B 2KEDA 1FYCA 3LWUA 3NVYA 2ZXPA 1KNEA 2KLGA 1KDBA 1IBKQ 2UXCL 1N5WA 4WWMA 1Y69U 1E24A 1TS2A 2A6ED 2L1BA 5I2XA 1VMCA 1B4OA 3I7FA 4R1JA 2A5HA 4WORA 3NE5B 2YU9H 5CV7A 1NENB 2VB3X 3T16A 1GB4A 1UEBA 4DR3Q 2H88B 4EUTA 4OL7A 3FVQA 5E3FA 4KI0A 5GXGB 2E74C 3AULA 4I65A 2IGDA 1UNSA 4F8CB 1QZEA 2KKCA 1YJWA 1R9TH 2MX2A 2DZJA 2Z0SA 1EU4A 2KJ6A 3MC0B 2BKFA 2AQ1B 3P4RB 2HD3A 4PMBA 4KHVA 1A3VA 1TWHB 4MTNA 2K3UA 1F0ZA 3HOVG 2B39A 3WIMA 4GN4B 1FGBD 4M00A 1EIHA 3J81L 2O5JC 1C9FA 4BBRH 3M63B 3ZO5B 1VZ8A 3MTNB 1ZKHA 1QB5D 4IQZA 4A9AA 2YTVA 1V1PB 2OTLA 2E2DC 2KMCA 5EBDA 3H3VH 1GHJA 4XTCS 3RZOH 2BW2A 2L7RA 2CFMA 4H13C 1KOTA 3GP7A 2WXFA 2K7VA 4LF9Q 4ZRZA 4FXDA 1WR1A 2KLCA 3J7AF 4DR2L 3TZDA 2F4VQ 3W9CB 2IO1B 5G5GA 1IGDA 1SMXA 3NSWA 2JPHA 4TUUA 2NWGA 1YJNA 4NAWA 2FINB 4FO2A 3QIAA 3GS2A 2EMTA 3B2GA 3DDCB 1QNKA 3A9JA 5ELCA 2RDBC 5CBAE 1Y1WG 3C1FA 2QW7A 2I5HA 4WURA 4F88A 2REXA 3J7A5 2HTHA 2MFIA 3GE8C 2DY8A 4LUOA 4BA1I 4N8X1 4XDXA 2UUBL 1A5RA 3AE5B 1NMFA 5LHY1 4B08A 3BJUA 1PYBA 3HKSA 3H94A 3EC8A 4OZAA 1OXVA 1EIFA 3D3RA 3CWIA 2QC8A 3ERQA 4A90A 1SE9A 1Q5WB 1IBXB 1K52A 4R4IA 1T5XD 2INNE 4NXNQ 4J6HA 4FXCA 1YITA 4ICUA 1T0QC 2N3SA 1WJ6A 1BCPB 2R2QA 3GTMB 2X38A 2D3GA 3MZ5A 1F9QA 5JHBA 3MEHA 4XWWA 4IPDA 4LUZA 2UUCL 4CQNA 2RPQA 2CQAA 4N58A 2Q2TA 4UDUC 1PFMA 3K9PB 1VQDA 2HJ8A 3P4QB 2IW3A 3W5OA 4O1NA 5E7NA 1D5ZC 4UY8C 4A3MH 3P4SB 3VYSA 3PF5A 2BYTA 4DR5Q 5FO8B 1RIPA 1M4VA 2FFKB 1HR0Q 2WP9B 2R7FA 4XWTA 2CH4A 4L5QA 1WYGA 3GOEA 2VZKD 3OTOQ 1WE7A 5BMGA 2E2IH 2L76A 4B3SQ 3CC2A 1CT1D 1XPRA 3A74A 1XQQA 1VQCA 4HCPB 4HLEA 2JA7B 1F9PA 4ABNA 4WAAA 2OCEA 1PMRA 4K14A 1HE8A 1T0SC 5AFWA 1G2SA 1YD8U 3OLMD 4ZRKA 2F0NA 1WGHA 4DV0Q 3HS0C 4IOAA 3VR6A 3WA0A 5FK9C 2KDEB 4US8A 1STHA 1XNRQ 1F77A 1MHHE 1E2WA 3VR3A 5IT9E 1QILA 2FE8A 1ILQA 1MSGA 4A3FH 1XNQL 1EM7A 2C7HA 4DF7A 3L7ZC 2G1EA 3DBLI 4ZQ3A 5C4JB 2ZM6L 1L1OC 3Q3NC 3H91A 1ET9A 2WXIA 2MUYA 3OMCA 4DXFA 3S16H 2KDMA 3QJYA 2M56B 3PO0A 1D6EC 3U4EG 2KOLA 4OVVA 3GD7A 4B3RL 1X3PA 1WXVA 2F0JA 3KFUA 5J22A 5C3EH 2OF1A 1L0YB 4RCNA 5FLXL 1AEXA 3K9OB 4NPSA 3RNAC 4L23A 4PZ6A 2G4SA 3D6CA 1K0SA 3BDOA 2JN4A 2IHEA 5FO7B 3LJ3A 1P8LA 1QOFA 3ZW3A 3V6EB 2Z4HA 3FPUB 1LM0A 1XT9B 2MLBA 4JI1L 2NS5A 2ZNVB 5C23A 3NWTA 1UE5A 1QCBD 5GAEC 4OHJA 4H0LC 4GLXA 5BMIA 2L05A 1I6HB 4YL8A 4IUNA 3QJZA 3Q0AA 2JK8A 3DMUA 1YVCA 3HG9A 2HDEA 1VQAA 3E3XA 3EN2A 2GVBA 1WM2A 2Q8RE 2X6GA 3ZYYX 2DZKA 1IBMQ 1NR2A 3RYTA 1NI2A 2A1AA 2JZ3B 4JLCA 4FYDA 1NE3A 1CZWA 5T1GA 3NZSA 2CKZB 3BG3A 2RDFA 3SR1A 3UDGA 1QOGA 4C3IB 3PRZA 4NXMQ 1FIQA 1T0YA 3VTUA 4RM9A 3CCLA 1W6KA 1YZ6A 2BGFA 1NCVA 2NVTB 1PGAA 1RFKA 3SFDB 5ELOA 2R93B 4WJNA 1UF0A 1H9JA 2A68C 1O7YA 3GTOB 2KK8A 3ZNZB 4ACFA 1P0RA 5JEAG 4I7ZC 5A2QL 4BBSB 3UI3A 2F3WA 5JJZA 4P74A 1GUOA 3NZ3A 1KABA 2VS1A 4QMGA 4FN2A 3TL5A 1IL8A 1I6VC 2EYOA 2QGQA 3P7JA 4JVZA 1WD0A 1B8AA 1N8RC 4AP4C 3ZJVA 3EVQA 1PFNA 2M0XA 1DGSA 2NZ1D 4HSPA 4AQYL 3R7RA 4EZKA 4L5SA 1N5XA 2WAQG 4LNOA 2BTEA 2VQEL 3VAWA 2VRRB 3LX0A 4DV2Q 1B50A 4J1MA 4A3DH 1IBXA 1C4AA 3ONAB 4JI5Q 1I4HA 1JCKB 5CYUA 3SEBA 2E2JB 3HM6X 4GSWA 4DQOC 2EXZA 2JA7G 3PGZA 1UD7A 2JU6X 2J52A 4IM0A 3H3VC 3F1ZA 3NVWA 3PVLA 4M0WB 1CSQA 1NR4A 4A3JB 1QNUA 2NYZD 1WYWB 4KKIA 3PZDA 1E1TA 4R4QA 1VRAB 3KUDB 1F1HA 1SNQA 2QILA 5F2DA 5DPRA 4BY1H 2ALYB 3Q8DA 2IDYA 2VQFQ 2ZPNA 2PW5A 1TR5A 1JMLA 5BR8Q 2RGFA 3E9HA 1SRUA 2UUAQ 1GNUA 5ELNA 4RWSC 3M4OH 2BKRB 4WJPA 2ICIA 1JW9D 2F0QA 3G71A 1LV9A 3AECB 4YTPB 1FD6A 1EWCA 2BDOA 3TZUA 1PV4A 4HIDA 2RDHA 3G4SA 3IAYA 5E4XA 2WNMA 4B95A 3MP9A 4GU2A 2M0AA 3WALA 1IGCA 3S9WA 4TVAB 5M3FG 1UE6A 4WJ3M 2PKOA 2XTIA 4XDCA 2M00A 4MTKA 4OEMB 4DUYL 4DUZQ 1WX9A 1GC6A 3M62B 1PRTF 4DR4L 2B63G 1RTNA 2VB2X 5C44B 2IBIB 3EROA 2LKVA 3I91A 2L3ZA 4A6QA 3RN9C 3I55A 3HOWB 2JYEA 2MHJA 2Q2HA 5CORA 3C3LA 2N9PC 1XMOL 4QCLA 3FHWA 4CJ1B 1JALA 3EFXD 1K83H 1C9OA 1STNA 2DNEA 3K7AH 4KLKA 5IE8A 3ICEA 1V80A 4C2MB 3DXJC 4NJ6A 1OXTA 4REZA 2K6DB 3TBLD 1V43A 3N52A 1VQMA 3N1YC 2B29A 5KEEA 3QA8A 3PSIA 3SFEB 1HNWL 5IP4D 4AOFA 4EVOA 5JEAJ 3W5VB 3CP0A 1E22A 1KDCA 2XWBB 2XGTA 4OIJA 3M4PA 4DHJD 5IODA 3RNGC 2QEJC 1V8QA 3P1HA 3ML8A 2Y5BB 5JJIA 1GC7A 1N61A 4HVBA 4LK0M 2E5LL 3S1QB 4B3ML 4BBSG 1XD3B 2R92H 2QCZA 4LJZC 5DPSA 3W1YA 2KUMA 2LXJA 1J6QA 4RM8A 2MBOA 1T0RC 2M19A 3CCJA 4DV4Q 4KSLC 4NY0A 3T3OA 3SK5A 3OIQA 1TVXA 2ZJQA 5DM73 1WJNA 3L13A 1WCMB 2NN6G 4LK1C 3OYYA 1TS3A 4YCUA 2PNHA 4A3GB 1D1IA 2EY5A 5IP9G 4DAVA 1SYCA 2F0KA 5ELFA 4ITKA 2IY0B 2NBUA 4HJAA 2NTTA 2PQEA 2SNSA 3AFQA 3VHTC 1UE1A 5I9PA 4C3JG 1H8CA 5C4HA 4DV6Q 1AP0A 3F2UA 1FMAD 1RFAA 1RRBA 3KWVA 4EOYA 2KCCA 1G6ZA 3R2TA 4K6DA 3F2BA 5D7GA 4A3JG 3JAMc 2MQHA 2YLMA 3B9JA 3ZVVA 1EQRA 2GN5A 1FCCC 4B3TL 2HUGA 4CKBA 2F52A 1NAPA 3NUCA 3GB1A 2EYFA 4OX9Q 1CKOA 4HJ7A 1J8CA 4A3OA 3FC4A 4FF4A 3U9SA 1Z2MA 4CJ2C 4IKGA 2K50A 1SIJA 4A3KG 5FR6A 2QDBA 1WVLA 1HHVA 2FUG1 1EY4A 3OWFA 1L0VB 1NNXA 2L5TA 2EOTA 2BB6A 2QDFA 1I7HA 5CTRC 3ZNID 2NB0A 4LF4Q 2B2VA 1TZOA 5FOBB 5IYBH 1HH2P 1BUIC 3AB5A 3Q8AA 2WX1A 4RGTA 4K2KA 1OTCA 1A3TA 1PXUA 3C2PA 2K8BA 4K5VA 5C4ZA 4C80A 2KTRB 2B8GA 3P42A 2IPKD 3M9BA 2BE5C 1EWIA 1UZXB 4DV3L 4YSYB 4M0WA 4PG3A 1SE8A 3N32A 3S1NH 1QOHA 5EPJA 1PA6A 2HIVA 5JAVA 3U50C 3N9YC 4PYZA 3TJPA 5M5YH 2JA6B 4S3SA 5IGCA 3BY4B 4HEA1 2N49A 5EPLA 4L5RC 1PQSA 5BN4A 5KIXA 4X64Q 4NJCA 2PZWA 2OEDA 3W2DA 3K81C 3AMZA 1RTOA 1WGDA 4OO1H 1JR0D 3TCAA 4WQMA 3IFTA 1VQPA 3VVWB 3L2PA 1A2UA 2JY6A 2EIFA 4DR1L 3LB8C 1PH2A 1J5EL 4HPLB 1SSOA 4YY3L 4XX5A 4IFDG 1IZ6A 1Y1VB 3QG1A 4DU9A 2VUMG 3DWMA 2D2CC 3PZ7A 1BVSA 3EQLC 1SE4A 3KF8B 2AUKA 3QOJA 4AYBB 2B2WC 3NTKA 3QARA 4IUMB 4URKA 2WB1G 1N9WA 1WTQA 3P63A 3ZRCA 2NN6I 2JEAI 2K6AA 2Z4IA 1DOLA 1WMHB 2PVGC 5IYDH 1B9MA 1WTOA 1UELA 3R3MA 1WI0A 3Q3MC 4LLGM 1OEYA 3DEOA 1EY7A 1JWMD 2NVYH 4L63B 2D3CA 3CKIB 4HEDA 3U8ZA 2LD9A 3Q3JA 1JRUA 4HWIB 1ICWA 4PV1C 4ZKBB 2JWUA 3UQAA 2CU1A 4U673 1V86A 3IG3A 2ZTDA 4IN3A 2K5VA 3M4QA 4EQ5A 3JC66 2ENBA 1LGRA 3CIRB 3CMMB 1FO4A 2R7DA 4APVA 3BK2A 3R66C 4PS7A 1HNXQ 4II2B 4XYOA 3J7ZC 3S2DH 4O0AA 1H9KA 2LGYA 5IN7A 1IBKL 1BCPF 3RUIB 4WH4A 1B9NA 5TR5A 2DGYA 2KCNA 1AFPA 2WDQB 4GLVB 4DNTB 3UDIA 4DR3L 1LTGD 1OXXK 1EOTA 2KN5A 2DHZA 4J6IA 4BVUC 3QIJA 4XQNA 4NPNA 2DJGC 1F2MA 4JI6L 1NUCA 3ML9A 5IOIA 1VQ5A 3CW2C 3ZUNA 2F3IA 5JVH3 4A3EG 1TIFA 1N63A 2Z0EB 3GTLB 1PUTA 1AE3A 1SEBD 4I7AA 2LXAA 4DK1A 4TMAB 5AJ3Q 1X3QA 1O7LA 1XTDA 4Q0FA 4DAYB 3SU8X 2NMQA 4IUPA 5C0XG 3EBEA 4OXPA 1IL2A 3BU2A 1A0IA 2HTME 3HOYB 4GKKQ 1OEYJ 2A6HD 1WI5A 3TEXA 4IC7B 4PZ8A 1JOKA 1KLUD 1VR9A 3X0WA 2INCC 2KDIA 3I70A 1F2RC 1SNDA 5GADC 2NVUI 4BA2I 2VH1A 3OG5A 4PS3A 1EQQA 1Y8PB 2F4VL 1WGRA 4I6PA 1MG4A 2MSED 4R4TA 1RL2A 5EGTA 2JA6G 1KJTA 5E6JA 1Q1OA 2M1MA 4KTAA 2RPVA 3Q6BA 5KYIA 2PCFB 2B2UA 2MWSB 2N9KA 1KLVA 3UIPB 3VYUA 1SNMA 1TWCB 3L4PA 3OW7A 3PO3B 2KWDA 1SMYC 1TZ1A 4W9GA 1G51A 1SMYD 1TTNA 2K33A 2L12A 1JJ2A 3G6JB 4K6LA 2OWOA 3Q8EA 1JB7A 2LRUA 1A3UA 4FF3A 4AYBG 1D8LA 3IT6B 2N7EA 3OJ3A 2G9DA 2N55A 4JI8L 2N9XA 2NVXB 1HQMC 2KTRA 4AJWA 2IL8A 3I4MH 5JZEB 4YCWA 2RBMA 2IY5B 2XEWA 2MNAA 1SBBB 2M17A 2RR9A 3JAML 1TWAH 1VD2A 5HG2A 4OIKA 4NQLB 1X3EA 3K7UC 4B9WA 3FKIB 3AEVA 2B2YC 4X3SA 5I6WA 3APDA 3T13A 1PZJD 1FRDA 4BKSA 1VZ7A 3QCAA 1JWBD 2DZMA 3GO5A 4JC0A 1ZPSA 3NJTA 1LT6D 4IUTA 1MKHA 4A93G 4KGTA 3G6EA 4S17A 4RCOA 3UF8A 1MJEA 2L9HA 1Y8RC 2LWPA 2K32A 4AYBE 3Q24A 3C8YA 4TSSA 1NYQA 2MRPA 1CZGA 4LNNA 4ZOHC 4DR5L 3KF8A 4C1NI 3BWUD 1YMHE 3DVNU 3EGRA 2F0SA 2CKHB 2FAZA 3PS6A 4EKUA 4F7ZA 1K8MA 3OTOL 3CPFA 2IYDB 1WMHA 4MELA 2AX5A 2HQEA 3HOUG 3N6RA 1S5CD 4B3SL 1C77A 3R2IA 2E2HH 2HE7A 3RLFA 4JI0Q 1EY9A 2K75A 1VCBA 1PH8A 1IKMA 2O6VD 4KZ0A 4MGKE 5I2YA 3P75A 3RR5A 4IPCA 1SJED 1IYJB 2N7JA 4LFAQ 3VR4A 4P73A 3A9KB 2A69C 1I3QH 2G5DA 1E8XA 3S24A 1J7AA 3I5JC 4E3CA 1O78A 1Z7TA 1PRTB 2A69D 2EPBA 2F0HA 4WJQA 2GBMA 3TQYA 1BDOA 1YI2A 3GTJB 2KBNA 3QWNA 4X3TA 1LTID 2L11A 4IPHA 4FVMA 2ZVOA 2AMCB 4JPSA 2INPE 3I4LA 3K5LA 5TSSA 3AE3B 2N0SB 4FXGC 3H1UA 3KH0A 2LGXA 5M3MB 4JI7Q 1VQJA 4IURA 3MHZA 3RNFC 1HQRD 1KAWA 4RHSA 3HM3A 1P7EA 1OFFA 2MJDA 4BWGB 4P1BC 3HOZH 2F0LA 4JI3Q 4GNXC 4C3HH 1PZID 1BNZA 4BAXA 1H9SB 1TS5A 1HZ6A 3ALBA 3JSVA 2EXDA 3RD4A 1ZOYB 3D32A 3NPPA 2QKIC 4G0NB 1LTSD 1GUSA 2KVZA 2GBRA 4K1RB 4M8AA 2DYOA 2EJMA 2ASBA 2B3GA 5KRUA 1L6VA 3HOXG 3X3NA 4CHKA 2MA9B 1BO0A 2N9LA 2ZXRA 4DAYA 3BS1A 3A1QB 3GV3A 3SXHA 1WH3A 2DLBA 1SNCA 4K3CA 3TP6A 2BYEA 4US9A 2KJRA 2QIEB 5EE1A 4J3OD 5K36G 5IIFA 2GOWA 3SHQA 3NWSA 2W3SA 1RODA 3E9SA 3AMUA 3AI5A 3DPDA 4PMWA 2D0OA 4A3IG 4LF6Q 4JI2Q 2BS2B 4P7IA 5FLXc 3KDFB 1CI3M 2EYJA 1N34Q 5COYA 4W9DA 1JE4A 2Z1CA 2OHFA 4NXML 3S17H 3RZWC 3W1SA 3MA2B 4ANWA 1PTOF 3HOVH 5DM63
chains in the Genus database with same CATH topology
3AB9A 1GUWA 2PPBC 4BBRB 4KKSA 3J80E 1TY2A 1STEA 3HRZC 1EL0A 4KY7A 2I46A 2L52A 1KF6B 3RZOB 4N9PA 3WOFA 1E9MA 1CM9A 4N9TA 1PYWD 1D2BA 3LYYA 1ZUD2 4KN4C 1FRRA 3IL8A 1D4BA 2EDGA 1R4QB 1BR9A 1A6XA 3PZ8A 1IYUA 3S15B 3KBXA 1LABA 2WS3B 4DFAA 4L1BA 4PQXA 1DOXA 4JK1C 4J8QA 4OZBA 2F1MA 4YWGG 1K8OA 4ZRPA 2SNMA 4WAFA 4L2YA 2PYKA 3HGBA 4D2KA 2F0MA 1XLQA 1ZYRC 2JXTA 2ZW1A 2WXHA 2QCPX 1ZYRD 1MHXA 1GAQB 1JICA 1TWFB 2WXQA 3I57A 1WTPA 4BY7B 4KX6B 1DM0B 2M2LA 4FNFA 4OVZA 1ESFA 1SAPA 3T51B 5KGUA 4U68A 5JPNC 1KRHA 4YSZB 2E2IB 5CV6A 1ET6A 1RF2D 5C2TB 5A35A 5C3JB 3VA7A 2WLBA 4RGMA 3IFDA 1GHKA 2F0FA 3K57A 1WRIA 1J7CA 4L8JA 4WRDA 3GV6A 1H9SA 2SAKA 4P2CB 2Q5WD 2WXPA 3T53B 3G7LA 3FAHA 4NKLA 4A3FB 2TSSA 4B0EA 3TUOA 3S16B 1B53A 3HVZA 4HCSA 2MH7A 4ODGA 2LGIA 3Q6SA 1JWUD 3NVZA 2W3RA 2MPMA 4X3UA 1NVID 3NRZA 3HVDA 4MH8A 4DXGA 4ARIA 1WD1A 3H8HA 1BBXC 3NTIA 4EQPA 2SEBD 3PUWA 4HKZE 1VJKA 1T3QA 4B0MA 3M7GA 1JQ4A 4TQUS 2BOSA 4C1NK 1QT9A 5CC4A 1ESRA 2MEKA 3D4DA 2O4XA 1HTLD 2LFNA 4PNYA 1C4CA 5HHDG 4CBVA 2CJOA 3AE1B 1U4RA 1V97A 4OGQC 5JEAH 4HAEA 3FILB 2E76C 1E7PB 2EZVA 4KY5A 1XF5L 2XRSD 2Z8LA 1J8IA 4CHTB 2H1EA 3AU7A 1BQQT 3RPFC 1G91A 1PGBA 4A3DB 2WDVB 5JOBA 3IT4B 1SNOA 4TKOB 1ZXHA 1YQ3B 1HPCA 3D8GA 1K51A 3NS1A 3X3MA 5CMDA 2IWHA 3MHBA 4FXKC 4GDKB 3P20A 4OW0A 2A68D 4ARCA 4RKLA 1II3A 3OSOA 1HUNA 1UWMA 5HFYA 1H9RA 1C76A 1XTCD 1YNJC 2F0PA 1EY8A 2R61A 1YNJD 5BYSA 2J42A 2NBFA 3TEYA 2F0DA 2K01A 2KMMA 2IX1A 4WJWA 1XX8A 3AE7B 3C46A 1B3AA 3ZJTA 2MGSA 3C1EA 1JWAD 3R93A 3ZGZA 2L0CA 1MBYA 2WV6D 4KY6A 4HMJA 2W82A 1L4ZB 4NW2A 1XYIA 5JVG3 4NDXA 2KACA 1FNUA 2PNRC 1K83B 3K7AB 4RH6A 2ICEC 4F7XA 4RKBA 3ETRA 4GLSC 2PW9A 4F87A 4CJ0B 2RKSA 3FEWX 1YN3A 3CHBD 2K0PA 5ELBA 2K9XA 2EYPA 5G3LD 2R92B 3NVVA 1PDQA 5EKLA 1CA5A 4QUCA 5EKIA 3NQTA 3M7NA 1ONLA 3Q23A 3AH7A 1PTOB 2A74C 1LT4D 4MM3B 1NEKB 3E5SA 1U4LA 3V2TA 4IOIE 4C3IG 1HA5A 4DK0A 1Y8NB 5T1IA 5DEHA 1PLFA 4HJGE 4MIUA 3TN2A 2RQXA 4EE2A 1GPXA 1EQTA 4DA2A 2DY7A 2PZUA 3FILA 4K8JA 5EE9A 1NI3A 4G4KA 4NMZA 1SYBA 2OXPA 4H2AA 3AEBB 4HN7A 3A55A 4FF2A 4M1UB 1HFNA 4RHRA 1FFUA 4WIPA 1QQRA 5DNFA 1CA6A 2R6GA 4R8IA 1E6EB 1EY6A 2XNAC 3RUZA 5I6YA 4V0BA 1QOBA 1QF6A 4N59A 3OWEB 1TU2B 4L6TB 3A56A 3S1NB 2CU3A 3BVZA 1PZKD 4FP5D 5M5YB 5FR3A 3SK4A 4CKEA 2G9HD 4XXEA 5JPMC 1BCPC 5EKKA 4HRSA 2OT2A 1DONA 3DWGC 1L6UA 5G5HA 4YTMB 1K53A 4ID6A 5JXVA 1EY5A 3NTHA 3NQIA 3J9CA 4USAA 4IFDH 1ACCA 1VF7A 3K6OA 4BS9A 2RA4A 2C9OA 4A8XC 2CHBD 1EYCA 3AN1A 2B2TA 3BIID 3VR8B 3CU7A 2GRIA 1E0ZA 2NVYB 3NXWA 2BE5D 2KVMA 4K2LA 4HCEA 2PVOD 1OO9B 2HDMA 2KQ4X 1FNWA 2WXKA 1FEHA 5FO9B 2L32A 2L4NA 3S2DB 4K5WA 1EYDA 4XT3B 5ISRA 1Y56A 1U9RA 1RHPA 1AN8A 1F2LA 1R7SA 1S5BD 1ZP0B 5FKAC 4V190 3U9OA 3MXNA 1DOYA 4UAIA 1TT2A 3ITPA 4YTNB 4A3BB 2PZTA 4JBWA 1XO3A 2JX5A 3BVMA 1DD2A 1UGJA 1STBA 1XLNA 5C0XH 1LACA 1ML0D 2JSOA 2K22A 3KLSX 4QB4A 2I2YA 4KJNA 3AV8A 2BA0A 2H89B 3FDTA 1SE2A 2WKCA 3BZDB 1S5FD 5ELDA 3KWLA 2PO4A 5E1FA 1B44D 1ENFA 1VDZA 3VR2A 3MFYA 1I4RA 4TRDA 2IJ0A 3D4RA 2ZXOA 3AE8B 2K5QA 1WWTA 2AQ2B 2JZPA 5HURA 4LMQD 1XCQL 5KNCA 4YSXB 2EKIA 2L55A 3V3XA 3ZJUA 4E6IA 3Q8BA 3I4MB 4GDLB 1BXTA 5EQ0A 1MI2A 2B2VC 2YEPF 2GA4B 3MJ5A 3NHHA 1TWAB 4IZ8A 3TSSA 1LTBD 1HRJA 2XWJB 3Q69A 3R8BA 1C48A 4OZCA 2ONQA 2K04A 1JWSD 3K5MA 1SNPA 2F0IA 3L3OC 2KAJA 2WXRA 1PFBA 2WKDA 2BS3B 1S5ED 1J7BA 3A7LA 1GUNA 1LT5D 4HMIA 1MVKA 1WTWA 2L83A 2K05A 3EA6A 3QOLA 2E2HB 3HP3A 1QLBB 3SK6A 4LTUA 3FPPA 3KLSA 4X3KA 1BUVT 4RGOS 1IHZA 4QIWB 3AE9B 2VZKB 1TKEA 2LHDA 4KKUA 1EFID 1I3QB 5I9OA 3W3AA 1LLRD 1STAA 4XDDA 3T56B 3V05A 5H8YE 1JRPA 3SK8A 2L1AA 1YNNC 3AE6B 3MAQA 1PTOC 1YNND 4OO1I 2XIWA 4K5XA 3D6WA 1GUTA 2KN4A 4K8IA 4RA8A 3WDNA 3HOZB 4C3HB 1ZXIA 1GUGA 2O5IC 1LO5D 3ABVB 1D5MC 2F3VA 2PTLA 3D4WA 1HFGA 1DGJA 2I38A 1TKWB 2K5PA 3AEFB 2V3NA 2MP1A 4QF4A 1F9SA 5E4WC 5D3IB 4ZYSA 5K36H 2ACZB 4RGNA 4B9XA 3HUIA 4P16A 3TP7A 2JP1A 3IAS1 4N6EB 2PIAA 3PMFA 1JORA 2V4DA 1JOQA 3I9V1 1SXTA 3HOVB 1WTVA 2CJNA 4C7YA 2ZW0A 3PUXA 5BN3A 4XIGS 2EE1A 1HA6A 2XSCA 3MWYW 3VYRA 1CFMA 3GTKB 4MT5A 2AQ3B 3S14B 1TIID 2B2UC 4HKQA 1J9OA 3OIPA 3SE0A 1G291 2YU9B 5EPKA 2LMCB 5LL6S 1VZ6A 1MSHA 2BDNA 5IGBA 3JAME 1HCZA 2BT6A 4TQ0A 1XCTL 5CGKA 1R9TB 2O2LD 2V0GA 4EQNA 1B1ZA 4IALA 3RMHA 1LTTD 1Q90A 1NYRA 2ID0A 3AEEB 2PW7A 2D62A 2WP8J 3B2FA 2LY7A 2WIIB 4KD3A 4KN7C 5CBEE 5IOCA 3K58A 1IW7C 1IW7D 3IKJA 3PV0A 2RMMA 2RSOA 3ND8A 4AS1A 1VDVA 1I4GA 2RSNA 2JYTA 4YXDB 3TBIB 3M4YA 3RZDB 2LFIA 4NP5A 1KAAA 2FBWB 3WCQA 3K5NA 2F0GA 1TYGB 1TS4A 5LNK1 2A6EC 1S5DD 1GB1A 1C8CA 3TDQA 1F2ZA 1AYFA 2BB5A 1WXQA 2FJ2A 1SSNA 5EE0A 3HZXA 1UEAB 2QSDA 5HGTA 1X32A 2F0UA 1LT3D 1SF0A 1I4PA 1TY0A 3SVMA 1WGKA 2DN8A 1RKNA 1GXDC 2IX0A 4A55A 5IT9L 4A3MB 3DM1A 5DAUA 4TQ1A 4XYQA 3AE2B 5IGEA 3BYTB 2KECA 1IYVA 2TMPA 1Q1EA 1ENCA 3H6MA 1L5PA 1C4PA 4DAPA 4KD4A 1QJOA 3KBGA 3FRPB 3IXSA 1KNAA 4Q5VA 3T4AC 1A70A 1HUMA 3SHLA 3V96A 4KV6A 3MXUA 2LMCA 2K28A 4MACA 3J7AV 1XXGA 3BVGA 5C3EB 1EU3A 3VRAB 3PUZA 1FNVA 3NP8A 4ULLA 1STGA 1DCZA 3VR9B 2WINB 3J81E 5KYLA 4P6VF 3U7ZA 2FMCA 2YEPB 5CV9A 4PT5A 2WAQB 1A2TA 3K0YA 2N88A 1QE6A 2QMTA 2HCIA 2QF7A 2XRQD 3PUYA 4NZLB 2ON8A 1MGSA 1KFYB 3MXPA 3R3OA 1QOAA 3NBIA 2AWOA 2Y3AA 3VA5A 1YNTE 2F0VA 1D5XC 5BN5A 1SYDA 1RDPD 3MXGA 1W6JA 1D1KA 3AEAB 3KQ4A 3I8ZA 1EZ8A 1FR3A 2Y5PA 4LAAA 1PRTC 1PRTD 1ILPA 1I4XA 5M3FB 3Q8CA 5AUIA 1V1OA 1K50A 2X6LA 1B9RA 2K1BA 5CV5A 2B63B 1CK1A 1HEZE 1FCLA 1Y8OB 3GTGB 2EY6A 1LTAD 5D65A 3A8JE 2KEEA 4KJOA 4G57A 2JEBI 3BYYB 3GTPB 1V1PA 4BY1B 3NUHB 1A15A 1ZDXA 2MJ8A 4G7OC 1T5EA 2HCCA 3M4OB 3RFZB 1C4QA 4HR7B 2D5DA 1EYAA 2BBCA 3EJIA 1U4MA 1FM0D 1VMPA 5LL6X 1SJHD 4G7HC 2IT1A 2X69A 3TEZA 3HEJA 3PO2B 2J4XA 2NUCA 1HXYD 1EY0A 2EJFC 1M8AA 2MJEA 2YYZA 3ND9A 4ZK9B 3NK9A 2GB1A 2JQRB 3KK7A 3IAM1 4KKJA 2V4IB 1E0BA 4C3JB 3CRLC 2E6XA 5CV8A 4RF0A 2MJ3A 2HDLA 1I50B 4ILWA 2LS01 5FLXE 2Y0SB 3OHXC 3M3YB 3DUZA 1SDFA 5KNBA 3HKZB 2WACA 2EYLA 2CVRA 4R9WA 4JWUC 4XQJA 1Q3LA 4A3KB 2LEKA 1WSPA 3A54A 2DNCA 2FHTA 2I07B 1N62A 2NN6H 2RVLA 3MVVA 2F0WA 1EEFD 2BCOA 2E75C 2KA7A 1L4DB 2WU2B 3BDLA 3VYTA 2K5DA 4IUQA 1AZPA 3AE4B 1RYJA 3VRBB 4AQ7A 3VR5A 2LUMA 5BYQA 5A2QE 2KJXA 3I73A 3S1RB 2BA1A 1BF4A 1F2YA 1TWGB 3M85A 4KMUC 3MFGA 1HZ5A 2XN9C 1ROEA 2WXLA 4DN4M 2AUJD 2B2WA 5MPOA 2VNUD 1B2TA 4JWSC 1PFDA 1BOSA 3A8IE 2FMMA 2F0TA 2VUMB 4KHZA 4ZUIA 5M9OA 3PUVA 2WB1B 3BDCA 1DOMA 3T3NA 2AWNA 4ZAIA 1QKZA 3AEDB 3MTSA 3J7YW 4EGVA 4Y7NB 3KLRA 2F03A 2A73B 1BMLC 3I3CA 2F0OA 1YN4A 1RCVD 2JYOA 2DWQA 1OXSC 5BMHA 5EBCA 1SYEA 1PDXA 4GZYC 1NSNS 3HRDD 3EUB2 1PTOH 2QJLA 1ENAA 1BCPD 1YJJA 3H0GB 1TKGA 4KGSA 1SE3A 1EEID 1DZ1A 1G8ZD 2WXMA 4RAUC 3PIP3 2EY1A 1RJTA 1DOIA 4IUVA 5M5XB 4JX1C 2M9VA 1P7FA 1YN5A 3E6ZX 5EJWA 2WQYB 1WTXA 5C6AA 1N60A 1EIGA 3A8KE 1CQFA 4A3EB 2SOBA 5G3LF 2W54A 2B8FA 1Q8IA 3E56A 1C79A 4KKTA 1AWDA 2JE6I 3S2HB 5T8IA 2NTSA 3OOCA 2PMZB 2J53A 2WXJA 3PIO3 1CJEA 1EWYC 3UI2A 1TJEA 3OMGA 3OPOA 1OXUA 2EJGC 1O7ZA 2F0EA 1MI0A 1Z6HA 3CQZB 5IGFA 4MHEA 2J0TD 1DYQA 3Q22A 4Z9CB 3O13A 1C78A 4WFN3 3VQIA 1XEEA 4F8MA 3LXFA 5CR3A 4IUUA 2C5CA 5D3DA 4R8NA 1XWEA 2E3TA 3U52E 4KK7A 1LTRD 1GJXA 1EWHA 1ZKOA 1JROA 4RF1A 2B2YA 1RM6C 2JXMB 4H44C 2K03A 3DWAA 1F2RI 3DWQA 4RFBA 3DHQA 2ZT9C 2KQ3A 4G7ZC 4EQOA 1Q12A 1O80A 4OO1G 1RWSA 4A93B 2W55A 1TQOA 1T6BX 3QB3A 1G2TA 2SDFA 2IGGA 2EVBA 2F4IA 3AEGB 1ZXTA 3HOUB 3URYA 5BYRA 1I4QA 4QUFA 5C3WA 3LNNA 4XT1B 1ZEQX 3SR6A 4ZUJA 2B2TC 4ME5A 2VXWA 1VF5C 3KUPA 3Q8FA 1F9RA 3QO2A 1MD2D 1CTMA 2EY2A 4MN3A 1DXMA 1YJIA 2CW0C 4ZHOA 1AZQA 2A6HC 2CW0D 3BK1A 1E2ZA 3WOEA 1YQ4B 1VCIA 2KHSA 1SYFA 3DEPA 5IGGA 1Q1BA 3CRKC 2PMVA 1UUPA 3P4PB 3I90A 3FMCA 4IFDI 1L0XB 1KDAA 1EZ6A 2WXOA 2JA8B 5HI1A 3A7AB 2JA5B 4IFDJ 5CV4A 2J7ZA 1IUEA 1DJRD 1CZPA 1XLOA 2LJIA 2WXGA 4JE3B 1JC7A 3HOXB 1FXAA 2V3PA 4R3DA 4HROA 2MHVA 1JB3A 5J1ZA 2B76B 4ZLTF 3LWEA 3K5OA 2WU5B 5M5WB 2IGHA 4KGRA 4A3IB 1QG7A 1KH0A 1V8CA 1TKYA 5C5LA 1PTOD 4NAMA 2JSVX 1FD7D 2K5WA 1OQQA 4PMCA 4DGZA 3I72A 1XLPA 5C4XB 4IDIA 2GI9A 1S4ZA 1KLGD 1GOZA 3DWPA 1SFOB 1WTRA 4Q2JA 4XE0A 1UWXA 3J80L 2R3ZA 4O42A 3U2SC 4DNRB 4XQQA 5IGDA 3TP5A 2EYHA 5C5MA 4C56C 3I4NB 1EQVA 1Q10A 5C0XI 4NAWB 3P1MA 5C0XJ 3S17B 4RNAA 3E0JA 2PLPA 2Q8IB 2EELA 3GQBA 3SDZA 4HTHA 2DYMA 3TP8A 2D5GA 1HTPA 1ZDVA 2NVQB 2Y5CA 1SB3C 4YT0B 1CHQD 1CHPD 2D9UA 1UAPA 2DBYA 2WDRB 3S1MB 3H09A 5D14A 5C3XA 1SYGA 5KNDA 4FF1A 5I4DA 1VLBA 3K59A 1Z47A 2Q8TA 3GTQB 4ZRQA 1JOOA 2H4OA 5J39A 4ZKCB 4YIJA 5NUCA 1FFVA 5AUKA 1Y1WB 1E10A 1STYA 2OEOA 5EE3A 4CKCA 1E2VA 2BS4B 1OQRA 3W5UB 1JQYD 1U4PA 3L9AX 5K5PA 5ELEA 1AW7A 3ZQ4A 1QWYA 2IX3A 1DOKA 2R7ZB 1KTKA 1H9MA 3TEWA 3AM9A 3D31A 4CGYB 1R4PB 3TMEA 2XVSA 2RDGA 4C3HG 1RD9D 2WXNA 1ZE3D 4H7BA 1IKLA 2EYMA 5H92C 4HSVA 1MPEA 1PGXA 1CQVA 3NBHA 1FXIA 2LHEA 2KEDA 1FYCA 3LWUA 3NVYA 2ZXPA 1KNEA 1KDBA 1N5WA 4WWMA 1Y69U 1TS2A 2A6ED 2L1BA 5I2XA 1VMCA 1B4OA 2A5HA 4WORA 3NE5B 5CV7A 1NENB 2VB3X 3T16A 1GB4A 2H88B 4OL7A 3FVQA 5E3FA 4KI0A 2E74C 4I65A 2IGDA 1UNSA 1EU4A 3MC0B 2AQ1B 3P4RB 4PMBA 4KHVA 1A3VA 1TWHB 2K3UA 1F0ZA 2B39A 1FGBD 1EIHA 3J81L 2O5JC 1C9FA 1VZ8A 1QB5D 4IQZA 4A9AA 1V1PB 2E2DC 5EBDA 1GHJA 4XTCS 2BW2A 4H13C 3GP7A 2WXFA 2K7VA 4ZRZA 4FXDA 3J7AF 3TZDA 3W9CB 5G5GA 1IGDA 3NSWA 2NWGA 2FINB 4FO2A 3QIAA 3GS2A 3B2GA 1QNKA 5ELCA 5CBAE 3C1FA 4WURA 4F88A 2DY8A 4BA1I 4XDXA 3AE5B 5LHY1 4B08A 3H94A 4OZAA 1OXVA 3D3RA 3CWIA 3ERQA 4A90A 1IBXB 1K52A 1T5XD 2INNE 4J6HA 4FXCA 1BCPB 3GTMB 2X38A 3MZ5A 1F9QA 3MEHA 4XWWA 4CQNA 2CQAA 4N58A 4UDUC 1PFMA 3P4QB 2IW3A 4O1NA 1D5ZC 3P4SB 3VYSA 2BYTA 5FO8B 1M4VA 2FFKB 2WP9B 4XWTA 1WYGA 2VZKD 5BMGA 1CT1D 2JA7B 1F9PA 4ABNA 1PMRA 4K14A 5AFWA 1G2SA 2F0NA 3HS0C 3VR6A 5FK9C 4US8A 1STHA 1F77A 1MHHE 1E2WA 3VR3A 5IT9E 1QILA 2FE8A 1ILQA 1MSGA 1EM7A 2G1EA 4DF7A 3L7ZC 4ZQ3A 5C4JB 3H91A 1ET9A 2WXIA 2MUYA 3OMCA 4DXFA 2KDMA 3QJYA 2M56B 3PO0A 1D6EC 3U4EG 2KOLA 3GD7A 1X3PA 2F0JA 5J22A 2OF1A 1L0YB 4RCNA 5FLXL 1AEXA 4L23A 3D6CA 3BDOA 5FO7B 1QOFA 2Z4HA 3FPUB 3NWTA 1QCBD 4OHJA 4H0LC 5BMIA 1I6HB 4IUNA 3Q0AA 3HG9A 3DMUA 2HDEA 2Q8RE 2X6GA 3ZYYX 1NR2A 4FYDA 1CZWA 5T1GA 3BG3A 2RDFA 3SR1A 1QOGA 4C3IB 1FIQA 1W6KA 1NCVA 2NVTB 1PGAA 1RFKA 3SFDB 2R93B 1H9JA 2A68C 1O7YA 3GTOB 5JEAG 4I7ZC 5A2QL 4BBSB 3UI3A 2F3WA 5JJZA 1GUOA 3NZ3A 1KABA 4QMGA 1IL8A 1I6VC 2EYOA 3P7JA 1WD0A 3ZJVA 3EVQA 1PFNA 2NZ1D 4HSPA 1N5XA 2BTEA 3LX0A 1B50A 4J1MA 1IBXA 1C4AA 3ONAB 1I4HA 1JCKB 5CYUA 3SEBA 2E2JB 4DQOC 2EXZA 2JU6X 2J52A 3H3VC 3NVWA 1NR4A 4A3JB 1QNUA 2NYZD 4KKIA 1VRAB 1SNQA 2QILA 5F2DA 2IDYA 2PW5A 1TR5A 1JMLA 4RWSC 2ICIA 1JW9D 2F0QA 1LV9A 3AECB 4YTPB 1FD6A 1EWCA 2BDOA 3TZUA 4C7ZA 3IAYA 2RDHA 2WNMA 5E4XA 3MP9A 2M0AA 1IGCA 3S9WA 2PKOA 4XDCA 2M00A 1PRTF 1RTNA 2VB2X 5C44B 4A6QA 3EROA 2LKVA 3I91A 2JYEA 3HOWB 5CORA 3C3LA 1JALA 4QCLA 4CJ1B 3EFXD 1STNA 2DNEA 4REZA 4C2MB 3DXJC 1OXTA 1V43A 3N52A 5KEEA 3SFEB 4EVOA 5JEAJ 3W5VB 1KDCA 2XWBB 4OIJA 5IODA 2QEJC 1V8QA 3P1HA 1N61A 4LK0M 3S1QB 4LJZC 2KUMA 2M19A 3T3OA 3SK5A 3OIQA 1TVXA 5DM73 1WCMB 2NN6G 4LK1C 4A3GB 1TS3A 3P63A 1D1IA 2EY5A 4DAVA 1SYCA 2F0KA 5ELFA 4ITKA 2NTTA 2PQEA 2SNSA 5I9PA 4C3JG 5C4HA 1AP0A 3F2UA 1FMAD 3KWVA 2KCCA 1G6ZA 3R2TA 4K6DA 5D7GA 3B9JA 1FCCC 2HUGA 4CKBA 1NAPA 3NUCA 3GB1A 2EYFA 3FC4A 4FF4A 3U9SA 4IKGA 4CJ2C 1SIJA 2QDBA 1WVLA 1HHVA 2FUG1 1EY4A 3OWFA 1L0VB 2L5TA 2EOTA 2BB6A 1I7HA 2NB0A 2B2VA 1TZOA 5FOBB 1BUIC 3AB5A 3Q8AA 4RGTA 4K2KA 1A3TA 1PXUA 3C2PA 4C80A 4K5VA 5C4ZA 2B8GA 3P42A 2IPKD 2BE5C 4YSYB 4M0WA 1QOHA 5EPJA 5JAVA 3N9YC 2JA6B 4S3SA 5IGCA 4HEA1 5EPLA 5BN4A 5KIXA 4NJCA 2PZWA 2OEDA 3W2DA 3AMZA 1RTOA 4OO1H 1JR0D 4WQMA 3IFTA 1A2UA 3LB8C 1SSOA 4IFDG 1Y1VB 3QG1A 4DU9A 3DWMA 3PZ7A 2D2CC 3EQLC 1SE4A 3QOJA 2AUKA 4AYBB 2B2WC 3NTKA 1WTQA 2NN6I 2JEAI 2K6AA 2Z4IA 1DOLA 2PVGC 1B9MA 1WTOA 4LLGM 3DEOA 1EY7A 1JWMD 4L63B 3CKIB 4HEDA 1ICWA 4PV1C 4ZKBB 2JWUA 4U673 4IN3A 2ENBA 3CIRB 1FO4A 3BK2A 4XYOA 1H9KA 1BCPF 4WH4A 1B9NA 2KCNA 1AFPA 2WDQB 4DNTB 1LTGD 1OXXK 1EOTA 4ZHPA 4XQNA 1F2MA 1NUCA 5JVH3 1N63A 3GTLB 1PUTA 1SEBD 4DK1A 4TMAB 1X3QA 1O7LA 4Q0FA 2NMQA 4IUPA 5C0XG 2HTME 3HOYB 2A6HD 3TEXA 1JOKA 1KLUD 1VR9A 3I70A 1F2RC 1SNDA 4BA2I 1Y8PB 5EGTA 5E6JA 4KTAA 2RPVA 5KYIA 2PCFB 2B2UA 2N9KA 3VYUA 1SNMA 1TWCB 3L4PA 3OW7A 3PO3B 2KWDA 1SMYC 1SMYD 2K33A 2L12A 3G6JB 4K6LA 3Q8EA 1A3UA 4FF3A 3IT6B 2G9DA 2N55A 2NVXB 1HQMC 2IL8A 2RBMA 1SBBB 3JAML 5HG2A 4OIKA 4B9WA 3FKIB 2B2YC 4X3SA 5I6WA 3T13A 1PZJD 1FRDA 1VZ7A 1JWBD 3GO5A 1ZPSA 1LT6D 4IUTA 4KGTA 4RCOA 2L9HA 2K32A 3Q24A 3C8YA 4TSSA 1NYQA 1CZGA 4ZOHC 3KF8A 4C1NI 3BWUD 1YMHE 3EGRA 2F0SA 1K8MA 2AX5A 2HQEA 3N6RA 1S5CD 1C77A 3R2IA 3RLFA 1EY9A 1IKMA 5I2YA 3P75A 1SJED 2N7JA 3VR4A 2A69C 1J7AA 1O78A 1Z7TA 1PRTB 2A69D 2EPBA 2F0HA 1BDOA 3GTJB 3QWNA 4X3TA 1LTID