1B1ZA

Streptococcal pyrogenic exotoxin a1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TOXIN)
publication title Structural basis for the recognition of superantigen streptococcal pyrogenic exotoxin A (SpeA1) by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 58
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b1zA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b1zA02
4K6LA 3BVZA 1LO5D 3BZDB 1LTTD 1LT5D 4BWGB 1PRTD 3DWQA 2CHBD 1I4RA 1BCPD 1RD9D 1PTOD 1RDPD 2G9HD 1UUPA 1CT1D 3BYYB 5FK9C 1B44D 1F77A 5FKAC 1YN3A 1S5DD 3R2TA 1YN4A 4L63B 4RGNA 1SXTA 1JWMD 1LLRD 1PZID 1S5BD 4RGOS 1HA5A 2RDHA 4DXFA 1L0YB 1TS2A 1LTAD 3OWEB 1LTID 5ELBA 4UDUC 3DWPA 1BCPC 1PRTB 1S5ED 5ELEA 1PZJD 2AQ1B 1YN5A 1MD2D 1BCPB 1JWUD 1PYWD 1SJED 1PTOB 1TY2A 1LTGD 1T5XD 4OHJA 1HTLD 1PZKD 3BVMA 1PRTF 1EEID 1D6EC 1EU3A 3MC0B 4RH6A 4RGTA 1S5CD 1PTOF 2QILA 3R8BA 2RDGA 3V05A 1ET9A 5I4DA 3SEBA 4DXGA 1SE4A 1LTSD 2IJ0A 1FGBD 5ELDA 3GP7A 3O13A 4RHSA 1AW7A 1LT6D 1EU4A 1TS5A 4RHRA 4NZLB 1PTOH 1S5FD 1D5XC 1I4XA 2Z8LA 1I4GA 1BXTA 3R2IA 2NTSA 3EFXD 1I4PA 3TSSA 1AN8A 3KLSX 2QEJC 1XTCD 1LTRD 1V1PB 1L0XB 2J4XA 1I4QA 1EWCA 1ET6A 1XXGA 2XN9C 1RCVD 3URYA 2XRQD 1CQVA 1CK1A 1EEFD 1SE3A 1STEA 1TY0A 2AQ3B 1M4VA 2XRSD 1KLUD 1BCPF 1CHPD 4RFBA 3EA6A 3MFGA 1D5MC 1EFID 2O2LD 1LT3D 1SEBD 1SBBB 1JQYD 1KLGD 4RCOA 1V1PA 1FNVA 4O1NA 1HXYD 4ZYSA 1SE2A 4TSSA 1ESFA 1D5ZC 3CHBD 1KTKA 2R61A 1GOZA 3W2DA 5D3DA 1QILA 1G8ZD 1JWSD 2SEBD 5ELCA 1TS4A 1FD7D 1HQRD 5D3IB 1RF2D 1SJHD 3DWAA 1LT4D 4C56C 1CHQD 1JR0D 1B1ZA 1UNSA 2TSSA 4Z9CB 3BYTB 1V1OA 1I4HA 1FNUA 2IPKD 3BVGA 2AQ2B 2XNAC 1ENFA 1JCKB 1DJRD 1DYQA 1PRTC 4RGMA 4L6TB 2NTTA 1LTBD 1FNWA 1PTOC 2ICIA 5ELFA 5TSSA 1TS3A 2WV6D
chains in the Genus database with same CATH superfamily
4C3IG 2HUGA 3UGBB 3VUWA 1PFSA 2WP9B 5JPMC 2CHBD 1IYJB 4GB9A 2V1CC 5DPTA 2KMAA 3TBIB 2OJRA 2ZNVC 5DLQE 3PO2B 4OELB 3SD5A 2JA9A 2FAZA 3T4AC 2UUBL 3CRKC 3OYYA 2KDIA 1V2YA 2DAJA 3NK9A 1UE1A 3FP9A 2PQEA 5C3WA 4XQNA 1WGDA 2VQEL 2BYEA 2JU6X 4DV7L 4CDCC 4ME5A 1P8LA 1SN8A 2JA7G 1HNXL 2ONQA 4E71A 1K0RA 3I63C 2IW3A 1YQBA 4DWFA 5JH5C 1ONLA 1L1OB 3PO2H 2PQAB 4RNAA 3RPFC 1H9SB 4JBJA 5IGFA 3H6MA 3A56A 2VZKB 1FFVA 4PS3A 2A69D 2GN5A 3PREA 1LTGD 1WX7A 2OCEA 4IWQA 4K8JA 5IOCA 3H7SA 2MP1A 2GVAA 3J81c 1K73C 4WJNA 2K8HA 1PTOF 4I6PA 3NQIA 2G9DA 1L7YA 2Z6KC 4OGQC 2KC1A 2NUCA 3I70A 2WS3B 1S4ZA 1J19A 2Z0EB 1Y1VB 4EKUA 2I5LX 3QR8A 2Q8IB 2B2VA 2CWAA 4OO1I 3EFUA 3RUZA 4PG3A 3VR3A 3JW0X 1N5XA 1WXSA 3PSIA 3EFXD 2MSED 3KLSX 1JRUA 4REZA 1LFDA 3PPAA 3J7AF 2ASQA 4HIDA 1LUZA 4S3SA 1VR9A 4FHKA 5FO7B 4DV5Q 3U7ZA 3A4RA 4HROA 1VQKA 2HD3A 1K83B 4GXBA 4DA2A 2EY2A 2PLPA 3EVQA 1VQIA 3D6CA 1BCPF 3RLFA 3AE3B 2B2YC 2PI2E 4G3XB 3QX1A 1H9JA 1EY7A 5FLXc 1P9DU 2BBCA 2IZVB 1OO9B 2VNUD 1MVKA 4OVUA 3FKIB 2AL6A 4IUTA 1N32Q 2BQQA 2E75C 2B2UA 1RAXA 2HHHL 1A2TA 3W1BA 5BN4A 2ICEC 2B63B 5EE0A 1GPXA 3I4NB 1K83H 1NVID 3LWEA 4F87A 4QCLA 1TZOA 3VTUA 5EKIA 3QK0A 1K53A 3W2DA 1N61A 5EPJA 1N9WA 1M90C 5C4XB 1IHZA 3I55A 4DR7Q 2JA5B 5D3IB 3VH3B 2EVBA 1FXAA 3KBGA 4JI8Q 3E0JA 3AEVA 1QOAA 4MT5A 3VQIA 3FKIH 3SHLA 1UNSA 2K14A 2JQRB 5JPNC 2TSSA 3QARA 3DDCB 2MLBA 2W82A 3BVGA 2BF8B 1E3PA 4GLVB 1PH2A 2UXBQ 4HKZE 4NY0A 5J2RA 4DV0Q 2WXHA 4NAWB 5C0XG 1DJRD 2E76C 4A6QA 4BXXG 2LRUA 1KOTA 2KN4A 1HEZE 3CCVA 3J80E 1MJDA 5C4XH 3DBHI 2JA5H 2L3ZA 3AU4A 2LHDA 1KDBA 2F0LA 3IAYA 3B6YA 1TS3A 2KMCA 4G4KA 5M3MG 5LMNQ 4C3JG 1NI3A 3D8GA 3M95A 2O5JC 3HZXA 4RM9A 2KQ3A 1UF0A 2DJFC 2G5DA 4B08A 4KVGB 4DUZL 3DBLB 1HZBA 5M5WH 2F0VA 2G9HD 3RLNA 3S1MH 2M0XA 3TP7A 1VCBA 4GU2A 1XMQL 1YN3A 4HJGE 1QLBB 2DHZA 4ZOHC 3KDFA 4U673 1D3ZA 5CMDA 3DQVA 3P4SB 2D5DA 3NJTA 1CZPA 3PIPA 1SYGA 5LMNW 1J8IA 4UDUC 3C1EA 4CBVA 4EQNA 2L0CA 4FHJA 1F2RC 2MO1A 1MI0A 2FINB 1N34L 3AE4B 2OJWA 1Q82C 1HUMA 3E9IA 5IE8A 5GAHC 1UBQA 2D2QA 2I1KA 5CTRC 3FILB 1MKHA 1A8VA 4DGZA 1IBXB 1WYDA 2M2LA 3OTOQ 2NBUA 3OJ4B 4K7SA 4B95A 2DY8A 3Q3MC 5LXHA 3C1FA 2MX2A 3AEGB 3OW2A 2MWSB 1PMRA 4IPHA 5JEAG 4R4QA 1RFKA 3A8KE 5ELDA 1NYQA 4OWWB 4GMVA 4A3JH 3B08A 3M3YB 2BGFA 2BTEA 4X3UA 2L0TA 4LNFA 2I5HA 1XNQQ 3NPPA 2C7NB 4IM2A 1X3PA 2E2JB 4WJ3M 1E22A 4II2B 3DM1A 1QOGA 1TGZB 2WXRA 4NPSA 1XTCD 1T0QC 4HPMB 2LGYA 1MIUA 2KA7A 3KUDB 3D32A 1H9MA 2GBMA 3TREA 2WDQB 1TVXA 2LWPA 1Y56A 3RT3B 5CYUA 2LGSA 1FRDA 3RNBC 1EIGA 1STEA 3CSFA 4LLGM 2XRSD 1PA6A 5M3FH 2I07B 4A3EH 3CF6E 4APVA 1XPOA 1EFID 3L13A 1V43A 5TR5A 2QKIC 3R93A 2JYOA 5COYA 4AYBE 2J0MA 5HG2A 4KIKB 2WAQB 4JOIA 1VQ7A 5JZEB 1PYSB 4FO2A 4RKBA 4GN4B 2Z4IA 5C44G 4LF7L 4FF1A 4JI1L 1TWFB 1IKMA 3O65B 4IFDH 1XMOL 1I6HB 5M5YB 3T1YQ 2WB1E 3ULJA 3J81j 4ICUA 2D3GA 3I3CA 2RA4A 2GBKA 5LLIA 3RN2A 4PNYA 1SNMA 2JWUA 1G8ZD 3ZDTA 2UUAQ 3CCSA 5AFWA 3FPPA 1DOLA 2F0NA 2F0IA 1SLJA 2CQAA 2ZM6L 4DNIA 4FJYA 5GROA 3IVFA 2ZTCA 1JE4A 1NBFC 3DHIC 1BO0A 3NUHB 1VQMA 1MHWC 5M5YH 2WXKA 4JWSC 2EYJA 3K0YA 3M4YA 4YWGG 3RZFA 3ZJVA 2KWCA 3S15H 3CQZB 1PRTC 1FCCC 4A3CG 3L0OA 3A5ZB 4L6TB 1IYVA 1E1OA 3K5NA 2NTTA 1JALA 1N5WA 3J80c 2JSVX 2K25A 4W9CA 3VRAB 3SK5A 1G2TA 2WV6D 3L3OC 4CJ1B 1KNEA 4OO1G 3NTIA 1LTTD 4TQ1A 3KQ4A 2L76A 3NQTA 3Q22A 3AYHB 3AE5B 1E7VA 1T9HA 2K03A 3N9YC 1EQRA 4XWTA 1LTLA 1P16A 2IY0B 3AULA 3QCAA 4ID6A 3CQZH 4DAVA 1C76A 5E4WC 4L5RC 3PO3B 3OG5A 3X3NA 2V4IB 2KCTA 1NAPA 1A3UA 2UUCQ 4QQBX 2J0KA 1PLFA 3AQQA 1RRBA 4DUYQ 4DV6Q 2RDHA 1WGGA 2FFKB 3DPDA 1LTAD 1V5OA 4UHVA 1K28A 4F7XA 3TEYA 1LTID 1STNA 3PUXA 1Q3LA 4JV5L 3GTKB 1Z47A 2V3NA 2ZW0A 1N62A 2N8NA 4PZ7A 5EBCA 4GNXB 3MC8A 5J18A 5G55A 4UY8C 1N33L 4KSKC 4YY3Q 1SIFA 2BB5A 1WE6A 5M5XB 1I42A 1H95A 1G6JA 1GB4A 4PMCA 2F1MA 1LYLA 2NPTB 1L1OA 3KF8B 4L8JA 1OXVA 1YJIA 2PQAA 2HIXA 4CHTB 4IUUA 1H9SA 3HKZB 4RG1A 5C6AA 4GOPB 3GTKH 1I50H 2CW0D 1WFYA 2XBBC 4IJHA 2Y0SB 3GQBA 4IUVA 4NXNQ 4NZLB 2BOSA 4BOSC 1F9SA 4AQYQ 1H4RA 3PHXB 3U30A 4OW0A 3E3XA 5IYDH 2HTHA 3C3LA 4K7UA 4WURA 1NR2A 4DHJD 1GXDC 4A3DG 5EPLA 1GJXA 4YL8A 4K0KL 2ZZPB 2JZ3B 2KK8A 1HR0W 1J8CA 3HOVB 2Z59B 3MZ5A 3OJ3A 4V0BA 1VQOA 4GLAC 4GN1A 4URKA 3P4RB 3NTKA 2XK5B 1K52A 4BA1I 2SOBA 1CQFA 1F2MA 1V9JA 4GN5A 3FEWX 2F0HA 4A3MB 1GJZA 4RFBA 4JI6Q 4FA6A 1QVCA 3I5JC 1VQHA 2VQEQ 1XJVA 4W9IA 1SYBA 4DV2Q 4DV7Q 2CQOA 1XCQL 4BFRA 3OMGA 3R66C 4TQUS 2GBNA 1FNVA 3HOVH 1GUGA 1XWEA 4B9WA 4KV2A 1DONA 4K81A 2I38A 2BYTA 4X66L 3RZOB 3TEWA 2MEKA 3F2BA 3BZKA 4IM0A 5DM73 3TZUA 4LNQA 3OSOA 1LM8B 3IAS1 4YCWA 4A3MH 2PYKA 4W9LA 3EROA 1R4PB 4A3IB 4HWIB 4NJCA 3A54A 1RF2D 2Z4HA 2J42A 2IO1B 1VDVA 2LZ6A 1BQQT 1AP0A 1RLFA 1TWAB 3CXCA 4C56C 3I9V1 1STAA 3G7LA 3L2PA 3AFPA 3RZOH 2J0JA 1FPYA 1I6VC 2J52A 3Q6BA 3S24A 1DOMA 1WR1A 1QVFA 2A8VA 3I57A 2NVYB 3MFYA 4LNOA 4A3IH 5AZHA 3U4ZA 3U52E 4B3MQ 5I6YA 4W9DA 3I4MG 1QUQA 2C7HA 1HNZL 2BA1A 4H2AA 1QQRA 5AZGA 2VZKD 5JOBA 1EQVA 3BU2A 1B53A 1ROEA 4IOCA 5D65A 3BK1A 4L5TA 2OQ0A 4NAWA 1YZ6A 4XXEA 4AJYB 3P1MA 4US8A 1K50A 4HCPB 2NVYH 3AFQA 5IT9L 1B4OA 3T13A 1ASYA 2JA6G 1HA6A 3UINB 2EDGA 1QKZA 4LJOB 5LHY1 3H3VH 4L1BA 4WRDA 2PW9A 2RPVA 1KFYB 2D62A 4ABNA 3K57A 3SR1A 3OAWA 1FEHA 2WU5B 4GNXC 1MHXA 4H13C 3NVVA 4HDOA 1Y8PB 4LTUA 1WVLA 4GZYC 4Y7NB 4LK1C 2NZ1D 3TS2A 2KJHB 3MTNB 2EE1A 5FR3A 1PZKD 1X9NA 1V81A 3U7DA 3K59A 1WWTA 3PUWA 3AE7B 1QF6A 2DLBA 2Q8RE 4XQQA 3K5OA 4RH6A 3J7YW 4GOPC 3HM3A 4K5XA 5KIXA 4W9JA 5C4HA 2K5QA 2HTME 3I4LA 2PPBC 2NBVB 5C3XA 1V6EA 3DVGX 2VW9A 3FKIG 5BN3A 1Q1EA 4AH6A 1EQTA 3P2BA 4H7BA 4Y7NH 1SDFA 3UDGA 1OXTA 5IWAL 1G6ZA 4TVAB 2KUMA 1KDAA 3FILA 3PZDA 1IBXA 2V3SA 4IUNA 1N32L 4J3OD 1P7EA 2NTSA 2N9XA 3U4EG 1Y8OB 1TYGB 4E3CA 4L5QA 2FIFA 1EY4A 2KFKB 4HXDA 2VZAA 1XXGA 2F0EA 2G45B 1EEFD 1CK1A 4DR1L 2E2IB 4DR7L 2LMCA 2MRPA 4KGSA 3J9CA 2L12A 1L0VB 3G71A 2YYZA 3NRZA 3WAPA 4K2LA 2QCPX 4X64L 2ZTDA 1WTWA 1XMQQ 1N8RC 2BDNA 3EA6A 2B76B 1SEBD 2B2TC 2O6VB 4OZAA 3HG9A 4PK1A 2UXBL 1SE9A 3NVYA 3VYUA 2B2WA 4C1NK 2QCZA 4GIVA 3G6EA 1SB3C 1UZXB 3B9JA 4ZKCB 2E2IH 1MHHE 3PF5A 2OTLA 3BIID 2K28A 2NVQH 1QWYA 1KL9A 4BBSG 1JJGA 5HFYA 4KHVA 2DBYA 3IRBA 5I9OA 1TTNA 3UI2A 1C48A 2SEBD 3GTOB 5IGCA 2PVOD 1E10A 2GA4B 3I2ZA 1X3EA 1L4ZB 4KIKA 3MA2B 4YHHL 4HVBA 1UE5A 1H9KA 3JSVB 1SE8A 3NHEB 2F0WA 2WINB 4P73A 2PCFB 4O42A 1SNCA 5J17A 1I3QB 2N9KA 3HOYG 2WXJA 4ZK9B 2KEDA 2RQXA 4FXCA 1UGJA 5IP9G 4A3JG 1WCMB 3I73A 4RGMA 3LB8C 4A8XC 3GTOH 4M02A 2K1FA 3W3AA 2NR2A 3CC7A 1LTBD 4U68A 5TSSA 3MEFA 1AFPA 2BVCA 3QJYA 3Q8CA 1LO5D 1XT9B 5AEKB 2MHVA 4KMUC 4NAMA 2NVXH 1WSPA 3Q0AA 3SR6A 3OTOL 1I3QH 1D8LA 4WWPA 4A3GG 1JJCB 3MWYW 2EXDA 3VHTC 1WCMH 5IT9E 4V190 2RF4A 2FBWB 3AXCA 3W1YA 3WALA 4ODGA 3H3VI 1LACA 5JVH3 2NBWB 5M3FG 3T53B 4A3EG 2Z1CA 1II3A 1CKMA 3N52A 4LMQD 1VQ8A 2OEDA 4R9WA 2UXCL 5C3EB 3PIO3 2HD5B 3Q3FA 3ZXVA 1A62A 3CCQA 1EYDA 2WLBA 1XMOQ 3HOXB 3MXPA 5H92C 1GO3E 1QOBA 2MBBB 1WD0A 1STYA 4IFDG 3A1QB 3AEFB 2MQHA 3Q14C 2HQEA 1S40A 4IPGA 4F88A 1XLNA 1W2BA 3M85A 1KJTA 3WAMA 2JE6I 1SYCA 2AHOB 1GNUA 1TT5B 3IFDA 2CKZB 5I6WA 4C1NI 4RGTA 5C3EH 1HNWL 4UP7A 1B3QA 2KWVB 2ZNVB 3KF6A 1Q1OA 5FLMH 4A90A 1VQDA 2IJ0A 4HSVA 3HOXH 2NYZD 2F0OA 5FOBB 3HGBA 4DR2L 3PO0A 1TS5A 1A3VA 4RHRA 2BYFA 1D5XC 4FXDA 2A6HD 4W9HA 1QOFA 2MHJA 1Q0WB 2JXMB 1QZHA 1BXTA 3AH7A 4DHZE 4FYDA 4C2MH 3WANA 3RZDB 1Q7YC 1F9RA 5CX3A 3T1YL 1BVSA 2XEWA 4JI0L 2NPTA 1Q12A 4CDEC 5EJWA 3KF8A 2LGIA 2GOWA 4WFN3 4P16A 3QQ8B 3AB5A 1H8CA 3VAWA 1FFUA 2IWHA 1PQSA 3Q8FA 2ZT9C 4OIKA 4N58A 4ASWC 1CHPD 3NELA 2H4OA 4OWTB 5C0XI 3LDZE 1E9MA 1HFNA 1DOIA 4LFCL 2O2LD 1V49A 2MJ3A 3RZDH 1JQYD 3ZJTA 2N3SA 1K8MA 5AZFA 4A3KG 3DEOA 4JLCA 4ITKA 3V6CB 2IX0A 3CKIB 1GKHA 5IP7H 5A2QL 2CU3A 4BZAA 2XK5A 3CHBD 2IBIB 3EUB2 3ULPA 3GZNB 4HK2A 2LJIA 4DU9A 1N33Q 1WIAA 1K3BC 3I91A 3ZQ4A 1EIYB 1YX5B 5KGUA 1NBWA 1R4MB 4AYBB 2CWPA 1SMYC 3TN2A 4GLXA 1UWMA 4S17A 1WYGA 1CHQD 2RSUA 2MUYA 1YITA 4BY1B 1HFGA 1EZ8A 4IALA 1ILPA 3BYTB 1IGCA 2WB1B 3H91A 1QG7A 2UUCL 1OXSC 1DGJA 3OHXC 3KUCB 3QA8A 3Q8AA 3J81i 1F9QA 1GUAB 3OPOA 4BY7B 3GTPB 2N9EB 3QWNA 2Q2UA 2W9NA 1LXDA 1EY9A 1TWCB 3DWGC 3M4QA 4JBWA 3PRZA 5IYDG 3ZJUA 2L32A 4EE2A 2EY5A 2G1EA 2PW7A 3T16A 1KNAA 2PZWA 4ZAIA 4YY3L 4DV4Q 1FIQA 4QL5A 5IOIA 1RIPA 4QJFA 4AIMA 4IDIA 1PGBA 3ND9A 4OEMB 3Q69A 4LJPB 1CTMA 4BY7H 3CMAA 3GTPH 2Y0SG 2JZZA 2WDRB 5IT9c 5E4XA 1TWCH 1LLRD 2SAKA 4CJ2C 1U4RA 1MI2A 4L5SA 3LXFA 4AQYL 4QY7A 2K3UA 4HR7B 4IWPA 4X66Q 3HOVG 3DWPA 3CAMA 3DCGA 1R7SA 4MSQB 3MEHA 2MBOA 5BO4B 1BCPB 3BZCA 2CHZA 2A68C 2EZVA 4ZDVA 4K5VA 4HJKA 3GTMB 2IL8A 3PSEB 2KX3A 1EU3A 4EZJA 2YEPF 3H0GB 4E6IA 2VUMH 5CV7A 5C5MA 4JI6L 1UEAB 4NJ7A 1LTSD 1B9RA 4DV2L 3G6JB 3QOLA 3QJZA 3I72A 3JAMi 2RMMA 3L08A 3U50C 3QIJA 1XTDA 3Q8EA 3GTMH 4TV3A 2L8JA 2K4KA 1JICA 2J7ZA 3AMZA 3P4QB 1CA6A 4XWWA 4A75A 3H0GH 1HNZQ 1V1PB 2HE7A 3E9HA 2CFMA 2EY1A 4IWOA 5G5GA 1YNJD 4FF2A 1TWGB 1PUTA 1IYUA 1RTOA 1RCVD 5IO9A 1CJEA 4MGIE 3WOEA 3NZSA 1NCVA 3VTWA 1RM6C 3ZNID 2GMIC 3KJOA 4HRSA 2WX1A 1Y8RC 3QAQA 1G2SA 2JN4A 1UWXA 4W9FA 2CVRA 1E6EB 4CKBA 3U4VA 1G91A 3SHQA 3NY5A 2NZHA 4X57B 3EBEA 4P2CB 4QUCA 4RCOA 2OOBB 1BR9A 5A2QE 1OFFA 4K3BA 2L0FA 3SDLC 4ZYSA 1C1YB 3TJPA 2KFKA 1TWGH 2E5LL 2GVBA 3TMEA 1G6PA 2KTRB 4RF1A 1X1MA 1KRHA 2W54A 4B3ML 5GXGB 3QO2A 1YBYA 1XYIA 2KWDA 3W5VB 3T3OA 4M0WB 3GV3A 3N1XC 1SMXA 1VF7A 4KKIA 4CGYB 2K5NA 1B3AA 4LCDE 3RNCC 2B39A 1Y1VH 2IYDB 4IG7B 4MH8A 5CHFA 3OWFA 5ELNA 2C60A 2WXOA 2EOTA 1KABA 3SK4A 4NJ6A 4BA2I 2H89B 1Y1WG 1I94Q 2C5CA 3TEZA 1NMFA 2QDBA 2AQ2B 2IHFA 2XNAC 5JHAA 1EL0A 4MJSB 5IWAQ 2FCSA 4II3B 1SRUA 2PI2A 4IUQA 3V2TA 1E7ZA 1RWSA 3C46A 3MHSD 1PTOC 2D2CC 2KENA 3CW2C 3JSVA 4FNFA 1Z7TA 4BWGB 2BKFA 4OVZA 4KZCA 4WAAA 4P74A 2XSCA 3M62B 2EJGC 4DR1Q 2JX5A 3QHTA 1VD2A 3HOWB 1C4CA 1WJ6A 3AE2B 5C3JB 3BYYB 2YTYA 4DKAC 4HCNB 4C4VB 4X64Q 4LAAA 1EYAA 1KAAA 2DJGC 4R4IA 1M94A 2KZRA 5JXVA 2B63H 4RGNA 1V97A 3I4NH 2R7FA 3TP8A 2PMZE 4GKKL 2EMSA 4IW0A 3H6NA 4CO7A 4RM8A 2JA8B 2IT1A 2F0KA 1BCPC 1PRTB 1FL0A 3FRPB 4R4CA 3H7PB 3HOWH 3GTGB 1HTQA 1EF5A 1J7AA 3C0RB 3RUIB 5JAVA 2XWJB 2KHSA 3DHHC 4RWSC 3BVMA 5FJ8G 3V6EB 2SDFA 2LXCA 2K04A 2BT6A 1YNTE 3F2UA 2OHFA 4YHHQ 4N9TA 1VQ6A 1WM2A 3A8JE 1S5CD 3ECIA 1C78A 3STBC 1FGBD 3L17A 1DXMA 1JJ2A 4FVMA 3GTGH 1T3QA 5DAUA 1JWAD 1YQ3B 3A1QA 3CWIA 3UDXA 4ANWA 2O6VD 2D9UA 3J7A5 5K36G 5IYBG 1VQFA 2QMTA 2SNSA 1RL2A 4PMBA 2B8GA 2VS1A 5KRUA 3GTQB 2K8CA 2SNMA 2DENB 3FC4A 3R7QA 1NNXA 3NXWA 1LTRD 1UBIA 1PFBA 1L0XB 1IL8A 5CBEE 4WJPA 4GLSC 1VLBA 3L16A 1PH3A 1YJWA 4LFAL 3M4OB 1N6ZA 1MSHA 2X8XX 4K1RB 1LT3D 2F0FA 1WCMG 3DUZA 2K5WA 4DR3L 1VZ7A 3RULA 5LNK1 1D7QA 2ZPYA 3GTJB 4KKSA 2UU7A 2CS4A 2CCZA 2UXCQ 4TSSA 1I7HA 1D5ZC 4XE0A 3DBRB 3MXUA 1C0AA 1KC8C 2MJ8A 1WJNA 1T0YA 2QDFA 1WX8A 2INPE 1L6VA 5E6PA 4RAUC 3OMCA 3HOZB 2KN5A 2LFNA 2KTFA 5E6NA 1QILA 4EUTA 2NVTB 1VQJA 2EYHA 2HDLA 2ES2A 3S2DB 2YVCA 3SE0A 2IGDA 2Z6KA 3E6ZX 3GTJH 2D3CA 3M3YH 4EOYA 1HNWQ 1NENB 1E1TA 2KVRA 4LUZA 2ENBA 2E2JH 5C3EG 3V3XA 3S1NB 3PUYA 5LMUL 1XLOA 4DR2Q 3UE1A 4JG2A 5FLMG 1CMXB 3AE9B 3L54A 4YT0B 1UWVA 3CRLC 3GE8C 4NPNA 2V9HA 1NY4A 1WY8A 3AE1B 2N49A 2FCMA 1U5KA 2CJNA 4NXML 1OXUA 1J9OA 1LABA 2K7VA 3S2DH 4LDTB 1Q10A 1CFMA 2QDLA 1EFWA 2DAFA 3BZDB 4NQKE 4WQOB 4B3TL 4JI0Q 1ILQA 1R4NB 3MJWA 3HOUG 5HURA 2Q2IA 1NI2A 2B2YA 2K05A 3E5SA 3ITPA 4A3FG 1JB3A 3FKYA 3PTFC 1VQAA 1E8WA 3S16B 2R6GA 3V62A 2KHIA 3X23A 2O2VB 3A5UA 4ALPA 2PKOA 1CKNB 1HJPA 1TWFH 3MXNA 4L63B 4KN7C 3C2PA 4LFCQ 4WJOA 4KKUA 1I6HH 3X3MA 3B2FA 2DZKA 3VVWB 3IBEA 3MXGA 3N3KB 1D1KA 1PFMA 5C1ZA 3W5OA 4PS7A 4M1UB 3RR5A 1L5PA 4GDKA 5IP7G 4X65L 1T5EA 1WXVA 4ILWA 4KDLB 3RI7C 2P5ZX 1A3TA 2N1WA 4LF9Q 1SSOA 3H09A 3CCMA 3S16H 1P98A 1VZ8A 3J7ZC 3PRPB 2KO3A 4FLHA 3ND8A 2NN6H 1PGXA 3K9OB 4YCVA 3GTLB 2NVUI 4XYCA 2MNAA 4HSPA 3KLRA 5I4DA 2HDEA 4KD3A 3IAM1 2XTIA 2MBHA 3F2CA 1K3RA 4JI2Q 2D0PA 5BYRA 5CBAE 5EE9A 2AYOB 3FMCA 1IGDA 2PPHA 3PIOA 1EYGA 1ASZA 2GLSA 4DPGA 2ALYB 2MO0A 1C77A 3DBLI 5HGTA 4A93B 5GAGC 2A6EC 1RKNA 3UQBA 2KWUB 2YTXA 4AYBG 1Q1BA 2JYEA 2KVMA 2JXTA 2KDEB 1I4QA 2RKSA 2HCIA 3PO3H 1ZE3D 4KHPQ 1AZQA 2H5XA 2GRIA 1YD8U 4EZLA 1C4PA 4QMGA 4M01A 4OONA 2DUDA 2K5VA 3AM9A 2CR5A 2YU9B 3SFDB 4DHZB 4KY6A 5C4JB 1PGAA 4XDXA 4A93H 4RKLA 4XTCS 5LL6X 1EY8A 4BY7G 4YTNB 4ZRIA 1KLGD 4R1JA 1YHQA 1HCZA 1V1PA 4O1NA 4G7ZC 1YVCA 4GN3B 4C3HB 2N7EA 1PDXA 4K8IA 4US9A 1ENAA 2WU2B 1HTPA 1QZGA 2BE5C 1YMHE 2JQOA 3OIQA 1MFWA 4ANVA 5M5XH 2RBMA 3EC8A 5HKHA 3PVLA 2L05A 1HZ9A 5IGBA 2K32A 1EUJA 3NVWA 4DV4L 4HEDA 1O80A 2K6QA 2IY5B 4C3HH 2EPBA 4WJWA 4GKJL 2WXLA 2LXAA 4TKNA 1SAPA 3DLLA 2IPKD 3EFCA 5I2XA 2VUMG 3NS8A 5DPRA 1KM7A 3DVGY 2J53A 1KXLA 3PZ8A 1LGRA 5CHVC 1VQPA 1DYQA 1XD3B 2IO3B 1SR3A 1B50A 2UWQA 2KHJA 4M0WA 4IFDI 5IN7A 4YWKA 4BBRB 3DEPA 4K5WA 2L15A 2ICIA 2X69A 2LGXA 3VTVA 3H1UA 2K75A 3MAQA 4O0AA 3AB9A 4HJ8A 3I7FA 1F2YA 1LT5D 2OT2A 3EIVA 2VXWA 2KACA 3H8HA 3PO2G 3ZW3A 4C00A 4EEWA 5BMIA 4DAMA 4C3IB 2W3SA 4I7ZC 1BCPD 1VCIA 1TQOA 3A8IE 4N9PA 4MJSA 3K8AA 2M0AA 5J1ZA 1TXYA 4DV1Q 4EQ5A 2XIWA 5FKAC 1EWYC 4DK6C 2N0SB 1YHBA 3BDLA 1L4DB 1J6QA 3KJPA 1YIWA 2ON8A 4AWJA 1X55A 1HZ6A 2PO4A 3RNUA 3STBD 2JA7B 4C3IH 2E5LQ 2Q2TA 3M3JA 4JCVE 1E90A 1ISNA 2N1VA 1X56A 4WWNA 2F0DA 5H8YE 3D4WA 1V5TA 2KCNA 2K1BA 5F2DA 4XYOA 1K9MC 1TWAH 1MGSA 1JWUD 4N8FA 1ZOYB 4C4VA 4HPPA 2MBEA 1HUNA 2F0PA 5CV4A 3KFUA 2DN8A 4IURA 3VR6A 5HY6A 1HQMC 3G4SA 3TRZA 2VH2A 4HMJA 4KDIC 4B3RQ 2QILA 2NS5A 1Y1VG 2JA7H 1WTPA 4FBJB 4LNKA 4MTNA 4OIJA 2DZIA 2L11A 4DXGA 2KLCA 4NQLB 4HJAA 1NYRA 2D07B 3FAHA 3H7PA 2LVQA 2A19A 4JGHB 2LI5A 4ANUA 1WTHA 4OZCA 2I46A 5BR8Q 2KX0A 1WJJA 3KOJA 1ZW7A 4LF6Q 2LFIA 3CP0A 5EKLA 2RGFA 4JE3B 3HKSA 1OTRB 3T9LA 3WWVA 2LVOA 1IW7C 1A5RA 3IFTA 2QHOA 3CC4A 4FULA 3S2AA 4H0LC 5DPSA 2N7JA 3RFZB 1UH6A 3N30A 4POGA 2M17A 3L9AX 3NEMA 3W1SC 4BBNF 1CQVA 2I0QA 1TJEA 2LASA 5KYLA 3SK6A 1N60A 1M4VA 1NR4A 3WDNA 3PZ7A 3WCQA 2FHTA 1J7CA 4XX5A 4DXAB 2QA4A 2MA9B 1I94L 4ZHPA 4DV3Q 2F03A 1VMPA 2JEBI 4J15A 1X3QA 3HEJA 1AE3A 1I5FA 4CKCA 2B3AA 4L23A 1E8ZA 1XPRA 1YOVB 4N8X1 4GKKQ 3UIPB 2B63G 2KD0A 3V60A 5GAEC 3ZNHB 1VF5C 3ZXRA 3P63A 5IA7A 3I4NG 3D0FA 2ZXRA 3I90A 2ID0A 4A9AA 3CCUA 3ZGZA 5C4XG 3UDFA 2JA5G 3ZKJC 4PS8A 4AUQC 4MGYE 2EYOA 1WE7A 1SNOA 1ZGUB 1HQRD 2L00B 3N6RA 1GUNA 3EN2A 2AKWB 3DWAA 3NHHA 1VRAB 5IYCH 4KY5A 4R4TA 1A0IA 1WTQA 4BS9A 4PZ6A 3QB3A 1JWBD 4KZ0A 2K39A 1PFNA 4X3KA 3Q23A 4BVUC 4YSXB 4KLKA 3DOWA 4LK0M 5JJZA 4JBKA 2R93B 2K5PA 3L0WB 1Q90A 4YCUA 1GUTA 1MG4A 1FYCA 2D11A 2MQJA 1AEXA 4JI4Q 1C4AA 3CCRA 3W9CB 4K6LA 3HK0A 1RTNA 1PRTD 4G7OC 5GADC 2G3QB 1QNUA 5M3MB 5CHWA 4IQZA 4HKQA 4TKOB 1J5EL 1WM3A 2C7MB 1YJ9A 1PHJA 2D5GA 1RDPD 2NB0A 1TKWB 5JVG3 2PE9A 5T1IA 4LFAQ 2R93H 1WOCA 2MP2B 2YV5A 1EYCA 4RF0A 4LFBQ 2NZOA 5J3BA 1VQNA 4DR3Q 2A69C 1VQLA 2IY1B 5LXIB 1FRRA 3DMUA 4IOAA 2ASBA 1BMLC 4KJOA 2PTLA 3IG3A 2WKDA 3U9OA 4HJ7A 2M19A 3ETRA 5ELEA 3VR2A 4HJ5A 4HDQA 1YN5A 4KGRA 4A76A 4FJVB 1TY2A 1U4LA 3AEBB 3ZUNA 4F1SA 3RD2A 3AV8A 2JWZA 2WWZA 4AP4C 1CZGA 2DY7A 2EJFC 4IM3A 2R7DA 3A7LA 3P20A 2PMZB 3FPUB 3KLWA 4Y52H 1C3TA 2N55A 4KHZA 3HM6X 3DHGC 3R8BA 2RDGA 4HCSA 3V05A 2QF7A 3VYRA 2ZVNA 4JI5Q 2Z0SA 3ER0A 4J1MA 3RNFC 5LMUQ 3J7AV 1EOVA 3KYHC 2UU9L 2LVPA 2EXZA 3NVZA 1B70B 5CV9A 5GQOA 4P75A 1CI3M 4HIMA 4KN4C 3V96A 1BF4A 3CPFA 4NXMQ 4K3CA 4CYEA 3CCJA 1AZPA 3TBLD 1TIID 4ME3A 2AWTA 5FO8B 4B3TQ 3CPWA 3TMPB 3A9KB 2L52A 1ZYRC 4FDBA 2NWGA 5E1FA 2KHWB 2XRQD 2WXFA 2KNBA 1EY5A 5KEEA 3EECA 1SGHA 4DF7A 2KCMA 2IO2B 1O78A 3KWLA 1KLUD 2LD9A 1AYFA 1O7ZA 2BS2B 4DK1A 4MTKA 1OQQA 1D5MC 2WAQG 3PCOB 1EUVB 4NMZA 2F0QA 1SSNA 4GNXA 2IX1A 2W55A 3QC8B 2IX3A 1ESFA 1F52A 4WQMA 3L4PA 4X65Q 1NUCA 3HRDD 5C44B 3WA0A 2D10A 1Q86C 3C19A 3NE5B 3VXWA 4LDTD 3NBIA 2R61A 2K52A 3IL8A 1MG8A 1XCTL 2AUKA 3S14B 2KDBA 3AEAB 2MGSA 4I7AA 4DR6Q 2E2HB 4GOPA 1DZ1A 4N6EB 4YSZB 2VQFQ 1L2NA 2GB1A 2FMMA 2BCOA 2NN6G 5BYQA 2BDOA 5T8IA 2EYLA 1JB7A 2AUJD 4JK1C 3PF4A 2AWOA 2Z6BA 4IPDA 3RD4A 3R3MA 3RNGC 5C44H 5IIFA 1E7UA 2DZJA 4ACFA 3JYUA 4HJ9A 2FNJB 2RSNA 3VYTA 1WR6E 1EWIA 1P3QU 2ZJDA 4MGZE 4A3LH 4OX9L 4B0EA 2QJLA 3S14H 5I2YA 2E2HH 4WORA 2B2VC 5HHDG 4NB3A 4FP5D 4QUFA 4NNJB 1ML0D 5DPWA 5J22A 2LXJA 1STGA 1DOKA 5DM63 2KANA 2B8FA 2L7RA 4I65A 4LF9L 2VY3A 4WWMA 4IOIE 1E2VA 1RODA 1FVIA 3J81E 2KDMA 2EMTA 3PUVA 2K5DA 3VUXA 3PO3G 1IBLQ 1HZCA 1JMCA 2B2TA 1CT1D 4W9EA 3A55A 5DCNA 3TZDA 1S72A 3KH0A 3RLOA 1UEBA 2K33A 3R2TA 1V80A 4A3CH 1VJKA 4NDXA 1ZDXA 4AQ7A 1JWMD 5A35A 1PZID 1ZXIA 4A93G 4JI2L 4KV6A 1ZXTA 4KTAA 3BWUD 2WNMA 3IFWB 5ELBA 3NS1A 2LKVA 4JL9A 1YJJA 1VQCA 1KRSA 2K5HA 4M8NA 1GUWA 4IPCA 1WGRA 2ZCCA 5JHBA 2B2UC 2X38A 1PTOB 1X6OA 4OHJA 4YTPB 3ICEA 2OF1A 4BY1H 2ZXOA 2XGTA 2RDBC 1EOTA 1J7BA 4KHPL 4M00A 3EGRA 5D6JB 1CM9A 5IGDA 1JE5A 2WXGA 3HVDA 1N36Q 3HKZG 4GKJQ 3ZTDA 4YXDB 4KK7A 4C3HG 3FDTA 3K6OA 3NP8A 2J7QB 1TKGA 4C80A 3O13A 4ICVA 3TL5A 1JC7A 1WX9A 1PTOH 2N88A 1WZ3A 2MJDA 4FN2A 3UE0A 5EGTA 3A33B 1I4GA 2HQLA 5CR3A 1NE3A 1UELA 2PVGC 2YLMA 1KH0A 2M56B 1OQYA 2KXJA 4FADA 5EDSA 1UE6A 2O5IC 3N1ZC 3Q24A 5CV8A 2WP8J 5CV5A 2BW2A 3JAME 4DAYB 3LWUA 3TCAA 1L2FA 2PIAA 3ZVVA 1FCLA 1QB5D 3DBHB 4A3MG 2N4FA 3LYYA 2HIVA 2PMVA 1CA5A 4WAFA 1JORA 2LUMA 1O7LA 2K22A 4J6IA 4XC2A 1ACCA 2EYMA 4JX1C 2QSDA 2CU1A 3MFGA 1BNZA 4B9XA 2FCNA 3NBHB 4XGAB 2N9PC 1VQBA 4PMWA 2ZTEA 3K5MA 3AEEB 4KD4A 4DR4L 5G5HA 2KDFB 1BBUA 4G0NB 4ZRPA 2K6DB 1JOOA 2MCNB 2AL3A 4Q5VA 4OWXB 3UDIA 4DN4M 2M4NA 4G57A 4F8CB 4A3IG 1IP9A 4GDLB 4YSYB 3ZRFA 4AOFA 1WMHB 1WTOA 3VA5A 1OEYJ 2M9VA 3RNAC 3GB1A 1C7YA 1TZ1A 1E8XA 3C8YA 2FMCA 1LT4D 1V1QA 4Q0FA 1HH2P 2E74C 5M9OA 1IUEA 2KJ6A 2MJEA 2RHQB 2Y3AA 2M1MA 2ZCBA 1PH4A 1FM0D 4JPSA 1MBYA 4DV1L 4IO9A 4FF4A 2JT4B 4D2KA 2Z9HA 5JJKA 3B1LX 4MEMA 2F3WA 1YQ4B 4TRDA 2BPSA 1ENFA 2OXPA 2JVCA 3AE6B 1IYFA 3N20C 2WIIB 2IHEA 4ZCKA 4GOCA 1OQRA 1R4QB 4X6AH 3TUOA 4IZ8A 4ARCA 4UAIA 1V86A 3BJUA 3KW5B 1FO4A 1QCBD 5H1SE 2DNCA 3DWQA 3F1ZA 4YIJA 2PNRC 2R7ZB 5CC4A 5I9PA 1TU2B 3I4MB 2WXIA 3TQYA 2BA0A 1FXIA 3RYTA 2I2YA 1S3SG 1KAWA 2O6VA 2E8GA 1W6JA 5D14A 2EELA 1YIJA 4ARIA 3UQAA 1KLVA 5HGQA 1WGYA 1B44D 1F77A 4IC7B 4B3RL 3K5LA 2LRWA 1ZPSA 4OXPA 1AARA 1YN4A 3KYCD 4WWOA 1U9RA 3GZNI 5EPKA 1HTOA 2BYVE 3PRMB 3WOFA 2F4IA 5BYSA 2EJMA 3TDQA 1GC7A 4MM3B 2JA6B 1IZ6A 4JI7L 5BR8L 1R4MI 1UD7A 2KKCA 4FF3A 1FGUA 4TUUA 2ZJPA 2R7ZH 4DQOC 4YWMA 4LF6L 3I4MH 2D3AA 1WRDB 4JOIC 4ZQ3A 1VDZA 2AEHA 1D4BA 3BK2A 1VQGA 1EO6A 2MP2A 2Z0DB 2BKRB 4MSMB 4R3DA 4HLEA 1BUIC 2RR9A 4I6NB 1LQBA 3IXSA 4XZ4A 2CW0C 3K81C 1TKYA 3CMMB 2JA6H 2A4ZA 1YJ1A 1GD7A 3ZLZA 1ZYRD 1V8QA 1WGKA 2KC2A 5KHQA 2REXA 1GHJA 5IYCG 4DV3L 4S0RA 3D31A 2WACA 4P71A 3K80C 1TIFA 5DEHA 1EU4A 2HT1A 3T8MA 5C23A 4ZHOA 4MGKE 1S5FD 3BS1A 2X6GA 4BAXA 2JRIB 2PW5A 4JPBW 4POFA 4KY7A 3VR4A 3ZIMA 3IT4B 5ELOA 2LY7A 1P1AA 1B9MA 2WYQA 2WDVB 4IJLA 2C5LC 4CDDC 2FUG1 2V1YA 5BN5A 2J4XA 1E7PB 3SGIA 2VH1A 5L83A 3GDEA 2LXKA 4LNIA 1TKEA 2IO0B 1G291 4OL7A 3JC66 1ZXHA 1J5EQ 5AUIA 2RHSB 3JAMc 1SE3A 4F8MA 3AECB 4N9F4 2V4DA 2MBQA 1QUQB 1WI5A 4BKGA 1QE6A 3DM3A 5J39A 1BKBA 3D4DA 2RD0A 1PV4A 1WD1A 2JA8H 2F4VL 2R93G 4I6LB 5C2TB 3GO5A 3LX0A 3CMEA 5C5LA 5M5WB 1IBML 2D3BA 1S3OA 3S1MB 3A9KA 2I5MX 2VL6A 2KVZA 2L83A 2DYOA 3WAOA 4BKTA 4DDID 3AEDB 5C0XJ 1A63A 3T1HL 2WXMA 4X62Q 4EQPA 4DBGA 2AWNA 5K5PA 2E3TA 3PV0A 3ENEA 4B3SL 1FJGQ 3GOEA 3SVMA 2Y5CA 3SU8X 4JI4L 3ZRCA 5E6OA 4EQOA 2INNE 2FCQA 1R9TB 1GM5A 3HRZC 5D3DA 1ZKOA 3G48A 3PQIA 4BBSB 1S1QB 2BWES 4ZUIA 5AJ3Q 2QC8A 2GBRA 1TS4A 3U2SC 4EGVA 4AS1A 3J80i 5KNDA 5G3LD 4H44C 1P0RA 4N59A 2PNHA 4BKSA 3OOCA 2LS01 1U0LA 4Z9CB 1T0RC 1ZP0B 2LHEA 1FNUA 2N78A 1PH7A 1SMYD 3GTQH 3Q6SA 4LFBL 2UU9Q 1L1OC 1F2RI 3NG0A 4LF5L 2YTVA 1R9TH 3HOYB 4LUVA 4BBSH 2CHWA 5IKCM 2XVSA 2JEAI 1U4AA 2BS3B 2E6XA 1QZEA 3CCLA 4A3JB 2RPQA 3ERQA 5CORA 4WJQA 1UE7A 3P7JA 2EKIA 1SNQA 1VMCA 3A7AB 4A3PA 1EWHA 5CGKA 3M4OH 2LJ5A 4LF4Q 1QNKA 2ATWA 2ZJRA 3JVZX 2K50A 4P1CC 2NBFA 1I35A 1F9PA 1X32A 1UUPA 4HN7A 1IL2A 3HOYH 3Q8BA 3A74A 4A3GB 4ULLA 1EY0A 3RN5A 1MSGA 3HFZB 1VZ6A 1WI0A 5IP9H 4NKLA 5JEAJ 2LMCB 4JI5L 1EF1A 1SXTA 4MN3A 1EIHA 4G7HC 2KBNA 1HA5A 4A20A 5M3FB 1TS2A 4JI3L 3HOZH 3HOXG 2QEXA 4A3EB 4WH4A 2TMPA 3AMUA 4TMAB 1TT2A 1GG3A 1NMGA 1A70A 5MPOA 4HCEA 3TS0A 2NVTH 1C8CA 2FUHB 4JWUC 1X3FA 2NCNA 2C35B 3PHWB 4TQ0A 1X3GA 2K0PA 1SJED 1PYWD 4L2YA 4A3GH 1FD6A 3TEHB 2KFJA 1B7YB 1PRTF 3S1NH 1XLQA 1GUSA 1PFDA 4HEA1 1K8AC 5E7NA 2A68D 3VYSA 2WXQA 1WH3A 1SYDA 3PLUA 5IGGA 2CH4W 2JY6A 4QGUA 3LGJA 1O7IA 4PV1C 3AN1A 4M8MA 1TWHB 1G51A 4ZLTF 4OX9Q 1I4XA 1QJOA 2RVLA 1PVOA 1B2TA 2XWBB 2C9OA 1RYJA 3ERSX 4A3LG 1ZUD2 3ONSA 1AN8A 2ACZB 2QEJC 4BKSD 2L55A 1Y14B 3ZJYC 3S15B 4DK3C 4PYZA 1Q81C 5IP4D 2A1AA 3K0XA 2KYWA 1W6KA 2D0OA 4QIWE 1VQEA 4DR6L 2L1BA 2VQFL 5ISRA 2KJRA 1TWHH 5AUKA 2AQ3B 3F2DA 5KNCA 4XDDA 5IGEA 5BMGA 4DR5Q 1PH5A 4BOZB 1E5WA 1XNRL 1HHVA 3ZNGC 3U9SA 4P72A 4WJ4A 2HJ1A 1B8AA 1HXYD 2RCFA 1GHKA 5L95C 1SFOB 1UAPA 3I8ZA 4DAYA 4A3KB 4FJZA 2HDMA 3E0EA 3OW7A 2KQ4X 5IODA 3GTLH 2UXDQ 1EIFA 3VR5A 1MJEA 4HIOA 1Q8KA 5E3FA 1GAQB 4KKTA 3HIZA 3P4PB 3M9BA 3T56B 3NBHA 1E0BA 1FD7D 3BDOA 2ZW1A 1SJHD 4BY1G 2PE6B 1TBEA 3APCA 4C7YA 2KAJA 1IBLL 1WRIA 3HVZA 2WB1G 1JR0D 1B1ZA 3IKJA 4A3KH 1SFOH 3AE8B 2JP1A 3AI5A 3SFEB 4AJWA 3KK7A 3ALBA 4JYAL 1E2WA 1F2LA 2R92B 4P7IA 4MHEA 4GDLA 5EE1A 3RCZA 2WX0A 3PLVA 3ZO5B 3KF6B 3DHQA 3D3RA 1WMHA 4E74A 4ZKBB 1IBKL 1I50B 2DNEA 3ABVB 1CUKA 3QG1A 2JXXA 3A9JB 4A3BB 3KBXA 4JC0A 4HPLB 1YX6B 2ZJQA 2YU9H 2K01A 4EVOA 5C4JH 1QOHA 1HR0Q 1PTOD 2R92H 3W5UB 3D4RA 3U8ZA 5D94A 3PMFA 5EE3A 2F3IA 5FK9C 3KLSA 1AH9A 1N36L 3DBRI 4JQWC 1JROA 4JBMA 1O7YA 2KTRA 4MIUA 3DVNV 2KOLA 3E9SA 1S5BD 4DXFA 4A3BH 4DR4Q 4UP9A 1LV9A 1WTXA 2C9WB 2O4XA 3CF5A 3APDA 3CIRB 4ZRKA 1WXQA 1F1HA 4MDKE 2B2WC 4GS3A 4ZUJA 3TP6A 3S1RB 1K0SA 4LF8L 3N32A 4JIOU 1PZJD 2AQ1B 3X0WA 4MACA 4DDGD 4XQJA 2JF5A 2L1AA 3P42A 3KYDD 1T5XD 1WGHA 3ULLA 3MC9A 5KHOA 4MNOA 3K58A 2UUBQ 1F2ZA 1EEID 2OQKA 3H0GG 2JRHA 3KWVA 4MM3A 1D6EC 3T51B 2EKEC 2WHIA 4G11A 2K9XA 1CSQA 1HZAA 5EKKA 2A6HC 2M00A 1HPCA 1PYBA 4BBRH 5DNFA 1IXRA 3S1RH 3R3OA 1F9JA 1HNXQ 2BH2A 3F8TA 1JW9D 2ZEQA 3DWMA 4DAPA 1R4NI 3H9DA 2KJXA 2A5UA 4PT5A 4YTMB 2DZMA 1W3SA 2FJ2A 4LNNA 2FXQA 5IY0A 2FIDA 3FVQA 2NN6I 2BB6A 2MW5A 1OXXK 2G4SA 3KUZA 3SK8A 3NZUA 1K8OA 1X65A 1ET6A 3DXJC 2XN9C 4LUOA 4KGTA 4RCNA 2GI9A 1D1IA 3A4SC 2I1JA 1ESRA 2J0TD 3VUYA 2LEKA 4GSWA 1CZWA 3PS6A 2FE8A 4R8IA 4JI7Q 2A74C 1WXMA 1AE2A 2A5HA 3NUCA 2K8BA 3Q8DA 1Z5SB 2EIFA 3VR8B 1YHAA 5CV6A 4CKEA 1C9OA 2QIEB 1EZ6A 3P1HA 2R7ZG 1A2UA 4XYQA 1KDCA 4A55A 1KTKA 1Z2MA 2EQSA 2PJHA 2OWOA 2R2OA 4UPAA 3MJ5A 2R3ZA 1Z9FA 3EJIA 1UGMA 3ZTCA 1MJCA 2AMCB 1ENCA 3NTHA 1YJNA 3IHPC 3RNEC 1STBA 2F0SA 1MPEA 2Q8TA 2DNFA 1WF9A 2PZTA 1V1OA 1EQQA 4LJZC 1SYEA 1PH6A 4ANXA 1Y1WB 1C4QA 1JCKB 3PIP3 1T6BX 2N9LA 2MPMA 5JJLA 2N7DA 3U58A 3AU7A 2DYBA 4M8AA 1KHIA 2HHHQ 4CQNA 1KRTA 2F52A 4A4IA 3TP5A 2LGDA 1SROA 3MP9A 4KKJA 4PYUA 3BY4B 3BDCA 4IUMB 4LWCA 4USAA 3HOWG 2H88B 3VR9B 2JUOA 1HZ5A 1GB1A 4DV5L 1LM0A 3P75A 1Y1WH 1T0SC 1FR3A 1QT9A 1YNNC 2VB2X 1SNPA 3MVVA 4R4OA 1M8AA 4GGQA 5C4ZA 1VS0A 2JSOA 4IUPA 2M8SA 4B9KA 3RZWC 2F4VQ 1SYFA 1E0ZA 3BG3A 1IBMQ 1Y8NB 3GE3C 1JOQA 3HHMA 2JA8G 3VDYA 1WXAA 4BBNC 1U4MA 1XLPA 3T1HQ 2UYZB 4MH0E 4OZBA 5KYIA 4RMAA 4K2KA 3PGEA 2V3PA 1WJUA 4B3SQ 1GUOA 4IKGA 4P6VF 1S5ED 3NSWA 4Q2JA 3S9WA 1NTGA 3VH4B 1A15A 4WIPA 1MD2D 1NEKB 3VRBB 1VQ4A 4OVVA 3RN9C 1ZKHA 1RJTA 1WTRA 4PQXA 3UIOB 2RDFA 4DUZQ 2NVQB 4C3JB 3UF8A 4HTHA 4HIKA 5FR6A 3J81L 4JI8L 2NMQA 5GMVA 3TEXA 2KCCA 1WJ4A 1U4PA 1ET9A 2JZPA 5C0XH 2F0JA 1SE4A 1E8YA 4BXXH 4RHSA 5FO9B 1AW7A 4DV0L 3GV6A 3HS0C 1XEEA 4J8QA 4LF5Q 2DYMA 1ICFB 1DD2A 2Z8LA 1PDQA 2F0TA 1YNJC 1NDDA 1SNDA 4X3TA 5M3MH 1BOSA 1Q5WB 1D2BA 1N34Q 4C3JH 4X62L 4MELA 2CJOA 1V9PA 1I4PA 5FJ8H 3TSSA 1FJGL 2V4LA 4LW1A 4ZRJA 4ZRQA 5D2MB 5LMNL 2WAQE 2X6LA 2KMMA 1EY6A 2LSSA 1EWCA 2O2VA 2Y5PA 2Q2HA 2CHXA 2IDYA 2F0MA 1CKNA 1BT0A 4XT3B 3EHVA 1RHPA 5AJ3L 2A6ED 2EY6A 3QOJA 2OTJA 1AWDA 4CHKA 5EBDA 3MHZA 1WZ0A 4X3SA 3DVNU 2NVXB 1DGSA 3B0AA 1YNXA 2PZUA 1X54A 2GBJA 4P1BC 2KT7A 5K36H 4KJNA 5IYBH 2K6AA 5FLXL 1ZEQX 4JI3Q 3S2HB 1SE2A 1BBWA 1Q8IA 1J0GA 1BDOA 3H3VC 2JPHA 3MHBA 3HOZG 5T1GA 3S17B 4EX5A 1VQ9A 3V61A 1L6UA 2A73B 5JJIA 1SF0A 2WXPA 3CD6A 2QW7A 2RSOA 4CJ0B 3OIPA 1GOZA 4KSLC 1JWSD 5ELCA 3CC2A 2BE5D 4LF4L 2ZPNA 4A3OA 1DOXA 3CCEA 3RMHA 1OGWA 3QIAA 5JEAH 3JAML 2L4NA 4F7ZA 1CKOA 2WXNA 3ML8A 2L5TA 4XIGS 3S2HH 2QGQA 1WFQA 1VQ5A 4KX6B 3M7GA 1FXTB 3Q2AC 2IGHA 1M1KC 4XDCA 3S17H 1NJIC 1DCZA 4DFAA 2G4DB 1KF6B 3PT2B 4LF7Q 4NW2A 1F0ZA 3IT6B 4JI1Q 1XNQL 1Q46A 2B3GA 1EM7A 3UI3A 1K51A 2V0GA 1PH8A 2JK8A 5ELFA 2VRRB 1BBXC 3KDFB 3OLMD 3ZNZB 2INCC 3W1SA 3BVZA 4IN3A 3SDZA 4DNRB 1NSNS 3M7NA 1DOYA 2E2DC 4IFDJ 1I4RA 1RD9D 3K7AB 4C2MB 2ZM6Q 3Q3JA 1WYWB 4K7WA 2ZXPA 1P7FA 1JRPA 5LL6S 1IPGA 3VFKA 2HCCA 5IAAC 4W9KA 3HOUB 3KVFB 2RCNA 2F0UA 2DWQA 5L37A 4RMFA 2H1EA 4A3FB 1XNRQ 2BWFA 2MH7A 1S5DD 4W9GA 5D7GA 3D6WA 5G3LF 2BH8A 3DBSA 1Y69U 5BMHA 3A9JA 3PGZA 4RGOS 4JW0A 1L0YB 4J6HA 4XT1B 3OWEB 3PUZA 3LNNA 2IGGA 2HJ8A 3K7AH 1V8CA 3W1GA 5E6JA 1Z6HA 3CSTA 4H02A 3K7UC 2F0GA 3HKZE 3L7ZC 3HOUH 3EQLC 2ZVOA 2INDC 3NWSA 2Y0SE 2YEPB 3KUPA 1YEZA 4A3FH 1FMAD 4EZKA 1HTLD 3QWZB 5HI1A 3Q3OC 4B0MA 4PZ8A 3GD7A 2UUAL 3BINA 3GS2A 3SXHA 1XQQA 3H94A 2EYPA 3RMKC 3MC0B 1K8GA 2WDTB 1XO3A 1E24A 1PH9A 2WQYB 2CKHB 3I3TB 4DR5L 1N63A 2KOXA 1TR5A 3SEBA 4UP8A 1L0WA 2LUEA 4JVZA 4JYAQ 3GP7A 5EQ0A 1C9FA 1E2ZA 2BS4B 1LT6D 4R8NA 4HAEA 5G2NA 1XF5L 3VDZA 3S1QB 4NP5A 1ZDVA 3HUIA 2AX5A 1OTCA 4JV5Q 4OO1H 1IBKQ 3FHWA 1KIXA 2EYFA 1BUVT 3R2IA 1KQSA 1OEYA 1RFAA 3WIMA 2KLGA 4O2DA 2UXDL 3NOBA 3NZ3A 3TIXA 3I4OA 2WFWA 4QF4A 1A6XA 3ML9A 4YWLA 1KD1C 2Y5BB 3MTSA 3NWTA 4DK0A 3URYA 4ZYNA 3R7RA 5KNBA 1TY0A 3S1QH 1IW7D 3M63B 4MZ9A 2R92G 2DGYA 3A0JA 4K6DA 4DNTB 3L10B 4CDFC 5FLXE 2WKCA 4FXKC 2R2QA 1SBBB 2DX5B 1QVGA 3H15A 4QAYA 3HP3A 4DUYL 4DV6L 1SIJA 2KEEA 2KQ7A 1XX8A 4DHJB 2F3VA 1YI2A 4QIWB 4RA8A 3MXNB 4A3BG 3PV1A 3T3NA 1CSPA 4K0KQ 3M4PA 2B29A 3NENA 2OEOA 4LF8Q 1HE8A 2PEAA 1K8RB 1JQ4A 1GVPA 3CU7A 1JOKA 1GC6A 2W3RA 1PH1A 4B6WA 2KQSA 2MFIA 4A3DB 1JT8A 3ONAB 1JMLA 3VA7A 4GDKB 4C7ZA 4KI0A 2L9HA 3E56A 3APFA 4G50A 2VB3X 1HR0L 4K14A 3I56A 1ICWA 2WGSA 1IKLA 1B9NA 3ZYYX 2Q5WD 1C79A 4ZRZA 1H9RA 4DK5A 4FXGC 1I4HA 1YNND 5NUCA 5EAYA 4EFOA 3K9PB 3Q3NC 4HMIA 1WTVA 4NXNL 3ZDMC 4QB4A 4BBRG 1XPUA 1DM0B 2VUMB 2KECA 3B2GA 4A3DH 1PXUA 3N1YC 1HRJA 3J80L 3AU5A 1FNWA 2JYTA 3LJ3A 2CH4A 2JJQA 1STHA
chains in the Genus database with same CATH topology
4C3IG 2HUGA 2WP9B 5JPMC 2CHBD 3TBIB 3PO2B 3T4AC 3CRKC 3NK9A 2PQEA 5C3WA 4XQNA 2JU6X 4ME5A 2ONQA 2IW3A 1ONLA 4RNAA 3RPFC 1H9SB 5IGFA 3H6MA 3A56A 2VZKB 1FFVA 2A69D 1LTGD 4K8JA 5IOCA 2MP1A 1PTOF 3NQIA 2G9DA 4OGQC 2NUCA 3I70A 2WS3B 1S4ZA 1Y1VB 2Q8IB 2B2VA 4OO1I 3RUZA 3VR3A 1N5XA 3EFXD 3KLSX 4REZA 3J7AF 4S3SA 1VR9A 5FO7B 3U7ZA 4HROA 1K83B 4DA2A 2EY2A 2PLPA 3EVQA 3D6CA 1BCPF 3RLFA 3AE3B 2B2YC 1H9JA 1EY7A 2BBCA 1OO9B 2VNUD 1MVKA 3FKIB 4IUTA 2E75C 2B2UA 5EE0A 2B63B 1A2TA 5BN4A 1GPXA 2ICEC 3I4NB 1NVID 3LWEA 4F87A 4QCLA 1TZOA 5EKIA 1K53A 3W2DA 1N61A 5EPJA 5C4XB 1IHZA 2JA5B 5D3IB 2EVBA 1FXAA 3KBGA 3E0JA 1QOAA 4MT5A 3VQIA 3SHLA 1UNSA 2JQRB 5JPNC 2TSSA 2W82A 3BVGA 4HKZE 2WXHA 4NAWB 5C0XG 1DJRD 2E76C 4A6QA 2KN4A 1HEZE 3J80E 2LHDA 1KDBA 2F0LA 3IAYA 1TS3A 4G4KA 4C3JG 1NI3A 3D8GA 2O5JC 3HZXA 2KQ3A 4B08A 2F0VA 2G9HD 3TP7A 1YN3A 4HJGE 1QLBB 4ZOHC 4U673 5CMDA 3P4SB 2D5DA 1CZPA 1SYGA 1J8IA 4UDUC 3C1EA 4CBVA 4EQNA 2L0CA 1F2RC 1MI0A 2FINB 3AE4B 1HUMA 3FILB 4DGZA 1IBXB 2M2LA 2DY8A 3C1FA 3AEGB 1PMRA 5JEAG 1RFKA 3A8KE 5ELDA 1NYQA 2BTEA 3M3YB 4X3UA 3NPPA 1X3PA 2E2JB 3DM1A 1QOGA 2WXRA 1XTCD 2KA7A 1H9MA 2WDQB 1TVXA 1Y56A 5CYUA 1FRDA 1EIGA 1STEA 4LLGM 2XRSD 2I07B 1EFID 1V43A 2QKIC 3R93A 2JYOA 5COYA 5HG2A 2WAQB 4FO2A 4RKBA 2Z4IA 4FF1A 1TWFB 1IKMA 4IFDH 1I6HB 5M5YB 3I3CA 2RA4A 4PNYA 1SNMA 2JWUA 1G8ZD 5AFWA 3FPPA 1DOLA 2F0NA 2F0IA 2CQAA 1JE4A 3NUHB 1BO0A 2WXKA 4JWSC 2EYJA 3K0YA 3M4YA 4YWGG 3ZJVA 3CQZB 1PRTC 1FCCC 1IYVA 4L6TB 3K5NA 2NTTA 1JALA 1N5WA 2JSVX 3VRAB 3SK5A 1G2TA 2WV6D 3L3OC 4CJ1B 1KNEA 4OO1G 3NTIA 1LTTD 4TQ1A 3KQ4A 3NQTA 3Q22A 3AE5B 2K03A 3N9YC 4XWTA 4ID6A 4DAVA 1C76A 5E4WC 3PO3B 3X3NA 2V4IB 1NAPA 1A3UA 1PLFA 2RDHA 2FFKB 1LTAD 4F7XA 3TEYA 1LTID 1STNA 3PUXA 1Q3LA 3GTKB 1Z47A 2V3NA 2ZW0A 1N62A 5EBCA 2BB5A 5M5XB 1GB4A 4PMCA 2F1MA 4L8JA 1OXVA 1YJIA 4CHTB 4IUUA 1H9SA 3HKZB 5C6AA 2CW0D 4IUVA 2Y0SB 3GQBA 4NZLB 2BOSA 1F9SA 4OW0A 3C3LA 4WURA 1NR2A 1GXDC 1GJXA 5EPLA 3HOVB 3MZ5A 4V0BA 3P4RB 3NTKA 1K52A 4BA1I 2SOBA 1CQFA 1F2MA 3FEWX 2F0HA 4A3MB 4RFBA 1SYBA 1XCQL 3OMGA 4TQUS 1FNVA 1GUGA 1XWEA 4B9WA 1DONA 2BYTA 2I38A 3RZOB 3TEWA 2MEKA 5DM73 3TZUA 3OSOA 3IAS1 2PYKA 3EROA 1R4PB 4A3IB 4NJCA 3A54A 1RF2D 2Z4HA 2J42A 1VDVA 1BQQT 1AP0A 1TWAB 4C56C 3I9V1 1STAA 3G7LA 1I6VC 2J52A 1DOMA 3I57A 2NVYB 3MFYA 3U52E 5I6YA 2BA1A 4H2AA 1QQRA 2VZKD 5JOBA 1EQVA 1B53A 1ROEA 5D65A 3BK1A 4XXEA 3P1MA 4US8A 1K50A 5IT9L 1B4OA 3T13A 1HA6A 2EDGA 1QKZA 5LHY1 4L1BA 4WRDA 2PW9A 2RPVA 1KFYB 2D62A 4ABNA 3K57A 3SR1A 1FEHA 2WU5B 1MHXA 4LTUA 4H13C 3NVVA 1Y8PB 1WVLA 4GZYC 4Y7NB 4LK1C 2NZ1D 2EE1A 5FR3A 1PZKD 3K59A 1WWTA 3PUWA 3AE7B 1QF6A 2DLBA 2Q8RE 4XQQA 3K5OA 4RH6A 3J7YW 4K5XA 5KIXA 5C4HA 2K5QA 2HTME 3I4LA 2PPBC 5C3XA 5BN3A 1Q1EA 1EQTA 4H7BA 1SDFA 1OXTA 1G6ZA 2KUMA 1KDAA 3FILA 1IBXA 4IUNA 4J3OD 1P7EA 2NTSA 3U4EG 1Y8OB 1TYGB 1EY4A 1XXGA 2F0EA 1EEFD 1CK1A 2E2IB 2LMCA 4KGSA 3J9CA 2L12A 1L0VB 2YYZA 3NRZA 4K2LA 2QCPX 2B76B 1WTWA 2BDNA 3EA6A 1SEBD 2B2TC 4OZAA 3HG9A 3NVYA 3VYUA 2B2WA 4C1NK 1SB3C 3B9JA 4ZKCB 1MHHE 3BIID 2K28A 5HFYA 1QWYA 4KHVA 2DBYA 5I9OA 3UI2A 1C48A 2SEBD 3GTOB 5IGCA 2PVOD 1E10A 2GA4B 1L4ZB 3MA2B 1H9KA 2F0WA 2WINB 2PCFB 4O42A 1SNCA 1I3QB 2N9KA 2WXJA 4ZK9B 2KEDA 2RQXA 4FXCA 1UGJA 4A8XC 1WCMB 3I73A 4RGMA 3LB8C 3W3AA 1LTBD 4U68A 5TSSA 1AFPA 3Q8CA 3QJYA 1LO5D 2MHVA 4KMUC 4NAMA 1WSPA 3Q0AA 3SR6A 3MWYW 5IT9E 4V190 2FBWB 4ODGA 1LACA 5JVH3 3T53B 2Z1CA 1II3A 3N52A 4LMQD 2OEDA 4R9WA 5C3EB 3PIO3 1EYDA 2WLBA 3HOXB 3MXPA 5H92C 1QOBA 1WD0A 1STYA 4IFDG 3AEFB 2HQEA 4F88A 1XLNA 3M85A 2JE6I 1SYCA 3IFDA 5I6WA 4C1NI 4RGTA 4A90A 2IJ0A 4HSVA 2NYZD 2F0OA 5FOBB 3HGBA 3PO0A 1TS5A 1A3VA 4RHRA 1D5XC 4FXDA 2A6HD 1QOFA 2JXMB 1BXTA 3AH7A 4FYDA 3RZDB 1F9RA 1Q12A 5EJWA 3KF8A 2LGIA 4WFN3 4P16A 3AB5A 1FFUA 2IWHA 3Q8FA 2ZT9C 4OIKA 4N58A 1CHPD 2H4OA 5C0XI 1E9MA 1HFNA 1DOIA 2O2LD 2MJ3A 3ZJTA 1JQYD 1K8MA 3DEOA 4ITKA 2IX0A 3CKIB 5A2QL 2CU3A 3CHBD 3EUB2 2LJIA 4DU9A 3ZQ4A 3I91A 5KGUA 4AYBB 1SMYC 3TN2A 1UWMA 1WYGA 1CHQD 2MUYA 4BY1B 1HFGA 1EZ8A 4IALA 1ILPA 3BYTB 1IGCA 2WB1B 3H91A 1QG7A 1DGJA 1OXSC 3Q8AA 3OHXC 1F9QA 3OPOA 4BY7B 3GTPB 3QWNA 1EY9A 1TWCB 3DWGC 3ZJUA 4JBWA 2L32A 4EE2A 2EY5A 2G1EA 2PW7A 3T16A 1KNAA 2PZWA 4ZAIA 1FIQA 4IDIA 1PGBA 3ND9A 3Q69A 1CTMA 2WDRB 5E4XA 1LLRD 2SAKA 4CJ2C 1U4RA 1MI2A 3LXFA 2K3UA 4HR7B 3DWPA 1R7SA 3MEHA 1BCPB 2A68C 2EZVA 4K5VA 3GTMB 2IL8A 1EU3A 2YEPF 3H0GB 4E6IA 5CV7A 5C5MA 1UEAB 1LTSD 1B9RA 3G6JB 3QOLA 3I72A 2RMMA 3Q8EA 1JICA 2J7ZA 3AMZA 3P4QB 1CA6A 4XWWA 1V1PB 2EY1A 5G5GA 1YNJD 4FF2A 1TWGB 1PUTA 1IYUA 1RTOA 1RCVD 1CJEA 3WOEA 1NCVA 1RM6C 4HRSA 1G2SA 1UWXA 2CVRA 1E6EB 4CKBA 1G91A 4P2CB 4QUCA 4RCOA 1BR9A 5A2QE 1OFFA 4ZYSA 3TMEA 4RF1A 2W54A 1KRHA 5GXGB 3QO2A 1XYIA 2KWDA 3W5VB 3T3OA 3GV3A 1VF7A 4KKIA 4CGYB 1B3AA 2B39A 4MH8A 3OWFA 2WXOA 2EOTA 1KABA 3SK4A 4BA2I 2H89B 2C5CA 3TEZA 2QDBA 2AQ2B 2XNAC 1EL0A 4IUQA 3V2TA 1RWSA 3C46A 1PTOC 2D2CC 4FNFA 1Z7TA 4BWGB 4OVZA 2XSCA 2EJGC 2JX5A 3HOWB 1C4CA 3AE2B 5C3JB 3BYYB 4LAAA 1EYAA 1KAAA 5JXVA 4RGNA 1V97A 3TP8A 2JA8B 2IT1A 2F0KA 1BCPC 1PRTB 3FRPB 3GTGB 1J7AA 5JAVA 2XWJB 2KHSA 4RWSC 3BVMA 2SDFA 2K04A 2BT6A 1YNTE 3F2UA 2OHFA 4N9TA 3A8JE 1S5CD 1C78A 1FGBD 1DXMA 4FVMA 1T3QA 5DAUA 1JWAD 1YQ3B 3CWIA 2D9UA 5K36G 2QMTA 2SNSA 4PMBA 2B8GA 5KRUA 3GTQB 2SNMA 3FC4A 3NXWA 1LTRD 1PFBA 1L0XB 1IL8A 5CBEE 4GLSC 1VLBA 3M4OB 1MSHA 1LT3D 2F0FA 3DUZA 2K5WA 5LNK1 1VZ7A 3GTJB 4KKSA 4TSSA 1I7HA 1D5ZC 4XE0A 3MXUA 2MJ8A 2INPE 1L6VA 4RAUC 3OMCA 3HOZB 2LFNA 1QILA 2NVTB 2EYHA 2HDLA 3S2DB 3SE0A 2IGDA 3E6ZX 1NENB 2ENBA 3V3XA 3S1NB 3PUYA 1XLOA 4YT0B 3AE9B 3CRLC 3AE1B 2CJNA 1OXUA 1J9OA 1LABA 2K7VA 1Q10A 1CFMA 3BZDB 1ILQA 5HURA 2B2YA 2K05A 3E5SA 3ITPA 1JB3A 3S16B 2R6GA 2PKOA 3C2PA 3MXNA 4L63B 4KN7C 4KKUA 3X3MA 3B2FA 3MXGA 1D1KA 1PFMA 4M1UB 1L5PA 1T5EA 4ILWA 1A3TA 1SSOA 3H09A 1VZ8A 3ND8A 2NN6H 1PGXA 3GTLB 4HSPA 3KLRA 5I4DA 2HDEA 4KD3A 3IAM1 5BYRA 5CBAE 5EE9A 3FMCA 1IGDA 1C77A 5HGTA 4A93B 2A6EC 1RKNA 1Q1BA 2JYEA 2KVMA 2JXTA 1I4QA 2RKSA 2HCIA 1ZE3D 1AZQA 2GRIA 1C4PA 4QMGA 3AM9A 2YU9B 3SFDB 4KY6A 5C4JB 1PGAA 4XDXA 4RKLA 4XTCS 5LL6X 1EY8A 4YTNB 1KLGD 1HCZA 1V1PA 4O1NA 4G7ZC 4C3HB 1PDXA 4K8IA 4US9A 1ENAA 2WU2B 1HTPA 2BE5C 1YMHE 3OIQA 2RBMA 5IGBA 2K32A 3NVWA 4HEDA 1O80A 2EPBA 4WJWA 2WXLA 1SAPA 2IPKD 5I2XA 2J53A 3PZ8A 1DYQA 1B50A 4M0WA 4IFDI 4BBRB 3DEPA 4K5WA 2ICIA 2X69A 3MAQA 3AB9A 3H8HA 1F2YA 1LT5D 2OT2A 2VXWA 2KACA 5BMIA 4C3IB 2W3SA 4I7ZC 1BCPD 1VCIA 1TQOA 3A8IE 4N9PA 2M0AA 5J1ZA 2XIWA 5FKAC 1EWYC 2N0SB 3BDLA 1L4DB 2ON8A 1HZ6A 2PO4A 2JA7B 5H8YE 2F0DA 3D4WA 2KCNA 2K1BA 5F2DA 4XYOA 1MGSA 1JWUD 1ZOYB 1HUNA 2F0PA 5CV4A 2DN8A 4IURA 3VR6A 1HQMC 4HMJA 2QILA 1WTPA 4OIJA 2L11A 4DXGA 1NYRA 3FAHA 4OZCA 2I46A 2LFIA 5EKLA 4JE3B 1IW7C 3IFTA 3RFZB 4H0LC 2N7JA 3L9AX 1CQVA 1TJEA 5KYLA 3SK6A 1N60A 1M4VA 1NR4A 3WDNA 3PZ7A 3WCQA 2FHTA 1J7CA 4ZHPA 2F03A 1VMPA 2JEBI 1X3QA 3HEJA 4CKCA 4L23A 1VF5C 3P63A 2ZXRA 3I90A 2ID0A 4A9AA 3ZGZA 2EYOA 1SNOA 1HQRD 3N6RA 1GUNA 3DWAA 3NHHA 1VRAB 4KY5A 1WTQA 4BS9A 1JWBD 3QB3A 1PFNA 4X3KA 3Q23A 4YSXB 4LK0M 5JJZA 2R93B 2K5PA 1Q90A 1GUTA 1FYCA 1AEXA 1C4AA 3W9CB 4K6LA 1RTNA 1PRTD 4G7OC 1QNUA 5M3MB 4IQZA 4HKQA 4TKOB 2D5GA 1RDPD 2NB0A 1TKWB 5JVG3 5T1IA 4RF0A 1EYCA 2A69C 1FRRA 3DMUA 1BMLC 4KJOA 2PTLA 2WKDA 3U9OA 2M19A 3ETRA 5ELEA 3VR2A 1YN5A 4KGRA 1TY2A 1U4LA 3AEBB 3AV8A 1CZGA 2DY7A 2EJFC 3A7LA 3P20A 2PMZB 3FPUB 2N55A 4KHZA 3R8BA 2RDGA 4HCSA 3V05A 2QF7A 3VYRA 4J1MA 3J7AV 3NVZA 2EXZA 5CV9A 1CI3M 4KN4C 3V96A 1BF4A 1AZPA 1TIID 5FO8B 2L52A 1ZYRC 2NWGA 5E1FA 2XRQD 2WXFA 1EY5A 5KEEA 4DF7A 1O78A 3KWLA 1KLUD 1AYFA 1O7ZA 2BS2B 4DK1A 1OQQA 1D5MC 4NMZA 2F0QA 1SSNA 2IX1A 2W55A 2IX3A 1ESFA 4WQMA 3L4PA 1NUCA 3HRDD 5C44B 3NE5B 3NBIA 2R61A 3IL8A 1XCTL 2AUKA 3S14B 3AEAB 2MGSA 2E2HB 4N6EB 4YSZB 1DZ1A 2GB1A 2FMMA 2BCOA 2NN6G 5BYQA 2BDOA 5T8IA 2EYLA 2AUJD 4JK1C 2AWOA 3RD4A 5IIFA 2RSNA 3VYTA 4B0EA 2QJLA 5I2YA 4WORA 2B2VC 5HHDG 4QUFA 4FP5D 1ML0D 5J22A 1STGA 1DOKA 5DM63 2B8FA 4I65A 4WWMA 4IOIE 1E2VA 1RODA 3J81E 2KDMA 3PUVA 2K5DA 2B2TA 1CT1D 3A55A 3TZDA 2K33A 3R2TA 1ZDXA 4AQ7A 1VJKA 4NDXA 1JWMD 5A35A 1PZID 1ZXIA 4KV6A 1ZXTA 4KTAA 3BWUD 2WNMA 3NS1A 5ELBA 2LKVA 1YJJA 1GUWA 2B2UC 2X38A 1PTOB 4OHJA 4YTPB 2OF1A 2ZXOA 1EOTA 1J7BA 3EGRA 1CM9A 5IGDA 2WXGA 3HVDA 4YXDB 4KK7A 4C3HG 3FDTA 3K6OA 3NP8A 1TKGA 4C80A 3O13A 1JC7A 1PTOH 2N88A 2MJDA 5EGTA 1I4GA 5CR3A 2PVGC 1KH0A 2M56B 2O5IC 3Q24A 5CV8A 2WP8J 5CV5A 2BW2A 3JAME 1FCLA 3LWUA 2PIAA 1QB5D 3LYYA 2PMVA 1CA5A 4WAFA 1JORA 2LUMA 1O7LA 2K22A 1ACCA 2EYMA 4JX1C 2QSDA 3MFGA 1BNZA 4B9XA 4PMWA 3K5MA 3AEEB 4KD4A 5G5HA 4ZRPA 1JOOA 4Q5VA 4DN4M 4G57A 4GDLB 4YSYB 1WTOA 3VA5A 2M9VA 3GB1A 3C8YA 2FMCA 1LT4D 4Q0FA 5M9OA 1IUEA 2E74C 2MJEA 2Y3AA 4JPSA 1FM0D 4D2KA 1MBYA 4FF4A 2F3WA 1YQ4B 4TRDA 3AE6B 1ENFA 2OXPA 2WIIB 1OQRA 1R4QB 3TUOA 4IZ8A 4ARCA 4UAIA 1FO4A 1QCBD 2DNCA 3DWQA 4YIJA 2PNRC 2R7ZB 5CC4A 5I9PA 1TU2B 3I4MB 2WXIA 1FXIA 2BA0A 2I2YA 5D14A 1W6JA 2EELA 4ARIA 1B44D 1F77A 3K5LA 1ZPSA 1YN4A 1U9RA 5EPKA 5BYSA 3WOFA 2F4IA 2EJMA 3TDQA 4MM3B 2JA6B 4FF3A 4DQOC 4ZQ3A 1VDZA 1D4BA 3BK2A 4R3DA 1BUIC 3IXSA 2CW0C 1TKYA 1ZYRD 1V8QA 1WGKA 1GHJA 3D31A 2WACA 5DEHA 1EU4A 4ZHOA 1S5FD 3BS1A 2X6GA 2PW5A 4KY7A 3VR4A 3IT4B 2LY7A 1B9MA 2WDVB 2FUG1 5BN5A 2J4XA 1E7PB 5AUIA 1TKEA 1G291 4OL7A 1ZXHA 1SE3A 4F8MA 3AECB 2V4DA 1QE6A 5J39A 3D4DA 1WD1A 5C2TB 3GO5A 3LX0A 5C5LA 5M5WB 3S1MB 2L83A 2DYOA 3AEDB 5C0XJ 2WXMA 4EQPA 2AWNA 5K5PA 2E3TA 3PV0A 3SVMA 2Y5CA 4EQOA 2INNE 1R9TB 3HRZC 5D3DA 1ZKOA 4BBSB 4ZUIA 1TS4A 3U2SC 4EGVA 4AS1A 5KNDA 5G3LD 4H44C 4N59A 3OOCA 2LS01 4Z9CB 1ZP0B 2LHEA 1FNUA 1SMYD 3Q6SA 1F2RI 3HOYB 2XVSA 2JEAI 2BS3B 2E6XA 4A3JB 3ERQA 5CORA 3P7JA 2EKIA 1SNQA 1VMCA 3A7AB 1EWHA 5CGKA 1QNKA 2NBFA 1F9PA 1X32A 1UUPA 4HN7A 3Q8BA 4A3GB 4ULLA 1EY0A 1MSGA 1VZ6A 4NKLA 5JEAJ 2LMCB 1SXTA 4MN3A 1EIHA 4G7HC 1HA5A 5M3FB 1TS2A 4A3EB 4WH4A 2TMPA 3AMUA 4TMAB 1TT2A 5MPOA 1A70A 4HCEA 1C8CA 4JWUC 4TQ0A 2K0PA 1SJED 1PYWD 4L2YA 1FD6A 1PRTF 1XLQA 1GUSA 1PFDA 4HEA1 3VYSA 2A68D 2WXQA 1SYDA 5IGGA 4PV1C 3AN1A 1TWHB 4ZLTF 1B2TA 1I4XA 1QJOA 2RVLA 2XWBB 2C9OA 1RYJA 1ZUD2 1AN8A 2ACZB 2QEJC 2L55A 3S15B 1W6KA 2L1BA 5ISRA 5AUKA 2AQ3B 5KNCA 4XDDA 5IGEA 5BMGA 1HHVA 3U9SA 1HXYD 1GHKA 1SFOB 1UAPA 3I8ZA 4DAYA 4A3KB 2HDMA 3OW7A 2KQ4X 5IODA 3VR5A 5E3FA 3P4PB 1GAQB 4KKTA 3T56B 3NBHA 1E0BA 1FD7D 3BDOA 2ZW1A 1SJHD 4C7YA 2KAJA 1WRIA 3HVZA 1JR0D 1B1ZA 3IKJA 3AE8B 3SFEB 2JP1A 3KK7A 1E2WA 1F2LA 2R92B 4MHEA 5EE1A 3DHQA 3D3RA 4ZKBB 1I50B 2DNEA 3ABVB 3QG1A 4A3BB 3KBXA 2K01A 4EVOA 1QOHA 1PTOD 3W5UB 3D4RA 3PMFA 5EE3A 5FK9C 3KLSA 1JROA 1O7YA 4MIUA 2KOLA 3E9SA 1S5BD 4DXFA 1LV9A 1WTXA 2O4XA 3CIRB 1WXQA 2B2WC 3TP6A 4ZUJA 3S1RB 1PZJD 2AQ1B 4MACA 4XQJA 2L1AA 3P42A 1T5XD 3K58A 1F2ZA 1EEID 3KWVA 1D6EC 3T51B 2K9XA 5EKKA 2A6HC 2M00A 1HPCA 5DNFA 1JW9D 3R3OA 3DWMA 4DAPA 2KJXA 4PT5A 4YTMB 2FJ2A 3FVQA 2NN6I 2BB6A 1OXXK 3SK8A 1K8OA 3DXJC 1ET6A 2XN9C 4KGTA 4RCNA 2GI9A 1D1IA 1ESRA 2J0TD 2LEKA 1CZWA 2FE8A 4R8IA 2A74C 2A5HA 3NUCA 3VR8B 5CV6A 4CKEA 2QIEB 1EZ6A 3P1HA 1A2UA 4XYQA 1KDCA 4A55A 1KTKA 3MJ5A 2R3ZA 3EJIA 1ENCA 3NTHA 1STBA 2F0SA 1MPEA 2Q8TA 2PZTA 1V1OA 4LJZC 1SYEA 1Y1WB 1C4QA 1JCKB 3PIP3 1T6BX 2N9LA 2MPMA 3AU7A 4M8AA 3TP5A 3MP9A 4KKJA 3BDCA 4USAA 2H88B 3VR9B 1GB1A 1HZ5A 3P75A 1FR3A 1QT9A 1YNNC 2VB2X 1SNPA 3MVVA 1M8AA 5C4ZA 2JSOA 4IUPA 1SYFA 1E0ZA 3BG3A 1Y8NB 1JOQA 1U4MA 1XLPA 4OZBA 5KYIA 4K2KA 4IKGA 2V3PA 1GUOA 4P6VF 1S5ED 3NSWA 4Q2JA 3S9WA 1A15A 4WIPA 1MD2D 1NEKB 3VRBB 1RJTA 1WTRA 4PQXA 2RDFA 2NVQB 4C3JB 4HTHA 3J81L 2NMQA 3TEXA 2KCCA 1U4PA 1ET9A 2JZPA 5C0XH 2F0JA 1SE4A 4RHSA 5FO9B 1AW7A 1XEEA 3GV6A 3HS0C 4J8QA 2DYMA 1DD2A 2Z8LA 1PDQA 2F0TA 1YNJC 1SNDA 4X3TA 1BOSA 1D2BA 2CJOA 1I4PA 3TSSA 4ZRQA 2X6LA 2KMMA 1EY6A 2Y5PA 1EWCA 2IDYA 2F0MA 4XT3B 1RHPA 2A6ED 2EY6A 3QOJA 1AWDA 5EBDA 3MHZA 4X3SA 2NVXB 2PZUA 5K36H 4KJNA 5FLXL 2K6AA 1ZEQX 3S2HB 1SE2A 1Q8IA 1BDOA 3H3VC 3MHBA 5T1GA 3S17B 1L6UA 2A73B 2WXPA 1SF0A 2RSOA 4CJ0B 3OIPA 1GOZA 1JWSD 5ELCA 2BE5D 1DOXA 3RMHA 3QIAA 5JEAH 3JAML 2L4NA 2WXNA 2L5TA 4XIGS 4KX6B 3M7GA 2IGHA 4XDCA 1DCZA 4DFAA 1KF6B 4NW2A 1F0ZA 3IT6B 1EM7A 3UI3A 1K51A 2V0GA 5ELFA 1BBXC 3W1SA 3BVZA 4IN3A 3SDZA 4DNRB 1NSNS 3M7NA 1DOYA 2E2DC 4IFDJ 1I4RA 1RD9D 3K7AB 4C2MB 2ZXPA 1P7FA 1JRPA 5LL6S 2HCCA 3HOUB 2F0UA 2DWQA 4A3FB 2MH7A 2H1EA 5D7GA 1S5DD 3D6WA 5G3LF 1Y69U 5BMHA 4RGOS 1L0YB 4J6HA 4XT1B 3OWEB 3PUZA 3LNNA 2IGGA 1V8CA 5E6JA 1Z6HA 2F0GA 3L7ZC 3EQLC 3NWSA 2YEPB 3KUPA 1FMAD 1HTLD 5HI1A 4B0MA 3GD7A 3GS2A 3SXHA 3H94A 2EYPA 3MC0B 1XO3A 2WQYB 1N63A 1TR5A 3SEBA 3GP7A 5EQ0A 1C9FA 1E2ZA 2BS4B 1LT6D 4R8NA 4HAEA 1XF5L 3S1QB 4NP5A 1ZDVA 3HUIA