1B1ZA

Streptococcal pyrogenic exotoxin a1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of superantigen streptococcal pyrogenic exotoxin A (SpeA1) by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
molecule keywords PROTEIN (TOXIN)
total genus 58
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b1zA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b1zA02
1PTOF 4RGNA 1CQVA 1HTLD 3BZDB 1EEID 1DJRD 1RD9D 1LT5D 1QILA 4L6TB 1RF2D 1PTOH 2O2LD 1JR0D 3BVMA 3BYTB 1CT1D 1S5ED 1FNVA 5FK9C 4Z9CB 1HQRD 1BXTA 1FNUA 3BVGA 1S5BD 3BVZA 1PZJD 1EWCA 3V05A 4RGTA 2SEBD 1PZKD 3OWEB 1I4HA 4RGMA 1PTOB 1PZID 1LLRD 1S5CD 3O13A 1M4VA 1GOZA 4BWGB 1MD2D 1YN4A 1BCPF 1EU3A 1LTTD 2XNAC 3DWPA 1HXYD 1YN5A 1TS2A 1V1PB 1D5XC 3MFGA 2IPKD 2TSSA 3SEBA 2AQ1B 2Z8LA 4L63B 1KLUD 1ET9A 1S5FD 1SEBD 1SE4A 2CHBD 4O1NA 3EFXD 1EU4A 2RDHA 1YN3A 1PRTF 1I4PA 3MC0B 1TS3A 3EA6A 4DXGA 4ZYSA 1I4QA 3CHBD 4RGOS 1PTOD 5ELFA 4RHSA 1SJHD 3URYA 2ICIA 1LTAD 1JWUD 1JCKB 4TSSA 1CHPD 1SE3A 1CHQD 1KLGD 3R2IA 3TSSA 1DYQA 1SBBB 1FGBD 1AW7A 1UUPA 1TY0A 2J4XA 1I4XA 2XRQD 1JQYD 5D3DA 5FKAC 5D3IB 1L0YB 1SXTA 1ENFA 3DWAA 1B1ZA 5ELDA 1CK1A 1G8ZD 1HA5A 4RH6A 1V1PA 4DXFA 1RCVD 1TS5A 1PRTD 1I4GA 5ELCA 2AQ3B 5TSSA 2RDGA 2R61A 1PTOC 2QEJC 4RCOA 4OHJA 4K6LA 1BCPD 1ET6A 4UDUC 1PRTB 4RFBA 1ESFA 1TY2A 2IJ0A 1LTRD 1T5XD 1D6EC 1FD7D 2AQ2B 3KLSX 1STEA 3R8BA 4RHRA 1D5MC 1BCPB 1LO5D 2WV6D 1LTBD 1JWMD 1EEFD 1XTCD 5I4DA 2QILA 1F77A 2NTSA 4NZLB 1LT4D 3R2TA 1SE2A 1LTID 5ELBA 1JWSD 1LTSD 1EFID 1PRTC 1KTKA 1TS4A 1XXGA 1SJED 1LT6D 2XN9C 4C56C 1D5ZC 3DWQA 1AN8A 2NTTA 3BYYB 1BCPC 3W2DA 1RDPD 1FNWA 1V1OA 1I4RA 1S5DD 2XRSD 1LTGD 1PYWD 2G9HD 1UNSA 1LT3D 1L0XB 1B44D 5ELEA 3GP7A
chains in the Genus database with same CATH superfamily
1E0BA 3DXJC 1A6XA 1IPGA 2C5LC 3R3MA 5AFWA 3OTOL 4G3XB 1LTLA 4A3FG 3OIQA 1N60A 2Y3AA 1HUNA 3IBEA 1Y14B 1FL0A 4NP5A 3A4RA 5M5WH 3V61A 2LUMA 3S1NB 3LNNA 4DV7Q 1CT1D 2LRWA 4KY7A 4NMZA 3NVWA 2E3TA 1TR5A 1WM3A 4IWQA 1MIUA 2NZ1D 1HR0L 1RTNA 1NDDA 1ZGUB 2K28A 1KC8C 1V86A 2BS4B 3S2AA 1VF7A 3A55A 1I4HA 3E0JA 1I6HH 3AE6B 4WWMA 4AS1A 2F1MA 1G6PA 1MD2D 3PO3G 1VQFA 1F1HA 2Z59B 3PZ8A 1GUSA 3S15B 4DHZB 4A3IB 1D3ZA 1D5XC 2MRPA 5T1IA 3EROA 1K8OA 2Z8LA 2IBIB 3ZNZB 3TEHB 2RDHA 1XMOQ 4LF5L 2KYWA 1RKNA 4GNXA 2L00B 3Q23A 4GKJL 2YYZA 3AE1B 5T8IA 2E2HH 5DLQE 1X54A 2MNAA 4HRSA 3HOXH 3AMUA 4IUUA 4XXEA 1J7CA 2BWES 2BKRB 4LCDE 2OCEA 3QO2A 5KHQA 3I4MH 3QCAA 1CHPD 3U9OA 4QF4A 1E7UA 4HJAA 3DCGA 5HGQA 4L5RC 1F9JA 3TJPA 4YT0B 4OIJA 3K7UC 1IKMA 3L4PA 2JEAI 1K3BC 4F87A 3I4MB 3MEHA 4DPGA 1TXYA 4IFDI 2WXMA 4GMVA 2F0QA 3DWAA 1PGAA 4AIMA 4MGZE 3MTSA 5IT9c 4IJHA 3EBEA 1C4CA 5C4ZA 2FCMA 3TEWA 5D2MB 1SR3A 3VYSA 3TCAA 4M00A 2BYTA 2L0TA 4K5WA 1PH1A 2NBUA 4TQ1A 2IZVB 5EE9A 3D8GA 3HOUG 1GVPA 1T6BX 1BUVT 2V1CC 2O6VA 2VUMH 3ABVB 1N33L 2WWZA 4HPLB 3SXHA 1E8YA 4CGYB 5CMDA 3VR9B 4FNFA 3BDCA 1D6EC 1FD7D 3WAPA 1R4QB 1EL0A 1X1MA 4JYAQ 5H92C 2RPVA 5IKCM 4GDLA 1Q86C 2UXCL 4RKLA 4A3BH 1C76A 4II2B 4R4CA 4HIDA 4KV6A 2O5JC 2OOBB 4HPMB 1EIHA 2JSOA 3VTUA 1E10A 1VR9A 1VQEA 4RMFA 5C4JB 2XSCA 3A8KE 4C3HB 3LX0A 5I4DA 3DVGY 3T3NA 4P16A 3KH0A 2INPE 2KXJA 4ARCA 1PA6A 2J0KA 3VYRA 2DX5B 1KHIA 1ENCA 2PCFB 2HCCA 2L3ZA 2H89B 4K81A 3PTFC 5AUIA 1QUQA 3CCJA 1YX5B 1FJGL 2D3CA 2K14A 5CORA 1NNXA 4GN5A 2INCC 3R7RA 5C4XH 1A2TA 2H5XA 3J80E 4GZYC 1II3A 2B39A 2I46A 3G4SA 1H95A 1A63A 3QIJA 1L0XB 1S3OA 4CDEC 2K03A 4FF1A 2A1AA 3QARA 2F0VA 1LT5D 1Q46A 3Q3FA 1D1KA 1S5ED 3GTOB 1V2YA 1TQOA 1DGSA 4LWCA 1PH9A 3MHSD 2MJ8A 1BXTA 3F2UA 3M4OB 1AFPA 1HRJA 2EY2A 4S0RA 2B29A 1TYGB 1XLOA 4PK1A 1LGRA 4NAWA 3NVVA 3CD6A 4ICVA 2VQFQ 1LLRD 1M4VA 2SNSA 1LTTD 4DV1L 2UUCL 1UBQA 1WI0A 2H4OA 1E7VA 1ICWA 3KUCB 4HJ9A 2OEOA 4J15A 5LL6X 4HKZE 5C4JH 1B3QA 3A7LA 1IBML 4A3PA 2F0SA 1OGWA 3U4EG 3L7ZC 1QOBA 1JJCB 3PUZA 1V9JA 3H91A 3MXNA 5FJ8H 1UEAB 1BDOA 4PNYA 4C2MH 4DXGA 1UELA 5C44H 1ZP0B 1TWHB 3DBHI 1HQMC 1SE8A 2VQEQ 2K39A 1CSPA 2C9OA 5COYA 2AWOA 4RHSA 1A8VA 4DV6Q 2K5PA 2L32A 2MBEA 4HKQA 2DNEA 1HR0Q 1XMQQ 4A90A 1C0AA 2V4IB 2N78A 2E2DC 3MVVA 1ZUD2 2RSNA 2DHZA 4B0MA 1AW7A 1ESRA 1R4PB 4DF7A 2D10A 3OJ3A 5J39A 2JA5G 4WAAA 2B2WC 1JQYD 4WWOA 2KVMA 2AWNA 4RNAA 1MGSA 1HTQA 4LJOB 4DUYL 2WP9B 2IHEA 1TWGH 4KHVA 4YWGG 1MG8A 1CK1A 1X32A 4RH6A 4DR3Q 4JI3L 3QC8B 1Y8NB 3FKIB 1L1OC 1LYLA 3IRBA 4KHPQ 2ACZB 4A3CG 1RFAA 2Q8IB 4KGRA 3UINB 2OTJA 2A73B 3MXGA 5GQOA 2R61A 3AU7A 2WXNA 4JE3B 2KN4A 1KOTA 1N32Q 2A69D 1CKMA 3H0GB 1GC6A 2VL6A 2GRIA 2WXLA 2VS1A 5IA7A 1QG7A 3IKJA 1L4DB 4A3KH 1FIQA 2MBQA 3N30A 2LEKA 4G11A 3U30A 4A3BG 3TMPB 2AEHA 2W3RA 4YWKA 4A4IA 1GHKA 4JG2A 4ZAIA 1E1OA 1TBEA 1BCPB 1ZPSA 2V9HA 2WV6D 4B9WA 3AEVA 4JWSC 1LTBD 2AL3A 2IDYA 1V1QA 4CHTB 1CA6A 4LFBQ 3H3VC 1EEFD 3PUXA 4YWLA 3FMCA 3TS2A 2JN4A 5EBCA 1KNAA 1HZAA 5CV5A 3QJYA 5IODA 1DM0B 5IYCH 4NAWB 3R93A 2GBRA 3K58A 3VYUA 1PQSA 1Y1VB 4UP8A 1QT9A 1YX6B 5JJZA 3EVQA 3S17H 2I5MX 1Q3LA 5J22A 2PE9A 3H9DA 4LNIA 4A8XC 4X64Q 1IP9A 3R7QA 1K8GA 3AE3B 2LZ6A 3GQBA 4ILWA 2FUG1 2WU5B 5CHFA 2R2OA 4MSMB 4UPAA 3DLLA 1BT0A 3CC2A 3TBIB 5AZFA 5G3LD 3NZSA 4IWOA 4CQNA 2LGYA 2WAQB 4DV4Q 1IL8A 3NENA 2ID0A 3TP8A 1IZ6A 4WH4A 3K5OA 2VNUD 1WD1A 2KLGA 3HOUB 3CW2C 3PUWA 1FNUA 4G0NB 5KYLA 1TU2B 4L2YA 4TMAB 2KA7A 4DV2Q 2Z1CA 3NPPA 4JPSA 1P7FA 4K7WA 3I57A 1OEYA 4GKKQ 3QWNA 3GTPB 1K28A 1QQRA 3CMMB 4XGAB 3U50C 4OIKA 1QZGA 2B2WA 4EE2A 4XYQA 3J7ZC 1GOZA 1GG3A 1SSOA 2E5LQ 4M8MA 1UZXB 1ZKOA 3B08A 2K9XA 2JRIB 4GLSC 3UIPB 2VUMG 4YIJA 1JRUA 2BS2B 2OEDA 3G48A 2EYFA 3EFXD 1DZ1A 4OXPA 2R3ZA 2IX1A 2CWPA 5D65A 2E2JB 1VQGA 2JPHA 3BINA 2MGSA 3K81C 4HJKA 2EJGC 1CSQA 1MVKA 3KQ4A 2ZNVB 3JW0X 3IHPC 4A55A 3R3OA 3NG0A 3HOWG 1YJ9A 2KHWB 2L0FA 5IGCA 3GTGH 3PMFA 3U8ZA 2ENBA 1JJ2A 5IO9A 2JQRB 4LNFA 1CM9A 1R7SA 3T51B 2AMCB 2JA5H 1XO3A 3N1YC 5JVG3 5DNFA 3PREA 2OT2A 1GM5A 4ARIA 3NE5B 3MP9A 4ZDVA 1SSNA 2Y0SE 2KD0A 5D3IB 2YTVA 5DCNA 2QGQA 2A5UA 2CKHB 2N9PC 3E0EA 2PO4A 3C46A 2B2VC 3FHWA 2K75A 1YZ6A 5E3FA 3I4OA 5EGTA 3V96A 2IY1B 3WOEA 2YTYA 2KLCA 2LSSA 4G50A 1SE9A 2FIDA 4X66Q 2O6VB 1WTWA 2EVBA 2JJQA 4W9JA 4EGVA 5A2QE 2NMQA 3WANA 1H9SB 2IT1A 3D6WA 2WIIB 3KUDB 1ESFA 1OXXK 2GB1A 2R92B 1TZ1A 4II3B 1T5XD 2F0LA 4QJFA 1SYCA 5KGUA 2K7VA 1QZHA 5E7NA 1TZOA 3KDFB 4N9F4 4CDCC 4DR7L 3RYTA 3MXUA 5C1ZA 1ZYRC 2FBWB 2CHXA 1EF1A 5J2RA 5K5PA 1S4ZA 3AYHB 1DOIA 4YTPB 1XPOA 4E71A 1F2YA 3P4RB 2PIAA 3L3OC 5GAEC 3BS1A 5I9PA 3GB1A 1EYAA 2B63B 1G291 2BDOA 3UQAA 3GTQB 3FDTA 1TWHH 3CPWA 1EFID 1PHJA 1HHVA 2WB1G 5FLMG 2NVXB 4FHJA 4XQQA 4IQZA 3SDLC 2LGSA 3U4VA 1Q8KA 1GUAB 1KTKA 2KWDA 4BBSG 1LT6D 2IL8A 1TKGA 4FULA 5C3JB 1IYJB 1MI0A 3V62A 4A3EG 2TMPA 4HSVA 3BJUA 3AEGB 1WCMB 3PHWB 4B3SL 1FFVA 5IT9E 4MJSB 1UE5A 1LTGD 1FPYA 4ANVA 4GB9A 3WAMA 3ULLA 3MC9A 5G55A 3Q3NC 5H8YE 2PQAA 1OTCA 2A68D 2D62A 3T16A 4BBRG 4EQPA 1MHHE 3NELA 4FDBA 3RN5A 3KW5B 2C5CA 4GSWA 3A7AB 4MGKE 3RLOA 2L8JA 1X56A 5C2TB 1JR0D 1YVCA 2E8GA 3H94A 1BR9A 3U58A 3S1MH 3S15H 3LWUA 4BXXH 2QSDA 4DR6Q 4ZRKA 3KUZA 1UE1A 1YBYA 3I56A 4RGTA 4FO2A 3I72A 4RGMA 4R4IA 2JZ3B 2UXCQ 1X3FA 2PNRC 4X3KA 1DOKA 4ZRQA 1BCPF 2N1WA 5D7GA 1ASZA 3CPFA 3SEBA 2LGIA 2TSSA 2BH2A 4KD4A 2K5NA 4L63B 2WACA 1V81A 3G71A 3A5ZB 2JA8B 2M0AA 3HS0C 1K83B 4DQOC 2F3IA 1XQQA 2MHJA 2K05A 1QE6A 3CCSA 5DM73 1EUVB 1JQ4A 1TS3A 4K3BA 4N9PA 1I4QA 3CHBD 3EN2A 2WB1E 4K7SA 2BGFA 2K5WA 1PFBA 4XQJA 1HNXL 2ICIA 1Z2MA 1OXTA 1C1YB 5CYUA 5IP7H 1WTVA 3WAOA 2E6XA 3HHMA 2Q8RE 1VJKA 3ITPA 1ZDVA 2HE7A 1Z9FA 1IKLA 1KLGD 2X6LA 3BDOA 2B3GA 4NPNA 1WRIA 3AU4A 1TY0A 3T4AC 5IGBA 4OO1I 1WYGA 3Q6SA 2IGHA 4WIPA 2ICEC 4DV5Q 1L0YB 3TL5A 2KQSA 2HCIA 1MHXA 2ES2A 1RODA 3OIPA 1ZOYB 3PGEA 4B3RQ 2JYEA 1UWMA 3O65B 1XWEA 2WXGA 2CR5A 2VXWA 3AH7A 5D94A 3ALBA 2K01A 2K33A 4DR3L 2GBNA 2N7DA 2MP2A 5EPLA 4E6IA 4OO1G 2REXA 3NVZA 1VQ6A 2INDC 2CH4A 1JOOA 4LFCQ 3MXPA 4MIUA 3GTPH 2YLMA 1LTRD 4XQNA 5K36H 1O80A 2FHTA 2IO1B 1WCMG 4C4VB 1QOHA 3SK6A 2EMSA 3A9KB 1U4AA 3Q3OC 3A74A 3S2DH 3I3CA 4A3JB 1E0ZA 3ZKJC 3PVLA 4MM3B 4ANWA 1NCVA 4LF4L 2PYKA 4EZLA 1L0WA 2UU9L 1K3RA 1IW7D 1H9KA 2HDMA 5FOBB 1VCBA 2C7HA 1FR3A 1L1OA 5ELBA 1SNPA 2OTLA 3CRLC 4PS7A 5C6AA 1XCTL 5DPSA 1IBMQ 3UE0A 2BW2A 2KDFB 2BCOA 3T9LA 5KYIA 1EQRA 2RCFA 4NY0A 3VFKA 4W9EA 1R4MB 2F0IA 1YJ1A 4DV1Q 2UUCQ 4BY7B 3A9KA 4A75A 2G5DA 1VQPA 1XNRL 4QQBX 1KDAA 2WP8J 3BDLA 4DUZL 1WR6E 2B3AA 5EE3A 1Q1EA 3CMEA 2A6ED 2F0PA 4IFDH 1Y8OB 2K04A 4HEDA 3AE7B 1FCLA 3HZXA 5C3XA 1P8LA 2UUAQ 3S16B 5ELEA 2MH7A 3GP7A 5EJWA 3NQIA 2E74C 3BK2A 4ULLA 4IOAA 4KJOA 1RIPA 2WFWA 4A93H 1V6EA 4JI0Q 3A9JB 1JOKA 4A6QA 4LFAQ 1FO4A 4YSXB 1TIID 5FK9C 1HZ5A 5GAHC 3P63A 2LXKA 2DAFA 4AQ7A 2Z0EB 3K6OA 4IM2A 3J9CA 3K9OB 2UYZB 3ZRFA 4LJPB 3P20A 4US9A 4JPBW 1PYSB 4KX6B 2OXPA 2B8GA 3DWPA 3GTKB 1M1KC 1P16A 1I6VC 1PGBA 5DM63 1J19A 1FVIA 3K5MA 1Z5SB 3QK0A 4QIWE 4JBMA 5HKHA 4W9LA 1SYDA 5IIFA 4OWTB 3CCMA 1BBXC 2VB2X 4H13C 3JVZX 1HZ6A 5LXIB 1IHZA 3GTLB 4GXBA 4BBNF 4NQLB 3KWLA 1K8MA 1T0QC 2CU3A 1KL9A 3HVZA 5IAAC 4H0LC 2MJ3A 3SFDB 5GMVA 1SN8A 1X3GA 1VS0A 3ZUNA 4XWWA 1M8AA 1YJJA 3NY5A 1XLPA 3CF5A 4JI5Q 3M7NA 3HOVH 1PH5A 1JWBD 1STGA 2YV5A 1P7EA 5I6WA 1JWUD 4V0BA 1WRDB 3H7PB 4XE0A 4WAFA 1I50B 1OO9B 1CHQD 1SE3A 2MCNB 4IURA 1B9RA 2K8HA 3ZJUA 4JYAL 3CAMA 1Q10A 3BY4B 1R4NI 5BMIA 4F7ZA 3D6CA 4LUOA 2PW5A 3MHZA 4OX9Q 4BBSH 3SK4A 2UU9Q 2WHIA 3B2FA 4DBGA 3EGRA 4KTAA 4DAPA 3BZCA 4CJ1B 2MHVA 4LJZC 4K5VA 3K57A 1S72A 3GV3A 2OF1A 3L9AX 4LF4Q 5M3MB 1OFFA 1F9SA 2BYVE 2WDTB 2EQSA 2HD3A 2KDIA 3P75A 4DXFA 3DVGX 2ZNVC 4EZJA 4OWWB 3OSOA 2UXBL 4RCNA 1QNUA 4WWNA 1DOMA 3DM1A 4YWMA 3J7YW 3ZW3A 5BYSA 1PTOC 2INNE 4MH0E 4C3JG 2YEPF 3DMUA 1K52A 4X57B 4PZ6A 1C4AA 4NKLA 2BDNA 4P75A 5K36G 4BY7G 1TWCH 2IJ0A 2K50A 5I2XA 3ZNGC 2EYMA 1Q0WB 3OHXC 1YD8U 3RNUA 2OHFA 1T5EA 4RMAA 4FBJB 1I35A 4X3TA 3A33B 3RZFA 4LF6Q 2KEEA 4LK1C 4JI4Q 4DK3C 4HTHA 1YHQA 2Y0SG 4JI8Q 1KH0A 3PLVA 4HDQA 1W3SA 5EKLA 3NVYA 2LXAA 3N6RA 1VD2A 1Q81C 3UIOB 3GTLH 3DVNU 4NJ6A 1NSNS 2KO3A 1E8ZA 1LFDA 3AE9B 4P2CB 1FXTB 5EAYA 3TS0A 4AOFA 4LF5Q 2GLSA 4ZK9B 4DV3L 1KM7A 1OQQA 4OVVA 5IYCG 1LV9A 3E56A 3P1HA 2BH8A 4JI2Q 2JF5A 1WI5A 5E1FA 2KJRA 3L0WB 4AYBE 1YEZA 2D5GA 1HFNA 4A3DB 1T0YA 3C0RB 5CHVC 2F0MA 3SE0A 3PSEB 2QHOA 3RUIB 1QUQB 2KHJA 4IN3A 4KY5A 1VQKA 1RLFA 3CCQA 1L5PA 2BB5A 3D4RA 2I38A 2N7EA 1N63A 4RGNA 1CQVA 1QLBB 1Y1WG 4KY6A 1ZXTA 3X3NA 2WX0A 4USAA 4IWPA 3U52E 4JK1C 1PTOH 1RAXA 4G7OC 2N7JA 5CV6A 1N34Q 1XD3B 4W9CA 5FLXE 2A5HA 1FRRA 4EZKA 5AEKB 5CR3A 1E90A 1MBYA 2F0TA 3TP6A 1WGGA 2WXJA 4ZUIA 1UH6A 3DQVA 1L2NA 3I4NG 2OQKA 3M4PA 5CBEE 3HM3A 2B2UA 3Q8EA 2GVBA 4R4QA 4KIKA 1FM0D 2KCNA 4ZRIA 2M9VA 2DZIA 1HXYD 4OL7A 2DZKA 2WGSA 2EE1A 3Q8AA 2IPKD 1Q1OA 2VH1A 1KLUD 5CV4A 4ZYNA 1HNWQ 1EU4A 1YNNC 1PH6A 1I4PA 3NTHA 2PMZE 3T1HL 1BBWA 1EY8A 1A70A 1VQIA 3VDYA 4M8NA 3S14B 4ZYSA 2D3BA 5IY0A 2FJ2A 1K53A 4LNNA 1Y1VH 1B2TA 3TBLD 4EQNA 1CUKA 5BR8L 3DWGC 1EYGA 1GUNA 3TEZA 1JCKB 4LNOA 5JXVA 3Q6BA 4M1UB 2M00A 1VZ7A 3TREA 3N1ZC 2R7ZB 1SMYC 1H9MA 1C4PA 2K6AA 1NBWA 2ZPYA 4KGTA 3C2PA 1WGRA 1XCQL 2N55A 4O2DA 1YHAA 5C3EG 1E24A 1E9MA 2F4VQ 5BN4A 3IVFA 2J7ZA 4LAAA 3ZXRA 2EPBA 4UAIA 1N62A 4X65Q 5E4XA 2IY0B 5JAVA 1V1PA 3E5SA 4BBRB 5M3FB 5JH5C 5MPOA 4MN3A 1XNRQ 2AKWB 5GAGC 4DR7Q 1FXAA 4EUTA 5ELCA 5JHAA 1NVID 2KWCA 3ZTCA 5FO9B 3HIZA 3HVDA 3KJOA 3CCLA 2BTEA 1GB1A 2HHHQ 4LW1A 4NW2A 1BCPD 1I6HB 1VQ8A 4KDLB 3JSVA 1AH9A 4YTMB 4F8MA 2BQQA 3EFUA 3GS2A 3I70A 4AJYB 4CHKA 1Y69U 4IPDA 4WFN3 3KLSX 2NB0A 3F2BA 4MT5A 1UE6A 3I2ZA 2JUOA 2G4SA 2IO3B 3EC8A 5C4HA 3TN2A 5GXGB 2KJXA 4FLHA 5LLIA 3RFZB 2MEKA 2HQLA 1G2SA 3TP7A 4YL8A 1VQBA 4JBKA 1MKHA 4ZHOA 4DHJD 5M3FG 4JCVE 3RUZA 5E6JA 2JY6A 2XWJB 3CU7A 4AQYQ 4N9TA 4FXCA 1EY5A 4EX5A 3FRPB 4PYZA 3RNAC 5FLMH 2AL6A 4HVBA 3M9BA 1UWXA 4M02A 4A76A 2I2YA 1PDQA 2F0FA 2L52A 1VQ9A 2OWOA 3PO3B 3N3KB 1RDPD 3RULA 1NE3A 3LWEA 3K0XA 2HJ8A 2K1BA 4BA2I 2C9WB 2JYTA 2NPTB 1VQ7A 4IUQA 1KAAA 3LYYA 4JVZA 1CKNA 4L5SA 1CQFA 3V2TA 3DOWA 1N9WA 2NZOA 4FF4A 5CC4A 5BMGA 1DJRD 1JROA 3IT6B 3PIOA 2O2LD 2O4XA 3BVMA 4DNTB 1CA5A 2E5LL 3Q8CA 2HD5B 4X3UA 1FYCA 5HG2A 1HTPA 1WJ4A 4AP4C 4BVUC 2QC8A 3V05A 4ME5A 2Y5BB 1DOYA 3HOYH 3NUHB 3O13A 2GI9A 4E3CA 1WWTA 2NZHA 4HCSA 5FLXL 3V6EB 2EXDA 4A3BB 5C23A 2DZJA 1YNJD 1WX7A 2ZTDA 1V1PB 1RYJA 2K6DB 1YNXA 4KV2A 4PYUA 5M3MH 1L6UA 1X3PA 3H1UA 4A3MG 1KQSA 3ZJYC 4YHHL 2F3VA 3CC4A 1PRTF 2ZJPA 3RZOH 4L23A 3MEFA 4OVUA 1R9TH 2LRUA 1HCZA 2LFIA 3HP3A 4A3FB 1I94Q 1NR4A 4MGIE 2E2IB 1X65A 3KFUA 4KLKA 1Q90A 3NHEB 2WINB 2L1AA 3IFTA 3Q24A 3X23A 1IBXA 3URYA 5JHBA 2DBYA 2IO2B 4WWPA 3TSSA 2KQ3A 2K52A 1JB7A 1N36L 1CZGA 2I1JA 4A3DG 4KKUA 1MG4A 2JQOA 3QHTA 4I6PA 1WR1A 3RMHA 2IHFA 1L7YA 3BIID 1F2ZA 2D0OA 3DVNV 3DBLB 2KOLA 3I3TB 2DN8A 4IPCA 5D6JB 3FPUB 4RKBA 3HOZH 3J80i 2NBVB 2WAQG 1HA5A 1WFQA 4B3SQ 1AWDA 1VCIA 5L37A 3PSIA 1L1OB 1IBKL 1PRTD 2LY7A 1J8IA 1XPUA 2K4KA 3TIXA 1EOVA 1JOQA 4TQ0A 2ALYB 3U2SC 3TZUA 3VR5A 2J0JA 1JJGA 4OHJA 1U5KA 4FXKC 3GTJH 3S1QH 4W9HA 1ZDXA 4B95A 4BY1G 3UDIA 3DWMA 4GDLB 2EYLA 4ANXA 4ANUA 3HM6X 3GTGB 4DAMA 4OELB 1N36Q 2R93G 3RLNA 1ZEQX 1ILQA 3A9JA 4A3GH 3I73A 2D07B 5IOIA 3VUWA 1KF6B 1X3EA 5CV8A 4DK1A 1Y56A 3NTIA 5M5WB 1KABA 1ML0D 3M85A 1RL2A 2Z9HA 3J81E 3CMAA 2F03A 2PVOD 3W5OA 1MJCA 1ONLA 5HGTA 4G4KA 2C7MB 2M4NA 4DR1Q 1N61A 3D32A 4MH8A 3RN9C 4ABNA 4DR2L 3PGZA 2BS3B 4JOIC 2L55A 2EJMA 2JZZA 3PQIA 1TT2A 3HEJA 1AN8A 3ZLZA 2R7ZH 1YJIA 4C1NI 2LJIA 1JB3A 2XGTA 3FEWX 4HIMA 1VQLA 1GAQB 2PPBC 3R66C 3QAQA 5CHWA 5F2DA 2DGYA 3SU8X 4LNQA 3RI7C 3SVMA 1QOGA 4I6LB 1K51A 1XF5L 4XT3B 2N9XA 1NMFA 3M4OH 1PTOF 1SGHA 3S14H 3NBHB 5LMNW 1DOLA 1NUCA 5M5YH 1HTLD 1KAWA 2L11A 5EBDA 2M8SA 3RZWC 4K2LA 4B0EA 4GNXC 2PJHA 2EIFA 2K5DA 1FNVA 1K9MC 3L0OA 5NUCA 3GO5A 4FP5D 4HCNB 2K5HA 1YIWA 5CTRC 3STBC 2EDGA 3TZDA 5M5XB 4A3EH 3H0GG 1JMLA 2G1EA 1VQJA 2J7QB 1GC7A 2O2VA 2I07B 4A3CH 2F0EA 4NXNL 2E2JH 4QAYA 3L2PA 3AB9A 3VTVA 2R92G 5ELNA 4PMCA 4DU9A 2MO1A 4EQ5A 4LF6L 1JT8A 3PO2G 2PPHA 4EKUA 4A3JH 2JE6I 1AYFA 3CQZH 3W3AA 3VH3B 3G6JB 2ZXOA 3A54A 1ASYA 3GE3C 3AMZA 1Q8IA 3I63C 3T13A 1WYDA 2KNBA 1Q5WB 2KMAA 4Q2JA 1JALA 3KF6B 1VMCA 1VQHA 5JOBA 5DPWA 3JAMi 3PF5A 5C5MA 4BAXA 4GKKL 1MJEA 3U9SA 1BMLC 2QW7A 3NXWA 2EYPA 3R2IA 1WSPA 4OZCA 2KCTA 3GTOH 1L6VA 1XT9B 1WY8A 4OX9L 3J81i 2RSOA 1HE8A 1STHA 5IP9G 3I4NB 2DNCA 4ZRJA 2A19A 3A1QB 2WDRB 4P1BC 5J17A 2LKVA 1WJNA 4DXAB 1XNQQ 1K0SA 2A8VA 1VQDA 2HTHA 2KX3A 2RMMA 1O7LA 2L7RA 1X6OA 2MPMA 1TKEA 1G6ZA 1AZQA 4WJNA 3NJTA 3KF6A 1RTOA 1WJJA 2B63G 2C60A 4C00A 2HT1A 3OMGA 3CCRA 5KNDA 2PZTA 1R4MI 4N58A 2RF4A 5L95C 3E9IA 5IP7G 4POFA 4EQOA 2L5TA 2RDGA 4ZKCB 2DYBA 4W9GA 3AU5A 4FVMA 4RCOA 5M5XH 2F4VL 2W9NA 2EELA 3K0YA 2L9HA 2Q2UA 3C1FA 4UY8C 1FRDA 2RPQA 3FILA 3WCQA 2ZM6Q 2PKOA 4XYOA 4CYEA 5IN7A 2KECA 2PNHA 4KGSA 1GJXA 4W9KA 1S40A 4A3IG 2ZZPB 2HQEA 1OQYA 2ON8A 4NJ7A 1I50H 1STEA 3R8BA 1V8QA 4J6HA 4KJNA 2FUHB 1SAPA 2N9EB 2B2YC 2J0MA 5BR8Q 5KEEA 1PDXA 4GOCA 2LXJA 2X6GA 2KANA 3ZRCA 4MM3A 4PMBA 1AARA 4IUTA 4K2KA 3DBRB 2FNJB 4XZ4A 2LGXA 3D4DA 2XK5A 1G2TA 1SE2A 3NBHA 4GOPA 1SFOH 4ODGA 1YJWA 5KIXA 1HNWL 2I1KA 1O7ZA 1UF0A 3WOFA 1TTNA 4MNOA 2KK8A 3RLFA 3P42A 1IL2A 2KHIA 3J81L 2D2CC 5L83A 2WXKA 1A5RA 3BYYB 2F0UA 4IFDJ 3PZ7A 2C35B 1I4RA 1S5DD 4JI3Q 4HPPA 4MJSA 3F2DA 2NVXH 4X62Q 4DAVA 4C2MB 5AJ3Q 4B3ML 1B44D 1NAPA 2JA8G 4QL5A 1XLNA 4A20A 3ZNID 1R4NB 2EMTA 1J5EL 2QF7A 3E9SA 4DUYQ 2QDBA 2M56B 2WAQE 2JP1A 4BOZB 3NTKA 1XJVA 4HWIB 1OXSC 4WRDA 2L83A 2V3NA 3P4QB 2KJHB 4KSKC 1BF4A 4M01A 3N52A 3KK7A 2CHZA 2AUKA 2NVTH 3H15A 3AEFB 4IUVA 3QIAA 1XMQL 1VQ5A 4JV5L 2W82A 4B6WA 4S17A 3W1YA 1PFDA 1H9SA 2NN6G 3ONSA 2SEBD 3FPPA 3PV0A 2DJFC 2R92H 2Q2IA 2SOBA 3T53B 1PTOB 4OVZA 2VQEL 3ULPA 1A3UA 3PO2H 4ITKA 1J9OA 3KDFA 3RNEC 3WDNA 1YN5A 1B9MA 4QMGA 1TS2A 1E7PB 2Q8TA 3OTOQ 3RZDB 1IYVA 1CJEA 4A93G 4K1RB 2KBNA 3D0FA 3GDEA 5I6YA 3RD4A 1ROEA 3NOBA 5DPRA 2XTIA 3NZ3A 2RGFA 1KRSA 1A62A 4C1NK 2Y5PA 3HRDD 4XIGS 1GUTA 1U4RA 3GTMH 3JSVB 1EQQA 1CI3M 4AWJA 1OTRB 2A69C 2F0NA 3WALA 3AN1A 4FADA 2HIVA 2F0HA 4N8FA 4NDXA 2Z4IA 1UD7A 1WH3A 1SNCA 1TWFB 4BY1B 2KDEB 4WQMA 1F9RA 3HRZC 3K5LA 1E1TA 2JA6B 2E75C 4A3EB 2J4XA 2XRQD 2LJ5A 3RPFC 3V3XA 3C19A 4AUQC 2DJGC 3PO0A 1PLFA 4DK6C 3CCVA 2DNFA 2HDLA 2MQHA 1C78A 4DAYB 3CQZB 3D31A 4K7UA 4IALA 2KFKB 2EXZA 1UEBA 4DNRB 2FIFA 5M5YB 3NP8A 1FJGQ 4I65A 3VR6A 3M3YH 1UWVA 4P74A 3L54A 2K5QA 4BKGA 2LVOA 3DBHB 5KNBA 4PG3A 3RNGC 2EKIA 2J0TD 2GOWA 4HMIA 4QUCA 1YIJA 1T0SC 1D7QA 4POGA 5E4WC 3DBSA 1Z47A 4LF9L 2DAJA 1PH4A 2JA9A 1GUWA 3BU2A 1O78A 3HGBA 3KYCD 3HKSA 2HUGA 4Q5VA 3B2GA 2A6HD 1EO6A 4ICUA 1Y1WB 4K0KQ 3E9HA 2CW0D 3AE2B 2EYHA 2LXCA 3G7LA 4XYCA 4LF9Q 2M2LA 4ZLTF 3R2TA 2BT6A 1LTSD 1N33Q 3QG1A 3AEAB 3KLRA 2XWBB 4GS3A 1Y8RC 3W1SC 4HJ5A 4JL9A 5D14A 3Q3MC 4HXDA 4ASWC 1GJZA 4CJ0B 4KD3A 2WXRA 1FGUA 1LM0A 1KJTA 1YOVB 3PUVA 3S9WA 5G5HA 4DV0Q 2KVRA 4L5QA 3PT2B 1LT3D 3OLMD 1VRAB 4C3IH 3QX1A 3W5UB 4WURA 4R1JA 3H7SA 4DR5Q 3S1MB 1NENB 2F0JA 1B9NA 2PI2A 3JAMc 1TWAH 1KXLA 4IO9A 2XIWA 4H44C 2PVGC 4FF2A 2QKIC 1B3AA 3AECB 1EYDA 5EKIA 2RR9A 4RF1A 1SF0A 4JLCA 1STYA 3QA8A 1AEXA 3S2HH 4R4TA 4P6VF 4Z9CB 2KKCA 1HQRD 2WDQB 2VB3X 4PZ7A 3DM3A 1WXQA 1X9NA 5EQ0A 4M0WB 1RRBA 1PZJD 2B63H 2V4LA 4XDXA 1P98A 3I5JC 3M62B 3AFQA 1JE4A 1KIXA 1PZID 3VVWB 3K7AH 2BPSA 4GKJQ 4JIOU 1I42A 1L4ZB 2L1BA 2K25A 4W9DA 2F0OA 1Z6HA 1XMOL 4ZKBB 1WFYA 4I7AA 5IYBG 4HJGE 3F8TA 3HK0A 4GDKA 1SE4A 4O1NA 1Y1WH 4ZRZA 2BB6A 1YN3A 3V60A 5M3MG 2MQJA 3U7ZA 2PEAA 4X66L 3KYHC 3TRZA 2LWPA 5IWAL 1KNEA 3KJPA 2WB1B 5JJLA 4A3LH 2KFKA 1SJHD 4GU2A 2V3SA 1NI3A 5KNCA 2NYZD 3VYTA 4DR1L 3NUCA 3UI2A 2ATWA 2LVQA 4FJYA 1QVFA 2JA7B 2H88B 4A9AA 3PCOB 4P1CC 2BKFA 5DEHA 3HUIA 2QA4A 1B8AA 1TVXA 3KWVA 4DK0A 5ISRA 1KDBA 3KUPA 4LF7L 4LFCL 3GTQH 2VZKB 1NI2A 3GZNB 5ELDA 1RJTA 5IOCA 1PGXA 1G8ZD 4YY3L 1RCVD 3NQTA 2OJRA 1DXMA 4ME3A 2AQ3B 4X3SA 4B3RL 2ZPNA 2KUMA 2LS01 5TSSA 2QIEB 1BO0A 2IX0A 1FEHA 1P9DU 2WNMA 2UUBL 3I90A 1SROA 4FN2A 2E2IH 2SAKA 4WJPA 3VA5A 1SMXA 4HIOA 2HIXA 1VLBA 4KKSA 3AE8B 4K8JA 1TWFH 1C7YA 4BY1H 4WJQA 1AE3A 2N4FA 4EEWA 4P72A 3CWIA 2Z6KA 1XPRA 1WGKA 4ZHPA 5DAUA 2Y5CA 2LASA 3NWTA 5LXHA 1J0GA 2PMZB 1JWMD 1IUEA 1QOFA 3MJ5A 1G6JA 2NTSA 5JEAG 4XTCS 2SDFA 3W5VB 2ZM6L 4LF8L 4IM3A 3M7GA 1VMPA 3VUYA 2IGDA 3FKYA 4W9IA 2KZRA 3T1YQ 2CH4W 4B3TQ 2AYOB 2PI2E 4DDID 1OXUA 2OJWA 2L4NA 2FAZA 1EY6A 4RA8A 2MA9B 4H02A 2JA5B 4G57A 2ZTEA 4EOYA 3TDQA 4DK5A 2VH2A 2JK8A 4WJ3M 5C0XJ 3OW7A 1I94L 1EWIA 2VUMB 2G9HD 2MFIA 2WX1A 4IZ8A 4A3MB 4YHHQ 2FCQA 2PTLA 3C1EA 2B2YA 4FXGC 2MUYA 1XYIA 3J7A5 1WGHA 5J18A 3BZDB 3FC4A 4K6DA 3PRPB 2K3UA 4GLXA 2ZXPA 3Q0AA 3PPAA 1RF2D 1XEEA 3FKIG 3L16A 2UXDL 1FFUA 1MPEA 1PFNA 3W1BA 1RWSA 2MO0A 5IT9L 2FCSA 2RBMA 5C44G 1PZKD 3OWEB 2KOXA 1YNTE 4E74A 3RN2A 1HUMA 1YN4A 1QNKA 2PZWA 4QUFA 1EIGA 4C3JH 1V80A 4APVA 3STBD 4PMWA 1QVGA 2MP1A 2OQ0A 2QDLA 1F2LA 3NBIA 1EF5A 3MFYA 2MP2B 3KF8B 2IYDB 4HEA1 1A2UA 4LLGM 2BYEA 2AWTA 5JZEB 2GVAA 4NXNQ 2KTRB 4MELA 4Y52H 3SDZA 1WTOA 1I3QB 4RM9A 1UAPA 1NTGA 4V190 1XX8A 4DNIA 3VRBB 1WYWB 1SYGA 3DPDA 3IFDA 4M0WA 3VDZA 3AQQA 1AE2A 4FHKA 1I4XA 3HOXB 2I5LX 3JAME 3D4WA 1GB4A 3E6ZX 3CCEA 4A3MH 2K8CA 3PRZA 2F52A 2K5VA 1EYCA 1B1ZA 1IW7C 4A3KG 2A4ZA 1J6QA 3VR3A 1HR0W 4DV6L 3NK9A 2G9DA 5IGGA 1TS5A 5J3BA 3HOWH 3HFZB 3N20C 1E2VA 2L76A 5JVH3 4ZRPA 3S2HB 3PO3H 3M95A 5DPTA 4KI0A 1W6JA 1IBLL 1RFKA 2BE5D 2N9LA 2ZJDA 2QEJC 4DKAC 1WVLA 2KFJA 1HZCA 1Z7TA 2W55A 2GN5A 4K6LA 4KMUC 1TY2A 1LABA 4TUUA 1BBUA 2O6VD 2NWGA 2WQYB 2AQ2B 3MA2B 4L8JA 5HY6A 4C3IB 1ZXHA 1F2RC 2EKEC 2PW9A 3A1QA 1IGDA 4RHRA 3IT4B 4A3IH 5HHDG 3OG5A 4LTUA 4NPSA 4YCUA 3RZDH 5IGFA 4A93B 3I4NH 4YXDB 2NVQB 2F4IA 3A8IE 1VQ4A 1PFMA 2QILA 2WKCA 1E2ZA 5LL6S 1TGZB 4NZLB 3OOCA 1LTID 3X3MA 1YITA 2WU2B 4N59A 3PZDA 4RF0A 2W54A 4NQKE 5EPJA 4QB4A 4P7IA 1I7HA 3AEEB 2W3SA 2NVYB 2XN9C 5C0XG 4KZ0A 4WJOA 1B4OA 1TIFA 4BKSD 4K14A 1IBKQ 2JA6H 5G3LF 1V1OA 2JXXA 2D2QA 4A3GG 2IY5B 3KF8A 4DA2A 3APDA 2RQXA 3VUXA 3H09A 4KN7C 3EJIA 2M1MA 2V3PA 3K9PB 3P4PB 3P1MA 1QILA 3UDXA 1SYBA 3BYTB 4PQXA 4KK7A 2V1YA 2MW5A 3MJWA 1PUTA 3SFEB 3WA0A 2JA7H 4KKTA 2YVCA 3BVGA 2JWZA 2KCMA 4IOCA 4BS9A 4K0KL 3QB3A 4QIWB 1PH8A 2CJNA 2CJOA 2R7ZG 2JA8H 3Q22A 4OEMB 1AZPA 2FMCA 2QCPX 4CKBA 2KWVB 4Y7NB 4HCEA 3GZNI 1S5CD 1SIJA 1E8XA 4MDKE 3I9V1 3PHXB 1EU3A 3NSWA 1U4LA 1HEZE 1JE5A 1SLJA 3L08A 1V97A 1PXUA 4KHZA 4HROA 3DHQA 1SNOA 5IGDA 1MSGA 1SEBD 4J8QA 3SHLA 4BA1I 2N1VA 4EFOA 1GNUA 1S1QB 3M3JA 1V49A 1RM6C 3OPOA 3WWVA 4GOPB 1V43A 1WX8A 2RHSB 3ZJVA 3H3VH 2XK5B 4RGOS 1PTOD 4BFRA 3TEYA 4DWFA 4FF3A 5CBAE 2EY5A 5C4XG 3JC66 3AB5A 1LTAD 4JBWA 5CV9A 1WGDA 5CX3A 4KZCA 2VZAA 3GOEA 3ZGZA 2MLBA 3V6CB 1E22A 4JI2L 4ALPA 2IGGA 1EY7A 4C80A 2C7NB 4I6NB 4J1MA 4CO7A 4C7YA 1UUPA 1YQ4B 2JX5A 3ZJTA 1F0ZA 4XDCA 3QR8A 4LNKA 2L0CA 4A3GB 1LM8B 3B1LX 5CGKA 1LACA 5HURA 4Q0FA 2QDFA 1BOSA 3UE1A 2UUBQ 1SXTA 4K3CA 1DCZA 4N6EB 3ML8A 4IG7B 1DONA 1EFWA 2BVCA 2BA0A 4ZOHC 1Q1BA 3CC7A 3GTJB 4JI4L 3S1QB 2JYOA 2WXHA 5FR6A 4IPHA 2V4DA 2R2QA 3LDZE 3F2CA 4AJWA 1Q12A 4YY3Q 3TP5A 1STBA 1QZEA 3Q8BA 1VDVA 1F2MA 4ZCKA 3VA7A 1NJIC 4LF7Q 4F8CB 3HOYB 3KVFB 2KCCA 3KLSA 4AQYL 4KVGB 3CRKC 2ASBA 3FKIH 3FP9A 2BOSA 1I3QH 1S3SG 4KIKB 3ZTDA 2B2UC 1JICA 2Z6KC 3ZDTA 1GO3E 3S24A 1GD7A 1WTHA 3L17A 2K1FA 1WTPA 1STAA 3ULJA 1G91A 1N5XA 1GXDC 2F0KA 5AZGA 2XEWA 3EUB2 2DLBA 3ZVVA 2PQAB 5FO7B 5A35A 3RZOB 2A74C 3OW2A 3LGJA 3UGBB 4IPGA 4JV5Q 3EHVA 5AUKA 4BKSA 2CFMA 4RAUC 5IWAQ 2NR2A 2E2HB 4K8IA 2G4DB 3KBGA 1D2BA 4BY7H 1LT4D 4DV7L 3GTMB 4OO1H 2K8BA 1B70B 3A8JE 4HSPA 3SK8A 4J6IA 4YTNB 2YEPB 3E3XA 4QGUA 3SHQA 4LUVA 4BZAA 4JI1L 2LI5A 4K5XA 4HMJA 3L10B 2CW0C 2P5ZX 4IW0A 3CSTA 1U0LA 2KTFA 3HKZG 3QOJA 4C56C 4HJ7A 4JI5L 2MBOA 3Q8FA 1H9JA 2WS3B 3VAWA 3SD5A 4X62L 2IWHA 4JQWC 1FNWA 2VQFL 3U7DA 3U4ZA 3W1GA 5LMNQ 1T3QA 2R93B 1PYWD 3Q3JA 3MAQA 1YNND 1I5FA 4DGZA 1ZYRD 1BVSA 3VR2A 4XDDA 5ELOA 5JEAJ 3C3LA 3S2DB 2KQ4X 4D2KA 4BOSC 5IYDG 4H2AA 2GBMA 4DR4Q 4JI6Q 1EEID 4IKGA 4CJ2C 3BZKA 1BUIC 1WXAA 4CKEA 2NVQH 2J53A 2KWUB 1KDCA 3NS1A 1BKBA 5CV7A 4N8X1 1WX9A 3BK1A 1E3PA 3MTNB 3DHHC 2KENA 2IW3A 3GD7A 3H6MA 3KBXA 4CKCA 4DDGD 3OYYA 2NVUI 1S5BD 5G2NA 4GN4B 4DR5L 2KQ7A 1SMYD 2QJLA 4TQUS 1PMRA 5BN3A 2B8FA 3AI5A 4DV0L 2M19A 4YSYB 2PW7A 1JMCA 4BWGB 1CZWA 2MJDA 2F3WA 1FCCC 4LFAL 3AEBB 4JI6L 3MFGA 5EDSA 2ZW1A 4IUNA 1Q82C 4PV1C 1EWYC 1S5FD 2NBFA 2KVZA 5J1ZA 5H1SE 3M3YB 1KRHA 3MC0B 1WXVA 4KSLC 4KN4C 2PMVA 1EY4A 2A68C 1H8CA 5LMNL 3GTKH 3CXCA 3PS6A 4NXML 5EPKA 2AUJD 2KDMA 5HFYA 2B2TA 5EE0A 4BBSB 4H7BA 4GIVA 5LMUL 4MHEA 3ML9A 4PT5A 2LD9A 1N34L 4JI1Q 1E7ZA 2NVYH 5LNK1 1SIFA 2KC2A 4HCPB 2EJFC 4OGQC 3H3VI 5FKAC 2NBWB 2Y0SB 2BBCA 3MXNB 5HI1A 4S3SA 1Q7YC 3RT3B 2PQEA 4FXDA 3K7AB 3I55A 2KMMA 3KYDD 2D11A 1RHPA 3BWUD 3TUOA 5E6NA 2FXQA 1VF5C 2HTME 1TWGB 3QQ8B 4NJCA 2JXTA 3ONAB 2IO0B 3DHGC 3AULA 2IX3A 4RG1A 2KX0A 3W1SA 4DV3Q 2NPTA 4RM8A 3I4LA 4O0AA 4MSQB 3RMKC 2KAJA 3PO2B 2LUEA 2JA7G 3ENEA 3CIRB 4R3DA 3ETRA 2NCNA 1PFSA 2L15A 3NHHA 1EY9A 3PIPA 2JSVX 3AXCA 1WGYA 3UF8A 3HKZE 3LJ3A 4UHVA 2WXIA 4GDKB 4JI8L 1Y8PB 4TRDA 4A3KB 1XTCD 4HJ8A 2YTXA 4MTNA 2LMCA 3IFWB 3ZNHB 1F77A 3IAS1 3MC8A 1GUGA 3PV1A 1VQMA 1V8CA 3PRMB 1AP0A 1WF9A 5JEAH 1JWSD 3HOZB 4JI7L 1QKZA 3MZ5A 3VXWA 1KRTA 3VHTC 3ND9A 4OZAA 1CKOA 1SDFA 1ENAA 1IBXB 4ZQ3A 1E6EB 4OW0A 4NNJB 4MZ9A 2CQOA 1HNXQ 2UXBQ 4IOIE 1M90C 3DEOA 4LK0M 1QF6A 2ASQA 1HFGA 4GGQA 4WQOB 1WMHA 3VQIA 1VQAA 4URKA 2ZCCA 2N49A 2ZXRA 4A3FH 3IG3A 4PS3A 4JW0A 4OZBA 1K8RB 2GBJA 1L0VB 3NRZA 4KKJA 1WTRA 4P71A 2FINB 2HDEA 2JRHA 4FA6A 4C3JB 1J5EQ 1UGJA 2DYOA 1Y1VG 1ICFB 2ZT9C 3M4QA 1EWCA 4WORA 5AJ3L 4B3MQ 1TWCB 4NXMQ 2M17A 3RD2A 3S1NH 3P7JA 2JT4B 2JEBI 2ZJRA 3FVQA 3HOXG 2VW9A 2CU1A 2EY6A 4XX5A 3RNBC 2MBBB 1A3TA 3G6EA 3VRAB 4C3IG 2JWUA 3I4MG 4ID6A 3IL8A 5BN5A 1OQRA 2L05A 2KMCA 2A6EC 1KD1C 3DBLI 5FR3A 2Z6BA 2CHBD 3HG9A 4CBVA 5IGEA 1P3QU 2LHDA 3IXSA 4C3HH 2EOTA 3EA6A 4P73A 3DDCB 2RVLA 1J7BA 1HNZQ 1KFYB 3UQBA 5ELFA 2BWFA 1HPCA 3A4SC 2WXOA 3QJZA 2EYOA 3OAWA 2N88A 1J7AA 1NEKB 1WTXA 1HA6A 2V0GA 5JJKA 4TSSA 4OONA 2WDVB 1FD6A 2MWSB 1SBBB 1PYBA 4X6AH 1WTQA 4YSZB 2GMIC 3BG3A 4BBRH 3TQYA 4F7XA 4JI0L 5IYBH 4NB3A 4PS8A 4BBNC 2X8XX 3D3RA 1C48A 3AM9A 4L1BA 1NR2A 3P4SB 5KHOA 2WXQA 4AH6A 1KLVA 4WJWA 1DOXA 1LUZA 3Q14C 1D1IA 1SYEA 4R4OA 4OWXB 2CKZB 1K50A 3ECIA 3T8MA 2EY1A 2KEDA 1EM7A 2WXFA 3B9JA 1VZ6A 4WJ4A 1WOCA 2XBBC 4A3LG 5E6OA 2D0PA 3J81j 3HOUH 2JZPA 4GN3B 2NVTB 2Z0SA 2VZKD 1GUOA 4MEMA 3CF6E 3DUZA 5IYDH 1NYRA 5BYRA 1MI2A 4UDUC 1XNQL 2FE8A 1IBLQ 2H1EA 3K59A 3I7FA 3S1RB 3KOJA 2F0DA 1SYFA 2WYQA 2RDFA 4GN1A 4XT1B 3S16H 2BE5C 1UGMA 4UP9A 4IUPA 1EIFA 3NS8A 2D5DA 4IM0A 2D3AA 2RCNA 2WKDA 1FMAD 3AV8A 4LDTD 1H9RA 4JC0A 1WD0A 3GV6A 1WXSA 3N1XC 4MTKA 4DN4M 2PZUA 1WMHB 1EY0A 1EWHA 2R7FA 4PZ8A 1XTDA 2CWAA 2ZEQA 5C4XB 2DWQA 3I8ZA 4TKNA 3X0WA 1WM2A 5TR5A 1U4MA 4HLEA 1MSHA 2N3SA 1C79A 3CKIB 2RSUA 4US8A 1TS4A 2K22A 3CCUA 1STNA 3CP0A 2KT7A 2QEXA 5GROA 1BNZA 1TWAB 4KKIA 3UI3A 1HTOA 2G3QB 5C0XH 1JC7A 3MHBA 3PF4A 3RNFC 4REZA 2WLBA 1E8WA 1TJEA 4R9WA 1EUJA 3B6YA 1H4RA 3ERQA 3NZUA 1V5TA 2LMCB 1ILPA 2K6QA 4U68A 2RA4A 1WIAA 1U9RA 3N32A 5I9OA 1WJUA 2RD0A 4J3OD 3VH4B 1SRUA 3APFA 4DV5L 3T3OA 2ZVOA 1O7IA 5M3FH 1F2RI 2KJ6A 3HOVB 1RD9D 1T0RC 5T1GA 4IC7B 1LQBA 4IJLA 3WIMA 1NYQA 2VRRB 3C8YA 3J7AF 2FFKB 5LHY1 1QJOA 1W2BA 3VTWA 2BA1A 2BYFA 3A5UA 2JXMB 3FAHA 2K0PA 4HR7B 2UXDQ 2X69A 4F1SA 1IXRA 1N5WA 1YQ3B 5C3EB 1DD2A 2XNAC 4FJZA 1PH2A 1TKWB 4FJVB 3ICEA 4DV4L 4LDTB 1A3VA 1ZE3D 3N9YC 2KHSA 1SNQA 1JWAD 1NBFC 1ET9A 4HDOA 4DR2Q 4G7HC 1QB5D 3EIVA 1B50A 4DAYA 4C3HG 4Y7NH 2B2VA 1PH7A 2HJ1A 5IP4D 4W9FA 4AYBG 4B9XA 3IAYA 2B76B 2F0WA 3H0GH 2F0GA 1JORA 2SNMA 4X64L 2J52A 4R8NA 3RCZA 1G51A 2FMMA 1YHBA 5FLXc 1X3QA 4DR6L 2DYMA 1K0RA 2YU9H 3DBRI 3EECA 4ZUJA 1ZW7A 3DHIC 3HOYG 2KC1A 4HIKA 1MFWA 5JPMC 3F1ZA 3T1YL 4B3TL 1F9QA 4FYDA 5C44B 3AEDB 2PE6B 1VDZA 3ND8A 4U673 4LF8Q 1NMGA 3IAM1 4KDIC 5BYQA 1C4QA 1SNMA 3AFPA 2CQAA 4O42A 2NUCA 2JVCA 1OXVA 2R93H 4LFBL 1N6ZA 1VQNA 2R7DA 3GE8C 4IUMB 3J80c 5KRUA 1EZ8A 3ZIMA 5GADC 1K83H 4YCWA 3APCA 1E5WA 4I7ZC 1EOTA 1HNZL 1R9TB 2DY7A 1C77A 1QWYA 4CDFC 5IP9H 2B2TC 5JJIA 3T56B 1V5OA 1LXDA 3H7PA 3S17B 3Q2AC 2CCZA 1N32L 1MJDA 4A3DH 1F52A 1PRTB 1HZBA 2L12A 2LFNA 1HJPA 3PUYA 1ACCA 1P0RA 3AE5B 1IYFA 1E2WA 3ERSX 4JGHB 4JX1C 5BO4B 4GLVB 1TKYA 3J7AV 3W9CB 2QCZA 1QVCA 4NAMA 2AHOB 3TEXA 4HAEA 3UDGA 1C9OA 4GLAC 2Q5WD 4C7ZA 2MSED 2G45B 4MGYE 1PH3A 3HOVG 5FO8B 3AE4B 2CHWA 4DHZE 3SGIA 2GBKA 1V9PA 1QCBD 2MX2A 1YI2A 1CMXB 4HK2A 3ZO5B 1P1AA 1C3TA 1W6KA 2RDBC 1XXGA 1SJED 3K8AA 3K5NA 4JOIA 1D5ZC 1GKHA 3DWQA 3ER0A 2LGDA 4MACA 2UU7A 1BCPC 3W2DA 1VZ8A 1ZKHA 2N0SB 3VR8B 2XRSD 1B7YB 2K32A 1EZ6A 1K73C 1D4BA 2VY3A 3I91A 2DZMA 1UNSA 2EZVA 4A3JG 3SR1A 1QOAA 2KN5A 2O5IC 4M8AA 3L13A 2N8NA 1HZ9A 2ZJQA 4LMQD 4TV3A 1MHWC 1WXMA 2J42A 4JI7Q 1WE7A 3PLUA 3Q69A 4L6TB 3PIP3 1YJNA 3MWYW 2ZCBA 1YMHE 5C0XI 1A0IA 5A2QL 1FXIA 2NN6I 1EIYB 3HOWB 3Q8DA 4GOPC 4F88A 1UBIA 3FILB 1IYUA 3PIO3 2PLPA 2RHQB 3J81c 2CS4A 3BVZA 3P2BA 4RWSC 3DEPA 3ZQ4A 5C3WA 2JA6G 5M9OA 2CVRA 3NWSA 1WZ3A 2MJEA 3EFCA 3EQLC 1ZXIA 1K8AC 2LVPA 2AQ1B 1WJ6A 3A56A 2WXPA 1SB3C 3J80L 1SNDA 1C9FA 3ZDMC 2Q2TA 4DHJB 2MBHA 4IDIA 2QMTA 5G5GA 5JPNC 1PV4A 3LB8C 2UWQA 4QCLA 1CFMA 3M4YA 1PVOA 3JAML 3HOZG 3TMEA 1SFOB 3LXFA 2I5HA 2ONQA 3QWZB 4DV2L 4G7ZC 4YCVA 4B08A 3QOLA 3S1RH 1YQBA 2LHEA 4B9KA 1DYQA 1L2FA 1FGBD 1HH2P 1OEYJ 2Z4HA 1U4PA 2KACA 2M0XA 4A3OA 2KDBA 1WE6A 1X55A 1A15A 1T9HA 4TKOB 4C4VA 4UP7A 1WCMH 2XVSA 5D3DA 3H6NA 3VR4A 1ISNA 3KLWA 3RR5A 2A6HC 3H8HA 3A0JA 2HHHL 1EQVA 2I0QA 1CKNB 1YNJC 1ENFA 5LMUQ 4XC2A 1DGJA 4R8IA 2BF8B 1VQOA 3OJ4B 3SR6A 1XLQA 4L5TA 3B0AA 1NY4A 2GA4B 2X38A 1O7YA 1I4GA 2R6GA 1D8LA 3OMCA 4LUZA 5IE8A 4X65L 4JWUC 2RKSA 3SK5A 4GNXB 3M63B 1UE7A 1IGCA 1F9PA 4ACFA 3HKZB 5AZHA 1ET6A 5C5LA 4RFBA 3CSFA 3OWFA 2ZTCA 2Q2HA 2E76C 4BKTA 2JU6X 2YU9B 2O2VB 5FJ8G 4QY7A 4EVOA 1GHJA 1JRPA 1D5MC 1LO5D 3UDFA 4IFDG 5EKKA 2Z0DB 2EYJA 2N9KA 1M94A 3K80C 4HN7A 4CDDC 2ZVNA 1B53A 1WZ0A 4AYBB 4DFAA 2DENB 1CZPA 3NEMA 2KTRA 3ZXVA 3T1HQ 1TT5B 3JYUA 1VQCA 1BQQT 1PRTC 1N8RC 4DR4L 2DUDA 2FCNA 5C3EH 1J8CA 1C8CA 5BMHA 2AX5A 2D9UA 2UUAL 4JBJA 2DY8A 2NS5A 2NN6H 2NTTA 4KHPL 5EE1A 1EQTA 4TVAB 4XWTA 4BXXG 4DUZQ 2ZW0A 1JW9D 1GPXA 2D3GA 5E6PA 5I2YA 3RNCC 1CTMA 3ZYYX
chains in the Genus database with same CATH topology
1E0BA 3DXJC 1A6XA 5AFWA 2BTEA 1N60A 2Y3AA 3OIQA 1HUNA 4NP5A 2LUMA 3S1NB 3LNNA 1CT1D 4KY7A 4NMZA 3NVWA 2E3TA 1TR5A 2NZ1D 1RTNA 2BS4B 2K28A 1VF7A 3A55A 1I4HA 3E0JA 3AE6B 4WWMA 4AS1A 2F1MA 1MD2D 3PZ8A 1GUSA 3S15B 4A3IB 1D5XC 5T1IA 3EROA 1K8OA 2Z8LA 2RDHA 1RKNA 3Q23A 2YYZA 3AE1B 5T8IA 4HRSA 3AMUA 4IUUA 4XXEA 1J7CA 3QO2A 1CHPD 3U9OA 4QF4A 4YT0B 4OIJA 1IKMA 3L4PA 2JEAI 4F87A 3I4MB 3MEHA 4IFDI 2WXMA 2F0QA 3DWAA 1PGAA 3MTSA 1C4CA 5C4ZA 3TEWA 3VYSA 2BYTA 4K5WA 4TQ1A 5EE9A 3D8GA 1T6BX 1BUVT 3ABVB 3SXHA 4CGYB 5CMDA 3VR9B 4FNFA 3BDCA 1D6EC 1FD7D 1R4QB 1EL0A 5H92C 2RPVA 4RKLA 1C76A 4KV6A 2O5JC 1EIHA 2JSOA 1E10A 1VR9A 5C4JB 2XSCA 3A8KE 4C3HB 3LX0A 5I4DA 3T3NA 4P16A 2INPE 4ARCA 3VYRA 1ENCA 2PCFB 2HCCA 2H89B 5AUIA 5CORA 1A2TA 3J80E 4GZYC 1II3A 2B39A 2I46A 1L0XB 2K03A 4FF1A 2F0VA 1LT5D 1D1KA 1S5ED 3GTOB 1TQOA 2MJ8A 1BXTA 3F2UA 3M4OB 1AFPA 1HRJA 2EY2A 1TYGB 1XLOA 3NVVA 1LLRD 1M4VA 2SNSA 1LTTD 2H4OA 1ICWA 2OEOA 5LL6X 4HKZE 3A7LA 2F0SA 3U4EG 3L7ZC 1QOBA 3PUZA 3H91A 3MXNA 1ZP0B 1UEAB 1BDOA 4PNYA 4DXGA 1TWHB 1HQMC 2C9OA 5COYA 2AWOA 4RHSA 2K5PA 2L32A 4HKQA 2DNEA 4A90A 2V4IB 2E2DC 3MVVA 1ZUD2 2RSNA 4B0MA 1AW7A 1ESRA 1R4PB 4DF7A 5J39A 2B2WC 1JQYD 2KVMA 2AWNA 4RNAA 1MGSA 2WP9B 4KHVA 4YWGG 1CK1A 1X32A 4RH6A 1Y8NB 3FKIB 4KGRA 2ACZB 2Q8IB 2A73B 3MXGA 2R61A 3AU7A 2WXNA 4JE3B 2KN4A 2A69D 3H0GB 2GRIA 2WXLA 1QG7A 3IKJA 1L4DB 1FIQA 2LEKA 2W3RA 1GHKA 4ZAIA 1BCPB 1ZPSA 2WV6D 4B9WA 4JWSC 1LTBD 2IDYA 4CHTB 1CA6A 3H3VC 1EEFD 3PUXA 3FMCA 5EBCA 1KNAA 5CV5A 3QJYA 5IODA 1DM0B 4NAWB 3R93A 3K58A 3VYUA 1Y1VB 1QT9A 5JJZA 3EVQA 5J22A 1Q3LA 4A8XC 3AE3B 3GQBA 4ILWA 2FUG1 2WU5B 4CQNA 3TBIB 5G3LD 2WAQB 1IL8A 2ID0A 3TP8A 4WH4A 3K5OA 2VNUD 1WD1A 3HOUB 3PUWA 1FNUA 4L2YA 5KYLA 1TU2B 4TMAB 2KA7A 2Z1CA 3NPPA 4JPSA 1P7FA 3I57A 3QWNA 3GTPB 1QQRA 4OIKA 4EE2A 2B2WA 4XYQA 1GOZA 1SSOA 1ZKOA 2K9XA 4GLSC 4YIJA 2BS2B 2OEDA 2EYFA 3EFXD 1DZ1A 2IX1A 2R3ZA 2E2JB 5D65A 4N59A 2MGSA 2EJGC 1MVKA 3KQ4A 4A55A 3R3OA 5IGCA 3PMFA 2ENBA 2JQRB 1CM9A 1R7SA 3T51B 1XO3A 5JVG3 5DNFA 2OT2A 4ARIA 3NE5B 3MP9A 1SSNA 5D3IB 2PO4A 3C46A 2B2VC 5E3FA 5EGTA 3V96A 3WOEA 1WTWA 2EVBA 4EGVA 5A2QE 2NMQA 1H9SB 2IT1A 3D6WA 2WIIB 1ESFA 1OXXK 2GB1A 2R92B 1T5XD 2F0LA 1TZOA 1SYCA 5KGUA 2K7VA 3MXUA 1ZYRC 2FBWB 5K5PA 1S4ZA 1DOIA 4YTPB 1F2YA 3P4RB 2PIAA 3L3OC 3BS1A 5I9PA 3GB1A 1EYAA 2B63B 1G291 2BDOA 3GTQB 3FDTA 1HHVA 1EFID 2NVXB 4XQQA 4IQZA 2KWDA 1KTKA 1LT6D 2IL8A 1TKGA 5C3JB 1MI0A 2TMPA 4HSVA 3AEGB 1WCMB 1FFVA 5IT9E 1LTGD 5H8YE 1MHHE 2A68D 4EQPA 2D62A 3T16A 2C5CA 3A7AB 5C2TB 1JR0D 3H94A 1BR9A 3LWUA 2QSDA 4RGTA 4FO2A 3I72A 4RGMA 4ZRQA 2PNRC 4X3KA 1DOKA 1BCPF 5D7GA 3SEBA 2LGIA 2TSSA 4KD4A 2WACA 4L63B 2M0AA 2JA8B 4DQOC 3HS0C 1K83B 2K05A 1QE6A 5DM73 1JQ4A 1TS3A 4N9PA 1I4QA 3CHBD 2K5WA 1PFBA 4XQJA 2ICIA 1OXTA 5CYUA 1WTVA 2E6XA 2Q8RE 1VJKA 3ITPA 1ZDVA 1IKLA 1KLGD 2X6LA 3BDOA 1WRIA 1TY0A 3T4AC 5IGBA 4OO1I 1WYGA 3Q6SA 2IGHA 4WIPA 2ICEC 1L0YB 2HCIA 1MHXA 1RODA 3OIPA 1ZOYB 2JYEA 1UWMA 1XWEA 2WXGA 2VXWA 3AH7A 2K01A 2K33A 5EPLA 4E6IA 4OO1G 3NVZA 1JOOA 3MXPA 4MIUA 1LTRD 4XQNA 5K36H 1O80A 2FHTA 1QOHA 3SK6A 3I3CA 4A3JB 1E0ZA 4MM3B 1NCVA 2PYKA 1IW7D 1H9KA 2HDMA 5FOBB 1FR3A 5ELBA 1SNPA 3CRLC 5C6AA 1XCTL 2BW2A 2BCOA 5KYIA 2F0IA 4BY7B 1KDAA 2WP8J 3BDLA 5EE3A 1Q1EA 2A6ED 2F0PA 4IFDH 1Y8OB 2K04A 4HEDA 3AE7B 1FCLA 3HZXA 5C3XA 3S16B 5ELEA 2MH7A 3GP7A 5EJWA 3NQIA 2E74C 3BK2A 4ULLA 4KJOA 1JOKA 4A6QA 1FO4A 4YSXB 1TIID 5FK9C 1HZ5A 3P63A 4AQ7A 3K6OA 3J9CA 3P20A 4US9A 4KX6B 2OXPA 2B8GA 3DWPA 3GTKB 1PGBA 1I6VC 5DM63 3K5MA 1SYDA 5IIFA 1BBXC 2VB2X 4H13C 1HZ6A 1IHZA 3GTLB 3KWLA 1K8MA 2CU3A 3HVZA 4H0LC 2MJ3A 3SFDB 4XWWA 1M8AA 1YJJA 1XLPA 3M7NA 1JWBD 1P7EA 4XDCA 4XE0A 1STGA 5I6WA 1JWUD 4V0BA 4WAFA 1B9RA 1I50B 1SE3A 1CHQD 1OO9B 4IURA 3ZJUA 1Q10A 5BMIA 3D6CA 2PW5A 3MHZA 3SK4A 3B2FA 3EGRA 4KTAA 4CJ1B 4DAPA 2MHVA 4LJZC 4K5VA 3K57A 1OFFA 3GV3A 2OF1A 3L9AX 5M3MB 1F9SA 3P75A 4DXFA 3OSOA 4RCNA 1QNUA 1DOMA 3DM1A 3J7YW 5BYSA 1PTOC 2INNE 4C3JG 2YEPF 3DMUA 1K52A 1C4AA 4NKLA 2BDNA 5K36G 2IJ0A 5I2XA 2EYMA 3OHXC 2OHFA 1T5EA 4X3TA 2KEEA 4LK1C 4HTHA 1KH0A 5EKLA 3NVYA 3N6RA 1NSNS 3AE9B 4P2CB 4ZK9B 1OQQA 1LV9A 3E56A 3P1HA 5E1FA 2D5GA 1HFNA 4A3DB 2F0MA 3SE0A 4IN3A 4KY5A 1L5PA 2BB5A 3D4RA 2I38A 1N63A 4RGNA 1CQVA 1QLBB 4KY6A 1ZXTA 3X3NA 4USAA 3U52E 4JK1C 1PTOH 4G7OC 2N7JA 5CV6A 5FLXE 2A5HA 1FRRA 5CR3A 1MBYA 2F0TA 3TP6A 2WXJA 4ZUIA 5CBEE 2B2UA 3Q8EA 1FM0D 2KCNA 2M9VA 1HXYD 4OL7A 2EE1A 3Q8AA 2IPKD 1KLUD 5CV4A 1EU4A 1YNNC 1I4PA 3NTHA 1EY8A 1A70A 3S14B 4ZYSA 2FJ2A 1K53A 1B2TA 4EQNA 3DWGC 1GUNA 3TEZA 1JCKB 5JXVA 4M1UB 2M00A 1VZ7A 2R7ZB 1SMYC 1H9MA 1C4PA 2K6AA 4KGTA 3C2PA 1XCQL 2N55A 1E9MA 5BN4A 2J7ZA 4LAAA 2EPBA 4UAIA 1N62A 5E4XA 5JAVA 1V1PA 3E5SA 4BBRB 5M3FB 5MPOA 4MN3A 1FXAA 5ELCA 1NVID 5FO9B 3HVDA 1GB1A 4NW2A 1BCPD 1I6HB 4YTMB 4F8MA 3GS2A 3I70A 1Y69U 4WFN3 3KLSX 2NB0A 4MT5A 5C4HA 3TN2A 5GXGB 2KJXA 3RFZB 2MEKA 3TP7A 1G2SA 4ZHOA 3RUZA 5E6JA 2XWJB 3CU7A 4N9TA 4FXCA 1EY5A 3FRPB 1UWXA 2I2YA 1PDQA 2F0FA 2L52A 3PO3B 1RDPD 3LWEA 2K1BA 4BA2I 2JYTA 4IUQA 1KAAA 3LYYA 1CQFA 3V2TA 4FF4A 5CC4A 5BMGA 1DJRD 1JROA 3IT6B 2O2LD 2O4XA 3BVMA 4DNTB 1CA5A 3Q8CA 4X3UA 1FYCA 5HG2A 1HTPA 3V05A 4ME5A 1DOYA 3NUHB 3O13A 2GI9A 1WWTA 4HCSA 5FLXL 4A3BB 1YNJD 1RYJA 1V1PB 1L6UA 1X3PA 2F3VA 1PRTF 4L23A 1HCZA 2LFIA 3HP3A 4A3FB 1NR4A 2E2IB 1Q90A 2WINB 2L1AA 3IFTA 3Q24A 1IBXA 3URYA 2DBYA 3TSSA 2KQ3A 1CZGA 4KKUA 3RMHA 3BIID 1F2ZA 2KOLA 2DN8A 3FPUB 4RKBA 1HA5A 1AWDA 1VCIA 1PRTD 2LY7A 1J8IA 1JOQA 4TQ0A 3U2SC 3TZUA 3VR5A 4FXKC 4OHJA 1ZDXA 3DWMA 4GDLB 2EYLA 3GTGB 1ZEQX 1ILQA 3I73A 1KF6B 5CV8A 4DK1A 1Y56A 3NTIA 5M5WB 1KABA 1ML0D 3M85A 3J81E 2F03A 2PVOD 5HGTA 1ONLA 4G4KA 1N61A 4MH8A 4ABNA 2BS3B 2L55A 2EJMA 1TT2A 3HEJA 1AN8A 1YJIA 4C1NI 2LJIA 1JB3A 3FEWX 1GAQB 2PPBC 5F2DA 3SVMA 1QOGA 1K51A 1XF5L 4XT3B 1PTOF 1DOLA 1NUCA 1HTLD 2L11A 5EBDA 4K2LA 4B0EA 2K5DA 1FNVA 5NUCA 3GO5A 4FP5D 2EDGA 3TZDA 5M5XB 1JMLA 2G1EA 2I07B 2F0EA 3AB9A 4DU9A 4PMCA 2JE6I 1AYFA 3W3AA 3G6JB 2ZXOA 3A54A 3AMZA 1Q8IA 3T13A 4Q2JA 1JALA 1VMCA 5JOBA 5C5MA 3U9SA 1BMLC 3NXWA 2EYPA 3R2IA 1WSPA 4OZCA 1L6VA 2RSOA 1STHA 3I4NB 2DNCA 2WDRB 2LKVA 2RMMA 1O7LA 2MPMA 1TKEA 1G6ZA 1AZQA 1RTOA 3OMGA 5KNDA 2PZTA 4N58A 4EQOA 2L5TA 2RDGA 4ZKCB 4FVMA 4RCOA 2EELA 3K0YA 2L9HA 1FRDA 3C1FA 3FILA 3WCQA 2PKOA 4XYOA 2KECA 4KGSA 1GJXA 2HQEA 2ON8A 1STEA 3R8BA 1V8QA 4J6HA 4KJNA 1SAPA 2B2YC 5KEEA 1PDXA 2X6GA 4PMBA 4IUTA 4K2KA 3D4DA 1G2TA 1SE2A 3NBHA 4ODGA 5KIXA 1O7ZA 3WOFA 3RLFA 3P42A 3J81L 2D2CC 2WXKA 3BYYB 2F0UA 4IFDJ 3PZ7A 1I4RA 1S5DD 4DAVA 4C2MB 1B44D 1NAPA 1XLNA 2QF7A 3E9SA 2QDBA 2M56B 2JP1A 3NTKA 1OXSC 4WRDA 2L83A 2V3NA 3P4QB 1BF4A 3N52A 3KK7A 3AEFB 2AUKA 4IUVA 3QIAA 2W82A 1PFDA 1H9SA 2NN6G 2SEBD 3FPPA 3PV0A 4OVZA 2SOBA 3T53B 1PTOB 1A3UA 4ITKA 1J9OA 3WDNA 1YN5A 1B9MA 4QMGA 1TS2A 1E7PB 2Q8TA 3RZDB 1IYVA 1CJEA 5I6YA 1ROEA 3RD4A 3NZ3A 4C1NK 2Y5PA 3HRDD 4XIGS 1GUTA 1U4RA 1CI3M 2A69C 2F0NA 3AN1A 4NDXA 2F0HA 2Z4IA 1SNCA 1TWFB 4BY1B 4WQMA 1F9RA 3HRZC 3K5LA 2JA6B 2E75C 4A3EB 2J4XA 2XRQD 3RPFC 3V3XA 3PO0A 1PLFA 2HDLA 1C78A 3CQZB 3D31A 4IALA 2EXZA 4DNRB 5M5YB 3NP8A 4I65A 3VR6A 2K5QA 5KNBA 2EKIA 2J0TD 4HMIA 4QUCA 5E4WC 1Z47A 1GUWA 1O78A 3HGBA 2HUGA 4Q5VA 3B2GA 2A6HD 1Y1WB 2CW0D 3AE2B 2EYHA 3G7LA 2M2LA 4ZLTF 3R2TA 2BT6A 1LTSD 3QG1A 3AEAB 3KLRA 2XWBB 5D14A 4CJ0B 4KD3A 2WXRA 3PUVA 3S9WA 5G5HA 1LT3D 1VRAB 3W5UB 4WURA 3S1MB 1NENB 2F0JA 1B9NA 2PVGC 2XIWA 4H44C 4FF2A 2QKIC 1B3AA 3AECB 1EYDA 5EKIA 4RF1A 1SF0A 1STYA 1AEXA 4P6VF 4Z9CB 2WDQB 1HQRD 2VB3X 1WXQA 5EQ0A 1PZJD 4XDXA 1JE4A 1PZID 1L4ZB 2L1BA 2F0OA 1Z6HA 4ZKBB 4HJGE 1SE4A 4O1NA 2BB6A 4ZRZA 1YN3A 3U7ZA 1KNEA 2WB1B 1SJHD 1NI3A 5KNCA 2NYZD 3VYTA 3NUCA 3UI2A 2JA7B 2H88B 4A9AA 5DEHA 3HUIA 1TVXA 3KWVA 4DK0A 5ISRA 1KDBA 3KUPA 2VZKB 5ELDA 1RJTA 5IOCA 1PGXA 1G8ZD 1RCVD 3NQTA 1DXMA 2AQ3B 4X3SA 2KUMA 2LS01 5TSSA 2QIEB 1BO0A 2IX0A 1FEHA 2WNMA 3I90A 2SAKA 3VA5A 1VLBA 4KKSA 3AE8B 4K8JA 3CWIA 1WGKA 4ZHPA 5DAUA 2Y5CA 3NWTA 2PMZB 1JWMD 1IUEA 1QOFA 3MJ5A 2NTSA 5JEAG 4XTCS 2SDFA 3W5VB 3M7GA 1VMPA 2IGDA 1OXUA 2L4NA 1EY6A 4RA8A 2JA5B 4G57A 3TDQA 5C0XJ 3OW7A 2VUMB 2G9HD 4IZ8A 4A3MB 2PTLA 3C1EA 2B2YA 4FXGC 2MUYA 1XYIA 3BZDB 3FC4A 4K6DA 2K3UA 2ZXPA 3Q0AA 1RF2D 1XEEA 1FFUA 1MPEA 1PFNA 1RWSA 5IT9L 2RBMA 1PZKD 3OWEB 1YNTE 1HUMA 1YN4A 1QNKA 2PZWA 4QUFA 1EIGA 4PMWA 2MP1A 3NBIA 1F2LA 3MFYA 4HEA1 1A2UA 4LLGM 3SDZA 1WTOA 1I3QB 1UAPA 4V190 1XX8A 3VRBB 1SYGA 4M0WA 3IFDA 1I4XA 3HOXB 3JAME 3D4WA 1GB4A 3E6ZX 1EYCA 1B1ZA 1IW7C 3VR3A 3NK9A 2G9DA 5IGGA 1TS5A 1E2VA 5JVH3 4ZRPA 3S2HB 4KI0A 1W6JA 1RFKA 2N9LA 2BE5D 2QEJC 1WVLA 2W55A 1Z7TA 4K6LA 4KMUC 1TY2A 1LABA 2NWGA 2WQYB 2AQ2B 3MA2B 4L8JA 4C3IB 1ZXHA 2PW9A 1F2RC 3IT4B 1IGDA 4RHRA 5HHDG 4LTUA 4A93B 4YXDB 5IGFA 2NVQB 2F4IA 3A8IE 1PFMA 2QILA 2WKCA 1E2ZA 5LL6S 4NZLB 3OOCA 1LTID 3X3MA 2WU2B 4RF0A 2W54A 5EPJA 4QB4A 1I7HA 3AEEB 2W3SA 2NVYB 2XN9C 5C0XG 1B4OA 4K14A 5G3LF 1V1OA 3KF8A 4DA2A 2RQXA 3H09A 3EJIA 4KN7C 2V3PA 3P4PB 3P1MA 1QILA 1SYBA 3BYTB 4PQXA 4KK7A 1PUTA 3SFEB 4KKTA 3BVGA 4BS9A 3QB3A 4QIWB 2CJNA 2CJOA 3Q22A 1AZPA 2FMCA 2QCPX 4CKBA 4Y7NB 4HCEA 1S5CD 1SIJA 3I9V1 1EU3A 3NSWA 1U4LA 1HEZE 1V97A 1PXUA 4KHZA 4HROA 3DHQA 1SNOA 5IGDA 1MSGA 1SEBD 4J8QA 3SHLA 4BA1I 1RM6C 3OPOA 1V43A 3ZJVA 4RGOS 1PTOD 3TEYA 4FF3A 5CBAE 2EY5A 3AB5A 1LTAD 4JBWA 5CV9A 3ZGZA 2IGGA 1EY7A 4C80A 4C7YA 4J1MA 1UUPA 1YQ4B 2JX5A 3ZJTA 1F0ZA 2L0CA 4A3GB 5CGKA 1LACA 5HURA 4Q0FA 1BOSA 1SXTA 1DCZA 4N6EB 1DONA 2BA0A 4ZOHC 1Q1BA 3GTJB 3S1QB 2JYOA 2WXHA 2V4DA 1Q12A 3TP5A 1STBA 3Q8BA 1VDVA 1F2MA 3VA7A 3HOYB 2KCCA 3KLSA 3CRKC 2BOSA 2B2UC 1JICA 1WTPA 1STAA 1G91A 1N5XA 1GXDC 2F0KA 3EUB2 2DLBA 5FO7B 5A35A 3RZOB 2A74C 5AUKA 4RAUC 2E2HB 4K8IA 3KBGA 1D2BA 1LT4D 3GTMB 4YTNB 4OO1H 1D4BA 4HSPA 3A8JE 3SK8A 2YEPB 4K5XA 4HMJA 2CW0C 3Q8FA 3QOJA 4C56C 1H9JA 2WS3B 2IWHA 1FNWA 1T3QA 2R93B 1PYWD 3MAQA 1YNND 4DGZA 1ZYRD 3VR2A 4XDDA 4D2KA 3C3LA 5JEAJ 3S2DB 2KQ4X 4H2AA 1EEID 4IKGA 4CJ2C 1BUIC 2J53A 4CKEA 1KDCA 3NS1A 5CV7A 3BK1A 2IW3A 3GD7A 3H6MA 3KBXA 4CKCA 1S5BD 1SMYD 2QJLA 4TQUS 1PMRA 5BN3A 2B8FA 2M19A 4YSYB 2PW7A 4BWGB 1CZWA 2MJDA 2F3WA 1FCCC 3AEBB 3MFGA 2ZW1A 4IUNA 1EWYC 4PV1C 1S5FD 2NBFA 5J1ZA 3M3YB 1KRHA 3MC0B 4KN4C 2PMVA 1EY4A 2A68C 5EPKA 2AUJD 2KDMA 5HFYA 2B2TA 5EE0A 4BBSB 4H7BA 4MHEA 4PT5A 5LNK1 2EJFC 4OGQC 5FKAC 2Y0SB 2BBCA 5HI1A 4S3SA 2PQEA 4FXDA 3K7AB 2KMMA 3BWUD 1RHPA 3TUOA 1VF5C 2HTME 1TWGB 4NJCA 2JXTA 3ONAB 2IX3A 3W1SA 3I4LA 2KAJA 3PO2B 3CIRB 4R3DA 3ETRA 3NHHA 1EY9A 2JSVX 2WXIA 4GDKB 1Y8PB 4TRDA 4A3KB 1XTCD 2LMCA 1F77A 3IAS1 1GUGA 1V8CA 1AP0A 5JEAH 1JWSD 3HOZB 1QKZA 3MZ5A 3ND9A 4OZAA 1SDFA 1ENAA 1IBXB 4ZQ3A 1E6EB 4OW0A 4IOIE 3DEOA 4LK0M 1QF6A 1HFGA 3VQIA 2ZXRA 4OZBA 1L0VB 3NRZA 4KKJA 1WTRA 2FINB 2HDEA 4C3JB 1UGJA 2DYOA 2ZT9C 4WORA 1EWCA 1TWCB 3P7JA 2JEBI 3FVQA 2EY6A 1A3TA 3VRAB 4C3IG 2JWUA 4ID6A 3IL8A 5BN5A 1OQRA 2A6EC 5FR3A 3HG9A 2CHBD 4CBVA 5IGEA 2LHDA 3IXSA 2EOTA 3EA6A 2RVLA 1J7BA 1KFYB 5ELFA 1HPCA 2WXOA 2EYOA 2N88A 1J7AA 1NEKB 1WTXA 1HA6A 2V0GA 4TSSA 2WDVB 1FD6A 1SBBB 1WTQA 4YSZB 3BG3A 4F7XA 3D3RA 1C48A 3AM9A 4L1BA 1NR2A 3P4SB 2WXQA 4WJWA 1DOXA 1D1IA 1SYEA 1K50A 2EY1A 2KEDA 1EM7A 2WXFA 3B9JA 1VZ6A 2JZPA 2VZKD 2NVTB 1GUOA 3DUZA 1NYRA 5BYRA 1MI2A 4UDUC 2FE8A 2H1EA 3K59A 3S1RB 2F0DA 1SYFA 2RDFA 4XT1B 2BE5C 4IUPA 2D5DA 1FMAD 2WKDA 3AV8A 1H9RA 1WD0A 3GV6A 4DN4M 2PZUA 1EY0A 1EWHA 5C4XB 2DWQA 3I8ZA 1U4MA 4US8A 1MSHA 1C79A 3CKIB 1TS4A 2K22A 1STNA 4KKIA 1BNZA 1TWAB 3UI3A 5C0XH 1JC7A 3MHBA 4REZA 2WLBA 1TJEA 4R9WA 3ERQA 2LMCB 1ILPA 4U68A 2RA4A 1U9RA 5I9OA 4J3OD 3T3OA 1F2RI 3HOVB 1RD9D 5T1GA 1NYQA 3C8YA 3J7AF 2FFKB 5LHY1 1QJOA 2BA1A 2JXMB 3FAHA 2K0PA 4HR7B 2X69A 1N5WA 1YQ3B 5C3EB 1DD2A 2XNAC 1TKWB 1A3VA 1ZE3D 3N9YC 2KHSA 1SNQA 1JWAD 1ET9A 4G7HC 1QB5D 1B50A 4DAYA 4C3HG 2B2VA 4B9XA 3IAYA 2B76B 2F0WA 2F0GA 1JORA 2SNMA 2J52A 4R8NA 2FMMA 1X3QA 2DYMA 4ZUJA 5JPMC 1F9QA 4FYDA 5C44B 3AEDB 1VDZA 3ND8A 4U673 5BYQA 3IAM1 1C4QA 1SNMA 2CQAA 4O42A 2NUCA 1OXVA 5KRUA 1EZ8A 4I7ZC 1EOTA 1R9TB 2DY7A 1C77A 1QWYA 2B2TC 3T56B 3S17B 1PRTB 2L12A 3PUYA 2LFNA 1ACCA 3AE5B 1E2WA 4JX1C 1TKYA 3J7AV 3W9CB 4NAMA 3TEXA 4HAEA 2Q5WD 4C7ZA 5FO8B 3AE4B 1QCBD 1W6KA 1XXGA 1SJED 3K5NA 1D5ZC 3DWQA 4MACA 1BCPC 3W2DA 1VZ8A 2N0SB 3VR8B 2XRSD 2K32A 1EZ6A 3I91A 1UNSA 2EZVA 3SR1A 1QOAA 2O5IC 4M8AA 4LMQD 2J42A 3Q69A 4L6TB 3PIP3 3MWYW 1YMHE 5C0XI 5A2QL 1FXIA 2NN6I 3HOWB 4F88A 3FILB 1IYUA 3PIO3 2PLPA 3BVZA 4RWSC 3DEPA 3ZQ4A 5C3WA 5M9OA 2CVRA 3NWSA 2MJEA 3EQLC 1ZXIA 2AQ1B 2WXPA 3A56A 1SB3C 3J80L 1SNDA 1C9FA 4IDIA 2QMTA 5G5GA 5JPNC 3LB8C 4QCLA 1CFMA 3M4YA 3JAML 3TMEA 1SFOB 3LXFA 2ONQA 4G7ZC 4B08A 3QOLA 2LHEA