1B1ZA

Streptococcal pyrogenic exotoxin a1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of superantigen streptococcal pyrogenic exotoxin A (SpeA1) by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
molecule keywords PROTEIN (TOXIN)
total genus 58
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b1zA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b1zA02
1LO5D 1EEID 1RDPD 1CK1A 2SEBD 1TY2A 1S5FD 1EFID 1V1PA 1PTOC 4RGOS 1B44D 4BWGB 3BZDB 1ESFA 2WV6D 1V1PB 3BVZA 1PTOF 5ELCA 2XN9C 4DXFA 1L0YB 1FNVA 1ET9A 1KLUD 1LT3D 1JWUD 1L0XB 1BXTA 5D3IB 1RCVD 2XRSD 1B1ZA 2AQ3B 1TS3A 3TSSA 1JWSD 3KLSX 4RHSA 1JCKB 2O2LD 2XNAC 3GP7A 3URYA 1YN3A 1HQRD 1PRTD 1ENFA 1LT5D 1I4QA 1SEBD 2NTTA 1FNWA 1I4GA 4O1NA 1ET6A 1PZKD 1UUPA 1EWCA 1S5BD 1V1OA 3R2IA 1S5CD 1JR0D 5FK9C 1D5XC 1AN8A 2G9HD 3DWQA 3MC0B 1LTBD 3CHBD 5ELEA 4L6TB 2XRQD 4RFBA 1BCPF 1XXGA 4NZLB 1DJRD 1LT4D 1LTGD 1FGBD 1PZID 1RF2D 1SJHD 1SBBB 1KLGD 2J4XA 2NTSA 1I4XA 2Z8LA 3SEBA 1D5MC 1EU4A 1KTKA 1T5XD 4RGNA 1YN5A 3OWEB 1LTSD 3DWAA 1PTOH 1SJED 1QILA 3BVGA 1PTOB 3EFXD 4C56C 1BCPD 1HTLD 1CHQD 3R8BA 1G8ZD 1EEFD 2IPKD 3MFGA 1YN4A 1HA5A 1D6EC 2AQ2B 5FKAC 1SE3A 3EA6A 1TS4A 2TSSA 3BYTB 4ZYSA 2IJ0A 1I4RA 1MD2D 4L63B 1CHPD 1TS2A 1RD9D 1LTID 1UNSA 1PZJD 3W2DA 1LTRD 1STEA 3DWPA 2RDHA 4K6LA 4RCOA 2ICIA 4RHRA 1D5ZC 4RGTA 2QEJC 3O13A 2AQ1B 5TSSA 1BCPB 4Z9CB 1TS5A 1I4PA 4RH6A 1PTOD 1PYWD 1S5ED 1BCPC 3R2TA 1F77A 2CHBD 1FNUA 1HXYD 1GOZA 2QILA 3BYYB 1SE2A 1JQYD 1M4VA 1SXTA 1XTCD 5I4DA 2R61A 1CT1D 1TY0A 4DXGA 1LLRD 1SE4A 5ELBA 3BVMA 4UDUC 1FD7D 1LTAD 4RGMA 1AW7A 1DYQA 1JWMD 2RDGA 5ELFA 5ELDA 1LT6D 1CQVA 1LTTD 1S5DD 1I4HA 3V05A 4OHJA 4TSSA 5D3DA 1EU3A 1PRTC 1PRTF 1PRTB
chains in the Genus database with same CATH superfamily
1GUWA 1K50A 4KZ0A 3A74A 4AQYL 2SEBD 2HT1A 5JPMC 3JSVB 1TY2A 1K8GA 1II3A 3Q2AC 3K0XA 3QO2A 5IGDA 4LNKA 2UXCL 3CMMB 3HZXA 4R4QA 3GO5A 3X3MA 3J7AF 4HAEA 5CHVC 4IQZA 4MN3A 3GZNI 2QW7A 4HIMA 1SSNA 2D3GA 3L16A 3L13A 3HKZE 1HNZQ 3V6CB 4MT5A 5FJ8H 3V60A 2K3UA 4LAAA 1EWYC 4QL5A 1T0SC 4GKJQ 3AV8A 1KABA 3AE2B 1CI3M 2NB0A 1MFWA 4DUYL 1SIJA 4GKJL 1JC7A 4O1NA 3T16A 3IVFA 1J8CA 1CZGA 4K6DA 4X3UA 1GPXA 3PRMB 3KVFB 3W5VB 4DV6Q 3Q8FA 3Q3OC 1L0VB 2ZJDA 3NVWA 2CHXA 2XRQD 4DGZA 5D65A 5E6NA 1PZID 1RF2D 4A3MG 2GLSA 2EXDA 2Z8LA 1FMAD 1L1OB 1N32Q 2RHSB 2MWSB 4B3TL 2UUAL 1A2TA 4KK7A 4IM2A 1OEYJ 2UYZB 1Q1EA 3I57A 1K53A 2BDOA 2K5VA 3E9IA 3W5OA 2IX3A 5C4XB 2JZZA 1GUTA 5IY0A 4HK2A 3U4VA 2O5IC 3B2GA 4GKKL 3TUOA 3NQTA 2KVZA 3D6CA 4NJ7A 4K5WA 4JBWA 5M3FG 4A3LH 3IT4B 2JQOA 5DPSA 2DY8A 1UELA 2R6GA 5FKAC 1QOAA 4JI8Q 3DWGC 2X6GA 3PUWA 1W6KA 1XNRQ 1UBIA 2K5WA 1XMOL 2IJ0A 4GLSC 1I4RA 3TZUA 1DOYA 2PQEA 1CHPD 3D0FA 2W54A 5FJ8G 2PLPA 3H8HA 4LF9L 3ITPA 1FXIA 1BT0A 3HOZB 3UINB 4DXAB 3L08A 3FC4A 2SOBA 2CU1A 3T51B 4DN4M 2BWES 2H5XA 1PUTA 4UP8A 4DV3Q 5D14A 5I9PA 1WI0A 5HG2A 2L55A 4Z9CB 1TS5A 3Q0AA 1VJKA 1PYWD 2Z4HA 4R4CA 5JXVA 3N9YC 1F77A 1WD0A 2CJNA 2BS3B 3GTPH 1TJEA 2C7NB 1RODA 2BGFA 4X65L 3IKJA 1C48A 3K7UC 5IGGA 4JOIA 1JJGA 1VR9A 3JAME 1FR3A 4PZ7A 1VCIA 4RAUC 4YY3L 4IFDG 5C3EG 2I0QA 3OMGA 3A0JA 1WJ4A 3A4SC 1V9PA 3EROA 1LT6D 2ZJRA 1Q81C 1E3PA 2KAJA 2ASBA 4S0RA 1TWFB 5IP7H 1HZCA 4DR6Q 4LNFA 1PRTF 3STBD 4HJ7A 5E6PA 4O42A 2XVSA 4PZ8A 1FVIA 4DNIA 3L3OC 3FAHA 2KQ3A 3RD4A 1IBLL 4N58A 4C80A 1LTLA 1NI3A 1IKMA 3N3KB 4PS7A 1XMQL 3PQIA 1B44D 3HOWH 1YD8U 3P42A 2LWPA 2P5ZX 1ESFA 4IPHA 4WURA 4GN4B 5JJKA 2LUEA 2OJRA 3PPAA 3PV0A 4OEMB 4CJ0B 4A3EG 1KLUD 5JHAA 3S16H 4C3JG 2ATWA 3ZUNA 1EZ8A 4US9A 1SN8A 1NI2A 4AYBG 1PFMA 1CKNB 4FJYA 1WY8A 2RPQA 3AE4B 3N1XC 2Y5BB 3TS0A 4LF4Q 4I6PA 2EY6A 1ZOYB 1I94Q 2EJMA 1YBYA 3SXHA 4FF2A 1ZGUB 3ZW3A 1VQFA 1ENFA 2RCNA 3MAQA 4BBSB 1DOLA 2OHFA 1SEBD 1VQDA 4DK5A 4EQOA 1KDAA 1LXDA 4G7HC 5E7NA 1SFOB 1NEKB 1R4NI 1TKEA 1Z7TA 1N36L 5I9OA 2FIDA 1KAAA 3CHBD 4F1SA 3X23A 3BZCA 4IPCA 1B7YB 2ZJQA 2O2VB 4GLAC 1BNZA 1GB1A 1BCPF 4HPMB 2K5NA 4BY1H 4DR7L 1N63A 1QOHA 1XYIA 2NTSA 4F87A 3I4NH 2VRRB 3M63B 2WAQE 3L2PA 3PVLA 5C3EH 5IKCM 1VQEA 1HRJA 4ZUIA 4AQYQ 4P16A 1EIFA 1I5FA 3CXCA 1SJED 1QILA 3W1SA 5ELOA 1AFPA 2NMQA 4DNTB 4E3CA 2ZNVB 4G4KA 3HM6X 4FYDA 2EYLA 1AH9A 2KK8A 2IHFA 1EY0A 3WOFA 4TMAB 4JX1C 2J7QB 1J19A 3CQZH 1G6PA 2RPVA 4DUZL 2LUMA 3U7DA 1TTNA 1HJPA 3EFUA 3PMFA 1VQ5A 1WFQA 3QJZA 4X64L 2JE6I 1WZ3A 3NS1A 2YTXA 3BINA 4AH6A 1Q1BA 1R4PB 3AH7A 3VDYA 3Q3FA 3D32A 5IP9G 2BA0A 2IY5B 4KN4C 4Q5VA 2KYWA 1CZWA 5EJWA 3TIXA 4KHVA 4DF7A 3O65B 1Q46A 1MSGA 4EX5A 4JWUC 1VF7A 2QDFA 1X56A 4JI0L 2MJEA 3PZ8A 4C2MB 4BY7H 2KHSA 2QIEB 1S5ED 4CJ1B 3DUZA 5G3LF 2R7ZH 2IO1B 4DAMA 5JVG3 2EQSA 4K2LA 2F3IA 2DNCA 4A3GH 4YWKA 3RZWC 2KACA 4B9KA 3HOYG 2ZPNA 1L6UA 4NPNA 1MPEA 3NZUA 1PYSB 1QKZA 2V3NA 1BOSA 2W82A 4GZYC 4UDUC 2MGSA 5FLMG 1FD7D 4DAPA 2D2QA 2IY0B 2L3ZA 3NZSA 3SR1A 5C4XG 1PGXA 1JQ4A 2RDGA 5EBCA 3A5UA 5AUKA 3CW2C 1XPRA 4JI2L 2LXKA 3T3OA 4OHJA 2ZJPA 1D1KA 1OXXK 3PREA 2IDYA 4N8FA 4ZQ3A 4JYAL 1J7BA 3SD5A 4MH0E 5IOCA 3VFKA 1R7SA 3CCMA 4PMCA 3F2DA 4AWJA 3LWUA 1RDPD 2AX5A 1K3RA 3HHMA 2K03A 4M02A 3Q8BA 4MACA 2QMTA 4QY7A 3P7JA 3QOJA 3J7AV 2BS2B 4BBSH 2BTEA 1GG3A 3CSTA 3W1GA 5LHY1 4GXBA 3N1ZC 4BBNF 2PTLA 1GUAB 4IM0A 4DXFA 5C4HA 4KDLB 2YVCA 2JA8H 4LF7Q 4F7ZA 2KDIA 2B2VC 2XRSD 4TRDA 3PRZA 3TEXA 1JWSD 3VR3A 1VQCA 3U2SC 3SVMA 2X38A 2XNAC 5JJZA 3URYA 1Q8IA 3HOXH 3CC7A 3ER0A 4CDCC 3H3VH 4JC0A 1HEZE 3AB5A 4HVBA 4CKEA 2KT7A 3H9DA 1FNWA 1BBUA 1V1QA 5AJ3L 1ET6A 1QNKA 2VUMH 1LV9A 3VR9B 1FJGL 2LGIA 2F0OA 5CHFA 4YCUA 3A4RA 2WKDA 2WGSA 4HRSA 1KRHA 4BAXA 1U9RA 1VF5C 2Q8IB 3BWUD 1VQMA 1BBWA 1VQ4A 3A1QA 1OGWA 1P7FA 1FL0A 1I35A 5C3WA 2N9PC 3P2BA 4J6HA 3AEFB 4I65A 3GQBA 1I4XA 1KRTA 3CC4A 2IO0B 3NPPA 1NYQA 1Q12A 1J7AA 2M0AA 2LXAA 4XYOA 2MBHA 2MEKA 3OWEB 3VUYA 4LF8Q 2IO3B 3GTJB 2JEAI 1PH1A 3DBHB 5H8YE 5M3FH 4A3LG 1MHHE 4QMGA 1CZPA 1I42A 3H7SA 1EEFD 1MJEA 1GNUA 3Q6SA 3ABVB 4MZ9A 2AWOA 3H1UA 2A73B 4AOFA 4YL8A 4PS8A 1VMPA 2SAKA 1SF0A 5KYIA 2L9HA 4A3IB 3AE1B 2WDVB 1YZ6A 3PO3H 2GI9A 3EIVA 1TS2A 3ENEA 4LJPB 1WGRA 5FLXL 3QG1A 5COYA 3IFDA 1UBQA 3ETRA 1N61A 1C78A 1YIWA 3RNEC 2WAQB 2EYPA 1B3AA 2EYOA 1XPOA 3RMHA 1TWCB 2HTME 3I72A 2L12A 2NN6H 3QAQA 4OWTB 3ZNHB 3CU7A 2DJFC 4A9AA 2BB6A 3ZYYX 2GN5A 1IBML 3LYYA 3J80E 3Q22A 4ZCKA 4JBJA 2L1BA 2KQ4X 3NXWA 4G0NB 4BBSG 3F2CA 1SROA 2IYDB 2K22A 3I63C 4G3XB 3RNBC 3SK5A 1RYJA 4A55A 3AMZA 5CMDA 2R61A 2CCZA 1RIPA 2UXDQ 2PNHA 1Z9FA 3J81c 3BY4B 1RWSA 3L4PA 2YV5A 4DV4Q 1BUVT 4K3BA 4LFAL 3NTIA 1FFVA 4IPDA 1XT9B 3HOZH 4R8NA 1YVCA 2A6EC 1QVGA 3S15B 1HH2P 1QQRA 1WGDA 2K1FA 1WTXA 2W55A 4D2KA 1I4HA 3DQVA 3F1ZA 2MBQA 1VQGA 1L7YA 1EU3A 2VQFL 4XE0A 2VXWA 4LF9Q 3WAMA 4QUFA 2EXZA 2A8VA 1YJ1A 3U4EG 1DCZA 2MSED 2WXHA 3E3XA 1XCQL 4C00A 3NY5A 2HIXA 5EPJA 1T6BX 4DDID 2LGXA 3L54A 2D10A 2K6AA 3I4OA 2QC8A 4BBNC 4GOPB 4CKBA 3I9V1 2NS5A 3Q23A 2Q2HA 2LD9A 4ICVA 4W9KA 1LACA 1LM0A 3ECIA 1RAXA 3GS2A 3I55A 1RHPA 4WAAA 4OZAA 2BW2A 1X3PA 4KI0A 1WTPA 1NBWA 2E2HB 1PH9A 4ZRJA 4YSXB 3CRKC 2HDMA 2DY7A 3NBHA 1A15A 3MXGA 1VRAB 1GVPA 1E10A 2E2JB 5M5WH 4M8NA 3G48A 4DUZQ 1YN3A 4F7XA 4DV1Q 4WQMA 3MTNB 1I4QA 2VB3X 2J0KA 2N7JA 3TEWA 1VQHA 2KVMA 2B8FA 2MHVA 2OTLA 4C3HH 1XNRL 3S15H 4FF4A 4DHZE 2K8HA 5D2MB 1X1MA 1C1YB 3D3RA 3FILA 5DPWA 4JGHB 4OW0A 3NSWA 2EY5A 4MGIE 2EYMA 1MIUA 4IOAA 4URKA 5EKLA 1D3ZA 1T0QC 2KA7A 2F0EA 3RNAC 4I7ZC 5EE9A 4II2B 4WWOA 3QIJA 5DNFA 5JPNC 1T5XD 3BDLA 4DV7Q 1AYFA 2IHEA 3WWVA 4KKIA 2NBWB 4WJNA 3BVGA 1EQRA 1J9OA 1EWIA 2J7ZA 1CFMA 4C1NI 4ZKCB 3NVVA 4NDXA 3QWZB 3BIID 1V5OA 4B95A 2LSSA 3GTLB 4JE3B 3A7AB 1N33L 3RMKC 5LMUL 1QE6A 2F0UA 3IL8A 1Y1VG 2WP9B 2UXCQ 5C0XI 4ITKA 2BH2A 3EBEA 3CKIB 1IL8A 1SE8A 2M17A 1E7ZA 5IYDG 2VNUD 1IYUA 5CX3A 2L83A 1LTRD 2JN4A 2NCNA 2N9KA 1IHZA 2DN8A 4PQXA 4EVOA 2OF1A 3SGIA 5E4WC 4Y7NB 3AFPA 1DONA 3J80i 5M3MB 1N34L 1D7QA 1O7ZA 1Y1VH 1TWGB 1ASZA 3S1NB 4A3BB 3T8MA 3I2ZA 2N9LA 2JA6G 2WXIA 4DR7Q 2B2UA 1AP0A 1R4MB 4HWIB 2LZ6A 1KDBA 5M3MH 5JEAH 1YX6B 4KMUC 1EIHA 3WDNA 4L5RC 2BE5C 2KDEB 5A2QE 3V61A 3MC9A 1IBMQ 4JV5Q 1FGUA 4GS3A 4LF4L 1E2VA 3I4MH 4PMBA 4L5SA 2KANA 2RA4A 5F2DA 4KGSA 4LLGM 3ZDTA 3VUXA 1N6ZA 5GAGC 1PH7A 1E8WA 1NAPA 2F0HA 4DR3Q 1XWEA 4N9TA 4OIJA 3UIPB 3FPUB 3WALA 4EQNA 1CA5A 3BVMA 1YJWA 1WE6A 5LMNQ 2CJOA 1MKHA 2H1EA 1OXSC 2VH1A 2WWZA 5LL6S 1F9QA 1LTTD 1SYEA 4NXML 1N33Q 1XPUA 4BOSC 1WH3A 1PMRA 3U58A 3S2AA 1G2TA 2XGTA 1KL9A 4B3SL 4C4VB 2Z1CA 1VZ7A 4RKBA 4CHTB 1E0BA 3RLOA 1JOQA 1NVID 4IOIE 3GTGH 4RWSC 4NPSA 3VDZA 2Q5WD 3FMCA 1SMYD 1NDDA 1X6OA 2J0JA 1Y1VB 3W3AA 2PW9A 2ZT9C 4MTNA 1WR6E 3AYHB 3BVZA 3MA2B 5EE1A 1B4OA 1B9MA 4C3IG 3HRDD 4DQOC 3UF8A 1QZEA 4ANVA 1VDVA 1JW9D 2KX3A 5C23A 5M9OA 3JC66 2HJ1A 5CR3A 1TWFH 5IT9L 4IDIA 4MGKE 1QOBA 3F2UA 1VQPA 1TKWB 2MNAA 3R66C 4PZ6A 2PW5A 1KLVA 1KNEA 4LK0M 3KK7A 3S1MH 3M4OH 3WAOA 1TXYA 5BR8L 5G2NA 1TGZB 1LT5D 2YYZA 4IALA 4FP5D 4MGYE 3GD7A 3WCQA 1EQTA 2AWNA 3MXNB 1FCCC 4X65Q 3M62B 3PF4A 1EWCA 4CJ2C 1WM3A 1N9WA 3UDIA 1ONLA 2A4ZA 4JWSC 3I8ZA 4A76A 1AN8A 4XIGS 3P4SB 5E1FA 1O7IA 1WM2A 2A5UA 1H9KA 5KRUA 1TT5B 2GBNA 1JRPA 5IE8A 1LT4D 2UUAQ 2CKZB 3G6JB 2WP8J 3OIQA 1PV4A 2HHHQ 3D4WA 1C7YA 2WB1G 2KJ6A 2WXNA 1EYCA 3OOCA 2L5TA 3KH0A 3MEHA 2ZZPB 1HUNA 3VRAB 1PTOH 2NBVB 4US8A 3APFA 1TKGA 1Q5WB 1JJCB 4ARIA 3HFZB 5HY6A 4HIOA 1WRIA 2BYFA 2DWQA 2Z4IA 5J18A 1GO3E 1E2ZA 2IPKD 4ICUA 4O2DA 4YHHQ 1WX9A 3Q6BA 4OVVA 4XDXA 2KEEA 4RMFA 3RD2A 2LGDA 1VZ6A 5IN7A 1TWAH 3H3VI 2E6XA 4JI2Q 1YNXA 2EDGA 2LEKA 2K1BA 1GUSA 2HE7A 3W5UB 1LTID 2BYEA 1RTOA 3W2DA 1XEEA 3AU5A 3L10B 4BOZB 2LASA 1IXRA 3SFEB 1A0IA 2FCSA 4A8XC 2AHOB 3CCJA 2LFIA 2ONQA 5GXGB 2JP1A 3KWLA 5CORA 5EPKA 1PH4A 2SNSA 2MJ3A 1S72A 2ICIA 2YLMA 3BU2A 1O80A 3C3LA 2B76B 3ZTDA 2Q8RE 1TBEA 4OX9L 3GTMH 3KJOA 2B63H 4NW2A 3LGJA 4BKTA 4YXDB 3OJ3A 4N9F4 1EUJA 2QCZA 2BS4B 3S2DB 4DPGA 3LDZE 3W9CB 2EYFA 5IYCH 2KOXA 4AUQC 2RCFA 4DK0A 2QILA 1WXSA 2D11A 4TUUA 2KCNA 3ZVVA 4USAA 5D94A 2E5LL 4EZJA 2F1MA 3ULLA 3QC8B 4WWMA 3SR6A 5HFYA 2FFKB 1GKHA 1TY0A 4B08A 1VQ6A 1UWXA 2LJ5A 2V3PA 3QQ8B 1LLRD 1K52A 4P7IA 4A93G 3GV3A 4YWGG 4R3DA 4A3PA 2K75A 3UDXA 2KJXA 4RGMA 5C4ZA 2JSVX 4RF1A 1WMHB 5ELFA 2M1MA 2NBUA 5L95C 1CQVA 2KWDA 3R3MA 1R9TB 2RSUA 5IT9E 1ZXHA 2N7DA 1AWDA 4IUUA 3PUXA 3M4QA 2WU5B 5EPLA 3I4NB 1D1IA 2D3BA 4OELB 3PTFC 2BQQA 1X54A 5BR8Q 4A3KH 5JEAG 5JEAJ 4LNOA 4P6VF 2N0SB 1K3BC 1YX5B 4KSLC 1QZHA 3PO0A 2PZWA 3CSFA 4JK1C 3KDFA 1WE7A 1B9NA 4FDBA 4DHZB 3M9BA 3IT6B 5JOBA 3W1SC 2I38A 1I94L 1ILPA 2DNEA 1DXMA 2PI2E 1R9TH 2XN9C 1A70A 3A9KA 2LRUA 1E9MA 3D4RA 4N9PA 3OYYA 1A63A 3N1YC 1EWHA 4KHPL 1PDXA 2C7MB 3HUIA 3T3NA 3I4LA 1SE9A 2KBNA 3HKZG 2KZRA 3ZNGC 3A5ZB 3HOXB 2DJGC 1IKLA 3P4RB 2WB1E 1JCKB 2MA9B 3BS1A 2G4SA 2LHEA 1VQ8A 2JYEA 3QJYA 1ML0D 2LXCA 1STYA 3PIO3 4ZUJA 2LS01 2KCTA 4WJWA 1PZKD 2BDNA 2R93G 1IGDA 3H09A 2PPHA 1OEYA 3DOWA 4HJAA 2C5CA 1HTOA 2KQSA 4HDQA 2JA5G 4HCSA 1AARA 2F0FA 1B9RA 3NVYA 4HCPB 1Q8KA 1FGBD 1HZ5A 3NQIA 2L00B 4M01A 2NVTH 4P1CC 2B39A 3G6EA 5D6JB 3K59A 3KF6B 4BKSA 3DHQA 3OPOA 2GMIC 3C0RB 2V0GA 3DM3A 3DWAA 4A3GG 4A3CG 1CKOA 4C3HG 4A4IA 2BT6A 2KFKA 4W9FA 3KBGA 2GOWA 1OTCA 1QNUA 3JAMc 2WXKA 3ONAB 2RHQB 3VUWA 4BBRH 1IBXB 2F0NA 3I56A 3JAML 2R7FA 4TQ1A 1HA5A 5CTRC 3Q8DA 3BYTB 4B3RL 3L0OA 1BUIC 1KRSA 4LF7L 1DZ1A 1DGJA 4IFDI 2E2IB 4DV2L 3DBSA 4W9IA 4REZA 2JYOA 2VY3A 3R7RA 2RDHA 3RNGC 2F0LA 2JWUA 2E2IH 1X65A 1G2SA 1CUKA 2K04A 3PUYA 5IIFA 3CAMA 4UHVA 2V4LA 2RR9A 4NJCA 1CSPA 2HCIA 4DFAA 3V96A 1BCPB 2RBMA 2MRPA 1I4PA 4AIMA 4BY1B 2ZW1A 3QHTA 3Q8CA 3GTLH 4HPPA 3K9OB 1GOZA 2BH8A 1JT8A 2MW5A 3G71A 3B2FA 1TIFA 1HTPA 3EUB2 4Q2JA 1YIJA 3H0GH 3UE0A 2J42A 3HOVB 1C4PA 2KTRB 2CR5A 5EGTA 2L32A 1A8VA 1LTAD 4FHJA 1RFKA 5KYLA 4XZ4A 2FINB 2A1AA 3BJUA 1Y8PB 2EZVA 3G7LA 5KHOA 2WKCA 4JI6L 1EF1A 1GD7A 2L0CA 2HIVA 4F8CB 1TWAB 2MPMA 1WYDA 1PRTC 4CO7A 4L8JA 3NHHA 2B2VA 2K5QA 4ULLA 2F0SA 5C3XA 1YI2A 4JI3L 1I6HB 3VYUA 1ZUD2 5CHWA 1HHVA 1K83H 5BN5A 2QEXA 5M3FB 3AFQA 4FN2A 3RT3B 3FVQA 3TQYA 1ENAA 4IURA 4MELA 5FO7B 3FKIH 2ES2A 4WJQA 4YTMB 4OONA 5J17A 2WX1A 2Z59B 2WXGA 3PO2G 4BXXG 1B3QA 2M8SA 1I3QB 1F9SA 1V43A 3J9CA 2F0TA 1BDOA 2J0TD 1WCMG 3M7GA 1NBFC 2FUHB 1NR2A 5IP9H 5C2TB 2H89B 2W3SA 1UF0A 4DV7L 1P98A 1WMHA 1EY6A 1H9JA 2EVBA 2EYHA 4A3FG 1QB5D 1C3TA 1B50A 4XT3B 2E3TA 1V9JA 4KLKA 3HOVH 4KV2A 4B3SQ 3QWNA 2JK8A 4XGAB 3WA0A 2YU9B 2A68C 2O5JC 2N1VA 3AU4A 1A3TA 4ID6A 3KYDD 1F9PA 2UXBQ 4ILWA 2JZPA 3TMPB 4N6EB 3FKYA 1WVLA 3OG5A 1L2FA 1TWGH 4DV5L 2KHWB 2PW7A 3A1QB 1PYBA 3HOVG 1VCBA 1ZXTA 5LMNW 1I6VC 1PH8A 2OXPA 2AL6A 1Q90A 3VHTC 1SJHD 2KLGA 2YEPB 2DLBA 3RLNA 2B2UC 4EQPA 1YN5A 2KN4A 1HR0W 5J2RA 1PFBA 1HE8A 4KY5A 5JH5C 5I2XA 3VH3B 4ODGA 3ONSA 2BYTA 1ZKHA 3X3NA 3ZIMA 2JA8B 1XD3B 1AE3A 4MM3B 1JROA 4DR4Q 1YNJD 4A3CH 3D31A 4NQLB 4EQ5A 1XJVA 2K0PA 1QUQB 3HVDA 2DENB 4QIWB 4G7ZC 1X3EA 3QA8A 2V1YA 2NZOA 2ENBA 4IO9A 4S3SA 3GTKH 1B2TA 4IW0A 5CV7A 3NG0A 1C4AA 5H92C 2K39A 4ME3A 3HOUG 1TU2B 1LUZA 1SYDA 2AUJD 2HHHL 3CRLC 4JQWC 4KSKC 2BVCA 4OWWB 4X3SA 2VZKD 5CV6A 1CA6A 3H0GG 1VLBA 3IBEA 4QIWE 4IZ8A 4NB3A 4R4OA 5EAYA 4ZRZA 3TEHB 5GQOA 1I6HH 2HDEA 1N5XA 3U4ZA 1HXYD 3BYYB 3CWIA 2WXFA 1G6JA 1VZ8A 3PLUA 1M4VA 2C9OA 4IJLA 1EO6A 5I4DA 2KD0A 3KLRA 2GBRA 2ZTCA 2F0QA 2JA5B 3GTJH 4YSYB 1UE1A 4K0KQ 2Y0SE 3GDEA 5ELBA 2QA4A 1EL0A 4K5XA 3T1HL 4TKNA 3VVWB 3SU8X 2JRIB 4AS1A 3HS0C 2PE6B 3EQLC 3JW0X 4K0KL 3ML8A 1KH0A 3ZNID 3V3XA 1S40A 1WSPA 1C0AA 4NXNQ 3MC8A 2LMCB 3M85A 2QDLA 2QKIC 3NP8A 2K50A 3SHLA 4CGYB 4A3JG 1Z47A 4CDEC 3S2HH 4PG3A 3B08A 3TP8A 1N62A 2AL3A 1FEHA 2F0IA 3I5JC 4A3DB 1EZ6A 3U9SA 2AKWB 2ZM6Q 5KHQA 3A8JE 4A3IG 1V6EA 3GE3C 4DKAC 4GKKQ 4TQ0A 1TWCH 2REXA 2WV6D 1V1PB 2V4DA 1PTOF 5ELCA 1XCTL 4M8MA 4PK1A 1SMXA 5BYSA 2VQEL 3H7PA 3FEWX 1RTNA 1LFDA 4F88A 1DGSA 3PGZA 1BXTA 4KKJA 3TZDA 4GN3B 3NVZA 1FD6A 1P0RA 1B1ZA 4LUOA 2AQ3B 1TS3A 3TSSA 4AQ7A 2HQEA 2EMSA 2J52A 2NPTA 1VQOA 1X3FA 1QVFA 2FCMA 2M4NA 2XK5B 5G5GA 1ASYA 1GAQB 3GTGB 1Q0WB 3DHGC 4B3MQ 4FO2A 3PRPB 1WGHA 4IC7B 1K8AC 1F2YA 3ML9A 1WGGA 2JA7G 1QUQA 4QF4A 3RFZB 4M00A 2G9HD 4FXCA 3S1QH 5AJ3Q 1EY5A 1YEZA 2R2OA 1JE4A 4CDDC 5JVH3 2DNFA 2FCQA 4G11A 3FDTA 4OX9Q 1F1HA 1I7HA 1ZP0B 4P2CB 4JI5Q 4DHJD 1WCMH 4K8JA 3CCSA 4FF1A 3DLLA 5C4XH 5C4JH 3SEBA 4QAYA 1KIXA 2GA4B 3VTUA 4C7ZA 2L05A 3ZJYC 1JB7A 1D4BA 2NUCA 3VYSA 1YITA 3QX1A 3SFDB 3RUIB 1SLJA 2KFJA 3J81E 4HEA1 3R8BA 4GNXC 4K81A 4JI0Q 5C5MA 4M1UB 1I50B 5M5YH 1YJ9A 1TT2A 1Y1WB 2D0OA 1SMYC 3MFGA 1LM8B 1WJ6A 2GBJA 2ZTDA 1WCMB 2K4KA 2LXJA 1TS4A 1PGBA 1MJCA 1Z2MA 3PO2B 3P20A 3H94A 3H15A 1RRBA 2L0FA 4CHKA 2FMMA 5G5HA 4HN7A 2JF5A 4KZCA 2EOTA 2I5MX 1IYJB 4C3IH 4JI6Q 4Y52H 2FHTA 1MSHA 4B0MA 1ESRA 3HGBA 4GMVA 3MXPA 5CYUA 3GTMB 1MG8A 3KQ4A 1AZPA 4J6IA 4DR2Q 1NY4A 2UUBQ 5I2YA 3APCA 4IWQA 3AEEB 4W9DA 1VQ9A 2VUMB 3ZRCA 4JI3Q 3GTPB 4RKLA 1SSOA 2AQ1B 2CS4A 2Y0SB 1E1OA 2IY1B 2WACA 2DUDA 1XNQL 4LNNA 1R4NB 4ZRPA 2ZM6L 1EUVB 2K5HA 1MHWC 3HOYB 2VS1A 3JSVA 2F0WA 4HJ8A 1JQYD 2MLBA 4HLEA 4JOIC 3CPWA 5HGTA 4I6LB 2JU6X 4IUTA 1WR1A 1RM6C 4DXGA 1VQ7A 4WJ4A 2K5DA 5C44H 4DR5Q 4A90A 4B0EA 4NAWA 1BR9A 2OT2A 4K7UA 4OVUA 4B9XA 4KKSA 3OLMD 1TWHB 4JI7L 1DYQA 1E5WA 1BO0A 5IGBA 1EF5A 3AE8B 3K5LA 1WGKA 5C44B 1MI0A 3NE5B 2CQOA 2CWPA 2N78A 1TKYA 3SK6A 1PFSA 3TP5A 1L1OC 2K6DB 2MP2B 1ZYRD 4KJNA 4A3IH 2DZIA 3BG3A 4KHZA 4C1NK 4F8MA 5IGFA 2JQRB 1ZPSA 1EY9A 2K9XA 2LI5A 3K0YA 2LVPA 3ZJTA 1ILQA 2L8JA 2VW9A 1EQQA 2HTHA 2MJDA 2X8XX 5FLXc 2QHOA 2NVTB 5DPRA 2KFKB 5IWAQ 1H4RA 1WRDB 2G5DA 1Q3LA 3RUZA 3RN5A 3P63A 2KWVB 4HDOA 5ELNA 3E0EA 1VD2A 2DAJA 4RA8A 5DM63 4HKQA 4LDTD 1D2BA 2EELA 2L15A 1Y14B 4LUVA 2WNMA 2YTVA 1IBKQ 4B3RQ 2Z0EB 2MO0A 3M4OB 1SAPA 5DCNA 4W9HA 5IAAC 2WDTB 1PFNA 1P1AA 3WOEA 1PHJA 3E56A 3RZOH 2F0PA 5CC4A 4ABNA 4DV2Q 1TYGB 1XQQA 3AE9B 3ALBA 4IN3A 1SRUA 1PH5A 1RFAA 3B0AA 3UQAA 3AE7B 2INPE 3JAMi 2RF4A 1ISNA 1GC6A 1GJXA 1IL2A 5FLXE 1S3OA 1ZW7A 2BBCA 2LVOA 3FKIB 1G6ZA 1JWAD 1JE5A 1LTBD 1EOVA 1MG4A 4L6TB 1HR0Q 4XT1B 1E8XA 2OJWA 4ZRKA 1VQIA 1A62A 4LW1A 2WS3B 3CCEA 4NZLB 2H4OA 4L1BA 4K14A 4O0AA 2F0DA 1HUMA 3RZOB 4KHPQ 4L5QA 4JI7Q 2DZJA 1D5MC 3ERSX 4HCNB 1KTKA 1X55A 4NXMQ 1LTSD 4B6WA 2R92B 3AMUA 2A19A 5IWAL 2OOBB 2NPTB 1H8CA 1J5EL 1Y8NB 1WIAA 3E9SA 1G8ZD 2A5HA 4C7YA 4K5VA 2IGDA 1R4MI 5J22A 3PS6A 2D5GA 2B8GA 4G50A 4IWPA 2UXBL 1ICFB 5J1ZA 1F2LA 1F2RI 3DBRB 1XMQQ 4MSMB 1Q86C 5IP7G 2WLBA 1W3SA 2RDFA 5GADC 3M3JA 3OW2A 2IWHA 3MFYA 4HKZE 3D4DA 2OEDA 4CYEA 3K6OA 1XMOQ 3HP3A 2PJHA 4Q0FA 4LNIA 3NZ3A 3WIMA 2ZTEA 2JT4B 1PQSA 3J81i 1ACCA 2SDFA 1WJNA 3VR4A 3SK4A 3K57A 2LMCA 3A8KE 2EYJA 2UU7A 1TIID 3TS2A 4ZHOA 3R3OA 5E4XA 1O7YA 2R7ZB 4OO1G 2AEHA 3LWEA 3K8AA 1PTOD 2IGHA 4MJSB 3R2TA 3JYUA 1H9MA 1QF6A 2L1AA 2MX2A 1QLBB 3RYTA 5KIXA 2A74C 2F52A 1N60A 4P74A 4HMIA 1SXTA 2EMTA 3ZGZA 2ZCCA 4A93B 3H91A 3GB1A 1BQQT 4W9LA 1FCLA 2KQ7A 2K01A 3I4NG 4GOCA 1LABA 1K28A 3QARA 3J80L 1JWMD 3J81j 4WWNA 4IUQA 5EQ0A 2CWAA 1PFDA 2ZVNA 3B9JA 3NS8A 2CFMA 3J7ZC 2INNE 4XDCA 1R4QB 3NWTA 2UUCL 5C44G 5IGEA 1K0SA 3RR5A 3AI5A 4LDTB 1H9SB 1X3GA 1WXVA 4NQKE 1EEID 4DA2A 3S9WA 2XK5A 3KDFB 3SE0A 2MQJA 1EIGA 2YEPF 4PYZA 3AECB 1NJIC 1WFYA 1JMCA 4IOCA 2I46A 5FR6A 3RI7C 4JPBW 4A3KG 3I70A 3OHXC 3TN2A 3H7PB 5IOIA 1E22A 3S1NH 1V86A 3DVNU 2LGYA 1RJTA 1YJIA 4ZKBB 3S2DH 3R7QA 1JWUD 5FR3A 1L0XB 4X3TA 1S1QB 4YT0B 3P1MA 3CCUA 2Z9HA 1KC8C 2MHJA 1PA6A 3H6MA 2YU9H 1NR4A 1K9MC 4A93H 2PMVA 2JY6A 2MBEA 4MDKE 2NR2A 1Z5SB 3GE8C 5EE0A 2EPBA 3C8YA 4OO1I 2E2DC 5LL6X 1OXTA 2F0KA 3UQBA 2NZ1D 4L5TA 4KKUA 2WIIB 2D5DA 2PZTA 5T1GA 4GNXA 1TZOA 1F9RA 2H88B 3Q69A 3U30A 4A20A 1C8CA 1XO3A 4WH4A 1KAWA 2NN6I 2W3RA 1LQBA 3A55A 3ZXRA 5G55A 4DAYB 2MH7A 2G45B 2RQXA 3SDLC 4ZHPA 2KJHB 1HZ9A 1K8MA 1V8CA 2B2YC 3M3YB 1IYVA 2MP2A 1IYFA 1DOKA 4H7BA 3RN9C 4U673 2OTJA 4WJOA 3PGEA 4HJ9A 2CU3A 1W6JA 2QDBA 2L7RA 4OZBA 4GSWA 2AUKA 3EFXD 3ZLZA 3TBLD 2KDBA 1U0LA 4LFAQ 3I3TB 1X9NA 4BZAA 4LF5L 2KO3A 2CHZA 3GTOB 4P71A 5J39A 4GLXA 1F52A 2F0JA 2FIFA 3MTSA 1E6EB 2QSDA 1SE3A 4WFN3 4LFCQ 2RD0A 2Y5CA 4W9GA 2TSSA 3PIP3 2MO1A 5CV5A 4GGQA 5BYQA 3VTWA 3LJ3A 2Z0SA 1QOFA 2KDMA 3PV1A 3Q14C 1SYGA 3KW5B 3NELA 4OZCA 3RPFC 3DDCB 4P1BC 4FHKA 2K14A 2BKFA 4RHRA 4W9CA 3OTOL 2Q2UA 3DVGX 2XBBC 2FJ2A 3C46A 4YCVA 4DHJB 2ACZB 4HSVA 2QEJC 3K7AB 4GLVB 5EBDA 4LJOB 5AZFA 5JJIA 5LXHA 3NENA 1I50H 3QIAA 2A69D 3IXSA 2JWZA 1U4RA 1WI5A 4BVUC 4J3OD 2W9NA 4W9EA 1XLOA 1A3UA 3F8TA 3I7FA 2KENA 5T1IA 3ZDMC 5C0XG 4YCWA 3ZXVA 2L11A 2ALYB 2NN6G 2FBWB 3AE5B 1JB3A 1UZXB 4JPSA 1FO4A 3GTKB 2X6LA 3W1BA 1H9RA 2KOLA 2MUYA 3KOJA 2WXOA 4XWWA 1UWMA 1HNXQ 2RDBC 3GOEA 1XTDA 2NWGA 2Q8TA 1V80A 1NMFA 2V1CC 3H6NA 4RM8A 3S2HB 2BYVE 3J7A5 2PI2A 4LNQA 3PCOB 3APDA 4IJHA 4MM3A 2E8GA 2A6ED 4A3EB 4ANXA 5GMVA 4AJYB 1TQOA 1CK1A 2Q2IA 1TZ1A 1WZ0A 4CBVA 3Q3JA 4EEWA 1VQJA 3OSOA 4RGOS 2JXXA 2RVLA 1HPCA 3ZO5B 1SR3A 2PNRC 3IAYA 2RMMA 3IFWB 5IODA 2N8NA 4L23A 2IW3A 1FNVA 4A3BG 2KC2A 2M0XA 2K6QA 1LT3D 4JI1L 3MZ5A 4DR1Q 4ZDVA 3M3YH 1JORA 3FP9A 3CF6E 1KJTA 3I91A 3VTVA 2K05A 2EY2A 1CQFA 5J3BA 1C79A 2E2JH 2KDFB 4RHSA 3VRBB 3RNUA 3HOWB 3EGRA 3ZQ4A 3DMUA 4ZRIA 5TR5A 5LNK1 3I90A 2HUGA 3TL5A 3ULJA 2FCNA 4KGTA 2EIFA 4ZLTF 4WRDA 5IYCG 3P4PB 4GIVA 2SNMA 4R9WA 4G57A 3DWQA 1STAA 4P75A 5FO9B 5GAHC 4PNYA 1WTVA 4ACFA 2VZKB 5C4JB 1IZ6A 2I1KA 3T1YQ 1JOKA 2DX5B 4X6AH 2TMPA 3MVVA 2O6VB 1GUNA 1N5WA 3VXWA 2J4XA 2J0MA 4PS3A 4X66L 2CHWA 1PGAA 2NBFA 4KN7C 1EU4A 4RGNA 2Y5PA 5E6JA 5NUCA 1HFNA 1YNNC 3DEOA 4LF6L 1L1OA 5G3LD 1FIQA 1JWBD 1PTOB 4EKUA 3MWYW 4C56C 3HVZA 1WYWB 4UP9A 4EUTA 1NMGA 4UP7A 3R93A 2C5LC 3KLSA 2KEDA 1GC7A 2WXMA 4DBGA 1WOCA 5CV9A 1K0RA 2KUMA 3ICEA 1J7CA 2VQEQ 5H1SE 4WORA 4QGUA 4ZYSA 1PXUA 1RD9D 4LUZA 5A2QL 1IW7C 1QZGA 4BY1G 4E74A 4IPGA 2UUBL 3CD6A 3PT2B 4MGZE 2R3ZA 1HFGA 1YHAA 4HMJA 2CH4W 3M7NA 2A69C 2DYBA 4B3TQ 3U7ZA 2WINB 4A3BH 4J15A 4A3FB 2B29A 3HOWG 1DM0B 2D3AA 3HOYH 1XLPA 5TSSA 3LXFA 3TBIB 2K8CA 2JSOA 3NJTA 2JRHA 5BMGA 2CH4A 4JG2A 4IUPA 4KX6B 4WJPA 2BCOA 2VB2X 4BA1I 2CHBD 2A68D 4HR7B 3HEJA 1NSNS 1SE2A 2LHDA 2N3SA 2GB1A 2ZXRA 4XYCA 3DWMA 3K5NA 4XQNA 2DZMA 1CMXB 1FRDA 5M5XB 3CCVA 4A3OA 5HURA 1NNXA 1SE4A 1VS0A 2I5LX 5EKKA 1YNTE 2DZKA 1YJNA 1STGA 3A9KB 1SYFA 1SNCA 1WXMA 5K5PA 4UY8C 1F2RC 3RZFA 4K8IA 1H95A 5BMHA 3S16B 4W9JA 4X3KA 2WB1B 4UAIA 2ZXOA 3BZKA 3PHWB 1ZKOA 4C2MH 5C0XH 1SYBA 4LFBL 4ME5A 4I6NB 4K7WA 2BA1A 1WYGA 2Z6KA 4WAFA 1YMHE 1Y8RC 4DV3L 1UH6A 2KWCA 2OQKA 5GROA 2XSCA 4KY6A 4NNJB 3PIOA 4LCDE 5JZEB 4GB9A 1YJJA 1PLFA 4R1JA 4C3JB 1SNDA 1EFWA 3T4AC 4LTUA 3RCZA 1V1PA 1MI2A 5M5XH 5GAEC 4BFRA 1N36Q 1L4ZB 4GNXB 1FXTB 2M56B 2F4IA 1WTRA 5BN3A 5KNCA 4L2YA 2UWQA 4ANUA 2FUG1 2IX0A 3MHBA 3QOLA 3CCRA 3RZDH 2FAZA 2K5PA 2PIAA 1UEBA 5K36G 1E1TA 1L0YB 4TKOB 3UI3A 2JPHA 1WTOA 2B2YA 1J5EQ 2PMZB 2Q2TA 2KMAA 5LLIA 3A33B 2JJQA 5BMIA 1Q10A 1J6QA 2N88A 2XWBB 2KTFA 4JBMA 2KJRA 4KVGB 3S1MB 3DVNV 2JA5H 1GUOA 1DOXA 3D8GA 1L0WA 2Z0DB 2F4VL 3N6RA 3A9JA 1PRTD 4DU9A 2IO2B 2NVQH 1RKNA 2DHZA 2KMCA 5JHBA 5AZGA 1WTWA 4BBRG 3AN1A 4S17A 2JA6H 5BN4A 1N8RC 1Q82C 4LF8L 1QOGA 3T9LA 4PT5A 3S1RH 4LK1C 4HROA 2ASQA 3OIPA 4NAWB 5ELEA 4OXPA 2DAFA 4ASWC 2IX1A 4RG1A 2HD3A 2Y3AA 3BDCA 4DV0L 3S1RB 2BPSA 5IT9c 4DV5Q 2JA8G 2KCMA 1V49A 3A8IE 1IGCA 1CKNA 1UE7A 3OTOQ 3T53B 3X0WA 2I07B 3ERQA 3J81L 4MTKA 3UDGA 1GHKA 4H44C 4B9WA 3PO3G 3MXUA 2IBIB 1JICA 4V0BA 2E74C 1E90A 3W1YA 2AYOB 3K5OA 1CHQD 2INCC 3KFUA 4XWTA 5T8IA 3KUZA 5IP4D 1YN4A 2JVCA 1Q7YC 2HDLA 5EDSA 1PH3A 2ID0A 1C4CA 1EY8A 5E3FA 4KIKA 1K8RB 5KNBA 1SYCA 3B6YA 4OVZA 1B8AA 1UNSA 3DXJC 2KWUB 5C5LA 4ALPA 3PSIA 5CBAE 4X62L 1PDQA 3BK2A 2EKIA 2F3WA 4ANWA 1AEXA 3HKZB 1U4AA 2OEOA 3WANA 5LMUQ 3T1YL 1W2BA 1EYGA 1B53A 1NCVA 4RGTA 5DM73 1IBKL 3QCAA 1E8YA 3MHZA 4TV3A 1C9FA 3FRPB 4BBRB 1BCPC 1WD1A 4YHHL 2ON8A 4DUYQ 5CGKA 2B63G 3AQQA 1XTCD 4JI8L 3FHWA 4JI4Q 4LMQD 4DR4L 1M94A 3EHVA 2B2TC 1V2YA 2F03A 3VR8B 2PYKA 1UD7A 3Q8EA 4EE2A 4AJWA 1NUCA 2F3VA 5C1ZA 2LFNA 4DAVA 3C19A 1Y56A 3FPPA 1PVOA 4I7AA 3V2TA 1SGHA 1SNQA 3IG3A 1GXDC 2WQYB 3HRZC 1GHJA 1ROEA 2OCEA 5AEKB 1N32L 4IFDJ 2M00A 3AB9A 3OMCA 3PO2H 4BXXH 1VQNA 2WHIA 5CBEE 1Y8OB 4DWFA 1PRTB 1MGSA 5JJLA 4DV1L 4OO1H 1K83B 1RLFA 4H13C 4OWXB 2VQFQ 2M19A 1OXUA 3C2PA 3PO3B 2LVQA 1Y69U 4FJVB 2MQHA 4NY0A 3U8ZA 4BWGB 2BB5A 5MPOA 1AE2A 4HIDA 2BF8B 2KNBA 4P73A 2M9VA 1ZDXA 2D62A 2NVXH 4XTCS 1EIYB 1WF9A 4X62Q 1E0ZA 2EY1A 1T0YA 3VQIA 4DV4L 4AYBE 4TVAB 3AM9A 4A3MH 3M95A 4YSZB 3S14H 1KQSA 3NTHA 2UUCQ 2XWJB 3AEBB 2D2CC 2LKVA 3NRZA 2XIWA 1P7EA 4C4VA 3KLSX 3H0GB 4JBKA 1SB3C 2NYZD 3HM3A 4X64Q 1E7VA 3AU7A 1KHIA 4CKCA 2JZ3B 3RNCC 3KWVA 1VQLA 3Q8AA 2IL8A 3AXCA 1UUPA 3AEDB 3R2IA 1JR0D 1CSQA 4RCNA 3GTQH 1P9DU 1HZBA 3S14B 4GDKA 4FNFA 1K8OA 2QCPX 3HIZA 4A3MB 1EQVA 1DJRD 1T5EA 1BBXC 2ZEQA 3RULA 1V8QA 4C3JH 3OJ4B 4NJ6A 2ZNVC 4XC2A 1QT9A 3AE3B 2K7VA 3T56B 1J0GA 1NYRA 1NE3A 1YQ4B 4FVMA 4A3JB 2O4XA 3U50C 3CP0A 5KEEA 4K2KA 1VQKA 1ZYRC 1EYDA 1WTQA 4KY7A 5HHDG 4LJZC 4LFCL 1UGJA 1CM9A 2DYOA 3CPFA 3RNFC 4CDFC 3TEZA 3S17B 4JV5L 1DOMA 2AQ2B 2HCCA 3TP7A 3F2BA 2DYMA 4XX5A 2ICEC 2MBOA 1K73C 2MFIA 5IGCA 2GBMA 2K25A 3A56A 1F2MA 3KF8A 1HNXL 1WX8A 1ZXIA 2MBBB 2X69A 3PHXB 2MCNB 2G4DB 4JIOU 3K81C 1C4QA 2NVQB 1MHXA 1STEA 3DWPA 4LFBQ 2WXRA 2WAQG 5FO8B 5L37A 2IT1A 2E5LQ 4RCOA 4K6LA 5M5WB 1L4DB 3EJIA 3I3CA 2K32A 1Q1OA 2BE5D 1V81A 1I3QH 1D5ZC 1C9OA 1UE6A 2PMZE 1C77A 2RGFA 4YY3Q 1CTMA 2UU9Q 3DHHC 2JA7B 1M8AA 5HGQA 1WX7A 1SNPA 2J53A 4DDGD 1X32A 1QWYA 1T9HA 2NVYB 3S17H 3K9PB 4R8IA 3TRZA 1OQQA 3PZ7A 3OW7A 4KJOA 1E7UA 1FNUA 1UE5A 3AEGB 3KBXA 3AEVA 2PEAA 3DPDA 2D9UA 2CW0D 1TVXA 3P1HA 4K3CA 2RKSA 4A3JH 4OIKA 3SHQA 2NVXB 1YOVB 4KDIC 4J1MA 3A7LA 5A35A 3K5MA 3I4MB 4OL7A 4BS9A 4FXDA 1OTRB 3ZKJC 3MEFA 1EY4A 2PQAB 3J80c 1HNWL 4HJ5A 4POGA 1AW7A 1YNJC 1KDCA 3DEPA 4C3HB 2JUOA 3N20C 4RNAA 1E8ZA 1QG7A 4A3EH 1FJGQ 4IKGA 4KGRA 2C7HA 4N59A 2C9WB 5D3DA 2MP1A 5EKIA 2PVOD 3CMAA 4II3B 1A5RA 1WWTA 2XEWA 1S5FD 4A3DH 2EJFC 4X66Q 1EFID 3KYHC 4GOPC 1XNQQ 3VYRA 1IP9A 1JMLA 4HJKA 3VH4B 2QJLA 3BDOA 5DLQE 5HKHA 1F2ZA 4FXGC 4A3FH 5IA7A 1A2UA 3GV6A 3EN2A 4R4IA 3NOBA 3PZDA 4GOPA 3KF8B 3CF5A 1ET9A 1UGMA 2EJGC 1EM7A 2B3GA 4TQUS 2V4IB 2I2YA 2KCCA 1FXAA 1GJZA 5DPTA 4IFDH 5CV8A 4PYUA 3DHIC 2L52A 3IRBA 2R7ZG 3QK0A 1HQRD 3OWFA 2KKCA 3E5SA 1V5TA 4RM9A 4Y7NH 4KV6A 4KD4A 3L17A 1V1OA 5FK9C 1OQRA 2FE8A 1S5CD 3MC0B 1HNWQ 5HI1A 1OXVA 3ND8A 1G291 1SFOH 3S1QB 2WXPA 3MP9A 3PLVA 2JYTA 4WQOB 4G7OC 3BK1A 1XXGA 4BY7B 2WYQA 2UXDL 1VDZA 3UI2A 1Y1WG 1SBBB 3RLFA 4YWLA 5AUIA 3UGBB 1D8LA 1FM0D 4HXDA 2INDC 4QJFA 1M90C 2N49A 2OWOA 4YTNB 1WTHA 2A6HD 4XYQA 4FULA 3VAWA 3HG9A 1TR5A 4NAMA 4E71A 2F0GA 2K33A 3DBRI 1E2WA 1NTGA 4ZOHC 3STBC 5KGUA 4HJGE 5C6AA 4QCLA 2LRWA 1D6EC 2B2WC 3N32A 4XDDA 1F9JA 1DD2A 1UEAB 4N8X1 4KKTA 5I6WA 3ZJVA 3QR8A 5L83A 5LMNL 1MJDA 1XLQA 3AEAB 4YIJA 1MD2D 2NZHA 4IUNA 4JI1Q 3HOZG 4QQBX 3CC2A 2JX5A 5K36H 1S3SG 2L4NA 4UPAA 4IWOA 1UAPA 3K7AH 4ZK9B 3L0WB 4WWPA 2C60A 3GTQB 4APVA 2PCFB 1P16A 1E7PB 3VYTA 1HR0L 1CKMA 2GVBA 3O13A 3NWSA 4GDLB 1JALA 4RH6A 4DNRB 4XXEA 1PH6A 2JXTA 1S4ZA 3HOXG 1VQBA 1WJJA 4IM3A 1K51A 2IGGA 2E76C 2N4FA 3LNNA 4PMWA 2D3CA 3UIOB 1ZE3D 5BYRA 2JA9A 1CT1D 1FRRA 3MJWA 3JVZX 1IPGA 2KHJA 2ZCBA 2C35B 4B3ML 1OQYA 2WX0A 3PUZA 4P72A 3PSEB 3ULPA 1KF6B 1QCBD 2F0MA 3HK0A 3KYCD 3C1FA 5M5YB 1QVCA 4YTPB 4FF3A 3KUPA 4LWCA 1B70B 4J8QA 4A6QA 4TSSA 1ENCA 4A75A 3KUDB 4U68A 2R93H 1A6XA 3PUVA 1JJ2A 4A3GB 2N9XA 3ND9A 3K58A 3EFCA 4GDLA 3U52E 1LO5D 2L0TA 2V9HA 2KXJA 2KECA 2KVRA 1STBA 1XLNA 3UDFA 2R7DA 4POFA 4FA6A 2K8BA 1PTOC 5E6OA 2N7EA 3DM1A 3MXNA 2ZPYA 2LY7A 3BZDB 1WXQA 3Q3NC 3VR5A 4MSQB 4BKSD 3N30A 1KOTA 1IW7D 1KM7A 1P3QU 3EC8A 1V97A 2R2QA 3D6WA 2RSOA 3EVQA 5D3IB 1NENB 2CVRA 5CV4A 2WFWA 3V6EB 2EKEC 2KX0A 4HSPA 2GRIA 5DEHA 2N9EB 3A54A 1O7LA 4H2AA 2G1EA 3V62A 5C3JB 1UWVA 2O2LD 1U4PA 3GP7A 4C3IB 2K52A 4IG7B 3HOUB 1HA6A 3NUHB 1X3QA 3I4MG 1YQBA 1I4GA 3NHEB 1TWHH 4ZAIA 3VR2A 1S5BD 2E75C 3CMEA 4GU2A 4KIKB 3N52A 3CCLA 2PPBC 2BKRB 3CIRB 3AE6B 4DK6C 3IHPC 1Y1WH 4KD3A 4HCEA 1YQ3B 2PZUA 4FJZA 3G4SA 3IFTA 4QB4A 2F4VQ 2L76A 3VR6A 4WJ3M 1KLGD 1VMCA 2AWTA 5C3EB 2O6VD 2ZVOA 3IAS1 3M4YA 3Q3MC 3E0JA 2R92H 2HJ8A 1OFFA 2CW0C 1GB4A 5BO4B 1BCPD 3ZJUA 2AMCB 3L9AX 1F0ZA 1EYAA 3J7YW 4DR3L 5IYBG 1JRUA 4PV1C 3EA6A 4GN1A 5D7GA 4NKLA 1G91A 3TMEA 3NUCA 3QB3A 1IUEA 3M4PA 1XX8A 1HZ6A 1FPYA 3CQZB 1PZJD 3L7ZC 2D0PA 4DAYA 3DCGA 4HIKA 2IZVB 5AZHA 4JCVE 3SDZA 3B1LX 3TDQA 3IAM1 3TJPA 3RZDB 2BOSA 2D07B 4FADA 2EE1A 2WXQA 4MH8A 3C1EA 2R93B 2QGQA 2N55A 4K7SA 3FKIG 1ZEQX 2G9DA 4OGQC 5C0XJ 4R4TA 4JLCA 1U5KA 1LYLA 2YTYA 2KLCA 2CQAA 3TP6A 4QUCA 2GBKA 1YHQA 2KHIA 4BY7G 1LGRA 4MJSA 3NEMA 4EOYA 5IO9A 1L2NA 3RN2A 1HNZL 4KTAA 3S24A 2PQAA 1SIFA 2BWFA 3DVGY 3K80C 2KN5A 3H3VC 1BKBA 2HQLA 1PH2A 2WXJA 2XTIA 1L6VA 2ZXPA 3UE1A 1T3QA 2DGYA 2WDQB 4FXKC 4MHEA 1FYCA 5AFWA 5ELDA 2I1JA 4M0WB 1S5DD 2KMMA 4K1RB 3E6ZX 4JI5L 3TCAA 2ZW0A 4M0WA 1KFYB 4A3DG 2LGSA 2K28A 1YNND 1WJUA 4MIUA 3A9JB 1H9SA 4NMZA 2VH2A 4RF0A 4A3KB 3LX0A 2FNJB 3P75A 2R92G 1BVSA 1GUGA 3EECA 4JVZA 4GDKB 1HTQA 4FBJB 1U4MA 2RSNA 2NVUI 2WXLA 3NTKA 3LB8C 1KXLA 4ZYNA 2JXMB 4X57B 2PKOA 2A6HC 1DOIA 1JOOA 1RCVD 4XQQA 3TREA 3VA7A 3OAWA 1SNMA 3E9HA 2KC1A 3ZNZB 2DBYA 2Z6KC 2PE9A 3KLWA 4IUVA 4DR6L 1KD1C 2JA6B 1T0RC 3HKSA 4WIPA 4ZRQA 1EOTA 2N1WA 1N34Q 4EZLA 3ZRFA 5M3MG 4MNOA 2NTTA 1KNAA 3NBIA 1IBXA 1IBLQ 3DBLB 1HQMC 3I73A 3KJPA 2B2TA 1D5XC 2B63B 3ZTCA 4HTHA 4NP5A 2WU2B 2GVAA 5I6YA 1YHBA 3FILB 4RFBA 4DK1A 1QJOA 2OQ0A 4HEDA 1LTGD 2FXQA 3KF6A 2JEBI 4NXNL 2O2VA 1AZQA 4DK3C 5ISRA 3VA5A 4IUMB 2CKHB 3NBHB 1MBYA 3T13A 1A3VA 3PIPA 4GN5A 1WXAA 3MHSD 5LXIB 4DR1L 4JW0A 1HTLD 4EGVA 1G51A 5IYBH 4V190 2VZAA 1OO9B 2M2LA 4EZKA 1M1KC 1STNA 3AULA 3U9OA 1BMLC 3MJ5A 1J8IA 1HZAA 3KUCB 1O78A 4L63B 2E2HH 1VQAA 2B2WA 2QF7A 1BF4A 3CCQA 1WGYA 3T1HQ 4FLHA 4CQNA 3HOUH 2Z6BA 5FLMH 5EE3A 4XQJA 2UU9L 5IYDH 4MEMA 1C76A 1SNOA 4BKGA 4AYBB 1ZDVA 2F0VA 2VL6A 4DR5L 3PF5A 3TEYA 3P4QB 2HD5B 1XF5L 4JYAQ 4HPLB 4LF6Q 4DV0Q 1P8LA 1E24A 4LF5Q 2G3QB 2WDRB 2VUMG 3GZNB 3Q24A 3GTOH 2PVGC 1SDFA 4AP4C 1FFUA 1Z6HA 2KTRA 2FMCA 4JL9A 4H0LC 5DAUA 1CJEA 1ICWA 4EFOA 2PO4A 2O6VA 4DR2L 4M8AA 3NK9A 4YWMA 5KNDA 1EY7A 1STHA 2Y0SG 4DV6L 4H02A 4JI4L 4ARCA 2MJ8A 4RMAA 1GM5A 4E6IA 4BA2I 1MVKA 3WAPA 5FOBB 1RL2A 3V05A 2NVYH 3DBLI 3SK8A 1U4LA 1L5PA 2V3SA 5JAVA 2JA7H 2LJIA 2B3AA 1HCZA 2I5HA 3DBHI
chains in the Genus database with same CATH topology
1GUWA 1K50A 2SEBD 5JPMC 1TY2A 1II3A 3QO2A 5IGDA 3HZXA 3GO5A 3X3MA 3J7AF 4HAEA 4IQZA 4MN3A 1SSNA 4MT5A 2K3UA 4LAAA 1EWYC 3AV8A 1KABA 3AE2B 1CI3M 2NB0A 1SIJA 1JC7A 4O1NA 3T16A 1CZGA 4K6DA 4X3UA 1GPXA 3W5VB 3Q8FA 1L0VB 3NVWA 2XRQD 4DGZA 5D65A 1PZID 1RF2D 2Z8LA 1FMAD 1A2TA 4KK7A 3I57A 1Q1EA 1K53A 2BDOA 5C4XB 2IX3A 1GUTA 2O5IC 3B2GA 3TUOA 3NQTA 3D6CA 4K5WA 4JBWA 3IT4B 2DY8A 3DWGC 2R6GA 5FKAC 1QOAA 2X6GA 3PUWA 1W6KA 2K5WA 4GLSC 2IJ0A 1DOYA 1I4RA 3TZUA 2PQEA 1CHPD 2W54A 2PLPA 3H8HA 3ITPA 1FXIA 3HOZB 3FC4A 2SOBA 3T51B 4DN4M 1PUTA 5D14A 5I9PA 5HG2A 2L55A 4Z9CB 1TS5A 3Q0AA 1VJKA 1PYWD 2Z4HA 5JXVA 3N9YC 1F77A 1WD0A 2CJNA 2BS3B 1TJEA 1RODA 3IKJA 1C48A 5IGGA 1VR9A 3JAME 1FR3A 4IFDG 1VCIA 4RAUC 3OMGA 3EROA 1LT6D 2KAJA 1TWFB 1PRTF 4O42A 2XVSA 3L3OC 3FAHA 2KQ3A 3RD4A 4N58A 4C80A 1NI3A 1IKMA 1B44D 3P42A 1ESFA 4WURA 3PV0A 4CJ0B 1KLUD 4C3JG 1EZ8A 4US9A 1PFMA 3AE4B 2EY6A 1ZOYB 2EJMA 3SXHA 4FF2A 4BBSB 1ENFA 3MAQA 1DOLA 2OHFA 1SEBD 4EQOA 1KDAA 4G7HC 1SFOB 1NEKB 1TKEA 1Z7TA 5I9OA 1KAAA 3CHBD 1BNZA 1GB1A 1BCPF 1N63A 1QOHA 1XYIA 2NTSA 4F87A 4P16A 1HRJA 4ZUIA 1SJED 1QILA 3W1SA 1AFPA 2NMQA 4DNTB 4G4KA 4FYDA 2EYLA 1EY0A 3WOFA 4TMAB 4JX1C 2RPVA 2LUMA 3PMFA 2JE6I 3NS1A 1Q1BA 1R4PB 3AH7A 2BA0A 4KN4C 4Q5VA 1CZWA 5EJWA 4KHVA 4DF7A 1MSGA 4JWUC 1VF7A 2MJEA 3PZ8A 4C2MB 2QIEB 2KHSA 1S5ED 4CJ1B 3DUZA 5G3LF 5JVG3 4K2LA 2DNCA 2KACA 1L6UA 1MPEA 1QKZA 2V3NA 1BOSA 2W82A 4GZYC 4UDUC 2MGSA 1FD7D 4DAPA 3SR1A 1PGXA 1JQ4A 2RDGA 5EBCA 5AUKA 3T3OA 4OHJA 1D1KA 1OXXK 2IDYA 4ZQ3A 1J7BA 5IOCA 1R7SA 4PMCA 3LWUA 1RDPD 2AX5A 4MACA 2K03A 3Q8BA 2QMTA 3P7JA 3QOJA 3J7AV 2BS2B 2BTEA 5LHY1 2PTLA 4DXFA 5C4HA 2B2VC 2XRSD 4TRDA 3TEXA 1JWSD 3VR3A 3U2SC 3SVMA 2X38A 2XNAC 5JJZA 3URYA 1Q8IA 1HEZE 3AB5A 4CKEA 1FNWA 1ET6A 1QNKA 1LV9A 2LGIA 2F0OA 2WKDA 4HRSA 1KRHA 1U9RA 1VF5C 2Q8IB 3BWUD 1P7FA 5C3WA 4J6HA 3AEFB 4I65A 3GQBA 1I4XA 3NPPA 1NYQA 1Q12A 1J7AA 2M0AA 2MEKA 4XYOA 3OWEB 3GTJB 2JEAI 5H8YE 1MHHE 4QMGA 1CZPA 1EEFD 3Q6SA 3ABVB 2AWOA 2A73B 1VMPA 2SAKA 1SF0A 5KYIA 2L9HA 4A3IB 3AE1B 2WDVB 2GI9A 1TS2A 5FLXL 3QG1A 5COYA 3IFDA 3ETRA 1N61A 1C78A 2EYPA 1B3AA 2EYOA 2WAQB 3RMHA 1TWCB 2HTME 3I72A 2L12A 2NN6H 4A9AA 3CU7A 2BB6A 3ZYYX 3LYYA 3J80E 3Q22A 2L1BA 2KQ4X 3NXWA 2K22A 3SK5A 1RYJA 4A55A 3AMZA 5CMDA 2R61A 1RWSA 3L4PA 1BUVT 3NTIA 1FFVA 4R8NA 2A6EC 3S15B 2W55A 1QQRA 4D2KA 1WTXA 1I4HA 1EU3A 4XE0A 2VXWA 3ZJTA 4QUFA 2EXZA 3U4EG 1DCZA 2WXHA 1XCQL 5EPJA 1T6BX 2K6AA 3I9V1 4CKBA 3Q23A 1LACA 3GS2A 1RHPA 4OZAA 2BW2A 1X3PA 4KI0A 1WTPA 2E2HB 4YSXB 3CRKC 2HDMA 2DY7A 3NBHA 1A15A 3MXGA 1VRAB 1E10A 2E2JB 1YN3A 4F7XA 4WQMA 1I4QA 2VB3X 2N7JA 3TEWA 2KVMA 2MHVA 2B8FA 4FF4A 3D3RA 3FILA 4OW0A 3NSWA 2EY5A 2EYMA 5EKLA 2KA7A 2F0EA 4I7ZC 5EE9A 5DNFA 5JPNC 1T5XD 3BDLA 1AYFA 4KKIA 3BVGA 4ZKCB 1J9OA 3NVVA 2J7ZA 1CFMA 4C1NI 4NDXA 3BIID 3GTLB 4JE3B 3A7AB 1QE6A 2F0UA 3IL8A 2WP9B 5C0XI 4ITKA 3CKIB 1IL8A 2VNUD 1IYUA 2L83A 1LTRD 2N9KA 1IHZA 2DN8A 4PQXA 4EVOA 2OF1A 4Y7NB 5E4WC 1DONA 5M3MB 1O7ZA 3S1NB 1TWGB 4A3BB 2N9LA 2WXIA 1AP0A 2B2UA 1KDBA 5JEAH 4KMUC 1EIHA 3WDNA 2BE5C 5A2QE 2QSDA 1E2VA 4PMBA 4LLGM 2RA4A 5F2DA 4KGSA 1NAPA 2F0HA 1XWEA 4N9TA 4OIJA 3FPUB 4EQNA 1CA5A 3BVMA 2CJOA 2H1EA 1OXSC 5LL6S 1F9QA 1LTTD 1SYEA 1PMRA 1G2TA 2Z1CA 1VZ7A 4RKBA 4CHTB 1E0BA 1JOQA 1NVID 4IOIE 4RWSC 2Q5WD 3FMCA 1SMYD 2PW9A 1Y1VB 3W3AA 2ZT9C 3BVZA 3MA2B 5EE1A 1B4OA 1B9MA 4C3IG 3HRDD 4DQOC 1VDVA 1JW9D 5M9OA 4IDIA 5CR3A 5IT9L 1QOBA 3F2UA 1TKWB 2PW5A 1KNEA 4LK0M 3KK7A 1LT5D 2YYZA 4IALA 4FP5D 3WCQA 3GD7A 1EQTA 2AWNA 1FCCC 1EWCA 4CJ2C 1ONLA 4JWSC 3I8ZA 3P4SB 1AN8A 4XIGS 5E1FA 1H9KA 5KRUA 1JRPA 1LT4D 3G6JB 2WP8J 3OIQA 3D4WA 2WXNA 1EYCA 3OOCA 2L5TA 3MEHA 1HUNA 3VRAB 1PTOH 4US8A 1TKGA 4ARIA 1WRIA 2DWQA 2Z4IA 1E2ZA 2IPKD 4XDXA 2KEEA 1VZ6A 2E6XA 2EDGA 2LEKA 2K1BA 1GUSA 3W5UB 1LTID 1RTOA 3W2DA 1XEEA 4A8XC 3SFEB 2LFIA 2ONQA 5GXGB 2JP1A 3KWLA 5CORA 5EPKA 2SNSA 2MJ3A 2ICIA 1O80A 3C3LA 2B76B 2Q8RE 4YXDB 4NW2A 2BS4B 3S2DB 3W9CB 2EYFA 4DK0A 2QILA 2KCNA 4USAA 5HFYA 2F1MA 3SR6A 4WWMA 2FFKB 1TY0A 4B08A 1UWXA 2V3PA 1LLRD 1K52A 4YWGG 3GV3A 4R3DA 2KJXA 4RGMA 5C4ZA 2JSVX 4RF1A 5ELFA 1CQVA 2KWDA 1R9TB 5IT9E 1ZXHA 1AWDA 4IUUA 3PUXA 2WU5B 5EPLA 3I4NB 1D1IA 5JEAG 5JEAJ 4P6VF 2N0SB 3PO0A 2PZWA 4JK1C 1B9NA 3IT6B 5JOBA 2I38A 1ILPA 2DNEA 1DXMA 1A70A 2XN9C 1E9MA 3D4RA 4N9PA 1EWHA 1PDXA 3HUIA 3T3NA 3I4LA 3HOXB 1IKLA 3P4RB 1JCKB 3BS1A 2LHEA 2JYEA 3QJYA 1ML0D 3PIO3 1STYA 4ZUJA 2LS01 4WJWA 1PZKD 2BDNA 1IGDA 3H09A 2C5CA 4HCSA 2F0FA 1B9RA 3NVYA 1FGBD 1HZ5A 3NQIA 2B39A 3K59A 3DHQA 3OPOA 2V0GA 3DWAA 4C3HG 2BT6A 3KBGA 1QNUA 2WXKA 3ONAB 1IBXB 2F0NA 3JAML 4TQ1A 1HA5A 3BYTB 1BUIC 1DZ1A 1DGJA 4IFDI 2E2IB 4REZA 2JYOA 2RDHA 2F0LA 2JWUA 1G2SA 2K04A 3PUYA 5IIFA 4NJCA 2HCIA 4DFAA 3V96A 1BCPB 2RBMA 1I4PA 4BY1B 2ZW1A 3Q8CA 1GOZA 3B2FA 1HTPA 3EUB2 4Q2JA 2J42A 3HOVB 1C4PA 5EGTA 2L32A 1LTAD 1RFKA 5KYLA 2FINB 1Y8PB 2EZVA 3G7LA 2WKCA 2L0CA 1TWAB 2MPMA 1PRTC 4L8JA 3NHHA 2B2VA 2K5QA 4ULLA 2F0SA 5C3XA 1I6HB 3VYUA 1ZUD2 1HHVA 5BN5A 5M3FB 3FVQA 1ENAA 4IURA 5FO7B 4YTMB 2WXGA 1I3QB 1F9SA 1V43A 3J9CA 2F0TA 1BDOA 2J0TD 3M7GA 1NR2A 5C2TB 2H89B 2W3SA 1EY6A 1H9JA 2EVBA 2EYHA 1QB5D 1B50A 4XT3B 2E3TA 3QWNA 2YU9B 2A68C 2O5JC 1A3TA 4ID6A 1F9PA 2JZPA 4ILWA 4N6EB 1WVLA 2PW7A 1ZXTA 1I6VC 2OXPA 1Q90A 1SJHD 2YEPB 2DLBA 2B2UC 4EQPA 1YN5A 2KN4A 1PFBA 4KY5A 5I2XA 4ODGA 2BYTA 3X3NA 2JA8B 4MM3B 1JROA 1YNJD 3D31A 2K0PA 3HVDA 4QIWB 4G7ZC 2ENBA 4S3SA 1B2TA 5CV7A 1C4AA 5H92C 1TU2B 1SYDA 2AUJD 3CRLC 4X3SA 2VZKD 5CV6A 1CA6A 1VLBA 4IZ8A 4ZRZA 2HDEA 1N5XA 1HXYD 3BYYB 3CWIA 2WXFA 1VZ8A 1M4VA 2C9OA 5I4DA 3KLRA 2F0QA 2JA5B 4YSYB 5ELBA 1EL0A 4K5XA 4AS1A 3HS0C 3EQLC 1KH0A 3V3XA 1WSPA 2LMCB 3M85A 2QKIC 3NP8A 3SHLA 4CGYB 1Z47A 3TP8A 1N62A 1FEHA 2F0IA 4A3DB 1EZ6A 3U9SA 3A8JE 4TQ0A 2WV6D 1V1PB 2V4DA 1PTOF 5ELCA 1XCTL 5BYSA 3FEWX 1RTNA 4F88A 1BXTA 4KKJA 3TZDA 3NVZA 1FD6A 1B1ZA 2AQ3B 4AQ7A 1TS3A 3TSSA 2HQEA 2J52A 5G5GA 1GAQB 3GTGB 4FO2A 1F2YA 4QF4A 3RFZB 2G9HD 4FXCA 1EY5A 1JE4A 5JVH3 3FDTA 1I7HA 1ZP0B 4P2CB 4K8JA 4FF1A 4C7ZA 3SEBA 2GA4B 1D4BA 2NUCA 3VYSA 3SFDB 3J81E 4HEA1 3R8BA 5C5MA 4M1UB 1I50B 1TT2A 1Y1WB 3MFGA 1SMYC 1WCMB 1TS4A 1PGBA 3PO2B 3P20A 3H94A 2FMMA 5G5HA 4HN7A 2EOTA 2FHTA 1MSHA 4B0MA 1ESRA 3HGBA 3MXPA 5CYUA 3GTMB 3KQ4A 1AZPA 5I2YA 3AEEB 2VUMB 3GTPB 4RKLA 1SSOA 2AQ1B 2Y0SB 2WACA 4ZRPA 3HOYB 2F0WA 1JQYD 5HGTA 2JU6X 4IUTA 1RM6C 4DXGA 2K5DA 4B0EA 4A90A 1BR9A 2OT2A 4B9XA 4KKSA 1TWHB 1DYQA 1BO0A 5IGBA 3AE8B 3K5LA 1WGKA 5C44B 1MI0A 3NE5B 1TKYA 3SK6A 3TP5A 1ZYRD 4KJNA 3BG3A 4KHZA 4C1NK 4F8MA 5IGFA 2JQRB 1ZPSA 1EY9A 2K9XA 3K0YA 1ILQA 2MJDA 2NVTB 3RUZA 1Q3LA 3P63A 4RA8A 5DM63 4HKQA 1D2BA 2EELA 2WNMA 3M4OB 1SAPA 1PFNA 3WOEA 3E56A 2F0PA 5CC4A 4ABNA 1TYGB 3AE9B 4IN3A 3AE7B 2INPE 1GJXA 5FLXE 2BBCA 3FKIB 1G6ZA 1JWAD 1LTBD 4L6TB 4XT1B 2WS3B 4NZLB 2H4OA 4L1BA 4K14A 2F0DA 1HUMA 3RZOB 1D5MC 1KTKA 1LTSD 2R92B 3AMUA 1Y8NB 3E9SA 1G8ZD 2A5HA 4C7YA 4K5VA 2IGDA 5J22A 2D5GA 2B8GA 5J1ZA 1F2LA 1F2RI 2WLBA 2RDFA 2IWHA 3MFYA 4HKZE 3D4DA 2OEDA 3K6OA 3HP3A 4Q0FA 3NZ3A 1ACCA 2SDFA 3VR4A 3SK4A 3K57A 2LMCA 3A8KE 2EYJA 4ZHOA 1TIID 3R3OA 5E4XA 1O7YA 2R7ZB 4OO1G 3LWEA 1PTOD 2IGHA 3R2TA 1QF6A 1H9MA 2L1AA 1QLBB 5KIXA 2A74C 1N60A 4HMIA 1SXTA 3ZGZA 4A93B 3H91A 3GB1A 1BQQT 1FCLA 2K01A 1LABA 3J80L 1JWMD 4IUQA 5EQ0A 1PFDA 3B9JA 4XDCA 2INNE 1R4QB 3NWTA 5IGEA 1H9SB 1EEID 4DA2A 3S9WA 3SE0A 1EIGA 2YEPF 3AECB 2I46A 3I70A 3OHXC 3TN2A 1RJTA 1YJIA 4ZKBB 1JWUD 5FR3A 1L0XB 4X3TA 4YT0B 3P1MA 3H6MA 1NR4A 2PMVA 5EE0A 2EPBA 3C8YA 4OO1I 2E2DC 5LL6X 1OXTA 2F0KA 2NZ1D 4KKUA 2WIIB 2D5DA 2PZTA 5T1GA 3Q69A 1TZOA 1F9RA 2H88B 1C8CA 1XO3A 4WH4A 2NN6I 2W3RA 3A55A 2MH7A 4ZHPA 2RQXA 1K8MA 1V8CA 2B2YC 3M3YB 1IYVA 1DOKA 4H7BA 4U673 2CU3A 1W6JA 2QDBA 4OZBA 2AUKA 3EFXD 3GTOB 5J39A 2F0JA 3MTSA 1E6EB 2Y5CA 1SE3A 4WFN3 2TSSA 3PIP3 5CV5A 5BYQA 1QOFA 2KDMA 1SYGA 3RPFC 4OZCA 4RHRA 2FJ2A 3C46A 2ACZB 4HSVA 2QEJC 3K7AB 5EBDA 3QIAA 2A69D 3IXSA 1U4RA 4J3OD 1XLOA 1A3UA 5T1IA 5C0XG 2L11A 2NN6G 2FBWB 3AE5B 1JB3A 4JPSA 1FO4A 3GTKB 2X6LA 1H9RA 2KOLA 2MUYA 2WXOA 4XWWA 1UWMA 2NWGA 2Q8TA 3S2HB 2A6ED 4A3EB 1TQOA 1CK1A 4CBVA 3OSOA 4RGOS 2RVLA 1HPCA 2PNRC 3IAYA 2RMMA 5IODA 4L23A 2IW3A 1FNVA 1LT3D 3MZ5A 1JORA 3I91A 2K05A 2EY2A 1CQFA 1C79A 4RHSA 3VRBB 3HOWB 3EGRA 3ZQ4A 3DMUA 5LNK1 3I90A 2HUGA 4KGTA 4ZLTF 4WRDA 3P4PB 2SNMA 4R9WA 4G57A 3DWQA 1STAA 5FO9B 1WTVA 4PNYA 2VZKB 5C4JB 1JOKA 2TMPA 3MVVA 1GUNA 1N5WA 2J4XA 1PGAA 2NBFA 4KN7C 1EU4A 4RGNA 2Y5PA 5E6JA 5NUCA 1HFNA 1YNNC 3DEOA 5G3LD 1FIQA 1JWBD 1PTOB 3MWYW 4C56C 3HVZA 3R93A 3KLSA 2KEDA 2WXMA 5CV9A 2KUMA 1J7CA 4WORA 4ZYSA 1PXUA 1RD9D 5A2QL 1IW7C 2R3ZA 1HFGA 3M7NA 4HMJA 2A69C 3U7ZA 2WINB 4A3FB 1DM0B 1XLPA 5TSSA 3LXFA 3TBIB 5BMGA 2JSOA 4IUPA 4KX6B 2BCOA 2VB2X 4BA1I 2CHBD 2A68D 4HR7B 3HEJA 1NSNS 1SE2A 2LHDA 2GB1A 2ZXRA 3DWMA 3K5NA 4XQNA 1FRDA 5M5XB 5HURA 1SE4A 5EKKA 1YNTE 1STGA 1SYFA 1SNCA 5K5PA 1F2RC 4K8IA 5BMHA 3S16B 4X3KA 2WB1B 4UAIA 2ZXOA 1ZKOA 5C0XH 1SYBA 4ME5A 2BA1A 1WYGA 4WAFA 1YMHE 2XSCA 4KY6A 1YJJA 1PLFA 4C3JB 4LTUA 1SNDA 3T4AC 1V1PA 1MI2A 1L4ZB 2M56B 2F4IA 1WTRA 5BN3A 5KNCA 4L2YA 2FUG1 2IX0A 3MHBA 3QOLA 2K5PA 2PIAA 3UI3A 5K36G 1L0YB 4TKOB 1WTOA 2B2YA 2PMZB 5BMIA 1Q10A 2N88A 2XWBB 3S1MB 1GUOA 1DOXA 3D8GA 3N6RA 1PRTD 4DU9A 1RKNA 1WTWA 3AN1A 5BN4A 1QOGA 4PT5A 4LK1C 4HROA 4NAWB 3OIPA 5ELEA 2IX1A 2Y3AA 3BDCA 3S1RB 3A8IE 1IGCA 3T53B 2I07B 3ERQA 3J81L 1GHKA 4H44C 4B9WA 3MXUA 1JICA 4V0BA 2E74C 3K5OA 1CHQD 5T8IA 4XWTA 1YN4A 2HDLA 2ID0A 1C4CA 1EY8A 5E3FA 5KNBA 1SYCA 4OVZA 1UNSA 3DXJC 5C5LA 5CBAE 1PDQA 3BK2A 2EKIA 2F3WA 1AEXA 3HKZB 2OEOA 1B53A 1NCVA 4RGTA 5DM73 3MHZA 1C9FA 3FRPB 4BBRB 1BCPC 1WD1A 2ON8A 5CGKA 1XTCD 4LMQD 2B2TC 2F03A 3VR8B 2PYKA 3Q8EA 4EE2A 1NUCA 2F3VA 2LFNA 4DAVA 1Y56A 3FPPA 3V2TA 1SNQA 1GXDC 2WQYB 3HRZC 1GHJA 1ROEA 4IFDJ 2M00A 3AB9A 3OMCA 5CBEE 1Y8OB 1PRTB 1MGSA 4OO1H 1K83B 4H13C 2M19A 1OXUA 3C2PA 3PO3B 1Y69U 5MPOA 4BWGB 2BB5A 1ZDXA 2M9VA 2D62A 4XTCS 1E0ZA 2EY1A 3VQIA 3AM9A 4YSZB 3NTHA 2XWJB 3AEBB 2D2CC 2LKVA 3NRZA 2XIWA 1P7EA 3KLSX 3H0GB 1SB3C 2NYZD 3AU7A 4CKCA 3KWVA 3Q8AA 2IL8A 1UUPA 3AEDB 3R2IA 1JR0D 4RCNA 3S14B 4FNFA 1K8OA 2QCPX 4A3MB 1EQVA 1DJRD 1T5EA 1BBXC 1V8QA 1QT9A 3AE3B 2K7VA 3T56B 1NYRA 1YQ4B 4FVMA 4A3JB 2O4XA 5KEEA 4K2KA 1ZYRC 1EYDA 1WTQA 4KY7A 5HHDG 4LJZC 1UGJA 1CM9A 2DYOA 3TEZA 3S17B 1DOMA 2AQ2B 2HCCA 3TP7A 2DYMA 2ICEC 5IGCA 3VR9B 3A56A 1F2MA 3KF8A 1ZXIA 2X69A 1C4QA 2NVQB 1MHXA 1STEA 3DWPA 2WXRA 5FO8B 1L4DB 2IT1A 4RCOA 4K6LA 5M5WB 3EJIA 3I3CA 2K32A 2BE5D 1D5ZC 1C77A 1CTMA 2JA7B 1M8AA 1SNPA 2J53A 1X32A 1QWYA 2NVYB 4R8IA 1OQQA 3PZ7A 3OW7A 4KJOA 1FNUA 3AEGB 3KBXA 2D9UA 2CW0D 1TVXA 3P1HA 2RKSA 4OIKA 2NVXB 3K5MA 3I4MB 3A7LA 4J1MA 5A35A 4OL7A 4BS9A 4FXDA 1EY4A 4RNAA 1AW7A 1YNJC 1KDCA 3DEPA 4C3HB 1QG7A 4IKGA 4KGRA 4N59A 5D3DA 2MP1A 5EKIA 2PVOD 1WWTA 1S5FD 2EJFC 1EFID 3VYRA 1JMLA 2QJLA 3BDOA 1F2ZA 4FXGC 1A2UA 3GV6A 1ET9A 2EJGC 1EM7A 4TQUS 2V4IB 2I2YA 2KCCA 1FXAA 4IFDH 5CV8A 2L52A 1HQRD 3OWFA 3E5SA 4KV6A 4KD4A 1V1OA 5FK9C 1OQRA 2FE8A 1S5CD 3MC0B 5HI1A 1OXVA 3ND8A 1G291 3S1QB 2WXPA 3MP9A 2JYTA 4G7OC 3BK1A 1XXGA 4BY7B 1VDZA 3UI2A 1SBBB 3RLFA 5AUIA 1FM0D 4YTNB 2A6HD 4XYQA 3HG9A 1TR5A 4NAMA 2F0GA 2K33A 1E2WA 4ZOHC 5KGUA 4HJGE 5C6AA 4QCLA 1D6EC 2B2WC 4XDDA 1DD2A 1UEAB 4KKTA 5I6WA 3ZJVA 1XLQA 3AEAB 4YIJA 1MD2D 4IUNA 2JX5A 5K36H 2L4NA 1UAPA 4ZK9B 3GTQB 2PCFB 1E7PB 3VYTA 3O13A 3NWSA 4GDLB 1JALA 4RH6A 4DNRB 4XXEA 2JXTA 1S4ZA 1K51A 2IGGA 2E76C 3LNNA 4PMWA 1ZE3D 5BYRA 1CT1D 1FRRA 3PUZA 1KF6B 1QCBD 2F0MA 3C1FA 5M5YB 4YTPB 4FF3A 3KUPA 4J8QA 4A6QA 4TSSA 1ENCA 4U68A 1A6XA 3PUVA 3U52E 4A3GB 3ND9A 3K58A 1LO5D 2KECA 1STBA 1XLNA 1PTOC 3DM1A 3MXNA 2LY7A 3BZDB 1WXQA 3VR5A 1IW7D 1V97A 3D6WA 2RSOA 3EVQA 5D3IB 1NENB 2CVRA 5CV4A 4HSPA 2GRIA 5DEHA 4H2AA 3A54A 1O7LA 5C3JB 2G1EA 2O2LD 1U4PA 3GP7A 4C3IB 3HOUB 1HA6A 3NUHB 1X3QA 1I4GA 4ZAIA 3VR2A 1S5BD 2E75C 3N52A 2PPBC 3CIRB 3AE6B 1YQ3B 4KD3A 4HCEA 2PZUA 3IFTA 4QB4A 3VR6A 1KLGD 1VMCA 5C3EB 3IAS1 3M4YA 3E0JA 1OFFA 2CW0C 1GB4A 1BCPD 3ZJUA 3L9AX 1F0ZA 1EYAA 3J7YW 4PV1C 3EA6A 5D7GA 4NKLA 1G91A 3TMEA 3NUCA 3QB3A 1IUEA 1XX8A 1HZ6A 3CQZB 1PZJD 3L7ZC 4DAYA 3SDZA 3TDQA 3IAM1 3RZDB 2BOSA 2EE1A 2WXQA 4MH8A 3C1EA 2R93B 2N55A 1ZEQX 2G9DA 4OGQC 5C0XJ 2CQAA 3TP6A 4QUCA 4KTAA 3H3VC 2WXJA 1L6VA 2ZXPA 1T3QA 2WDQB 4FXKC 4MHEA 1FYCA 5AFWA 5ELDA 1S5DD 2KMMA 3E6ZX 2ZW0A 4M0WA 1KFYB 2K28A 1YNND 4MIUA 1H9SA 4NMZA 4RF0A 4A3KB 3LX0A 3P75A 1GUGA 4GDKB 1U4MA 2RSNA 2WXLA 3LB8C 3NTKA 2JXMB 2PKOA 2A6HC 1DOIA 1JOOA 1RCVD 4XQQA 3VA7A 1SNMA 2DBYA 4IUVA 2JA6B 4WIPA 4ZRQA 1EOTA 2NTTA 1KNAA 3NBIA 1IBXA 1HQMC 3I73A 2B63B 2B2TA 1D5XC 4HTHA 4NP5A 2WU2B