1B1ZA

Streptococcal pyrogenic exotoxin a1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
DPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKTELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVKVSIDGIQSLSFDIETNKKMVTAQELDYKVRKYLTDNKQLYTNGPSKYETGYIKFIPKNKESFWFDFFPEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TOXIN)
publication title Structural basis for the recognition of superantigen streptococcal pyrogenic exotoxin A (SpeA1) by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Toxin
total genus 58
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b1zA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1b1zA02
1T5XD 1JR0D 1SJED 1DJRD 1LTGD 1FGBD 1CK1A 3MFGA 3BVGA 1EU3A 1D5ZC 1FD7D 1JCKB 1GOZA 5ELCA 4TSSA 1I4HA 4RCOA 1EEID 1PTOD 1YN3A 1FNUA 2SEBD 1ENFA 1I4XA 2AQ1B 1TY2A 1LT6D 2TSSA 4RGOS 1S5CD 3GP7A 3R2IA 1BXTA 4DXGA 5ELBA 1SXTA 3EFXD 2NTTA 1SE3A 1LTSD 2IPKD 4Z9CB 1RCVD 3W2DA 5D3IB 3SEBA 1EU4A 1I4QA 1D5XC 1ESFA 4DXFA 1LTID 1TS2A 3BZDB 1LTRD 3EA6A 1XXGA 1FNVA 1HQRD 2RDHA 2J4XA 1PZKD 1S5ED 3R8BA 2O2LD 2XN9C 1L0YB 1M4VA 5ELEA 1JQYD 1SBBB 1UUPA 1JWMD 3V05A 1SJHD 1HA5A 1KTKA 3BYYB 3R2TA 3BVMA 1TS3A 2Z8LA 3URYA 1L0XB 1SEBD 1STEA 1CQVA 5D3DA 1LT4D 1V1PA 1B44D 1EWCA 1F77A 1BCPB 2IJ0A 1EEFD 1LTTD 1MD2D 2AQ2B 5TSSA 1KLGD 1V1PB 1D6EC 1UNSA 1PYWD 1CHQD 1S5BD 1I4PA 1JWSD 5ELDA 4L6TB 4RFBA 1PRTB 1BCPC 1PZID 1G8ZD 2NTSA 2XRQD 1XTCD 2QILA 1LLRD 1V1OA 3OWEB 1D5MC 2R61A 1PRTC 1PZJD 1S5FD 1BCPD 2G9HD 1JWUD 2QEJC 3KLSX 1BCPF 3BVZA 1RD9D 5ELFA 1I4RA 4RGTA 3TSSA 1TS4A 2ICIA 4L63B 1EFID 4RHSA 1RDPD 3DWPA 4K6LA 4RHRA 1YN4A 4BWGB 1PRTD 1PTOC 3DWQA 1LTBD 3BYTB 1B1ZA 1FNWA 1ET6A 1PRTF 2WV6D 2XNAC 4C56C 3CHBD 1CT1D 1LTAD 1HTLD 1LT3D 1SE2A 4NZLB 1CHPD 1ET9A 1TS5A 4OHJA 1PTOH 1LO5D 4ZYSA 3DWAA 1LT5D 1PTOF 2RDGA 5I4DA 1YN5A 3O13A 1AW7A 1PTOB 1QILA 4RGNA 4RGMA 1I4GA 2AQ3B 2XRSD 5FK9C 3MC0B 1KLUD 5FKAC 1AN8A 1HXYD 2CHBD 4RH6A 1S5DD 1SE4A 1RF2D 1DYQA 4UDUC 1TY0A 4O1NA
chains in the Genus database with same CATH superfamily
1N61A 3RN9C 5IP7H 1S72A 2RVLA 1JICA 1SJED 3NJTA 1LTGD 4QQBX 2Q8RE 3S16H 4BBRH 1M94A 2NCNA 2RGFA 2K8HA 3ZJTA 4G7ZC 4EEWA 1GPXA 1KRSA 4OVUA 1K83B 3BDOA 1E5WA 2YU9H 1HHVA 3GTPB 5IGBA 2F0GA 2EOTA 4AP4C 2AQ1B 1RAXA 1QNUA 1MG8A 1OTCA 2W54A 1FVIA 1SNDA 5M3FH 3NY5A 4ACFA 4B0MA 1WE6A 3J7A5 3WA0A 3NQIA 4KJOA 2D3GA 3RNAC 2D9UA 3C8YA 5CGKA 3S1NB 2F4VL 1JB7A 3QJZA 4DN4M 1DGSA 1DOLA 2WX1A 4PYUA 1D1IA 3D8GA 5FJ8H 2KTRA 3MZ5A 3HG9A 4IOIE 1FNVA 4ARIA 1E24A 2OOBB 1RRBA 1PVOA 2KLGA 1ZYRC 4ZQ3A 5M5WB 3HOXB 4YY3Q 2B3AA 2YLMA 2JEBI 1R4QB 4OX9Q 4ZRQA 2Z4HA 4G11A 3L7ZC 1SEBD 2KCTA 2F0WA 2JA8B 2LGXA 1CQVA 4IO9A 4WURA 1N9WA 5E3FA 2E6XA 3SR1A 5L95C 4RCNA 3SFDB 4ANUA 4EKUA 1DOIA 1D6EC 2KHSA 4X66Q 1G2TA 4A3KH 1WWTA 1E0ZA 2AUKA 3M4PA 4G7OC 5CV5A 5T1IA 4N58A 4DK5A 1IBMQ 1XNRQ 1JWSD 1XMOL 1GO3E 4X6AH 2JA7H 3I55A 1NMFA 2ES2A 2PEAA 4PS7A 1A3TA 1OXTA 5JHAA 4QL5A 4JGHB 2NTSA 3ZGZA 3FVQA 5KNDA 1Q0WB 1H9JA 1HZ9A 1EFWA 1M8AA 4EQNA 2BVCA 2CJOA 1LLRD 3P1MA 3SGIA 3S17H 4GDKB 5HHDG 4WJQA 1GC6A 4JK1C 2NVXH 1Q81C 1DD2A 3NTHA 2F0FA 3GTGB 1SR3A 1SB3C 2VZKD 4LF4Q 4POGA 2A6HD 4X65Q 1HNZQ 1FJGL 1E6EB 3H6MA 1ZEQX 2QF7A 4RHRA 2L15A 1N62A 1WGHA 2X8XX 4XWTA 2K5QA 1PRTD 2E2JH 3EN2A 1UWMA 2LASA 4ZRIA 3UI2A 3BYTB 1N8RC 5D65A 3STBC 1UWVA 1O7LA 4I7ZC 4FHKA 2ZT9C 1PH2A 2L05A 5AZGA 3PO0A 3APDA 1WVLA 3AULA 4PG3A 2K39A 2MLBA 3T13A 1WCMH 3UDIA 4LF5L 3P4PB 2BYFA 2OJRA 1LM0A 1V5TA 5E6PA 2D3BA 4EVOA 4XQJA 1R4PB 4HTHA 3B2GA 4FYDA 1KQSA 2KCNA 1YOVB 2I07B 3DOWA 1NI3A 5K5PA 3HOYG 4JBKA 2J42A 2AEHA 4MGZE 4R3DA 2WFWA 2NVTH 3EC8A 4JI0Q 5A2QE 2K1FA 1Q12A 3V3XA 2RCFA 3CP0A 4CJ0B 2EYPA 3J9CA 1Q8KA 1FR3A 1JR0D 2HQLA 4IW0A 5I9PA 4ZYNA 2CWAA 3UI3A 3ER0A 1QUQA 3BWUD 4P71A 5ELCA 2JEAI 1V8QA 2FMCA 3J7ZC 2JZZA 2OEDA 3FILB 3AFQA 4TQUS 1R4NB 3ZLZA 1KM7A 1CKNB 4DUYQ 2LXJA 3CWIA 4BXXH 3S16B 4BBRB 1J9OA 3V6CB 3TZUA 3FPUB 4W9GA 3KUPA 1C4PA 1BXTA 4DXGA 4KIKA 3PO3G 1IYVA 2JU6X 2WYQA 1EF1A 2LEKA 4EOYA 2YU9B 4H13C 1V8CA 1D3ZA 5E6NA 4H02A 3QOJA 1KC8C 1JRUA 2AHOB 1YNND 3K7UC 4A4IA 1XF5L 3SHQA 1LTSD 3RLNA 3PZ7A 2BF8B 3OHXC 3WCQA 1XLPA 2ENBA 5KHQA 3GD7A 4DR2L 5M3FB 3PZDA 3VUXA 5JHBA 2OT2A 3ALBA 3RZOH 2AWNA 3BZDB 4UPAA 2CVRA 1NYRA 4P6VF 5BYRA 4YHHQ 5CV7A 2N0SB 3ZQ4A 4B3TQ 1OEYA 2BBCA 2G4DB 2ASQA 1GUGA 1X3FA 5LMUQ 1Y56A 1G6JA 3GE8C 3KH0A 1HA5A 4BS9A 2ON8A 2RPVA 3DPDA 2UU7A 3I63C 5HI1A 1Z7TA 1EQRA 4A3DG 2ZW0A 4OW0A 3PUYA 1DCZA 4XXEA 3I7FA 2VS1A 2PTLA 1VDVA 3RNCC 3X23A 1MG4A 4LFAL 3HOWG 3PO2G 5IYCH 1J7BA 2V0GA 1Z5SB 1F2RC 2INDC 3LNNA 2AQ2B 3K5MA 1S4ZA 1V1PB 5KRUA 5DEHA 1TKGA 5G2NA 3AU5A 3AE8B 3EQLC 2G9DA 2ZJPA 1EF5A 1WYDA 3P20A 4HSVA 4I65A 4DK1A 2ZEQA 5HFYA 1BOSA 4JI7Q 4RFBA 2K33A 1TIID 4APVA 3VHTC 2EVBA 4HRSA 4A3KB 4J8QA 3CCUA 4LNNA 3OTOQ 4DV0Q 1RTOA 4RF1A 1HCZA 3AB9A 3VR6A 3OWEB 4TKNA 2JA7B 4LNQA 2ZZPB 4R4TA 1WM3A 3R66C 3ERSX 2WS3B 4C7YA 4CDEC 3S17B 3DBSA 1TS4A 1QOBA 2K6DB 3JSVB 1T5EA 1GKHA 2NVXB 4XZ4A 2DZKA 2CKZB 3BS1A 4BY7G 1K50A 2K8CA 2N78A 1JJCB 2DENB 2LZ6A 3V61A 4GGQA 2ALYB 4LAAA 4GLAC 4LF9L 3PQIA 3RD4A 1FPYA 1LTAD 2I5LX 4H44C 4LF8L 1QVFA 2NB0A 3VR3A 2E2JB 3ZNHB 2F52A 4LF7Q 2MBBB 4RMAA 4NDXA 4NXNL 1AH9A 4ZYSA 3J7YW 2WB1B 3DWAA 1LT5D 3EUB2 2PQAB 1JOQA 3I5JC 4EGVA 4B3ML 2BA0A 3I8ZA 1IL8A 4WORA 3HFZB 3NK9A 3J81i 3MVVA 1WCMB 2VRRB 3HIZA 1SYFA 3U9SA 3CW2C 3MC0B 1SLJA 4AYBB 3JAML 1OQRA 4C4VB 4EQ5A 4RH6A 3S24A 5C4HA 3UF8A 4CHTB 3H15A 1CFMA 2UU9L 1FD6A 3AI5A 3I4NG 1TGZB 5FLXL 2NVTB 4XX5A 1HZAA 1Y8RC 1VZ6A 3M62B 2BS3B 5HKHA 1KDBA 1EEID 4DHZE 3PRPB 3H9DA 3CKIB 2MGSA 1P16A 3KLWA 4RGOS 2KDIA 3R2IA 1WGKA 2B76B 4CBVA 4IUVA 4C3JG 3N9YC 1L2FA 3K9PB 2QSDA 2F0EA 2MBQA 1TQOA 1E7ZA 2QJLA 1ML0D 1HFNA 3NUHB 2TMPA 3P4QB 1SYGA 1PH7A 1OXXK 3N30A 1YNTE 3QIAA 4OL7A 1I4QA 3ABVB 2N1VA 5JEAJ 4G7HC 1PH9A 2BWES 4IM2A 4GLVB 3MXNB 5EKLA 4IUMB 2RDHA 1II3A 5A35A 4A3FH 2INPE 3GTJH 1JMCA 2QIEB 3CIRB 2LVOA 3RZOB 4IUPA 2UYZB 4F7XA 3QJYA 2RR9A 1H4RA 1HTQA 1MJCA 1FEHA 3BVMA 1TS3A 5C3EG 3CU7A 4WAFA 2K05A 4R8NA 2KUMA 2VH1A 3IT4B 4WJPA 1BNZA 2KFKB 2F0MA 1VQKA 3E6ZX 1E8ZA 2D2CC 1X3PA 2C60A 1LTTD 1MD2D 1QWYA 1DONA 1VD2A 1U4AA 3RNUA 3AEDB 3TS2A 3A5UA 1C0AA 4L5SA 3HOYH 2KA7A 3RLOA 2K5DA 2M0XA 5EE9A 5IKCM 4QMGA 4DAYA 3DDCB 4PNYA 3BDLA 3OMGA 1SMYC 3WAPA 4A3GG 2I46A 4I6NB 4QIWE 4L23A 2QILA 1TU2B 2VUMH 4REZA 3AE4B 1A3UA 4GSWA 1E1TA 1Y8PB 2DNCA 3VR5A 1I7HA 2M9VA 2L0TA 2KJ6A 3FAHA 3AEBB 1EYAA 4DR4L 4ZLTF 3ML9A 1ZYRD 2E5LQ 1RJTA 3VYSA 1A63A 2ICIA 3L3OC 3CCQA 5D2MB 3C3LA 5BN4A 2Y5BB 2RKSA 3N32A 2HIXA 2FJ2A 5DM73 3PO3H 1SSNA 3IVFA 3CRLC 4FXKC 3R7RA 4BAXA 4KSKC 3E5SA 1GM5A 4LFCL 4DR5Q 3FILA 1QLBB 4OO1G 3RZWC 2EJGC 2N8NA 1E8YA 3NELA 2ZVOA 2NZHA 3J7AV 4XT1B 4CGYB 3L08A 1KDCA 2WP9B 1D7QA 2NBWB 5LL6S 1LUZA 4YWMA 4GKJQ 4GDLB 4DR7Q 1FXTB 3L54A 2L0FA 1J0GA 2RDGA 1VQJA 5L37A 2LGIA 3ZKJC 3GTMH 4TQ0A 1IYUA 1SNCA 3R3OA 3NZUA 3U2SC 2ID0A 4JG2A 4R4OA 3GE3C 2I5MX 2WACA 4RGNA 5FK9C 4LDTB 3DEOA 4W9KA 4US9A 1U5KA 2CWPA 1AZQA 2W3RA 4OZBA 1WX8A 2BDNA 3HOXG 1EY8A 2N9LA 2JN4A 5FKAC 4EX5A 1G6ZA 4AQYL 1OXSC 2PZUA 2F0SA 2PW5A 2FNJB 4OXPA 4BY1G 4A3LH 1J6QA 3EJIA 2JXXA 3U50C 1HNXQ 4HROA 5IA7A 4WQMA 5EKKA 4YSXB 3PO2H 1K8AC 1SDFA 3KUDB 4JI8L 4HCSA 3AE2B 3A0JA 5CBEE 2M0AA 2JA8G 1FGBD 2PMZB 2N9KA 2WP8J 1TKEA 5GADC 1NE3A 4JYAQ 1TJEA 4FXDA 2LGSA 5C3WA 5G3LF 4TVAB 3K5LA 2F0OA 1OTRB 3CCLA 4Y7NH 3KYCD 4OO1I 3A5ZB 1TWHB 4WJ4A 3A9KA 5G55A 4ODGA 1D1KA 1L5PA 1N36Q 1SXTA 2NVUI 2NTTA 4AWJA 1SE3A 4JBJA 4F8CB 1L1OA 1HNWL 2DJFC 3E3XA 5IODA 3IAYA 3NTIA 1MHHE 4WWOA 4KY7A 3AXCA 1WSPA 2FCMA 3FRPB 4XDXA 4M02A 3VTWA 2G4SA 1GXDC 1TS2A 2JSOA 4K1RB 3QO2A 4JI2L 1KLVA 2RBMA 3HP3A 1B9RA 4BY7H 4YWKA 1N34L 1YHAA 1M4VA 2KOXA 5BYQA 1SRUA 3TDQA 4B3SQ 3EHVA 4HJKA 2L1AA 2CCZA 2RCNA 4FNFA 1T0QC 1U4RA 4A3FB 3JSVA 4BOSC 3TEYA 2DYBA 3GQBA 3J81j 3GTJB 3SK8A 1B2TA 4ZK9B 5CYUA 2WAQG 3SE0A 4ZUIA 4GNXA 1XD3B 5GQOA 2G3QB 4J1MA 5D14A 4YT0B 1X54A 4NW2A 2FE8A 4MHEA 1KXLA 1VR9A 5JPMC 3T1YL 4GLSC 3DVGX 4MM3B 2A69D 3TIXA 5IOCA 1E7VA 3ZXVA 3KBXA 2UUAQ 3M7GA 5JZEB 1HUMA 3BZCA 1WRDB 2W55A 3DBLI 3HRZC 4JWSC 1WD0A 5JEAG 3HOYB 4EFOA 3BG3A 3UIPB 1C4AA 3EGRA 2C9OA 3I4NH 3U4EG 2KHJA 1ICWA 2K4KA 3RFZB 4B9XA 1OQYA 2LJIA 3VYTA 1XLNA 1XTDA 1B9NA 1PRTC 5KGUA 3VDZA 3IFDA 3OOCA 2QEJC 2RSUA 4OIJA 1PH5A 3KLSX 2VUMB 1J8IA 4YIJA 5D6JB 2RHQB 3BVZA 3KFUA 1I4RA 1R7SA 3ZNGC 4GXBA 2WKCA 4N6EB 1RDPD 4PQXA 1K8GA 2PE9A 2A5UA 2GBRA 4C3JH 1JWAD 4ITKA 3TP7A 3VRAB 2ICEC 4B08A 2ZTCA 3V6EB 4LUZA 1VQ8A 4N59A 5JPNC 1T0SC 2K14A 3PO3B 3F2BA 1CHPD 2MBEA 1TS5A 3GDEA 1GB4A 2Z59B 4A90A 4YY3L 1PQSA 4KKTA 1MI2A 4OX9L 4P7IA 1XCTL 3O13A 1KAWA 3DUZA 4HMIA 4IPCA 1PFSA 1V86A 2BWFA 1YD8U 2XEWA 4JPSA 5GXGB 5H92C 4IJLA 1R9TH 3A1QB 4GN4B 3MC8A 2OTLA 5C5LA 5C0XH 5CV8A 1HXYD 3GTMB 2VL6A 4HAEA 3VR9B 4X66L 2BB6A 2ZPYA 5BMHA 4HIKA 1HUNA 1CZGA 2FMMA 5LNK1 4A3EG 1IBML 1XNRL 5M3MG 2F03A 2HJ8A 4JOIA 1AFPA 3TP6A 3FHWA 3DWGC 1WJNA 1D5ZC 4BFRA 4F7ZA 3UIOB 3PO2B 1YNNC 4HJ9A 1W3SA 1VQ6A 5ISRA 1ENFA 1F9PA 2MUYA 4A3GH 1VQOA 4MIUA 1CA6A 2TSSA 2HDLA 1WFQA 4UY8C 1LM8B 2BKRB 4LF4L 2Y3AA 1KF6B 4X65L 1KHIA 1HNZL 2O5JC 1KJTA 4KHVA 4Y7NB 2KK8A 2N9XA 2MH7A 2JE6I 4WRDA 4CDCC 4A9AA 3SHLA 2PI2A 3GV6A 3KDFB 1WXVA 2WXPA 1H9SA 4ZOHC 3DLLA 1ESFA 2F0KA 4ANXA 3EA6A 3GTPH 3S15H 5JVH3 5IYBG 1CMXB 2OTJA 2ZVNA 1QVCA 1N60A 2JPHA 5G3LD 4HDQA 1SBBB 3ZDMC 3W3AA 1C4CA 3J81E 3N1YC 2XK5B 2O6VA 2EPBA 3PUWA 5FOBB 4BY7B 2IY1B 3JAMi 4JI3Q 4USAA 3NTKA 4R4IA 4OVVA 1TR5A 1D2BA 2PPBC 2L00B 1C78A 5T8IA 3B08A 3C46A 1GB1A 2MEKA 4JI0L 2E3TA 4KGRA 4A3BG 2WB1G 3SR6A 1CQFA 2VZKB 4WFN3 1MJDA 3I72A 2H4OA 2I1JA 2J0TD 4X3SA 3PRMB 1X3GA 1I4PA 3PMFA 3KF8B 1P7FA 2YV5A 5ELDA 4W9DA 1WCMG 1TKWB 2HJ1A 4IDIA 4CYEA 1PRTB 4BY1H 4RAUC 1VQGA 1VDZA 5EAYA 4ICUA 4IWOA 2IHFA 4DAPA 3PV0A 2WXGA 1Q3LA 1MVKA 4DUYL 2CR5A 1D5MC 4JBMA 2JA8H 4JL9A 1I3QH 2IHEA 3OW7A 5I9OA 1TTNA 3AE7B 3KVFB 3MJ5A 4EZKA 5EE0A 3G71A 4HIOA 4HCPB 1J8CA 2CHWA 1F2ZA 1EY9A 3I4NB 2NPTB 1BBUA 4W9CA 2LGDA 2IYDB 1XX8A 1Q10A 1YN4A 5TR5A 1SE8A 1KOTA 1YITA 2DHZA 1FCCC 1ACCA 2F0UA 1NVID 2AYOB 4HWIB 4KDLB 2WKDA 3NENA 1EY4A 2WXIA 1PRTF 3UDFA 1S3SG 3PGZA 1P0RA 4MSQB 4IPHA 2CHZA 4YHHL 3CF6E 3CSFA 4B3TL 1SMXA 2QDLA 3MEFA 4L8JA 2IWHA 4Q0FA 4C3JB 2V3SA 3DCGA 4X64Q 4A20A 2IX3A 1FRRA 5CV4A 1OFFA 5LMUL 1NNXA 4PV1C 2KVRA 2DLBA 3PF5A 4US8A 1EUJA 4A3CG 1DZ1A 1SMYD 4GOPB 1ISNA 2NR2A 5IT9L 4P73A 4KTAA 1PH3A 2WNMA 1N32Q 3NVYA 1MFWA 3N1XC 1UBQA 1QOFA 2BGFA 3ONAB 1XMQQ 5MPOA 3LDZE 1ZOYB 1R9TB 1YX5B 1TY0A 5IGCA 4DNTB 1QVGA 3KWLA 4FLHA 2CHXA 3A74A 4IG7B 4OGQC 4K5VA 3Q22A 1BUIC 4JI7L 1E90A 2NWGA 2A4ZA 3S9WA 3SK4A 3OTOL 2LS01 3OIQA 1S1QB 4DV0L 1P1AA 1YX6B 2I38A 2PVGC 4GMVA 3MC9A 1WTWA 3KWVA 3TUOA 2EYHA 3P4RB 4OWWB 1SIJA 5IYCG 5JEAH 4A8XC 5ELBA 3B2FA 2DAJA 3IRBA 3KJPA 1LTLA 1H8CA 1CSQA 2UXBQ 3OWFA 4MGYE 3QB3A 1HZ6A 2EIFA 3J7AF 5NUCA 3IL8A 4ZCKA 2LFNA 5J22A 1X9NA 1VQ7A 3ETRA 2VQFQ 4LCDE 1E10A 5F2DA 4GZYC 3NUCA 1G2SA 1WX7A 4ZKBB 2O2LD 2D3CA 4YCVA 2A74C 4LF7L 4IURA 4YWLA 3CMEA 1U4MA 1K8OA 1F2RI 2AWOA 3N20C 1XYIA 3SDLC 2VQEQ 2KHIA 1EZ8A 3S15B 2EE1A 3R2TA 2KMMA 2AWTA 1ZDXA 3MXPA 3RYTA 2NN6G 1A0IA 4QGUA 1XCQL 1DM0B 2IL8A 1EWHA 3I2ZA 1FYCA 3NZ3A 1F0ZA 3NBIA 1TWGH 2B29A 2PVOD 1K51A 2KWDA 1BT0A 1SYDA 1FIQA 3AU4A 1WGRA 1QNKA 1ZKOA 2DZMA 1JE4A 3Q3JA 3ZRCA 4EUTA 1STBA 3NS8A 1Y69U 1IBKQ 4I6LB 1UH6A 5JJZA 3PF4A 2KT7A 2JA5B 3V62A 2XRQD 1GUAB 1N5XA 4ZHPA 1T0RC 1Q86C 1RHPA 1CZWA 2NVYH 4A3EH 5M3MH 2OWOA 1VQFA 1YBYA 3PHWB 1WTHA 3AMUA 1WXQA 2QMTA 2PCFB 4L5RC 2R61A 1G91A 4BY1B 3J81c 1TBEA 1CSPA 5KYIA 3ZIMA 3QA8A 1A15A 1NBWA 2AL6A 3A4RA 3EECA 3DHGC 2L12A 1PDXA 5ELFA 1V80A 3DWMA 1I3QB 4LWCA 1VS0A 1GVPA 2JQOA 4PMBA 2YYZA 3AH7A 2NN6I 2BA1A 3QWNA 4PS8A 4K7WA 3RMKC 3KK7A 2WV6D 2F3WA 1AWDA 3DBRB 3PPAA 5I2XA 1WTXA 1RL2A 3UE0A 1XEEA 1QE6A 1SE2A 3C2PA 3IFWB 4M1UB 4K6DA 1ET9A 2BS2B 2R2OA 2K1BA 1V9JA 5CR3A 3A56A 2PYKA 3F8TA 3TZDA 2B2WA 5JAVA 1SYEA 5IYBH 2O5IC 3H3VC 2LMCA 2WXJA 3DBLB 1F9SA 2FHTA 2PQEA 5C4ZA 1QQRA 2C7MB 2ZPNA 5CV9A 1VCIA 3DHQA 2XRSD 2BE5C 2I2YA 1QOHA 2JA6G 2ZM6L 1EQTA 1K28A 2CHBD 3DHHC 4TRDA 1VMPA 4KZ0A 1VQBA 1JC7A 4KGSA 3T16A 2JXTA 4A3FG 4DR6Q 1I6HH 1KNEA 1AYFA 1JWBD 5AZFA 2I0QA 1K8MA 3AM9A 3PIP3 5J1ZA 3OPOA 4A3BH 3U8ZA 2IX0A 1L1OC 2WAQB 1EU3A 1JQ4A 4TMAB 3ZNZB 5FO8B 1WTVA 5LXHA 2QW7A 5KYLA 4JI4Q 4U673 3W1SA 2IY5B 2KXJA 3A9JB 4MH0E 4K0KQ 1TY2A 2E76C 3MA2B 1SGHA 2K0PA 4N8X1 3GP7A 2MO1A 3FPPA 1J19A 4CDFC 5DAUA 1V5OA 1KABA 1RTNA 4DQOC 2E5LL 3AFPA 1WRIA 2KACA 1ZW7A 3CCJA 1Z2MA 1WX9A 1K53A 2B2VA 3I4MG 1YHQA 3I3CA 3CCVA 2Z6BA 1D5XC 4II3B 4AIMA 3IBEA 4Q5VA 3LJ3A 2HCIA 4J15A 5GROA 4DR5L 3NHEB 1XXGA 2VUMG 4GNXC 4NXMQ 2DZIA 3H7PB 3O65B 1ZKHA 2VNUD 4GKJL 5C0XJ 4DUZL 1PFDA 4DR7L 2E2IH 5IIFA 2M4NA 3RPFC 5DPRA 4K14A 4NY0A 2DY8A 2J53A 4HMJA 2KWCA 3M3JA 2Z4IA 2D5GA 1AE3A 2A69C 1STEA 2L55A 1EL0A 4NQLB 2IDYA 2N4FA 4A3CH 1AE2A 2WIIB 1VRAB 2KX0A 3L16A 5DCNA 2SNSA 5TSSA 2EZVA 1QT9A 1HNXL 4JV5Q 1S5BD 4IPGA 4PZ6A 1LFDA 1TWGB 2CH4A 2MO0A 4FN2A 3ZDTA 2ZCBA 1WGDA 4A55A 3Q8FA 4JYAL 2K28A 1WYGA 1MHXA 3Q3NC 2WU2B 2D11A 5E4WC 5LXIB 2QCZA 1WMHA 1HTOA 3CPFA 2N1WA 5D7GA 5E1FA 1E22A 1A70A 4DV2Q 5D94A 2VZAA 4A3EB 2NVYB 3CCSA 1N36L 5M3MB 4P72A 1IL2A 2DAFA 4A3LG 2V3PA 1V2YA 2Q8TA 1IGDA 3PUXA 1F2MA 5IGGA 4NAWA 2W82A 2BPSA 4KKUA 1C48A 2QGQA 3HGBA 3RUZA 1IBXA 1EM7A 2O2VA 4LNFA 2LGYA 1EQVA 2Q5WD 1U0LA 3D32A 1LXDA 2WXRA 1HTLD 5IP4D 3PUVA 1TWFH 1MJEA 3PTFC 3NP8A 4UP8A 3GTOH 3BIID 5JH5C 5I6YA 5A2QL 1H95A 4LK1C 3R7QA 1ICFB 3CD6A 1R4MB 4JI6Q 2PI2E 2GBKA 4F1SA 4RKBA 5FO7B 4FVMA 4IUQA 4II2B 4JX1C 5IN7A 2IY0B 1Z47A 3OIPA 5C44G 4HEDA 1AZPA 1RLFA 2NN6H 3AB5A 3PHXB 1SE4A 4XWWA 3HKZE 4W9EA 2KMCA 1F52A 1RF2D 2Q2IA 2M00A 5AZHA 1EIYB 1LACA 1MHWC 3SK5A 1KRHA 3HVDA 1Z9FA 2L4NA 2UUAL 3AYHB 3I57A 4TKOB 4AJYB 3D4RA 3H94A 1XQQA 1LV9A 3AQQA 1CKOA 2C7HA 3Q8DA 1I6HB 1I4HA 4CQNA 3WDNA 5CORA 2IW3A 3OJ3A 4HLEA 2C5LC 1ILQA 2RSNA 4A3BB 3W5VB 3ZW3A 3D0FA 2KKCA 2B8FA 3HOUH 1UEAB 1UZXB 4DGZA 1V81A 4IN3A 1SF0A 4BBSH 4MEMA 4W9IA 2C35B 1IYJB 3MHZA 4OVZA 4RA8A 1HH2P 4AH6A 1QKZA 3ZVVA 3SK6A 1WXMA 4BKSA 3WWVA 1MSGA 1EU4A 1VQEA 2M17A 4DXFA 1AEXA 2LUEA 5C5MA 3KYHC 1HQRD 2K5HA 1UWXA 3X0WA 3IAM1 2JRHA 5FLMH 4BKTA 4WJNA 4DXAB 2KDFB 1TWHH 5ELEA 1C7YA 3B0AA 1L6UA 4HXDA 2WDTB 1C79A 1JB3A 2GVBA 2HT1A 4KHPQ 2LXCA 4LNKA 3KF6B 5EJWA 3V05A 4ZRPA 3WIMA 2SOBA 4L5QA 1WIAA 2MJEA 2IGGA 4GN3B 2RDBC 3V96A 4OIKA 2NBVB 2E2IB 4HPPA 2JYOA 4DV1Q 2JYTA 2MW5A 2H89B 3AE6B 4DDID 1JE5A 3VYUA 2KECA 3C0RB 3TCAA 1P9DU 4JLCA 4H0LC 3J80i 3HEJA 1HR0Q 1DOXA 2X6LA 2XTIA 2JA6H 2E8GA 4A3OA 2CS4A 4OWXB 5EPLA 3ND9A 4NPNA 2WDRB 1YJ9A 1RKNA 2MP1A 5HY6A 4GDKA 2BOSA 1TWAH 2RQXA 3RD2A 3JC66 4MGIE 3NEMA 2INNE 4O42A 4A3JB 2WXNA 5DPSA 2EJMA 5GMVA 2WX0A 3MEHA 1PGAA 5C0XG 2VY3A 3RI7C 4XDCA 1F2YA 4LFBQ 1DOMA 1B4OA 2V4DA 2K22A 4R4QA 1I50H 3TSSA 1X3QA 2WGSA 2KVZA 1XPUA 3Q6BA 1C1YB 4RHSA 4K6LA 1PH4A 3N3KB 2Y0SE 1UF0A 1X1MA 3DWQA 2YVCA 4N9TA 1ENCA 3CHBD 3I4MH 2JX5A 3HOVH 1N5WA 3KUCB 1VCBA 2W3SA 4YSZB 5CV6A 1WH3A 4C00A 1WZ3A 4ZRZA 3Q8BA 1UEBA 2GRIA 3L0WB 2ZCCA 2FXQA 4JI3L 2IO1B 1TWFB 3VDYA 3IHPC 3GTOB 2X6GA 4DU9A 2JJQA 1HE8A 4IM0A 1TZOA 5IOIA 2HQEA 2R3ZA 1EY6A 2J7QB 1KLUD 3H09A 4A3IG 4W9HA 1F2LA 1Y1WH 4KK7A 4C1NK 1LYLA 4V0BA 1EIGA 1F9JA 1DYQA 5C0XI 5E6OA 4K3CA 2NZOA 3A54A 3K7AH 1IPGA 3AE9B 1DJRD 2D07B 1B9MA 1E2ZA 1PH6A 1CK1A 2Q2TA 4C7ZA 1GUTA 2B2UC 1CKNA 2X38A 2F1MA 1JT8A 1FM0D 1K52A 2HTHA 1FNUA 2SEBD 2HE7A 4RG1A 4ZRKA 1I4XA 5C1ZA 1IGCA 4FBJB 2JSVX 3UQBA 2F0QA 1MIUA 1WZ0A 2N7JA 3BK1A 1UGMA 1STGA 1HZCA 1E1OA 3P4SB 2JA5G 1WE7A 2M1MA 3D31A 3GTQH 2L3ZA 1GD7A 4GLXA 3AECB 1VQ9A 2WXMA 2EYJA 4ULLA 3ZJUA 1EQQA 3HOUB 2FIFA 3T56B 3T51B 4FHJA 2XGTA 2BH8A 3H91A 4BBSB 4YSYB 1PLFA 3VH4B 1CKMA 1Y14B 2BE5D 2K7VA 2LVQA 3H1UA 3X3MA 4X64L 1L0YB 5G5GA 3ULJA 3AEGB 4C80A 4MJSB 1YVCA 1X55A 2A5HA 2K04A 4KY6A 4X57B 2ATWA 4ZHOA 3K0XA 3CCRA 1L0XB 3RN5A 3KQ4A 4OEMB 1PHJA 1FFUA 2N7DA 1N32L 3BJUA 1V1PA 2PZTA 2OEOA 5M5XH 1NJIC 1XMQL 2B39A 3DMUA 1UNSA 1OO9B 4R1JA 1CHQD 2LFIA 2A1AA 5C44H 1XPRA 2HHHQ 2V4LA 4DHZB 1WTPA 2EYFA 2JF5A 3GTLH 2ZXRA 2KJXA 4DR3Q 4HJ5A 1MPEA 1FFVA 3MXUA 5GAHC 2OXPA 3T1HQ 2WXFA 3CCMA 3UDXA 1VQCA 2JA6B 3DQVA 4AUQC 2UXCQ 1V1OA 1S40A 1EOVA 2C9WB 2N9PC 4DHJD 4JC0A 4HJ8A 4L1BA 3OYYA 2CH4W 1TWAB 4K5XA 2UXBL 2GVAA 1KH0A 4LJOB 3M7NA 1YQBA 2KENA 4G4KA 2JYEA 4DV7Q 3SDZA 1OXUA 4BA1I 4YXDB 3A55A 3D6CA 3P7JA 3OSOA 4KI0A 2FUG1 3DBRI 1PTOC 2B2WC 3KYDD 4ZRJA 4FADA 2VQFL 1I6VC 1B53A 1I50B 4DFAA 1B1ZA 1FNWA 1ENAA 3S1MB 1GAQB 3RZFA 4ZKCB 4XQQA 4WH4A 1V9PA 1NR2A 2UUBQ 2WXLA 3ZYYX 2R6GA 2L0CA 2PQAA 4A3MG 4WWNA 5BR8Q 4M8NA 4QUFA 3L9AX 2VQEL 1WR1A 5I4DA 3I4MB 3HOVB 2OQKA 3VH3B 3BK2A 3W1GA 3NBHB 1D8LA 4CO7A 4DDGD 4C4VA 1LGRA 2KDEB 2AQ3B 4KN4C 1DOYA 4HCNB 3SU8X 5HGTA 1SROA 5CHVC 4NP5A 2OQ0A 3W1SC 2ZTEA 4AOFA 4QIWB 4W9JA 1Q1BA 1BR9A 3E9HA 4XTCS 5IGDA 1BF4A 1IBKL 3NS1A 4OZCA 2IT1A 4QCLA 1Y1WB 1N33Q 1WTRA 3FKIG 4LJZC 4X62Q 2E2DC 4A93G 2GI9A 1HQMC 1GOZA 3D6WA 2F0VA 4R4CA 1YZ6A 2B2VC 2EJFC 3K7AB 1IZ6A 3RMHA 2MX2A 1FGUA 1TWCH 4RM9A 4C3HH 3Q69A 3M4YA 2E75C 1FMAD 3PREA 4K81A 2NS5A 4KKJA 4KD4A 3EFXD 1JORA 1SYBA 3Q23A 2BYEA 2ONQA 1DOKA 2KX3A 3VA5A 3QAQA 2K03A 1TKYA 1WYWB 1F9RA 3DM3A 3MXNA 4JBWA 3SVMA 3G4SA 3GTQB 3MTSA 5BYSA 3M85A 2ASBA 2J4XA 1PZKD 1NEKB 4IOCA 2H1EA 3I91A 1S3OA 2F3VA 2XN9C 4LUOA 2KTRB 2F0IA 2ZXPA 3PSEB 3DHIC 4GB9A 5J3BA 3VUWA 3ZJVA 3AE1B 1K9MC 3I73A 2N3SA 4H7BA 3ICEA 1K0SA 4ZAIA 2D2QA 3URYA 5LMNQ 1MI0A 4ASWC 2BYTA 3NG0A 2KFKA 3TN2A 1U4LA 3APFA 2R92G 4N9PA 3VR2A 2WXQA 4E71A 5D3DA 2UUCQ 4DV5Q 4B95A 4V190 3M95A 4H2AA 3OJ4B 2XVSA 2KQ7A 3TP8A 4DR6L 2Z6KA 3GOEA 1KNAA 3K57A 5M5XB 4A3IH 2IX1A 2PW7A 4L6TB 2J0MA 3NVVA 4G0NB 1XNQQ 2FIDA 2Z0SA 3BZKA 1BDOA 4QUCA 3Q2AC 1X32A 4JI4L 2RF4A 5C44B 1SNQA 5DLQE 1XTCD 2O6VD 3BU2A 4RMFA 2F3IA 3GTLB 4K0KL 4XYQA 1K3BC 1PYBA 1J7AA 1ONLA 2KEDA 1FXAA 1PZJD 2QDBA 1BCPD 3BINA 2I1KA 2D0OA 2CW0D 3ERQA 5K36H 1W6KA 3M9BA 1GG3A 1EWIA 1Q8IA 2VXWA 1NY4A 3TS0A 2MHJA 4NJCA 5CBAE 5IGFA 4BZAA 2GOWA 2JA5H 2FUHB 4OZAA 2L83A 1I42A 3RR5A 1PH1A 4FXCA 4PZ8A 4NXML 5IT9E 4YTNB 1BBWA 2A6EC 4GDLA 3ZTDA 1IBLQ 3TRZA 1R4MI 3AE3B 4XDDA 3U7ZA 3CC2A 4EZJA 4LDTD 1LO5D 1EY7A 1TYGB 1YMHE 4PYZA 1PTOF 1PUTA 3E56A 1YN5A 2DJGC 3S2DH 3LGJA 1HR0W 3CXCA 2BB5A 1N6ZA 3NQTA 1STHA 1QCBD 2MWSB 3J80E 2PE6B 1L0WA 3E9SA 4DR1Q 2WDQB 1S5DD 5EE1A 4NJ7A 5LLIA 4JV5L 1WF9A 3HZXA 3JW0X 2H5XA 2X69A 4UDUC 1QZHA 2KC2A 2B63G 2HD5B 4ABNA 4O1NA 3VTUA 1T5XD 4IUTA 5AEKB 4JPBW 5FO9B 1FL0A 1CM9A 5DNFA 4DV4Q 4RKLA 2WXKA 2K6AA 4ANVA 3QK0A 1JCKB 2HDEA 3HOZH 1HFGA 2IZVB 2NMQA 2K5PA 4LK0M 1ZXHA 2WQYB 4DBGA 1YN3A 1QUQB 4HJAA 1K8RB 1IP9A 4LJPB 2OHFA 4FA6A 3OMCA 3UGBB 4XE0A 2KQSA 4DV2L 3I4LA 2R7DA 4O0AA 3PLUA 3MAQA 2PJHA 4NAMA 1XO3A 3F2UA 1I94Q 1TWCB 3JVZX 4KIKB 2N7EA 4C3HB 3PIOA 3TREA 2K6QA 3J81L 1GHJA 1V49A 2IO2B 4A3JG 2IO0B 4AJWA 1U9RA 2M8SA 4IWPA 1S5ED 2QDFA 3MJWA 2LXKA 2ZJQA 1PMRA 5J2RA 2XWJB 1KL9A 2WINB 4JI6L 3OG5A 1XT9B 1E9MA 1X56A 4A3MH 3UQAA 4KHZA 1GHKA 1AP0A 2K01A 4G3XB 5J18A 3IAS1 3H0GG 3K5OA 3UDGA 3NZSA 1UE1A 2IJ0A 3E0EA 4OELB 2V9HA 4MM3A 2G45B 1YNJC 4B9KA 2KBNA 4LTUA 3B6YA 4X3KA 1BUVT 1JJ2A 4K2KA 4U68A 1WJUA 3GO5A 1H9MA 5IP9G 2B2TA 2JZPA 5J17A 1W2BA 1OQQA 3TMEA 3MFYA 1NYQA 2K32A 3F1ZA 1F1HA 1PYSB 2ZJRA 2LRWA 3TEHB 3CPWA 2JUOA 5C2TB 4A3IB 1VQ5A 1SYCA 4JI1Q 2K9XA 1YHBA 1X6OA 3FKIH 2F0NA 1CUKA 4A93H 1O78A 5I6WA 2ZW1A 4GN5A 1Q82C 3VQIA 1NUCA 2N88A 1Q5WB 2IGHA 2WWZA 1VQIA 4OWTB 3NHHA 5IGEA 1WM2A 2Y5PA 1Z6HA 4FF4A 1L6VA 4RGTA 1IKLA 4L63B 2LSSA 4WWMA 5JXVA 3ZNID 3Q3FA 3AE5B 3HKZG 4YTPB 2MFIA 3V2TA 1LTBD 3S1RH 1QZGA 4N9F4 1DGJA 5E6JA 1UAPA 3WAOA 1EWYC 2EYLA 5IYDG 1STNA 1PA6A 2HDMA 1W6JA 4KHPL 3HOUG 1XJVA 1RWSA 1VMCA 3OW2A 2LRUA 4BOZB 4BBSG 2Z1CA 3A1QA 1RODA 2LD9A 1FXIA 1YI2A 2KDMA 3W9CB 5AJ3Q 4RGMA 4DV1L 1RFAA 2GMIC 4MTKA 4KSLC 1E2VA 4Y52H 1ZP0B 4PS3A 4MSMB 2L1BA 3S2DB 1E7UA 2DUDA 4JI5Q 3H3VH 1CJEA 2C7NB 2R92H 4JWUC 3TL5A 3VRBB 1HR0L 4M8AA 1SNOA 5FLMG 2EY1A 2ACZB 3A8JE 4DV6Q 4NQKE 2XIWA 2PW9A 1IKMA 2D10A 3GS2A 5E4XA 3CAMA 1FD7D 2DNFA 5IT9c 3BY4B 1PH8A 2B2YA 2CQAA 4E3CA 1PTOD 4O2DA 5ELOA 4P1BC 1VQDA 1SN8A 2BW2A 1C9OA 5EBDA 4JQWC 3CC7A 1SFOH 4DAVA 3HOZB 3NXWA 1J5EQ 4LFBL 1CTMA 3LWEA 4JCVE 2REXA 4P1CC 1RYJA 1VQNA 3B1LX 3KDFA 5JOBA 1ZGUB 1QG7A 3K8AA 1YNXA 3J80c 1HPCA 3QCAA 2B3GA 3HRDD 2DZJA 3PRZA 1H9RA 1TVXA 2CFMA 3QOLA 2V1CC 2K50A 3SEBA 4DF7A 3DVNU 3AMZA 3OLMD 2KANA 3I70A 1MBYA 4P16A 2VH2A 2MPMA 2KCCA 3DBHI 3CMAA 2WHIA 5BO4B 1WFYA 2MBOA 3PIPA 4MN3A 2A19A 1ZDVA 4M00A 4D2KA 2XK5A 5DM63 2DX5B 1TXYA 5LHY1 1EYDA 3K6OA 1VZ8A 2KMAA 1EOTA 2Z8LA 4BKGA 1E8WA 4HEA1 4C2MH 2AL3A 3PS6A 3VTVA 4S0RA 3T9LA 3EBEA 2ZNVC 2WB1E 1EWCA 4NKLA 3K81C 2NZ1D 1J7CA 2O4XA 2EKEC 1NCVA 4A3MB 1JW9D 3I9V1 2MQJA 3KF8A 2Y0SG 3EVQA 2BDOA 4ILWA 2J7ZA 4DV3Q 3HOVG 5CHFA 4K2LA 1VQPA 3M4OH 3C1EA 3CC4A 5CHWA 2Z9HA 4AYBE 2ZTDA 1QOGA 1T3QA 1O7IA 2R93H 1UELA 2LUMA 3CRKC 1NI2A 4DAYB 4JE3B 2B63H 4RF0A 2FINB 1PDQA 1XLOA 3MXGA 2E74C 5GAGC 1GUSA 2N55A 3B9JA 1CZPA 1K3RA 3T4AC 5C4XG 2HTME 4JVZA 2NPTA 2BTEA 1OEYJ 1Y1WG 1P7EA 3Q6SA 1YQ3B 5IWAQ 5IO9A 3M4QA 1JROA 2QC8A 1F9QA 3A8KE 3FKIB 1EFID 3SXHA 2DNEA 5I2YA 4A93B 2KDBA 1Y1VG 1BVSA 2F0JA 4B3RQ 4J6HA 3Q24A 1E8XA 3ZTCA 2Z0EB 3D4WA 5LMNW 2WLBA 4A3JH 3AEEB 1RM6C 3M3YH 3Q3OC 4I7AA 1JOOA 3S1RB 4FF3A 1NDDA 4ARCA 3I90A 5HGQA 4HIMA 5M5YH 2KLCA 4A3PA 2F0DA 4GOPA 4POFA 5GAEC 1VQLA 1B3AA 2JP1A 2V3NA 1VQHA 2R7FA 1X65A 1ESRA 4CKEA 4IQZA 2G1EA 1EIHA 1I4GA 2OCEA 1N63A 2LVPA 3RNGC 1YIWA 2KTFA 3RCZA 2EYMA 3GB1A 2FAZA 1EZ6A 2HHHL 3HUIA 5DPWA 2FCNA 3PGEA 3AU7A 3H0GH 4HCEA 4HIDA 3RLFA 4GKKQ 4DR3L 1JOKA 2F0PA 1XLQA 3GV3A 2R92B 2M56B 3T1HL 2N49A 4LF6Q 3VUYA 4IFDJ 4B3SL 4B9WA 4RCOA 5IP9H 3G6JB 2EQSA 3JAME 2A8VA 2UXCL 4FJVB 2B8GA 2KQ3A 4GOCA 2KCMA 5BN5A 3H7SA 4TV3A 4FF2A 1T6BX 1S5CD 1BBXC 3ZUNA 2JZ3B 1WTQA 1M90C 4W9FA 2A6ED 4JOIC 4XT3B 3Q8EA 3WANA 2UWQA 1STAA 2UXDQ 5FLXE 4KY5A 1EO6A 3A9KB 3VFKA 1NSNS 3K0YA 4DV7L 2EXDA 3CSTA 4YL8A 1VQAA 3W2DA 1PGXA 5EPKA 1SFOB 2EMTA 4WJOA 4BBNC 1L1OB 1SAPA 4KLKA 1GJZA 2NVQH 3KJOA 2DYMA 1H9KA 3T53B 3KLSA 2UUBL 4HKZE 1ZE3D 3LYYA 3R8BA 2QKIC 4ID6A 4C3IG 2D3AA 4UAIA 2K5NA 2WDVB 5BR8L 1KRTA 3H6NA 1JWMD 2MQHA 4KKSA 3KBGA 4A6QA 2ZNVB 4F88A 2V4IB 4WWPA 5IYDH 1KTKA 3BYYB 4GS3A 3Q8CA 2Z6KC 3HKSA 5KNCA 4E74A 4KMUC 3IFTA 4FP5D 2JY6A 4G57A 2BYVE 1VJKA 2JQRB 1E3PA 4DHJB 1UE6A 4BKSD 4I6PA 4GNXB 1ASZA 2MCNB 4GIVA 4C2MB 4HPLB 1KLGD 4M01A 2JT4B 4ANWA 2V1YA 1P3QU 3K9OB 3LWUA 5HG2A 3S14H 1C9FA 1FRDA 4LLGM 1N33L 4X62L 5AUIA 1BCPC 3U4VA 4ZUJA 1YQ4B 4KGTA 2FFKB 2R7ZG 2CW0C 1STYA 3KW5B 2KZRA 4XYCA 3M4OB 3SFEB 1IW7D 5CC4A 2MP2B 4EQPA 1PFMA 1C4QA 2F4IA 4M8MA 1B7YB 2GBJA 2PZWA 4QF4A 3R93A 2R93B 3APCA 1GUWA 2PMZE 1S5FD 4ME5A 2B63B 1O80A 1JWUD 1P98A 1PGBA 3QWZB 3TP5A 3HK0A 2WXOA 1RD9D 1D4BA 2WU5B 1CI3M 2QA4A 2K3UA 3T3NA 2KOLA 2EY6A 3C19A 2YTYA 3NE5B 1I5FA 2F4VQ 2KHWB 1P8LA 3K80C 1GJXA 2DBYA 2M2LA 3QIJA 3U7DA 4C56C 4S3SA 3QR8A 4LW1A 1ZXTA 5JJLA 4TUUA 5H1SE 1CT1D 2AKWB 5EQ0A 1ROEA 3QHTA 4B0EA 3A7AB 3KOJA 4C3HG 3VAWA 4NJ6A 5KIXA 1YNJD 3F2CA 2BS4B 3UINB 3QX1A 4XQNA 1KDAA 1A2UA 3UE1A 5LMNL 4RM8A 3N52A 3M3YB 1AW7A 2RMMA 4WAAA 2HIVA 1A2TA 5BN3A 4KD3A 5M5YB 2XBBC 2YTVA 2UUCL 4DV5L 2KWVB 1MKHA 4B6WA 4MZ9A 1M1KC 1WJJA 4MDKE 3S1MH 1JRPA 2NBUA 2F0HA 5C3XA 3WAMA 3WOFA 4EZLA 3L0OA 2KVMA 3G7LA 5EKIA 2C5CA 2L11A 4MELA 3QQ8B 1XMOQ 5CTRC 1XNQL 1UE7A 2MJ8A 4LUVA 1HTPA 3BVGA 1E0BA 4KDIC 1G51A 3L4PA 4KX6B 1O7YA 3A9JA 1WXAA 4NNJB 4CKBA 2L8JA 2EDGA 1C76A 3H0GB 3ENEA 4MT5A 2L9HA 3GZNI 3K58A 3U58A 4WIPA 1UBIA 2GBMA 3ITPA 1EIFA 1DXMA 3RT3B 3PV1A 3MTNB 2D5DA 2ZM6Q 1FJGQ 2NBFA 5C4XH 1HRJA 1RCVD 1HZ5A 1Q46A 2GA4B 3LXFA 3WOEA 5D3IB 3ML8A 2Q2UA 4K8IA 3H7PA 2GBNA 2CKHB 2EY5A 2N9EB 4IWQA 1LTRD 3PSIA 3I4OA 3AEVA 2KYWA 1H9SB 3H8HA 1L2NA 3FC4A 1YJIA 2JXMB 1Y1VH 4IM3A 1XWEA 1IBLL 4A76A 1V6EA 3W1BA 2NVQB 3FKYA 4BBNF 4LF5Q 1B8AA 1SJHD 4X3TA 3JAMc 5K36G 3HKZB 2B2TC 4IFDG 3W5OA 2JVCA 2BT6A 2BH2A 2O6VB 2PNHA 1IYFA 2CU3A 2HCCA 4AS1A 2RHSB 3FDTA 4DR1L 1B44D 5FLXc 2LHEA 1BCPB 3F2DA 3Q8AA 5EGTA 1TZ1A 3P2BA 3QC8B 4IKGA 4IC7B 3P42A 1PYWD 4HJGE 3G48A 2OJWA 4P75A 3ULPA 2CJNA 4DV4L 1BO0A 1JALA 3NWSA 3NSWA 4PMWA 5IY0A 2LKVA 3LX0A 5LL6X 1G8ZD 1L4ZB 4WQOB 5DPTA 4DUZQ 1GNUA 3VXWA 1YJWA 3DBHB 1VF7A 3S14B 4P74A 5JJKA 3AEAB 2SAKA 2W9NA 2A68C 2VB2X 2DYOA 5COYA 4IJHA 1YJNA 1RIPA 3GTKH 2HUGA 3EFCA 2P5ZX 4MACA 1I94L 1BCPF 3ZXRA 3MHSD 2PIAA 2D62A 4A3DH 5ELNA 3S1QH 3AEFB 4M0WB 4BA2I 2GB1A 1GUNA 2ZXOA 3NRZA 3MWYW 1WGGA 1Q7YC 3A8IE 4IFDI 4DR2Q 3HOWH 3M63B 4G50A 3VA7A 2R2QA 3TBLD 5BMGA 3HOZG 1ET6A 1LABA 4BVUC 1ZUD2 4DNRB 1Q1EA 3HS0C 3IG3A 4K7SA 2MSED 2L7RA 3WALA 2NUCA 3U52E 4F8MA 1B50A 4DK0A 3T3OA 1WI5A 1XPOA 2L76A 4K3BA 5H8YE 3ZJYC 1PTOH 2KJRA 1WXSA 3EROA 2IO3B 1FO4A 4DPGA 2RA4A 3STBD 3TEXA 1I35A 3QARA 2F0LA 4C3IH 4UP9A 2ZJDA 5EBCA 2DWQA 3K59A 5CX3A 5KHOA 4MTNA 1JMLA 1C8CA 4LFAQ 4FDBA 2XWBB 1IHZA 1OGWA 3OAWA 2B2YC 3D3RA 1PXUA 2KAJA 3PZ8A 2AUJD 1AARA 4QAYA 2PNRC 1VF5C 1G291 3U9OA 3TMPB 2KQ4X 3W5UB 4NPSA 1VQMA 3P75A 5EPJA 3MFGA 2CQOA 1Q90A 1A6XA 1RFKA 3ONSA 4YCUA 1V43A 2KJHB 4TSSA 1A5RA 3L2PA 1TIFA 4K5WA 2RSOA 1HEZE 4J3OD 4JI1L 4KV2A 2LY7A 4TQ1A 2L5TA 1Y8OB 1LT6D 2Y0SB 1ZPSA 5EE3A 3IKJA 3Q0AA 2R7ZH 1YJ1A 3ZO5B 3Q3MC 3T8MA 3DEPA 1WY8A 1WR6E 2IPKD 2QEXA 1YIJA 5EDSA 4HR7B 1G6PA 1EY5A 2F0TA 4KN7C 3RZDH 1SE9A 3KUZA 1NTGA 2LJ5A 1Q1OA 4RWSC 2PLPA 3PLVA 4L5TA 2K8BA 4HVBA 5C4XB 4LF9Q 1UGJA 3S2HH 3K5NA 2MP2A 4GN1A 2OF1A 3AV8A 3KF6A 5JJIA 4LF8Q 2A6HC 4DKAC 1JQYD 4DNIA 4PMCA 4NXNQ 4ICVA 4DWFA 1FCLA 2Y5CA 2FCSA 3NVZA 5C23A 1WJ6A 4MGKE 2HD3A 3NOBA 1Y1VB 3HM3A 4B3MQ 4YCWA 4CKCA 4LMQD 1E7PB 1C77A 2JWUA 2KN5A 3C1FA 2PMVA 5AJ3L 4PK1A 3RNFC 2KNBA 3IT6B 5KEEA 3X3NA 4W9LA 3PVLA 1LT4D 5IP7G 2AX5A 1ASYA 3L17A 1EEFD 4JI5L 4BBRG 5HURA 3RN2A 4UP7A 1BQQT 1MSHA 4DV6L 3TQYA 5C4JH 2UU9Q 1EYGA 4HDOA 1VLBA 4L2YA 1TT2A 1Y8NB 2SDFA 4EQOA 1VZ7A 1HA6A 2LHDA 1EY0A 5M3FG 5G5HA 4QY7A 4ME3A 1L0VB 1TT5B 5L83A 5T1GA 3NPPA 1A62A 2PKOA 3CF5A 1U4PA 2E2HH 1L4DB 4QJFA 2CU1A 1J5EL 2G9HD 2JA9A 2EELA 2KO3A 1B3QA 2I5HA 1WJ4A 1KAAA 2PPHA 2K75A 4MH8A 5FJ8G 5C6AA 5C3EH 3TEZA 1GC7A 3SD5A 2MA9B 4GOPC 3GTKB 2BQQA 3VVWB 1CA5A 3CQZH 4J6IA 1EYCA 4DA2A 1JJGA 4A3DB 2XNAC 3S1QB 2RDFA 2RPQA 4S17A 5IE8A 1R4NI 3N6RA 3E0JA 1LT3D 1WOCA 2DN8A 2EMSA 2LI5A 4NZLB 1WD1A 2NYZD 4OHJA 3HOWB 4IUUA 3TJPA 2EXZA 2EY2A 3A7LA 1ZXIA 1QJOA 4CJ2C 4F87A 2GLSA 3EFUA 3Q14C 2JK8A 2LMCB 2MBHA 3L13A 1PTOB 2LWPA 3RULA 4A3KG 4LNIA 2MHVA 3RNBC 1QOAA 3NVWA 2VB3X 3D4DA 2L32A 3W1YA 1X3EA 3P1HA 1NAPA 4C3IB 3ULLA 4A75A 2JA7G 4IFDH 1SNPA 5CMDA 3ECIA 4DK3C 4DV3L 3HVZA 5KNBA 3VYRA 4HSPA 3TBIB 1K83H 2BKFA 4YTMB 4IOAA 1V1QA 3H3VI 4JIOU 4K7UA 3HHMA 4WJ3M 2IBIB 4FJZA 3U30A 3CCEA 2L52A 2D0PA 2BCOA 3A4SC 1NMGA 3PT2B 5AUKA 3E9IA 4OO1H 1HJPA 3KLRA 4C1NI 4ZDVA 1YJJA 4DK6C 2KFJA 3JYUA 3HM6X 4KKIA 4XGAB 1C3TA 3EIVA 4IALA 3S1NH 4HPMB 1UD7A 4PZ7A 5IWAL 4DR4Q 1HZBA 4X3UA 4N8FA 3U4ZA 3FP9A 4Z9CB 4FF1A 2J52A 2R7ZB 4CJ1B 2DGYA 3G6EA 2FCQA 4B3RL 2KN4A 3RNEC 2R93G 5M5WH 3HOXH 1LTID 1KFYB 1O7ZA 2AMCB 4XYOA 1K73C 4LFCQ 4ALPA 3VR8B 4R9WA 4HJ7A 2KEEA 5E7NA 4AYBG 4E6IA 3RZDB 1ILPA 3LB8C 4MJSA 3ND8A 3ZRFA 2PO4A 3A33B 3NWTA 1KD1C 4RNAA 1UE5A 4GU2A 2K25A 4PT5A 1UUPA 2Z0DB 1SNMA 2EYOA 3QG1A 4IUNA 4IZ8A 3FMCA 3S2HB 5IAAC 2XSCA 2WXHA 3PCOB 4P2CB 2YTXA 3N1ZC 5M9OA 4M0WA 4HKQA 2MNAA 2Q2HA 2MJ3A 3GZNB 4IPDA 4CHKA 1E2WA 1PFBA 1F77A 2H88B 4OONA 4AQYQ 2M19A 2QCPX 2KC1A 1T9HA 1IW7C 4YWGG 4Q2JA 3MP9A 4DAMA 4JI8Q 3CMMB 1IXRA 1QF6A 1WI0A 2RD0A 4GKKL 3DVNV 1A8VA 4HK2A 1PZID 4BXXG 3TEWA 1WTOA 4LF6L 3BDCA 4EE2A 3AN1A 3GTGH 2VW9A 4URKA 5C4JB 1K0RA 4K8JA 5JVG3 3PUZA 4NB3A 1OXVA 1WGYA 5FR6A 3V60A 2IGDA 1V97A 2DY7A 3FEWX 4KV6A 1WMHB 2WAQE 4NMZA 2MJDA 2G5DA 2UXDL 3PIO3 2JWZA 1PFNA 1EUVB 4KVGB 3I56A 2K5VA 4JW0A 3RUIB 1BMLC 1HNWQ 3DWPA 4QB4A 2E2HB 3S2AA 1IUEA 3I3TB 1SIFA 4BWGB 1PV4A 4R8IA 2K52A 5J39A 3R3MA 1VQ4A 2EKIA 2YEPB 4NAWB 5AFWA 1T0YA 2JRIB 3DVGY 5BMIA 3P63A 2A73B 5C3EB 2J0KA 4JI2Q 3J80L 2KD0A 4FJYA 1IBXB 2SNMA 4XIGS 2O2VB 3IXSA 4HN7A 2FBWB 1N34Q 4CDDC 3DM1A 1QB5D 3CQZB 4KJNA 5FR3A 2Q8IB 2GN5A 1YEZA 1A3VA 3NBHA 2QHOA 4KZCA 3DXJC 3L10B 1GUOA 1NENB 1L7YA 1SSOA 1B70B 5C3JB 4UHVA 4XC2A 4WJWA 3MHBA 1BKBA 1QILA 4FULA 1KIXA 2B2UA 4A3GB 2LXAA 2J0JA 1LQBA 4AQ7A 4MNOA 1QZEA 1AN8A 4FO2A 2INCC 1NR4A 2MRPA 2KWUB 2YEPF 2A68D 2K5WA 4FXGC 3T1YQ 4LNOA 1MGSA 3VR4A 1NBFC
chains in the Genus database with same CATH topology
1N61A 2RVLA 1JICA 1SJED 1LTGD 2Q8RE 3ZJTA 4G7ZC 1GPXA 1K83B 3BDOA 1HHVA 3GTPB 5IGBA 2F0GA 2EOTA 2AQ1B 1QNUA 2W54A 1SNDA 4B0MA 3NQIA 4KJOA 2D9UA 3C8YA 5CGKA 3S1NB 4DN4M 1DOLA 1D1IA 3D8GA 3MZ5A 3HG9A 4IOIE 1FNVA 4ARIA 1ZYRC 4ZQ3A 5M5WB 3HOXB 2JEBI 1R4QB 4ZRQA 2Z4HA 3L7ZC 1SEBD 2JA8B 2F0WA 1CQVA 4WURA 5E3FA 2E6XA 3SR1A 4RCNA 3SFDB 1DOIA 1D6EC 2KHSA 1G2TA 1WWTA 1E0ZA 2AUKA 4G7OC 5CV5A 5T1IA 4N58A 1JWSD 1A3TA 1OXTA 3ZGZA 2NTSA 3FVQA 5KNDA 1H9JA 1M8AA 4EQNA 2CJOA 1LLRD 3P1MA 5HHDG 4GDKB 4JK1C 1DD2A 3NTHA 2F0FA 3GTGB 1SB3C 2VZKD 2A6HD 1E6EB 3H6MA 1ZEQX 2QF7A 4RHRA 1N62A 4XWTA 2K5QA 1PRTD 1UWMA 3UI2A 3BYTB 5D65A 4I7ZC 1O7LA 2ZT9C 3PO0A 1WVLA 3T13A 3P4PB 4EVOA 4XQJA 1R4PB 4HTHA 3B2GA 4FYDA 2KCNA 2I07B 1NI3A 5K5PA 2J42A 4R3DA 5A2QE 1Q12A 3V3XA 4CJ0B 2EYPA 3J9CA 1FR3A 1JR0D 5I9PA 3UI3A 3BWUD 5ELCA 2JEAI 1V8QA 2FMCA 2OEDA 3FILB 4TQUS 3CWIA 3S16B 4BBRB 1J9OA 3TZUA 3FPUB 3KUPA 1C4PA 1BXTA 4DXGA 1IYVA 2JU6X 2LEKA 2YU9B 4H13C 1V8CA 3QOJA 1YNND 1XF5L 1LTSD 3PZ7A 3OHXC 3WCQA 1XLPA 2ENBA 3GD7A 5M3FB 2OT2A 2AWNA 3BZDB 4P6VF 2CVRA 1NYRA 5BYRA 3ZQ4A 5CV7A 2N0SB 2BBCA 1GUGA 1Y56A 1HA5A 4BS9A 2RPVA 5HI1A 1Z7TA 2ZW0A 3PUYA 1DCZA 4XXEA 2PTLA 1VDVA 1J7BA 2V0GA 1F2RC 3LNNA 2AQ2B 3K5MA 1S4ZA 1V1PB 5KRUA 5DEHA 1TKGA 3AE8B 3EQLC 2G9DA 3P20A 4I65A 4HSVA 4DK1A 5HFYA 1BOSA 4RFBA 2K33A 1TIID 2EVBA 4HRSA 4A3KB 4J8QA 1RTOA 4RF1A 1HCZA 3AB9A 3VR6A 3OWEB 2JA7B 2WS3B 4C7YA 3S17B 1TS4A 1QOBA 1T5EA 2NVXB 3BS1A 1K50A 4LAAA 3RD4A 1LTAD 4H44C 2E2JB 2NB0A 3VR3A 4NDXA 4ZYSA 3J7YW 2WB1B 3DWAA 1LT5D 3EUB2 1JOQA 4EGVA 2BA0A 3I8ZA 1IL8A 4WORA 3NK9A 3MVVA 1WCMB 1SYFA 3U9SA 3MC0B 4AYBB 3JAML 1OQRA 4RH6A 5C4HA 4CHTB 1CFMA 1FD6A 5FLXL 2NVTB 1VZ6A 2BS3B 1KDBA 1EEID 3CKIB 2MGSA 4RGOS 3R2IA 1WGKA 2B76B 4CBVA 4IUVA 4C3JG 3N9YC 2QSDA 2F0EA 1TQOA 2QJLA 1ML0D 1HFNA 3NUHB 2TMPA 3P4QB 1SYGA 1OXXK 1YNTE 3QIAA 4OL7A 1I4QA 3ABVB 5JEAJ 4G7HC 5EKLA 2RDHA 1II3A 5A35A 2INPE 3CIRB 2QIEB 3RZOB 4IUPA 4F7XA 3QJYA 1FEHA 3BVMA 1TS3A 3CU7A 4WAFA 2K05A 4R8NA 2KUMA 3IT4B 1BNZA 2F0MA 3E6ZX 2D2CC 1X3PA 1LTTD 1MD2D 1QWYA 1DONA 3AEDB 5EE9A 2KA7A 2K5DA 4QMGA 4DAYA 4PNYA 3BDLA 3OMGA 1SMYC 2I46A 4L23A 2QILA 1TU2B 4REZA 3AE4B 1A3UA 2DNCA 1Y8PB 3VR5A 1I7HA 2M9VA 3FAHA 3AEBB 1EYAA 4ZLTF 1ZYRD 1RJTA 3VYSA 2ICIA 3L3OC 3C3LA 5BN4A 2RKSA 2FJ2A 5DM73 1SSNA 3CRLC 4FXKC 3E5SA 3FILA 1QLBB 4OO1G 2EJGC 3J7AV 4XT1B 4CGYB 1KDCA 2WP9B 5LL6S 4GDLB 2RDGA 2LGIA 4TQ0A 1IYUA 1SNCA 3R3OA 3U2SC 2ID0A 2WACA 4RGNA 5FK9C 3DEOA 4US9A 1AZQA 2W3RA 4OZBA 2BDNA 1EY8A 2N9LA 5FKAC 3AEGB 1G6ZA 2ON8A 1OXSC 2PZUA 2F0SA 2PW5A 2WXJA 3EJIA 4HROA 4WQMA 5EKKA 4YSXB 1SDFA 4HCSA 3AE2B 5CBEE 2M0AA 1FGBD 2PMZB 2N9KA 2WP8J 1TKEA 1TJEA 4FXDA 5C3WA 5G3LF 3K5LA 2F0OA 4OO1I 1TWHB 4ODGA 1D1KA 1L5PA 1SXTA 2NTTA 1SE3A 5IODA 3IAYA 3NTIA 1MHHE 4KY7A 1WSPA 3FRPB 4XDXA 1GXDC 1TS2A 2JSOA 3QO2A 2RBMA 3HP3A 1B9RA 1M4VA 5BYQA 3TDQA 2L1AA 4FNFA 1U4RA 4A3FB 3TEYA 3GQBA 3GTJB 3SK8A 1B2TA 4ZK9B 5CYUA 3SE0A 4ZUIA 4J1MA 5D14A 4YT0B 4NW2A 2FE8A 4MHEA 1VR9A 5JPMC 4GLSC 4MM3B 2A69D 5IOCA 3KBXA 3M7GA 1HUMA 2W55A 4JWSC 3HRZC 1WD0A 5JEAG 3HOYB 3BG3A 1C4AA 3EGRA 2C9OA 3U4EG 1ICWA 3RFZB 4B9XA 2LJIA 3VYTA 1XLNA 1B9NA 1PRTC 5KGUA 3IFDA 3OOCA 2QEJC 4OIJA 3KLSX 2VUMB 1J8IA 4YIJA 3BVZA 1R7SA 1I4RA 2WKCA 4N6EB 1RDPD 4PQXA 1JWAD 4ITKA 3TP7A 3VRAB 2ICEC 4B08A 4N59A 5JPNC 3PO3B 1CHPD 1TS5A 1GB4A 4A90A 4KKTA 1MI2A 1XCTL 3O13A 3DUZA 4HMIA 5GXGB 5H92C 4JPSA 5C5LA 5C0XH 5CV8A 1HXYD 3GTMB 4HAEA 3VR9B 2BB6A 5BMHA 1HUNA 1CZGA 2FMMA 5LNK1 2F03A 1AFPA 3TP6A 3DWGC 1D5ZC 3PO2B 1YNNC 5ISRA 1ENFA 1F9PA 2MUYA 4MIUA 1CA6A 2TSSA 2HDLA 2Y3AA 1KF6B 2O5JC 4KHVA 4Y7NB 4A9AA 2MH7A 2JE6I 4WRDA 3SHLA 3GV6A 2WXPA 1H9SA 4ZOHC 1ESFA 2F0KA 3EA6A 5JVH3 1N60A 5G3LD 1SBBB 3W3AA 1C4CA 3J81E 2EPBA 3PUWA 5FOBB 4BY7B 4USAA 3NTKA 1TR5A 1D2BA 2PPBC 1C78A 5T8IA 3C46A 1GB1A 2MEKA 2E3TA 4KGRA 3SR6A 1CQFA 2VZKB 4WFN3 3I72A 2H4OA 2J0TD 4X3SA 1I4PA 3PMFA 1P7FA 5ELDA 1TKWB 4IDIA 1PRTB 4RAUC 1VDZA 4DAPA 3PV0A 2WXGA 1Q3LA 1MVKA 1D5MC 3OW7A 5I9OA 3MJ5A 3AE7B 5EE0A 1F2ZA 1EY9A 3I4NB 1XX8A 1Q10A 1YN4A 1FCCC 1ACCA 2F0UA 1NVID 2WKDA 1EY4A 2WXIA 1PRTF 4L8JA 2IWHA 4Q0FA 4C3JB 2IX3A 1FRRA 5CV4A 1OFFA 4PV1C 2DLBA 4US8A 1DZ1A 1SMYD 2WNMA 5IT9L 4KTAA 3NVYA 1QOFA 3ONAB 5MPOA 1ZOYB 1R9TB 1TY0A 5IGCA 4DNTB 3KWLA 4OGQC 4K5VA 3Q22A 1BUIC 2NWGA 3S9WA 3SK4A 2LS01 3OIQA 2I38A 2PVGC 1WTWA 3KWVA 3TUOA 2EYHA 3P4RB 1SIJA 5JEAH 4A8XC 5ELBA 3B2FA 3OWFA 3QB3A 1HZ6A 3J7AF 5NUCA 3IL8A 2LFNA 5J22A 3ETRA 1E10A 5F2DA 4GZYC 3NUCA 1G2SA 4ZKBB 2O2LD 2A74C 4IURA 1K8OA 1U4MA 1F2RI 2AWOA 1XYIA 1EZ8A 3S15B 2EE1A 3R2TA 2KMMA 1ZDXA 3MXPA 2NN6G 1XCQL 1DM0B 2IL8A 1EWHA 3NZ3A 1FYCA 1F0ZA 3NBIA 2PVOD 1K51A 2KWDA 1FIQA 1SYDA 1QNKA 1ZKOA 1JE4A 1STBA 1Y69U 5JJZA 2JA5B 2XRQD 1N5XA 4ZHPA 1RHPA 1CZWA 3AMUA 1WXQA 2QMTA 2PCFB 1G91A 2R61A 4BY1B 5KYIA 1A15A 2L12A 1PDXA 5ELFA 3DWMA 1I3QB 4PMBA 2YYZA 3AH7A 2NN6I 2BA1A 3QWNA 3KK7A 2WV6D 2F3WA 1AWDA 5I2XA 1WTXA 1XEEA 1QE6A 1SE2A 3C2PA 4M1UB 4K6DA 1ET9A 2BS2B 2K1BA 5CR3A 3A56A 2PYKA 3TZDA 5JAVA 2B2WA 2O5IC 1SYEA 2LMCA 3H3VC 1F9SA 2FHTA 2PQEA 5C4ZA 1QQRA 5CV9A 1VCIA 3DHQA 2XRSD 2BE5C 2I2YA 1QOHA 1EQTA 2CHBD 4TRDA 1VMPA 1JC7A 4KGSA 3T16A 2JXTA 1KNEA 1AYFA 1JWBD 1K8MA 3AM9A 3PIP3 5J1ZA 3OPOA 2IX0A 2WAQB 1EU3A 1JQ4A 4TMAB 5FO8B 1WTVA 5KYLA 4U673 3W1SA 1TY2A 2E76C 3MA2B 2K0PA 3GP7A 3FPPA 5DAUA 4DQOC 1KABA 1RTNA 1WRIA 2KACA 1K53A 2B2VA 3I3CA 1D5XC 4Q5VA 2HCIA 1XXGA 2VNUD 5C0XJ 1PFDA 5IIFA 3RPFC 4K14A 2DY8A 2J53A 4HMJA 2Z4IA 2D5GA 2A69C 1STEA 2L55A 1EL0A 2IDYA 2WIIB 1VRAB 2SNSA 5TSSA 2EZVA 1QT9A 1S5BD 1TWGB 4A55A 3Q8FA 2K28A 1WYGA 1MHXA 2WU2B 5E4WC 5D7GA 5E1FA 1A70A 4A3EB 2NVYB 2V3PA 5M3MB 2Q8TA 1IGDA 3PUXA 1F2MA 5IGGA 2W82A 4KKUA 1C48A 3HGBA 3RUZA 1IBXA 1EM7A 1EQVA 2Q5WD 2WXRA 1HTLD 3PUVA 3NP8A 3BIID 5I6YA 5A2QL 4LK1C 4RKBA 5FO7B 4FVMA 4IUQA 4JX1C 1Z47A 3OIPA 4HEDA 1AZPA 2NN6H 3AB5A 1SE4A 4XWWA 1RF2D 2M00A 1LACA 3SK5A 1KRHA 3HVDA 3I57A 2L4NA 4TKOB 3D4RA 3H94A 1LV9A 1I6HB 1I4HA 4CQNA 3WDNA 5CORA 2IW3A 1ILQA 2RSNA 4A3BB 3W5VB 2B8FA 1UEAB 4DGZA 4IN3A 1SF0A 3MHZA 4OVZA 4RA8A 1QKZA 3SK6A 1MSGA 1EU4A 4DXFA 1AEXA 5C5MA 1HQRD 1UWXA 3IAM1 5ELEA 1L6UA 1C79A 1JB3A 5EJWA 3V05A 4ZRPA 2SOBA 2MJEA 2IGGA 3V96A 4OIKA 2E2IB 2JYOA 2JYTA 2H89B 3AE6B 3VYUA 2KECA 4H0LC 3HEJA 1DOXA 2X6LA 5EPLA 3ND9A 2WDRB 1RKNA 2MP1A 2BOSA 2RQXA 2INNE 4O42A 4A3JB 2WXNA 2EJMA 3MEHA 1PGAA 5C0XG 4XDCA 1F2YA 1DOMA 1B4OA 2V4DA 2K22A 3TSSA 1X3QA 4RHSA 4K6LA 3DWQA 4N9TA 1ENCA 3CHBD 2JX5A 1N5WA 2W3SA 4YSZB 5CV6A 4ZRZA 3Q8BA 2GRIA 1TWFB 3GTOB 2X6GA 4DU9A 1TZOA 2HQEA 2R3ZA 1EY6A 1KLUD 3H09A 1F2LA 4KK7A 4C1NK 4V0BA 1EIGA 1DYQA 5C0XI 3A54A 3AE9B 1DJRD 1B9MA 1E2ZA 1CK1A 4C7ZA 1GUTA 2B2UC 2X38A 2F1MA 1FM0D 1K52A 1FNUA 2SEBD 1I4XA 1IGCA 2JSVX 2F0QA 2N7JA 3BK1A 1STGA 3P4SB 3D31A 3AECB 2WXMA 2EYJA 4ULLA 3ZJUA 3HOUB 3T56B 3T51B 4BBSB 3H91A 4YSYB 1PLFA 2BE5D 2K7VA 3X3MA 1L0YB 5G5GA 4C80A 2A5HA 2K04A 4KY6A 4ZHOA 1L0XB 3KQ4A 1FFUA 1V1PA 2PZTA 2OEOA 2B39A 3DMUA 1UNSA 1OO9B 1CHQD 2LFIA 1WTPA 2EYFA 2ZXRA 2KJXA 1MPEA 1FFVA 3MXUA 2OXPA 2WXFA 2JA6B 1V1OA 4L1BA 1TWAB 4K5XA 1KH0A 3M7NA 2JYEA 4G4KA 3SDZA 1OXUA 4BA1I 4YXDB 3A55A 3D6CA 3OSOA 4KI0A 3P7JA 2FUG1 1PTOC 2B2WC 1I6VC 1B53A 1I50B 4DFAA 1B1ZA 1FNWA 1ENAA 3S1MB 1GAQB 4ZKCB 4XQQA 4WH4A 1NR2A 2WXLA 3ZYYX 2R6GA 2L0CA 4QUFA 3L9AX 5I4DA 3I4MB 3HOVB 3BK2A 1DOYA 2AQ3B 4KN4C 5HGTA 4NP5A 4QIWB 1Q1BA 1BR9A 4XTCS 5IGDA 1BF4A 3NS1A 4OZCA 2IT1A 4QCLA 1Y1WB 1WTRA 4LJZC 2E2DC 2GI9A 1HQMC 1GOZA 3D6WA 2F0VA 2B2VC 2EJFC 3K7AB 3RMHA 3Q69A 3M4YA 2E75C 1FMAD 4KKJA 4KD4A 3EFXD 1JORA 1SYBA 3Q23A 2ONQA 1DOKA 3VA5A 2K03A 1TKYA 1F9RA 3MXNA 4JBWA 3SVMA 3GTQB 3MTSA 5BYSA 3M85A 2J4XA 1PZKD 1NEKB 2H1EA 3I91A 2F3VA 2XN9C 2F0IA 2ZXPA 3ZJVA 3AE1B 3I73A 4H7BA 2BYTA 4ZAIA 3URYA 1MI0A 3TN2A 1U4LA 4N9PA 3VR2A 2WXQA 5D3DA 4V190 4H2AA 2XVSA 3TP8A 1KNAA 3K57A 5M5XB 2IX1A 2PW7A 4L6TB 3NVVA 1BDOA 4QUCA 1X32A 5C44B 1SNQA 1XTCD 3GTLB 4XYQA 1J7AA 1ONLA 2KEDA 1FXAA 1PZJD 2QDBA 1BCPD 2CW0D 3ERQA 5K36H 1W6KA 1Q8IA 2VXWA 4NJCA 5CBAE 5IGFA 4OZAA 2L83A 4FXCA 4YTNB 5IT9E 2A6EC 3AE3B 4XDDA 3U7ZA 1LO5D 1EY7A 1TYGB 1YMHE 1PTOF 1PUTA 3E56A 1YN5A 2BB5A 3NQTA 1STHA 1QCBD 3J80E 3E9SA 2WDQB 1S5DD 5EE1A 3HZXA 2X69A 4UDUC 4ABNA 4O1NA 1T5XD 4IUTA 5FO9B 5DNFA 1CM9A 4RKLA 2WXKA 2K6AA 1JCKB 2HDEA 2NMQA 1HFGA 4LK0M 2K5PA 1ZXHA 2WQYB 1YN3A 2OHFA 3OMCA 4XE0A 3I4LA 3MAQA 4NAMA 1XO3A 3F2UA 1TWCB 4C3HB 3J81L 1GHJA 1U9RA 1S5ED 1PMRA 2XWJB 2WINB 1E9MA 4KHZA 1GHKA 1AP0A 2K01A 3IAS1 3K5OA 2IJ0A 1YNJC 4LTUA 4X3KA 1BUVT 4K2KA 4U68A 3GO5A 1H9MA 2B2TA 2JZPA 1OQQA 3TMEA 3MFYA 1NYQA 2K32A 5C2TB 4A3IB 1SYCA 2K9XA 2F0NA 1O78A 5I6WA 2ZW1A 3VQIA 1NUCA 2N88A 2IGHA 2Y5PA 5IGEA 3NHHA 1Z6HA 4FF4A 1L6VA 4RGTA 1IKLA 4L63B 4WWMA 5JXVA 3AE5B 4YTPB 3V2TA 1LTBD 1DGJA 5E6JA 1UAPA 1EWYC 2EYLA 1STNA 2HDMA 1W6JA 1RWSA 1VMCA 2Z1CA 1RODA 1FXIA 2KDMA 3W9CB 4RGMA 1E2VA 1ZP0B 2L1BA 3S2DB 1CJEA 3VRBB 4JWUC 4M8AA 1SNOA 2EY1A 2ACZB 3A8JE 2XIWA 2PW9A 1IKMA 3GS2A 5E4XA 1FD7D 2B2YA 2CQAA 1PTOD 2BW2A 5EBDA 4DAVA 3HOZB 3NXWA 1CTMA 3LWEA 1RYJA 5JOBA 1QG7A 1HPCA 3HRDD 1H9RA 1TVXA 3QOLA 3AMZA 3SEBA 4DF7A 3I70A 1MBYA 4P16A 2MPMA 2KCCA 4MN3A 1ZDVA 4D2KA 5DM63 5LHY1 1EYDA 3K6OA 1VZ8A 1EOTA 2Z8LA 4HEA1 1J7CA 1EWCA 4NKLA 2NZ1D 2O4XA 1NCVA 4A3MB 1JW9D 3I9V1 3KF8A 4ILWA 3EVQA 2BDOA 2J7ZA 4K2LA 3C1EA 1QOGA 1T3QA 2LUMA 3CRKC 4JE3B 4RF0A 2FINB 1PDQA 1XLOA 3MXGA 2E74C 1GUSA 2N55A 3B9JA 1CZPA 2HTME 3T4AC 2BTEA 1P7EA 3Q6SA 1YQ3B 1JROA 1F9QA 3A8KE 3FKIB 1EFID 3SXHA 2DNEA 5I2YA 4A93B 2F0JA 4J6HA 3Q24A 3D4WA 2WLBA 3AEEB 1RM6C 1JOOA 3S1RB 4FF3A 4ARCA 3I90A 2F0DA 1B3AA 2JP1A 2V3NA 4CKEA 1ESRA 2G1EA 4IQZA 1EIHA 1I4GA 1N63A 2EYMA 3GB1A 1EZ6A 3HUIA 3AU7A 4HCEA 3RLFA 1JOKA 2F0PA 1XLQA 3GV3A 2R92B 2M56B 4IFDJ 4B9WA 4RCOA 3JAME 3G6JB 2B8GA 2KQ3A 5BN5A 4FF2A 1T6BX 1S5CD 1BBXC 1WTQA 2A6ED 4XT3B 3Q8EA 1STAA 5FLXE 4KY5A 1NSNS 3K0YA 3W2DA 1PGXA 5EPKA 1SFOB 1SAPA 2DYMA 1H9KA 3T53B 3KLSA 4HKZE 1ZE3D 3LYYA 3R8BA 2QKIC 4ID6A 4C3IG 4UAIA 2WDVB 1JWMD 4KKSA 3KBGA 4A6QA 4F88A 2V4IB 1KTKA 3BYYB 3Q8CA 5KNCA 4KMUC 3IFTA 4FP5D 4G57A 2JQRB 1VJKA 4C2MB 1KLGD 3LWUA 5HG2A 1C9FA 1FRDA 4LLGM 5AUIA 1BCPC 4ZUJA 1YQ4B 4KGTA 2FFKB 2CW0C 1STYA 3M4OB 3SFEB 1IW7D 5CC4A 4EQPA 1PFMA 1C4QA 2F4IA 2PZWA 4QF4A 3R93A 2R93B 1GUWA 1S5FD 4ME5A 2B63B 1O80A 1JWUD 1PGBA 3TP5A 2WXOA 1RD9D 1D4BA 2WU5B 1CI3M 2K3UA 3T3NA 2KOLA 2EY6A 3NE5B 2DBYA 1GJXA 2M2LA 4C56C 4S3SA 1ZXTA 1CT1D 5EQ0A 1ROEA 4B0EA 3A7AB 4C3HG 5KIXA 1YNJD 2BS4B 4XQNA 1KDAA 1A2UA 3N52A 3M3YB 1AW7A 2RMMA 1A2TA 5BN3A 4KD3A 5M5YB 1JRPA 2F0HA 5C3XA 3WOFA 2KVMA 3G7LA 5EKIA 2C5CA 2L11A 2MJ8A 1HTPA 3BVGA 1E0BA 3L4PA 4KX6B 1O7YA 4CKBA 2EDGA 1C76A 3H0GB 4MT5A 2L9HA 3K58A 4WIPA 3ITPA 1DXMA 2D5DA 2NBFA 1HRJA 1RCVD 1HZ5A 2GA4B 3LXFA 3WOEA 5D3IB 4K8IA 2EY5A 1LTRD 3H8HA 1H9SB 3FC4A 1YJIA 2JXMB 1XWEA 2NVQB 1SJHD 4X3TA 5K36G 3HKZB 2B2TC 4IFDG 2BT6A 2CU3A 2HCCA 4AS1A 3FDTA 1B44D 2LHEA 1BCPB 3Q8AA 5EGTA 4IKGA 3P42A 1PYWD 4HJGE 2CJNA 1BO0A 1JALA 3NWSA 3NSWA 4PMWA 1L4ZB 2LKVA 3LX0A 5LL6X 1G8ZD 1VF7A 3S14B 3AEAB 2SAKA 2A68C 2VB2X 2DYOA 5COYA 2HUGA 4MACA 1BCPF 2PIAA 2D62A 3AEFB 4BA2I 2GB1A 1GUNA 2ZXOA 3NRZA 3MWYW 3A8IE 4IFDI 3VA7A 5BMGA 1ET6A 1LABA 1ZUD2 4DNRB 1Q1EA 3HS0C 2NUCA 3U52E 4F8MA 1B50A 4DK0A 3T3OA 5H8YE 1PTOH 3EROA 1FO4A 2RA4A 3TEXA 2F0LA 5EBCA 2DWQA 3K59A 1JMLA 1C8CA 2XWBB 1IHZA 2B2YC 3D3RA 1PXUA 2KAJA 3PZ8A 2AUJD 2PNRC 1VF5C 1G291 3U9OA 2KQ4X 3W5UB 3P75A 5EPJA 3MFGA 1A6XA 1Q90A 1RFKA 1V43A 4TSSA 4K5WA 2RSOA 1HEZE 4J3OD 2LY7A 4TQ1A 2L5TA 1Y8OB 1LT6D 2Y0SB 1ZPSA 5EE3A 3IKJA 3Q0AA 3DEPA 2IPKD 4HR7B 1EY5A 2F0TA 4KN7C 4RWSC 2PLPA 5C4XB 1UGJA 3K5NA 2OF1A 3AV8A 2A6HC 1JQYD 4PMCA 1FCLA 2Y5CA 3NVZA 1Y1VB 4CKCA 4LMQD 1E7PB 1C77A 2JWUA 2PMVA 3C1FA 3IT6B 5KEEA 3X3NA 1LT4D 2AX5A 1EEFD 5HURA 1BQQT 1MSHA 1VLBA 4L2YA 1TT2A 1Y8NB 2SDFA 4EQOA 1VZ7A 1HA6A 2LHDA 1EY0A 5G5HA 1L0VB 5T1GA 3NPPA 2PKOA 1U4PA 1L4DB 2G9HD 2EELA 1KAAA 4MH8A 5C6AA 3TEZA 3GTKB 1CA5A 1EYCA 4DA2A 4A3DB 2XNAC 3S1QB 2RDFA 3N6RA 3E0JA 1LT3D 2DN8A 4NZLB 1WD1A 2NYZD 4OHJA 3HOWB 4IUUA 2EXZA 2EY2A 3A7LA 1ZXIA 1QJOA 4CJ2C 4F87A 2LMCB 1PTOB 2MHVA 1QOAA 3NVWA 2VB3X 3D4DA 2L32A 4C3IB 3P1HA 1NAPA 4IFDH 1SNPA 5CMDA 3HVZA 5KNBA 3VYRA 4HSPA 3TBIB 4YTMB 2L52A 2BCOA 5AUKA 4OO1H 3KLRA 4C1NI 1YJJA 4KKIA 4IALA 4X3UA 4Z9CB 4FF1A 2J52A 2R7ZB 4CJ1B 2KN4A 1LTID 1KFYB 1O7ZA 4XYOA 3VR8B 4R9WA 3RZDB 2KEEA 1ILPA 4OW0A 4E6IA 3LB8C 3ND8A 2PO4A 3NWTA 4RNAA 4PT5A 1UUPA 1SNMA 2EYOA 3QG1A 4IUNA 4IZ8A 3FMCA 3S2HB 2XSCA 2WXHA 4P2CB 4M0WA 5M9OA 4HKQA 2MJ3A 1E2WA 1PFBA 1F77A 2H88B 2M19A 2QCPX 1IW7C 4YWGG 4Q2JA 3MP9A 1QF6A