1B20A

Deletion of a buried salt-bridge in barnase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
109
structure length
109
Chain Sequence
QVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGSTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 36
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b20A00
3DGYA 1BNJA 3AHWA 5HOHA 4GSPA 9RNTA 1BUJA 1BRKA 1GMQA 3A5EA 1GSPA 1AQZA 1AY7A 1GMRA 1LOWA 4J5KA 1FZUA 2F5WA 2F5MA 1B2SA 2KF5A 1GOYA 1RGEA 2F4YA 3BU4A 1FYSA 1BSDA 3BIRA 1DE3A 2AADA 1DETA 1PYLA 1BU4A 2RNTA 1RCLA 2KF6A 2KF3A 1RGGA 1GOVA 3URPA 1PY3A 1B21A 1RDSA 1YGWA 4RNTA 1BNEA 1Q9EA 3D5GA 1RLSA 1BNRA 1RGKA 1UCLA 2BU4A 3DH2A 2AAEA 4BU4A 1UCKA 1RGFA 1RGHA 1T2HA 1RNBA 3AGNA 1RSNA 1X1XA 3HOHA 1BRGA 3D5IA 1C54A 1RN1A 1I0VA 1BRSA 2ZA4A 1BNIA 1HZ1A 1RCKA 4HAAA 1BSAA 1BSBA 1RHLA 1BNSA 3KCHA 1BSCA 8RNTA 1B2MA 1R4YA 1BIRA 1A2PA 4GHOA 1G02A 1B2UA 1RTUA 1X1WA 2F56A 1BGSA 1HYFA 1B3SA 1T2IA 1X1YA 2GSPA 3WR2A 5BIRA 1LRAA 1LOVA 1IYYA 1I0XA 3AHSA 1BNFA 1X1UA 5GSPA 1UCJA 1BAOA 3RNTA 1RNTA 1TTOA 2C4BA 1BRJA 1UCIA 1RGCA 1BRNL 1RGAA 1GMPA 1B2ZA 1I3FA 1YNVX 2BIRA 1I70A 2SARA 1FUSA 1LNIA 5RNTA 1FW7A 3SYUA 1GOUA 1ZGXA 1CH0A 1I2GA 1YVSA 1BANA 6GSPA 3AGOA 1RMSA 1MGRA 7GSPA 1BNGA 1MGWA 3Q3FA 4J5GA 1RN4A 1I2EA 1BSEA 4BIRA 4HOHA 3D4AA 7RNTA 1JBTA 2HOHA 5BU4A 1B20A 1JBSA 1LOYA 3WHOA 2KAAA 2KF4A 1I8VA 2RBIA 1BOXA 1SARA 1RGLA 1TRQA 1I2FA 1TRPA 1B2XA 3GSPA 1BVIA 6RNTA 1B27A 1BRIA 1JBRA 1FUTA 1BRHA 1I3IA
chains in the Genus database with same CATH superfamily
1IVXA 5M1AA 1T5YA 3V99A 4CDLA 4GSPA 9RNTA 4GL6A 4DKIA 1Q814 1BRKA 2ML5A 2XSHB 4IIAA 1LOWA 3MPHA 1IU7A 3O8YA 1ULJB 3F7SA 4J5KA 4WYKA 1UUGB 4CCVA 1TJDA 2V1LA 4U13A 2F5WA 4R1KA 3STDA 2KF5A 1VQ63 3HZPA 6STDA 1LVNA 4WYKB 2AADA 2JDIH 2XGLA 2MC8A 5CF1A 1JB4A 4RBNA 1DETA 4LGQA 1A67A 1RRHA 3N8BA 5STDA 3X3ZA 3D79A 3ALAA 4O3VA 1ROVA 3CCU3 3CCR3 3PCSA 1TU5A 3BNDA 3G713 3GZRA 4AKYA 3S5CA 1Q40A 1PY3A 1PFPA 1RJOA 3JUQA 3ZFZA 1BNEA 3ECFA 3UB1A 2K54A 1NDOB 2W0QA 2IY2A 1RLSA 3MKIA 3GZYB 1QAFA 1TIJA 4HKVB 2ZDJA 1Q40B 2BU4A 4HZ9B 3BNCA 1IVWA 2AAEA 1FGRA 2HMJB 3SEDA 1MNLA 2XRXB 3UL6A 4BU4A 1RGFA 2UX0A 3MYTA 4FMAA 1RNBA 1YVBI 1JN5A 2C10A 2HMLB 1RSNA 1NB3I 1O7HB 3FF2A 1NWWA 1M904 3CC43 3F8HA 5AIFA 1UI8A 3OXAA 4H3UA 1C54A 1JN5B 1RN1A 3NHXA 1Q824 1EQKA 1RN7A 1OHPA 4EXRA 3EX9A 1BNIA 2HMMB 2O9UX 4HAAA 1BSAA 1BSBA 1FGOA 3KCHA 2XGNA 3EB8A 1W4NA 1R4YA 3L0RA 2P0XA 1AVLA 3Q90A 1G02A 4LMIA 1B2UA 3EJVA 4NHFA 1NO3A 1BGSA 1QJGA 1LQGC 1MWUA 3KFQC 1Z1SA 4BTWA 2CWUA 1S723 5FW5A 3S29A 3PCRA 3WODG 3FG4A 1I0XA 1LNHA 1MWTA 1X1UA 1SIIA 3LOYA 3CCS3 2QA43 3WA3A 1QAKA 1UUVB 1CQSA 5AIIA 3RNTA 1SPUA 1TTOA 2C4BA 4MEIA 1K41A 1UCIA 3FG1A 1HKXA 3CNMA 3SXXA 5G2GA 1GY6A 1I3FA 3CU3A 1W6GA 3NQYA 3NX0A 2BMOB 1NNVA 1W7CA 1UGIA 2YFIB 2YFLB 4R9LA 1FW7A 1W00A 4HM3B 1J2BA 1OGXA 1YVSA 3MG1A 2OOVC 2KXGA 5EVHA 3CCV3 2F98A 5M18A 2IUKA 3KKGA 1VQQA 4ILFA 3X42A 1PU4A 2BHMA 3Q3FA 1FA3A 1RRLA 1OUNA 4WFOA 2J8XB 1EA2A 4HOHA 3GRDA 3PYJA 1V74A 3T8UA 5IEPA 2IMJA 1B20A 5EQLA 1WNHA 2KAAA 1YIT3 1I8VA 3N9HA 1AVKA 2XH9A 1BOXA 1SARA 2BO9B 2CFGA 2Z6BA 3RDEA 5BVBA 1RGLA 1TRQA 3X41A 1NJI4 1DMQA 1VQ83 3OX9A 3CNXA 3JUNA 1JBRA 1FUTA 1BNFA 1BRHA 4J9AA 5JPUA 3DGYA 1BNJA 1QALA 5IG4A 3KN4A 2OQEC 5AYSC 3IJEB 4HJLB 1GMQA 1A2VA 1JKGA 4STDA 1GMRA 1EUIC 4XDWA 3NQZA 1FZUA 3DGMA 2F5MA 1B2SA 3FLJA 2F4YA 2XFTA 1KC84 1BSDA 1D6ZA 1YI23 1DE3A 1ASKA 1IVUA 1UGHI 2XEPA 2F99A 1O7WB 5DRVA 1OACA 1BU4A 4LYLB 1QMAA 2L1SA 1QVG2 2KF6A 1CYVA 3HX8A 3SLUA 1FUWA 3M8CA 3LMLA 1GOVA 2JQ5A 2CIUA 1B21A 1RDSA 1YGWA 1ZS7A 2CHCA 3X3YA 4O02B 2P09A 3FSDA 3D5GA 2W04A 1N9EA 4L7KA 2WGOA 1OPYA 1SJWA 1ROAA 1T2HA 2Z76A 4R80A 5G1KA 5M19A 1M1K4 2LQVA 3AGNA 4H61A 1KSIA 2CW9A 1X1XA 2P38A 3EF8A 1US1A 3NBRA 3FGYA 1IV7A 1LXEA 3D5IA 4LEHA 5AIGA 2OCTA 2CWVA 1OCVA 3PZWA 1I0VA 3LTBA 1VQM3 5AIHA 1IVVA 2H0HA 1RCKA 2LYXA 2E2TA 1BNSA 1JB5A 1N5HA 3BB9A 1BSCA 3DXOA 2D42A 2W9QA 3K63A 4FMCA 1BIRA 1KD14 4GHOA 1RTUA 1GD3A 3LYGA 3VGNA 3DGLA 1B3SA 1T2IA 1X1YA 1YIJ3 3WR2A 3DMCA 1LRAA 1LOVA 3WDGB 1U5OA 4HBRA 5KP1A 1IYYA 1W02A 1DVCA 3LZAA 3D9RA 3TDGA 4EYCA 1RKYA 1BAOA 4IPBA 4LSOA 3WA2X 2XR8B 3EHCA 3CCJ3 1EEJA 1STDA 3KSPA 5CXOA 1RNTA 4FR9A 1STFI 4HM4B 1JV2B 5FGOA 5IERA 2GEXA 3EN1B 4K1UA 3SOAA 1BRNL 1BUQA 5LC7A 1B2ZA 5D82A 1VQ93 1LOXA 3BNEA 2QIYA 1LNIA 3UJMA 5RNTA 1K734 2B1XB 3DM8A 2CC3A 2W03A 4J8TA 3F8XA 3MWZA 5LC6A 3DUKA 1BANA 2SBLA 3K0ZA 3WOFB 1KWIA 1E3RA 3V98A 1MGWA 7GSPA 1WMOA 4KFEA 1I2EA 3OW22 3CME3 4BIRA 3S27A 3F7XA 3JUPA 4MMYB 5AEWB 3FG3A 2BMQB 4KT3B 4Q53A 3T0UA 4WWUC 3K7CA 2R4IA 4I4KA 4N6V0 5IG3A 1DMMA 3KSED 3KE7A 4MMZB 3CPOA 4PEJA 5TGNA 4K61A 1VQ53 1Q864 1BVIA 1B27A 5HGRA 4RNZA 1FGMA 4EC6A 1B2MA 1U8CB 1G0TA 3CCE3 1E97A 1OH0A 2WOFA 3AHWA 3E99A 4EW5A 5HOHA 1VQO3 1BUJA 1UDII 2GBXB 2Q07A 3ZG5A 1D6YA 3FF0A 5BXQA 1AQZA 4I5QA 1AY7A 3EQQB 2PNCA 4MMXB 4FCJA 1JB2A 2IYJA 1O7GB 2WGQA 3ZG0A 5A0OB 3MSOA 3ROBA 1WMPA 3BIRA 2CX0A 5EEOA 1IQXA 4OVMA 3S28A 1IT8A 2YFJB 4N6TA 3I553 1W2ZA 3HIIA 1WMNA 2R41A 1NU3A 3DY5A 3MG3A 3N54B 5AI1A 3AMOA 1RGGA 1QVF2 1GS3A 2RSXA 4NPBA 4HYZA 3WOEB 2D1WA 2FGTA 3GZBA 1VQK3 1AV4A 1AR0A 4EV5A 3AMOB 1N5PA 4JRFA 1BNRA 5I97A 1MWRA 5KP4A 3DH2A 5KP3A 1F8NA 2H0GA 1V58A 1LQMB 2IA7A 1YJW3 1GD4A 5IG5A 1FGTA 3LTAA 1DVDA 2Y74A 1A90A 3CC73 1GYBA 1SIHA 2C11A 3HOHA 3OWYA 5ELUA 3CD63 1TFOA 3G0KA 1A2KA 1O7MB 4G1MB 1KQS2 2RCDA 7STDA 4L8PA 2OWPA 3NV0A 3GAXA 2MF7A 3X40A 2B24B 3LH4A 4KZ1A 1YJN3 1A2PA 3Q2PA 4L8OA 1JJ22 3FZWA 1N8R4 2F56A 3F14A 3NV0B 3CMA3 3DGOA 1HYFA 2ZL8A 5IF6A 3G16A 5BIRA 2P0MA 3X3XA 4KFFA 1VQ73 3AHSA 5IEOA 1T3BA 5GSPA 5IW9A 1JRQA 3UNLA 3SOYA 1GY5A 2W2CA 4HZBB 3B4OA 2L4VA 1BRJA 3FCSB 2K3DA 3QK9A 4BTYA 4XB5A 4XBYA 3F9SA 3SVAA 2CH9A 1RGAA 2SARA 1ULIB 1OHOA 1I70A 1C7HA 2E2UA 4HVNA 4BL2A 4CJNA 1FUSA 3LXUX 3SYUA 2CKFB 4FMDA 1OF5A 1ZGXA 4TX4A 1CH0A 1I2GA 2Y73A 2OTL3 2OTJ3 4GB5A 3CC23 1CYUA 2A15A 4N6LA 4N6OB 2M7OA 1OF5B 1M9GA 1RMSA 3KIIA 1JZOA 4J5GA 4HM8B 2CFLA 4HM2B 1M1XB 5D83A 3D4AA 2ML6A 1JBTA 4ZM8A 1OHSA 3D3LA 3EN8A 2XF3A 2HMOB 1ZO2A 1EKMA 4HM5B 2GU1A 2FNQA 1IQ8A 2GXFA 2P05A 2W56A 3EBYA 1MWSA 3NBJA 3WHOA 2CFDA 3HK4A 3WMDA 3OWSA 1I2FA 1S5AA 1B2XA 1NB5I 2H0IA 1TFKA 1JNQA 2W56B 1W6CA 5CK6A 4FMBA 6RNTA 3DGNA 3OWUA 3PXMA 4OK0A 3UL5A 4MJDA 4N6NB 1I3IA 2CFKA 2OOVA 2XSOB 3CCM3 2CWTA 1YGEA 5IENA 2KCDA 2WOHA 3H3HA 2WO0A 4AEQA 3A5EA 4X2OA 1GSPA 1ISKA 2Z7AA 1R4CA 1WTHA 4RNYA 2CFWA 1WQLB 3LT8A 3S67A 3CPW2 2BNGA 1W01A 4WP5A 3CXC2 3F40A 1W5ZA 3NUVA 1IDPA 3BU4A 1GOYA 1RGEA 3HI7A 4HM0B 1FYSA 1G96A 4O8SA 3LTDA 2UGIA 3BNBA 5JPPA 3A76A 1PYLA 1N8QA 3I0YA 4R9KA 3G4S3 1YHQ3 3DZLA 3JUOA 4N6UA 4N6MA 2RNTA 1RCLA 2KF3A 2STDA 2ZHXB 1FGQA 3K5TA 3NM2A 3SX1A 3VF1A 4EV2A 1Q7Y4 3URPA 1IV9A 1IQYA 1O7PB 2GU3A 4XBXA 4RNTA 2OQEA 1Q9EA 3Q1CA 1VQP3 1VZZA 1RGKA 1UCLA 2CG0A 4AKZA 3MG2A 1HU9A 1UCKA 4FCZA 4HM7B 1RGHA 2YX9A 3KZTA 3VSYA 4X2HA 1K8A4 1Q42A 1SQWA 3JUMA 3OV4A 4HM1B 4K90B 1BRGA 4R4KA 2RFRA 3FH1A 5G1LA 3LT9A 3B8LA 4ORLA 3EE1A 4KVHA 3G8ZA 3PGBA 1BRSA 2ZA4A 1UUWB 2KRTA 1HZ1A 3HIGA 1VQN3 1RHLA 3ER7A 3JVCA 4OUQA 1JZDA 8RNTA 3NBBA 1X1WA 2BMRB 1CEWI 4JF8A 2XFSA 3NM7A 3PS8A 1W6YA 2W9PA 3U1WA 3V92A 4EBGA 5JBSA 2GSPA 4XM4A 3QRDA 4LZIA 1D6UA 5D81A 3GZXB 5DREA 2K0MA 2CX1A 3NXJA 3CCL3 1GY7A 1IT7A 5CF2A 3RGRA 2UUGC 1IK3A 2Z77A 1UCJA 1UW1A 2O3OA 3EC9A 1Y4KA 1ZX2A 3RGAA 2F86B 2RGQA 1RGCA 4KFDA 1DYUA 1V57A 3MHEA 4N3VA 2CK3H 1GMPA 2E2VA 5AEUB 1YNVX 2BIRA 3J7Yd 1OGZA 1E3VA 2GEYA 2I9WA 1K9M4 1N9JA 1L5GB 3U97A 1W2B2 5IG0A 1GOUA 3IPTA 2PZVA 2IUJA 4NREA 1O7NB 4BTXA 4O2HA 2HMKB 1Q7HA 4FCMA 3GWRA 6GSPA 3B7CA 3AGOA 4HM6B 1VQ43 3IMAB 2QEX3 1MGRA 4XDVA 1BNGA 2HMNB 3I563 1K28A 1RN4A 2FXTA 3LTCA 1EG9B 1VQL3 1BSEA 2W6JH 4WHAA 7RNTA 1JKGB 3B4PA 2HOHA 3H51A 8CHOA 2INXA 4XBTA 5BU4A 3G6E3 1JBSA 1LOYA 4RZMA 5AYRB 2BT3A 3K9MC 1YJ93 2KF4A 4BL3A 2GBWB 2RBIA 4CPKA 1TP6A 1TRPA 5ELJA 4QWTA 3GSPA 1DMNA 3FKAA 1BRIA 3EBTA 4IT7A 1MOLA 4K1VA 5CLKA 2CG1A 3T8NA 3BLZA 2QGUA 1TUHA 3CCQ3 1UI7A
chains in the Genus database with same CATH topology
3DGYA 1BNJA 3AHWA 5HOHA 4GSPA 9RNTA 1BUJA 1BRKA 1GMQA 3A5EA 1GSPA 1AQZA 1AY7A 1GMRA 1LOWA 4J5KA 1FZUA 2F5WA 2F5MA 1B2SA 2KF5A 1GOYA 1RGEA 2F4YA 3BU4A 1FYSA 1BSDA 3BIRA 1DE3A 2AADA 1DETA 1PYLA 1BU4A 2RNTA 1RCLA 2KF6A 2KF3A 1RGGA 1GOVA 3URPA 1PY3A 1B21A 1RDSA 1YGWA 4RNTA 1BNEA 1Q9EA 3D5GA 1RLSA 1BNRA 1RGKA 1UCLA 2BU4A 3DH2A 2AAEA 4BU4A 1UCKA 1RGFA 1RGHA 1T2HA 1RNBA 3AGNA 1RSNA 1X1XA 3HOHA 1BRGA 3D5IA 1C54A 1RN1A 1I0VA 1BRSA 2ZA4A 1BNIA 1HZ1A 1RCKA 4HAAA 1BSAA 1BSBA 1RHLA 1BNSA 3KCHA 1BSCA 8RNTA 1B2MA 1R4YA 1BIRA 1A2PA 4GHOA 1G02A 1B2UA 1RTUA 1X1WA 2F56A 1BGSA 1HYFA 1B3SA 1T2IA 1X1YA 2GSPA 3WR2A 5BIRA 1LRAA 1LOVA 1IYYA 1I0XA 3AHSA 1BNFA 1X1UA 5GSPA 1UCJA 1BAOA 3RNTA 1RNTA 1TTOA 2C4BA 1BRJA 1UCIA 1RGCA 1BRNL 1RGAA 1GMPA 1B2ZA 1I3FA 1YNVX 2BIRA 1I70A 2SARA 1FUSA 1LNIA 5RNTA 1FW7A 3SYUA 1GOUA 1ZGXA 1CH0A 1I2GA 1YVSA 1BANA 6GSPA 3AGOA 1RMSA 1MGRA 7GSPA 1BNGA 1MGWA 3Q3FA 4J5GA 1RN4A 1I2EA 1BSEA 4BIRA 4HOHA 3D4AA 7RNTA 1JBTA 2HOHA 5BU4A 1B20A 1JBSA 1LOYA 3WHOA 2KAAA 2KF4A 1I8VA 2RBIA 1BOXA 1SARA 1RGLA 1TRQA 1I2FA 1TRPA 1B2XA 3GSPA 1BVIA 6RNTA 1B27A 1BRIA 1JBRA 1FUTA 1BRHA 1I3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGY A;  1BNJ A;  3AHW A;  5HOH A;  4GSP A;  9RNT A;  1BUJ A;  1BRK A;  1GMQ A;  3A5E A;  1GSP A;  1AQZ A;  1AY7 A;  1GMR A;  1LOW A;  4J5K A;  1FZU A;  2F5W A;  2F5M A;  1B2S A;  2KF5 A;  1GOY A;  1RGE A;  2F4Y A;  3BU4 A;  1FYS A;  1BSD A;  3BIR A;  1DE3 A;  2AAD A;  1DET A;  1PYL A;  1BU4 A;  2RNT A;  1RCL A;  2KF6 A;  2KF3 A;  1RGG A;  1GOV A;  3URP A;  1PY3 A;  1B21 A;  1RDS A;  1YGW A;  4RNT A;  1BNE A;  1Q9E A;  3D5G A;  1RLS A;  1BNR A;  1RGK A;  1UCL A;  2BU4 A;  3DH2 A;  2AAE A;  4BU4 A;  1UCK A;  1RGF A;  1RGH A;  1T2H A;  1RNB A;  3AGN A;  1RSN A;  1X1X A;  3HOH A;  1BRG A;  3D5I A;  1C54 A;  1RN1 A;  1I0V A;  1BRS A;  2ZA4 A;  1BNI A;  1HZ1 A;  1RCK A;  4HAA A;  1BSA A;  1BSB A;  1RHL A;  1BNS A;  3KCH A;  1BSC A;  8RNT A;  1B2M A;  1R4Y A;  1BIR A;  1A2P A;  4GHO A;  1G02 A;  1B2U A;  1RTU A;  1X1W A;  2F56 A;  1BGS A;  1HYF A;  1B3S A;  1T2I A;  1X1Y A;  2GSP A;  3WR2 A;  5BIR A;  1LRA A;  1LOV A;  1IYY A;  1I0X A;  3AHS A;  1BNF A;  1X1U A;  5GSP A;  1UCJ A;  1BAO A;  3RNT A;  1RNT A;  1TTO A;  2C4B A;  1BRJ A;  1UCI A;  1RGC A;  1BRN L;  1RGA A;  1GMP A;  1B2Z A;  1I3F A;  1YNV X;  2BIR A;  1I70 A;  2SAR A;  1FUS A;  1LNI A;  5RNT A;  1FW7 A;  3SYU A;  1GOU A;  1ZGX A;  1CH0 A;  1I2G A;  1YVS A;  1BAN A;  6GSP A;  3AGO A;  1RMS A;  1MGR A;  7GSP A;  1BNG A;  1MGW A;  3Q3F A;  4J5G A;  1RN4 A;  1I2E A;  1BSE A;  4BIR A;  4HOH A;  3D4A A;  7RNT A;  1JBT A;  2HOH A;  5BU4 A;  1B20 A;  1JBS A;  1LOY A;  3WHO A;  2KAA A;  2KF4 A;  1I8V A;  2RBI A;  1BOX A;  1SAR A;  1RGL A;  1TRQ A;  1I2F A;  1TRP A;  1B2X A;  3GSP A;  1BVI A;  6RNT A;  1B27 A;  1BRI A;  1JBR A;  1FUT A;  1BRH A;  1I3I A; 
#chains in the Genus database with same CATH topology
 1IVX A;  5M1A A;  1T5Y A;  3V99 A;  4CDL A;  4GSP A;  9RNT A;  4GL6 A;  4DKI A;  1Q81 4;  1BRK A;  2ML5 A;  2XSH B;  4IIA A;  1LOW A;  3MPH A;  1IU7 A;  3O8Y A;  1ULJ B;  3F7S A;  4J5K A;  4WYK A;  1UUG B;  4CCV A;  1TJD A;  2V1L A;  4U13 A;  2F5W A;  4R1K A;  3STD A;  2KF5 A;  1VQ6 3;  3HZP A;  6STD A;  1LVN A;  4WYK B;  2AAD A;  2JDI H;  2XGL A;  2MC8 A;  5CF1 A;  1JB4 A;  4RBN A;  1DET A;  4LGQ A;  1A67 A;  1RRH A;  3N8B A;  5STD A;  3X3Z A;  3D79 A;  3ALA A;  4O3V A;  1ROV A;  3CCU 3;  3CCR 3;  3PCS A;  1TU5 A;  3BND A;  3G71 3;  3GZR A;  4AKY A;  3S5C A;  1Q40 A;  1PY3 A;  1PFP A;  1RJO A;  3JUQ A;  3ZFZ A;  1BNE A;  3ECF A;  3UB1 A;  2K54 A;  1NDO B;  2W0Q A;  2IY2 A;  1RLS A;  3MKI A;  3GZY B;  1QAF A;  1TIJ A;  4HKV B;  2ZDJ A;  1Q40 B;  2BU4 A;  4HZ9 B;  3BNC A;  1IVW A;  2AAE A;  1FGR A;  2HMJ B;  3SED A;  1MNL A;  2XRX B;  3UL6 A;  4BU4 A;  1RGF A;  2UX0 A;  3MYT A;  4FMA A;  1RNB A;  1YVB I;  1JN5 A;  2C10 A;  2HML B;  1RSN A;  1NB3 I;  1O7H B;  3FF2 A;  1NWW A;  1M90 4;  3CC4 3;  3F8H A;  5AIF A;  1UI8 A;  3OXA A;  4H3U A;  1C54 A;  1JN5 B;  1RN1 A;  3NHX A;  1Q82 4;  1EQK A;  1RN7 A;  1OHP A;  4EXR A;  3EX9 A;  1BNI A;  2HMM B;  2O9U X;  4HAA A;  1BSA A;  1BSB A;  1FGO A;  3KCH A;  2XGN A;  3EB8 A;  1W4N A;  1R4Y A;  3L0R A;  2P0X A;  1AVL A;  3Q90 A;  1G02 A;  4LMI A;  1B2U A;  3EJV A;  4NHF A;  1NO3 A;  1BGS A;  1QJG A;  1LQG C;  1MWU A;  3KFQ C;  1Z1S A;  4BTW A;  2CWU A;  1S72 3;  5FW5 A;  3S29 A;  3PCR A;  3WOD G;  3FG4 A;  1I0X A;  1LNH A;  1MWT A;  1X1U A;  1SII A;  3LOY A;  3CCS 3;  2QA4 3;  3WA3 A;  1QAK A;  1UUV B;  1CQS A;  5AII A;  3RNT A;  1SPU A;  1TTO A;  2C4B A;  4MEI A;  1K41 A;  1UCI A;  3FG1 A;  1HKX A;  3CNM A;  3SXX A;  5G2G A;  1GY6 A;  1I3F A;  3CU3 A;  1W6G A;  3NQY A;  3NX0 A;  2BMO B;  1NNV A;  1W7C A;  1UGI A;  2YFI B;  2YFL B;  4R9L A;  1FW7 A;  1W00 A;  4HM3 B;  1J2B A;  1OGX A;  1YVS A;  3MG1 A;  2OOV C;  2KXG A;  5EVH A;  3CCV 3;  2F98 A;  5M18 A;  2IUK A;  3KKG A;  1VQQ A;  4ILF A;  3X42 A;  1PU4 A;  2BHM A;  3Q3F A;  1FA3 A;  1RRL A;  1OUN A;  4WFO A;  2J8X B;  1EA2 A;  4HOH A;  3GRD A;  3PYJ A;  1V74 A;  3T8U A;  5IEP A;  2IMJ A;  1B20 A;  5EQL A;  1WNH A;  2KAA A;  1YIT 3;  1I8V A;  3N9H A;  1AVK A;  2XH9 A;  1BOX A;  1SAR A;  2BO9 B;  2CFG A;  2Z6B A;  3RDE A;  5BVB A;  1RGL A;  1TRQ A;  3X41 A;  1NJI 4;  1DMQ A;  1VQ8 3;  3OX9 A;  3CNX A;  3JUN A;  1JBR A;  1FUT A;  1BNF A;  1BRH A;  4J9A A;  5JPU A;  3DGY A;  1BNJ A;  1QAL A;  5IG4 A;  3KN4 A;  2OQE C;  5AYS C;  3IJE B;  4HJL B;  1GMQ A;  1A2V A;  1JKG A;  4STD A;  1GMR A;  1EUI C;  4XDW A;  3NQZ A;  1FZU A;  3DGM A;  2F5M A;  1B2S A;  3FLJ A;  2F4Y A;  2XFT A;  1KC8 4;  1BSD A;  1D6Z A;  1YI2 3;  1DE3 A;  1ASK A;  1IVU A;  1UGH I;  2XEP A;  2F99 A;  1O7W B;  5DRV A;  1OAC A;  1BU4 A;  4LYL B;  1QMA A;  2L1S A;  1QVG 2;  2KF6 A;  1CYV A;  3HX8 A;  3SLU A;  1FUW A;  3M8C A;  3LML A;  1GOV A;  2JQ5 A;  2CIU A;  1B21 A;  1RDS A;  1YGW A;  1ZS7 A;  2CHC A;  3X3Y A;  4O02 B;  2P09 A;  3FSD A;  3D5G A;  2W04 A;  1N9E A;  4L7K A;  2WGO A;  1OPY A;  1SJW A;  1ROA A;  1T2H A;  2Z76 A;  4R80 A;  5G1K A;  5M19 A;  1M1K 4;  2LQV A;  3AGN A;  4H61 A;  1KSI A;  2CW9 A;  1X1X A;  2P38 A;  3EF8 A;  1US1 A;  3NBR A;  3FGY A;  1IV7 A;  1LXE A;  3D5I A;  4LEH A;  5AIG A;  2OCT A;  2CWV A;  1OCV A;  3PZW A;  1I0V A;  3LTB A;  1VQM 3;  5AIH A;  1IVV A;  2H0H A;  1RCK A;  2LYX A;  2E2T A;  1BNS A;  1JB5 A;  1N5H A;  3BB9 A;  1BSC A;  3DXO A;  2D42 A;  2W9Q A;  3K63 A;  4FMC A;  1BIR A;  1KD1 4;  4GHO A;  1RTU A;  1GD3 A;  3LYG A;  3VGN A;  3DGL A;  1B3S A;  1T2I A;  1X1Y A;  1YIJ 3;  3WR2 A;  3DMC A;  1LRA A;  1LOV A;  3WDG B;  1U5O A;  4HBR A;  5KP1 A;  1IYY A;  1W02 A;  1DVC A;  3LZA A;  3D9R A;  3TDG A;  4EYC A;  1RKY A;  1BAO A;  4IPB A;  4LSO A;  3WA2 X;  2XR8 B;  3EHC A;  3CCJ 3;  1EEJ A;  1STD A;  3KSP A;  5CXO A;  1RNT A;  4FR9 A;  1STF I;  4HM4 B;  1JV2 B;  5FGO A;  5IER A;  2GEX A;  3EN1 B;  4K1U A;  3SOA A;  1BRN L;  1BUQ A;  5LC7 A;  1B2Z A;  5D82 A;  1VQ9 3;  1LOX A;  3BNE A;  2QIY A;  1LNI A;  3UJM A;  5RNT A;  1K73 4;  2B1X B;  3DM8 A;  2CC3 A;  2W03 A;  4J8T A;  3F8X A;  3MWZ A;  5LC6 A;  3DUK A;  1BAN A;  2SBL A;  3K0Z A;  3WOF B;  1KWI A;  1E3R A;  3V98 A;  1MGW A;  7GSP A;  1WMO A;  4KFE A;  1I2E A;  3OW2 2;  3CME 3;  4BIR A;  3S27 A;  3F7X A;  3JUP A;  4MMY B;  5AEW B;  3FG3 A;  2BMQ B;  4KT3 B;  4Q53 A;  3T0U A;  4WWU C;  3K7C A;  2R4I A;  4I4K A;  4N6V 0;  5IG3 A;  1DMM A;  3KSE D;  3KE7 A;  4MMZ B;  3CPO A;  4PEJ A;  5TGN A;  4K61 A;  1VQ5 3;  1Q86 4;  1BVI A;  1B27 A;  5HGR A;  4RNZ A;  1FGM A;  4EC6 A;  1B2M A;  1U8C B;  1G0T A;  3CCE 3;  1E97 A;  1OH0 A;  2WOF A;  3AHW A;  3E99 A;  4EW5 A;  5HOH A;  1VQO 3;  1BUJ A;  1UDI I;  2GBX B;  2Q07 A;  3ZG5 A;  1D6Y A;  3FF0 A;  5BXQ A;  1AQZ A;  4I5Q A;  1AY7 A;  3EQQ B;  2PNC A;  4MMX B;  4FCJ A;  1JB2 A;  2IYJ A;  1O7G B;  2WGQ A;  3ZG0 A;  5A0O B;  3MSO A;  3ROB A;  1WMP A;  3BIR A;  2CX0 A;  5EEO A;  1IQX A;  4OVM A;  3S28 A;  1IT8 A;  2YFJ B;  4N6T A;  3I55 3;  1W2Z A;  3HII A;  1WMN A;  2R41 A;  1NU3 A;  3DY5 A;  3MG3 A;  3N54 B;  5AI1 A;  3AMO A;  1RGG A;  1QVF 2;  1GS3 A;  2RSX A;  4NPB A;  4HYZ A;  3WOE B;  2D1W A;  2FGT A;  3GZB A;  1VQK 3;  1AV4 A;  1AR0 A;  4EV5 A;  3AMO B;  1N5P A;  4JRF A;  1BNR A;  5I97 A;  1MWR A;  5KP4 A;  3DH2 A;  5KP3 A;  1F8N A;  2H0G A;  1V58 A;  1LQM B;  2IA7 A;  1YJW 3;  1GD4 A;  5IG5 A;  1FGT A;  3LTA A;  1DVD A;  2Y74 A;  1A90 A;  3CC7 3;  1GYB A;  1SIH A;  2C11 A;  3HOH A;  3OWY A;  5ELU A;  3CD6 3;  1TFO A;  3G0K A;  1A2K A;  1O7M B;  4G1M B;  1KQS 2;  2RCD A;  7STD A;  4L8P A;  2OWP A;  3NV0 A;  3GAX A;  2MF7 A;  3X40 A;  2B24 B;  3LH4 A;  4KZ1 A;  1YJN 3;  1A2P A;  3Q2P A;  4L8O A;  1JJ2 2;  3FZW A;  1N8R 4;  2F56 A;  3F14 A;  3NV0 B;  3CMA 3;  3DGO A;  1HYF A;  2ZL8 A;  5IF6 A;  3G16 A;  5BIR A;  2P0M A;  3X3X A;  4KFF A;  1VQ7 3;  3AHS A;  5IEO A;  1T3B A;  5GSP A;  5IW9 A;  1JRQ A;  3UNL A;  3SOY A;  1GY5 A;  2W2C A;  4HZB B;  3B4O A;  2L4V A;  1BRJ A;  3FCS B;  2K3D A;  3QK9 A;  4BTY A;  4XB5 A;  4XBY A;  3F9S A;  3SVA A;  2CH9 A;  1RGA A;  2SAR A;  1ULI B;  1OHO A;  1I70 A;  1C7H A;  2E2U A;  4HVN A;  4BL2 A;  4CJN A;  1FUS A;  3LXU X;  3SYU A;  2CKF B;  4FMD A;  1OF5 A;  1ZGX A;  4TX4 A;  1CH0 A;  1I2G A;  2Y73 A;  2OTL 3;  2OTJ 3;  4GB5 A;  3CC2 3;  1CYU A;  2A15 A;  4N6L A;  4N6O B;  2M7O A;  1OF5 B;  1M9G A;  1RMS A;  3KII A;  1JZO A;  4J5G A;  4HM8 B;  2CFL A;  4HM2 B;  1M1X B;  5D83 A;  3D4A A;  2ML6 A;  1JBT A;  4ZM8 A;  1OHS A;  3D3L A;  3EN8 A;  2XF3 A;  2HMO B;  1ZO2 A;  1EKM A;  4HM5 B;  2GU1 A;  2FNQ A;  1IQ8 A;  2GXF A;  2P05 A;  2W56 A;  3EBY A;  1MWS A;  3NBJ A;  3WHO A;  2CFD A;  3HK4 A;  3WMD A;  3OWS A;  1I2F A;  1S5A A;  1B2X A;  1NB5 I;  2H0I A;  1TFK A;  1JNQ A;  2W56 B;  1W6C A;  5CK6 A;  4FMB A;  6RNT A;  3DGN A;  3OWU A;  3PXM A;  4OK0 A;  3UL5 A;  4MJD A;  4N6N B;  1I3I A;  2CFK A;  2OOV A;  2XSO B;  3CCM 3;  2CWT A;  1YGE A;  5IEN A;  2KCD A;  2WOH A;  3H3H A;  2WO0 A;  4AEQ A;  3A5E A;  4X2O A;  1GSP A;  1ISK A;  2Z7A A;  1R4C A;  1WTH A;  4RNY A;  2CFW A;  1WQL B;  3LT8 A;  3S67 A;  3CPW 2;  2BNG A;  1W01 A;  4WP5 A;  3CXC 2;  3F40 A;  1W5Z A;  3NUV A;  1IDP A;  3BU4 A;  1GOY A;  1RGE A;  3HI7 A;  4HM0 B;  1FYS A;  1G96 A;  4O8S A;  3LTD A;  2UGI A;  3BNB A;  5JPP A;  3A76 A;  1PYL A;  1N8Q A;  3I0Y A;  4R9K A;  3G4S 3;  1YHQ 3;  3DZL A;  3JUO A;  4N6U A;  4N6M A;  2RNT A;  1RCL A;  2KF3 A;  2STD A;  2ZHX B;  1FGQ A;  3K5T A;  3NM2 A;  3SX1 A;  3VF1 A;  4EV2 A;  1Q7Y 4;  3URP A;  1IV9 A;  1IQY A;  1O7P B;  2GU3 A;  4XBX A;  4RNT A;  2OQE A;  1Q9E A;  3Q1C A;  1VQP 3;  1VZZ A;  1RGK A;  1UCL A;  2CG0 A;  4AKZ A;  3MG2 A;  1HU9 A;  1UCK A;  4FCZ A;  4HM7 B;  1RGH A;  2YX9 A;  3KZT A;  3VSY A;  4X2H A;  1K8A 4;  1Q42 A;  1SQW A;  3JUM A;  3OV4 A;  4HM1 B;  4K90 B;  1BRG A;  4R4K A;  2RFR A;  3FH1 A;  5G1L A;  3LT9 A;  3B8L A;  4ORL A;  3EE1 A;  4KVH A;  3G8Z A;  3PGB A;  1BRS A;  2ZA4 A;  1UUW B;  2KRT A;  1HZ1 A;  3HIG A;  1VQN 3;  1RHL A;  3ER7 A;  3JVC A;  4OUQ A;  1JZD A;  8RNT A;  3NBB A;  1X1W A;  2BMR B;  1CEW I;  4JF8 A;  2XFS A;  3NM7 A;  3PS8 A;  1W6Y A;  2W9P A;  3U1W A;  3V92 A;  4EBG A;  5JBS A;  2GSP A;  4XM4 A;  3QRD A;  4LZI A;  1D6U A;  5D81 A;  3GZX B;  5DRE A;  2K0M A;  2CX1 A;  3NXJ A;  3CCL 3;  1GY7 A;  1IT7 A;  5CF2 A;  3RGR A;  2UUG C;  1IK3 A;  2Z77 A;  1UCJ A;  1UW1 A;  2O3O A;  3EC9 A;  1Y4K A;  1ZX2 A;  3RGA A;  2F86 B;  2RGQ A;  1RGC A;  4KFD A;  1DYU A;  1V57 A;  3MHE A;  4N3V A;  2CK3 H;  1GMP A;  2E2V A;  5AEU B;  1YNV X;  2BIR A;  3J7Y d;  1OGZ A;  1E3V A;  2GEY A;  2I9W A;  1K9M 4;  1N9J A;  1L5G B;  3U97 A;  1W2B 2;  5IG0 A;  1GOU A;  3IPT A;  2PZV A;  2IUJ A;  4NRE A;  1O7N B;  4BTX A;  4O2H A;  2HMK B;  1Q7H A;  4FCM A;  3GWR A;  6GSP A;  3B7C A;  3AGO A;  4HM6 B;  1VQ4 3;  3IMA B;  2QEX 3;  1MGR A;  4XDV A;  1BNG A;  2HMN B;  3I56 3;  1K28 A;  1RN4 A;  2FXT A;  3LTC A;  1EG9 B;  1VQL 3;  1BSE A;  2W6J H;  4WHA A;  7RNT A;  1JKG B;  3B4P A;  2HOH A;  3H51 A;  8CHO A;  2INX A;  4XBT A;  5BU4 A;  3G6E 3;  1JBS A;  1LOY A;  4RZM A;  5AYR B;  2BT3 A;  3K9M C;  1YJ9 3;  2KF4 A;  4BL3 A;  2GBW B;  2RBI A;  4CPK A;  1TP6 A;  1TRP A;  5ELJ A;  4QWT A;  3GSP A;  1DMN A;  3FKA A;  1BRI A;  3EBT A;  4IT7 A;  1MOL A;  4K1V A;  5CLK A;  2CG1 A;  3T8N A;  3BLZ A;  2QGU A;  1TUH A;  3CCQ 3;  1UI7 A; 
#chains in the Genus database with same CATH homology
 3DGY A;  1BNJ A;  3AHW A;  5HOH A;  4GSP A;  9RNT A;  1BUJ A;  1BRK A;  1GMQ A;  3A5E A;  1GSP A;  1AQZ A;  1AY7 A;  1GMR A;  1LOW A;  4J5K A;  1FZU A;  2F5W A;  2F5M A;  1B2S A;  2KF5 A;  1GOY A;  1RGE A;  2F4Y A;  3BU4 A;  1FYS A;  1BSD A;  3BIR A;  1DE3 A;  2AAD A;  1DET A;  1PYL A;  1BU4 A;  2RNT A;  1RCL A;  2KF6 A;  2KF3 A;  1RGG A;  1GOV A;  3URP A;  1PY3 A;  1B21 A;  1RDS A;  1YGW A;  4RNT A;  1BNE A;  1Q9E A;  3D5G A;  1RLS A;  1BNR A;  1RGK A;  1UCL A;  2BU4 A;  3DH2 A;  2AAE A;  4BU4 A;  1UCK A;  1RGF A;  1RGH A;  1T2H A;  1RNB A;  3AGN A;  1RSN A;  1X1X A;  3HOH A;  1BRG A;  3D5I A;  1C54 A;  1RN1 A;  1I0V A;  1BRS A;  2ZA4 A;  1BNI A;  1HZ1 A;  1RCK A;  4HAA A;  1BSA A;  1BSB A;  1RHL A;  1BNS A;  3KCH A;  1BSC A;  8RNT A;  1B2M A;  1R4Y A;  1BIR A;  1A2P A;  4GHO A;  1G02 A;  1B2U A;  1RTU A;  1X1W A;  2F56 A;  1BGS A;  1HYF A;  1B3S A;  1T2I A;  1X1Y A;  2GSP A;  3WR2 A;  5BIR A;  1LRA A;  1LOV A;  1IYY A;  1I0X A;  3AHS A;  1BNF A;  1X1U A;  5GSP A;  1UCJ A;  1BAO A;  3RNT A;  1RNT A;  1TTO A;  2C4B A;  1BRJ A;  1UCI A;  1RGC A;  1BRN L;  1RGA A;  1GMP A;  1B2Z A;  1I3F A;  1YNV X;  2BIR A;  1I70 A;  2SAR A;  1FUS A;  1LNI A;  5RNT A;  1FW7 A;  3SYU A;  1GOU A;  1ZGX A;  1CH0 A;  1I2G A;  1YVS A;  1BAN A;  6GSP A;  3AGO A;  1RMS A;  1MGR A;  7GSP A;  1BNG A;  1MGW A;  3Q3F A;  4J5G A;  1RN4 A;  1I2E A;  1BSE A;  4BIR A;  4HOH A;  3D4A A;  7RNT A;  1JBT A;  2HOH A;  5BU4 A;  1B20 A;  1JBS A;  1LOY A;  3WHO A;  2KAA A;  2KF4 A;  1I8V A;  2RBI A;  1BOX A;  1SAR A;  1RGL A;  1TRQ A;  1I2F A;  1TRP A;  1B2X A;  3GSP A;  1BVI A;  6RNT A;  1B27 A;  1BRI A;  1JBR A;  1FUT A;  1BRH A;  1I3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...