1B28A

Arc repressor myl mutant from salmonella bacteriophage p22
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
MKGMSKMPQFNLRWPREVLDLVRKVAEENGMSVNSYIYQLVMESFKKEGRIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure and dynamics of an Arc repressor mutant reveal premelting conformational changes related to DNA binding.
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Translation/regulation
molecule keywords PROTEIN (REGULATORY PROTEIN ARC)
total genus 8
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03869 Arc Arc-like DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1b28A00
2WVBA 2BSQE 2CPGA 3LGHA 3VEAA 1ARRA 3OD2A 1MNTA 2JXHA 2WVCA 2BJ3A 2BJ9A 2K6LA 2K5JA 2JXGA 4ME7E 2CA9A 1MYKA 4FXEA 2KELA 3QOQA 1BAZA 3GXQA 3FMTA 1Q5VA 2K9IA 2K1OA 4D8JA 1EA4A 2AY0A 1BDVA 1PARA 1ARQA 1B28A 4HV0A 2BJ7A 2WVEA 1MYLA 1U9PA 2K29A 2BNWA 2RBFA 2BJ1A 1QTGA 3FT7A 1BDTA 2JXIA 3VW4A 1NLAA 2BNZA 2CAJA 1P94A 2CADA 2HZAA 3VEBA 1B01A 2CAXA 1X93A 2H1OE 3H87C 1IRQA 2BJ8A 2WVDA 2BA3A 2HZVA 2GPEA 2WVFA
chains in the Genus database with same CATH superfamily
2WVBA 2BSQE 1ARRA 2JXHA 2BJ9A 1OHNA 2K5JA 2CA9A 2WK4A 2KOEA 3H5XA 3SFUA 1ARQA 1Q5VA 2K1OA 4O4RA 3NAHA 2WVEA 4LQ3A 2RBFA 2GPEA 2CKWA 4MJWA 1SIWA 1P94A 3UQSA 4QPXA 3VEBA 2UUWA 2CPGA 2B43A 1MNTA 2WVCA 3UR0A 2JXGA 3UPFA 1Q16A 2KELA 1BAZA 4NRTA 3NO7A 3GXQA 4D8JA 1BDTA 4LQ9A 3VW4A 2A2BA 2WVDA 2CAXA 3QIDA 2WVFA 3LGHA 4NRUA 2BJ3A 2Q2KA 4ME7E 2JBVA 1SH2A 3FMTA 1PARA 2K9IA 2AY0A 1B28A 4HV0A 2K29A 3BSOA 2BNWA 2BJ1A 1SH0A 1NLAA 3BSNA 2BNZA 3NAIA 2CAJA 1SH3A 2CADA 3SFGA 2H1OE 1EA4A 2KKEA 4AAIA 2H3AA 4LRVA 3H5YA 3OD2A 3VEAA 3LJPA 2K6LA 3G5OA 1MYKA 2UUTA 4FXEA 3QOQA 3NNEA 1BDVA 2BJ7A 1MYLA 1U9PA 2JXIA 1QTGA 2HZAA 1B01A 1X93A 3IR7A 3H87C 1IRQA 2ADLA 2BJ8A 2AN7A 1OG7A 2BA3A 2HZVA 3FT7A
chains in the Genus database with same CATH topology
2WVBA 2BSQE 2CPGA 3LGHA 3VEAA 1ARRA 3OD2A 1MNTA 2JXHA 2WVCA 2BJ3A 2BJ9A 2K6LA 2K5JA 2JXGA 4ME7E 2CA9A 1MYKA 4FXEA 2KELA 3QOQA 1BAZA 3GXQA 3FMTA 1Q5VA 2K9IA 2K1OA 4D8JA 1EA4A 2AY0A 1BDVA 1PARA 1ARQA 1B28A 4HV0A 2BJ7A 2WVEA 1MYLA 1U9PA 2K29A 2BNWA 2RBFA 2BJ1A 1QTGA 3FT7A 1BDTA 2JXIA 3VW4A 1NLAA 2BNZA 2CAJA 1P94A 2CADA 2HZAA 3VEBA 1B01A 2CAXA 1X93A 2H1OE 3H87C 1IRQA 2BJ8A 2WVDA 2BA3A 2HZVA 2GPEA 2WVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVB A;  2BSQ E;  2CPG A;  3LGH A;  3VEA A;  1ARR A;  3OD2 A;  1MNT A;  2JXH A;  2WVC A;  2BJ3 A;  2BJ9 A;  2K6L A;  2K5J A;  2JXG A;  4ME7 E;  2CA9 A;  1MYK A;  4FXE A;  2KEL A;  3QOQ A;  1BAZ A;  3GXQ A;  3FMT A;  1Q5V A;  2K9I A;  2K1O A;  4D8J A;  1EA4 A;  2AY0 A;  1BDV A;  1PAR A;  1ARQ A;  1B28 A;  4HV0 A;  2BJ7 A;  2WVE A;  1MYL A;  1U9P A;  2K29 A;  2BNW A;  2RBF A;  2BJ1 A;  1QTG A;  3FT7 A;  1BDT A;  2JXI A;  3VW4 A;  1NLA A;  2BNZ A;  2CAJ A;  1P94 A;  2CAD A;  2HZA A;  3VEB A;  1B01 A;  2CAX A;  1X93 A;  2H1O E;  3H87 C;  1IRQ A;  2BJ8 A;  2WVD A;  2BA3 A;  2HZV A;  2GPE A;  2WVF A; 
#chains in the Genus database with same CATH topology
 2WVB A;  2BSQ E;  1ARR A;  2JXH A;  2BJ9 A;  1OHN A;  2K5J A;  2CA9 A;  2WK4 A;  2KOE A;  3H5X A;  3SFU A;  1ARQ A;  1Q5V A;  2K1O A;  4O4R A;  3NAH A;  2WVE A;  4LQ3 A;  2RBF A;  2GPE A;  2CKW A;  4MJW A;  1SIW A;  1P94 A;  3UQS A;  4QPX A;  3VEB A;  2UUW A;  2CPG A;  2B43 A;  1MNT A;  2WVC A;  3UR0 A;  2JXG A;  3UPF A;  1Q16 A;  2KEL A;  1BAZ A;  4NRT A;  3NO7 A;  3GXQ A;  4D8J A;  1BDT A;  4LQ9 A;  3VW4 A;  2A2B A;  2WVD A;  2CAX A;  3QID A;  2WVF A;  3LGH A;  4NRU A;  2BJ3 A;  2Q2K A;  4ME7 E;  2JBV A;  1SH2 A;  3FMT A;  1PAR A;  2K9I A;  2AY0 A;  1B28 A;  4HV0 A;  2K29 A;  3BSO A;  2BNW A;  2BJ1 A;  1SH0 A;  1NLA A;  3BSN A;  2BNZ A;  3NAI A;  2CAJ A;  1SH3 A;  2CAD A;  3SFG A;  2H1O E;  1EA4 A;  2KKE A;  4AAI A;  2H3A A;  4LRV A;  3H5Y A;  3OD2 A;  3VEA A;  3LJP A;  2K6L A;  3G5O A;  1MYK A;  2UUT A;  4FXE A;  3QOQ A;  3NNE A;  1BDV A;  2BJ7 A;  1MYL A;  1U9P A;  2JXI A;  1QTG A;  2HZA A;  1B01 A;  1X93 A;  3IR7 A;  3H87 C;  1IRQ A;  2ADL A;  2BJ8 A;  2AN7 A;  1OG7 A;  2BA3 A;  2HZV A;  3FT7 A; 
#chains in the Genus database with same CATH homology
 2WVB A;  2BSQ E;  2CPG A;  3LGH A;  3VEA A;  1ARR A;  3OD2 A;  1MNT A;  2JXH A;  2WVC A;  2BJ3 A;  2BJ9 A;  2K6L A;  2K5J A;  2JXG A;  4ME7 E;  2CA9 A;  1MYK A;  4FXE A;  2KEL A;  3QOQ A;  1BAZ A;  3GXQ A;  3FMT A;  1Q5V A;  2K9I A;  2K1O A;  4D8J A;  1EA4 A;  2AY0 A;  1BDV A;  1PAR A;  1ARQ A;  1B28 A;  4HV0 A;  2BJ7 A;  2WVE A;  1MYL A;  1U9P A;  2K29 A;  2BNW A;  2RBF A;  2BJ1 A;  1QTG A;  3FT7 A;  1BDT A;  2JXI A;  3VW4 A;  1NLA A;  2BNZ A;  2CAJ A;  1P94 A;  2CAD A;  2HZA A;  3VEB A;  1B01 A;  2CAX A;  1X93 A;  2H1O E;  3H87 C;  1IRQ A;  2BJ8 A;  2WVD A;  2BA3 A;  2HZV A;  2GPE A;  2WVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...