1B2OA

Clostridium pasteurianum rubredoxin g10vg43a mutant
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
MKKYTCTVCVYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RUBREDOXIN)
publication title Rubredoxin from Clostridium pasteurianum. Structures of G10A, G43A and G10VG43A mutant proteins. Mutation of conserved glycine 10 to valine causes the 9-10 peptide link to invert.
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transport
total genus 7
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1b2oA00
1LKOA 1LKMA 4AR6A 4POFA 1RDVA 2LCQA 1VCXA 3KYXA 3KYWA 4TPUA 1QCVA 1T9PA 1B71A 1CADA 2VL6A 1B2JA 1BQ9A 1FHMA 1IRNA 1S30A 4YWLA 1YK4A 6RXNA 1C09A 1E8JA 4AR3A 2GMGA 2PYAA 2M4YA 1S2ZA 2DSXA 1IROA 2KN9A 1R0IA 3QVDA 2K2DA 1ZRPA 1IU6A 3RYGA 1CAAA 1DVBA 2V3BB 3RZTA 1R0JA 1T9OA 5IY0A 1BFYA 1DX8A 1RWDA 3SS2A 1FHHA 2PVEA 1S24A 2MS3A 1JYBA 1BQ8A 1YV1A 1SMWA 1RB9A 1YUXA 3KYUA 1BRFA 2PVXA 1R0HA 4YWMA 1R0FA 4ME3A 1SMUA 3PWFA 1RDGA 1H7VA 1QYBA 2KKDA 4POGA 1LTLA 3A44A 3KYVA 1SMMA 3RZ6A 3KYYA 1RYTA 4AR4A 8RXNA 1B13A 1T9QA 2QL0A 2HR5A 5AI3A 1R0GA 1BE7A 2RDVA 5RXNA 1YK5A 1LKPA 1IU5A 4AR5A 3PZAA 5AI2A 1B2OA 7RXNA 3MPSA 4RXNA 1YUZA 4K9FA 1NNQA
chains in the Genus database with same CATH superfamily
2H12A 1PFYA 2RFKB 2WB1P 4LHNA 2AQCA 1T9PA 1B71A 2XJUA 2VL6A 4BY1L 3S2DL 5MFPA 1VZHA 1BQ9A 4YWLA 5C4XL 4AR3A 3JR7A 3HOUL 2KN9A 1R0IA 4A3IL 2XJPA 4AHYA 1TWFL 1DVBA 3MQKB 5IY0A 1PFVA 2WAQP 5C3EL 5K2ME 2R93L 1JYBA 1BQ8A 4ZN1B 4A3LL 1YUXA 3QQCE 3HOWL 2PVXA 1TWGL 1R0FA 4ME3A 4BXXL 2J9UB 1LTLA 4XXBB 2AUSB 4JADA 5M5YL 3RZDL 4JAGA 1YK5A 1Z92B 2NVXL 4A93L 4G6BA 3K35A 3PKJA 2B63L 4AI0A 3ZG6A 5M5XL 4AI3A 2Z3QB 4QIWP 5M3ML 5GAHc 1LKOA 1VZIA 5EIOC 4AR6A 2XJRA 3WWNB 3VPBE 3S1QL 5AN9H 1TWHL 3KYXA 4A3FL 2E2HL 3H9CA 3HOYL 3GTLL 3HJWB 3RZOL 5FJ8L 2PYAA 2DSXA 1I3QL 5GADc 2JA7L 2ERSA 2R7ZL 3RYGA 2E2JL 3NFPI 1T9OA 1BFYA 2JI2A 5JVH1 2PMZP 3GTPL 5C4JL 1S24A 2MS3A 1RB9A 3KYUA 3H9BA 4YWMA 1SMUA 2XJVA 1PFUA 3H97A 5IP9L 1H7VA 5MLC3 3CQZL 2C6AA 2C6BA 1SMMA 3RZ6A 4AR4A 1TWAL 5H1Sc 4A3JL 1PFWA 3PO3L 1BE7A 3S2HL 4B8CD 5RXNA 3GTKL 1LKPA 1OWCA 5IYCL 1ODHA 3HAXC 3PKIA 5GAEc 5AI2A 1B2OA 2A68D 3GTJL 7RXNA 3H3VM 5DM71 4GS7D 4JAEA 3PIP1 4K9FA 4AYBP 1NNQA 4BBSL 1RDVA 2B5ID 2LCQA 3FKIL 2JI3A 2NYDA 3B08B 3S17L 3KYWA 1PZXA 4TPUA 2Y0SP 1QCVA 3P8BA 1P7PA 2EY4E 2A6HD 1FHMA 4A3BL 1S30A 3GTOL 1NXGA 4AHXA 2HVYC 5FLML 3MSUA 2M4YA 1S2ZA 5MFZA 3M3YL 4Y52L 4JAFA 2ZIXA 4ZN3B 5M5WL 4A3DL 1IU6A 1CAAA 2V3BB 4XGHA 2XJQA 1Y1WL 1R0JA 3S1ML 2NVYL 1DX8A 3HKZP 1RWDA 3SS2A 4AI1A 2E2IL 2JA6L 2PVEA 2A6ED 2JI1A 2M4VA 1SMWA 2NVTL 3LWPB 2JA8L 1R0HA 1SFOL 4UY81 3LWOB 1RDGA 1QYBA 2KKDA 3LWRB 5JVG1 3HJYB 3A44A 3S15L 3J7Y1 1B13A 1WCML 2HR5A 3P2AA 2NVQL 4A3GL 1VZGA 3S1RL 2AYJA 2ERJA 3H99A 2CKCA 3LPEB 1IU5A 4AR5A 3S16L 3LNLA 2V0FA 2Z3RB 3PZAA 2PPTA 3HOVL 5EINC 3MPSA 4RXNA 2VUML 5DM61 4LHLA 4X6AL 2O5JD 4WFN1 1QQTA 1F4LA 5GAGc 4C3IL 3K7AL 1LKMA 4U671 4A3KL 4POFA 1VCXA 2XJTA 1Y1VL 2YU9L 5IYBL 3M4OL 1CADA 1I6HL 2CKAA 4Y7NL 1B2JA 2BE5D 3PO2L 1IRNA 1YK4A 6RXNA 3HOZL 3H0GL 1C09A 1I50L 1E8JA 5IYDL 2GMGA 3LWQB 1IROA 2A69D 2M6OA 2M6PA 3QVDA 3HOXL 5M3FL 2K2DA 1OWBA 3S14L 4V196 4C3HL 2CR8A 1ZRPA 3J7Z1 3GTGL 3I4NL 3RZTA 4C3JL 2V0EA 3I4ML 3PIO1 1FHHA 1WJVA 5MGNA 1K83L 1YV1A 2APOB 1BRFA 3FDJA 3GTML 4TVMA 5IP7L 3PWFA 4A3CL 3S1NL 3GTQL 5MF6A 3B0AB 4POGA 1IW7D 2JA5L 3KYVA 4A3ML 2PSMC 4AI2A 1RYQA 3WWLA 3KYYA 1RYTA 4BBRL 8RXNA 1T9QA 2QL0A 3LWVB 5AI3A 2L0ZA 4AHZA 1R9TL 1R0GA 1TWCL 2RDVA 4BY7L 1NXEA 3IU3I 4C2M1 3PL5A 5C44L 2XJSA 4E6YA 1YUZA 4A3EL 4AHWA 2R92L
chains in the Genus database with same CATH topology
5GAHc 1LKOA 5GAGc 4U671 1LKMA 2H12A 1VZIA 5EIOC 4AR6A 2XJRA 3WWNB 4POFA 1RDVA 2B5ID 3VPBE 2LCQA 1VCXA 5AN9H 2XJTA 4LHNA 2JI3A 2NYDA 3B08B 3KYXA 3KYWA 4TPUA 1QCVA 1T9PA 1B71A 1CADA 2XJUA 3P8BA 2VL6A 2CKAA 5MFPA 1VZHA 1B2JA 1BQ9A 2A6HD 2BE5D 1FHMA 1IRNA 1S30A 4YWLA 1YK4A 6RXNA 1C09A 1NXGA 4AHXA 1E8JA 3MSUA 2GMGA 4AR3A 2M4YA 2PYAA 1S2ZA 2DSXA 1IROA 2A69D 2KN9A 2M6PA 2M6OA 1R0IA 5MFZA 3QVDA 2XJPA 5GADc 4AHYA 4JAFA 2ZIXA 4ZN3B 2K2DA 1OWBA 4V196 2CR8A 1ZRPA 2ERSA 1IU6A 3J7Z1 3RYGA 1CAAA 1DVBA 2V3BB 4XGHA 2XJQA 3RZTA 3NFPI 2V0EA 1R0JA 1T9OA 5IY0A 1BFYA 2JI2A 5K2ME 5JVH1 1DX8A 1RWDA 3PIO1 3SS2A 4AI1A 1FHHA 1WJVA 2PVEA 2A6ED 2JI1A 1S24A 5MGNA 2MS3A 1JYBA 2M4VA 1BQ8A 4ZN1B 1YV1A 1SMWA 1RB9A 1YUXA 3KYUA 3QQCE 1BRFA 2PVXA 1R0HA 4TVMA 4YWMA 1R0FA 4ME3A 1SMUA 2XJVA 4UY81 3PWFA 1RDGA 1H7VA 1QYBA 2KKDA 5MF6A 3B0AB 4POGA 5MLC3 2J9UB 1LTLA 1IW7D 2C6AA 5JVG1 3A44A 2C6BA 3KYVA 2PSMC 4XXBB 4AI2A 3J7Y1 1RYQA 1SMMA 3RZ6A 3KYYA 1RYTA 3WWLA 4AR4A 8RXNA 1B13A 1T9QA 5H1Sc 2QL0A 2HR5A 3P2AA 5AI3A 4JADA 2L0ZA 4AHZA 1R0GA 1VZGA 1BE7A 2AYJA 2RDVA 2ERJA 4JAGA 4B8CD 5RXNA 1YK5A 1NXEA 1LKPA 1Z92B 1OWCA 1IU5A 2CKCA 3IU3I 3LPEB 4AR5A 1ODHA 3LNLA 2V0FA 2Z3RB 3PKIA 5GAEc 4G6BA 3K35A 3PKJA 3PZAA 5AI2A 1B2OA 2A68D 4AI0A 3ZG6A 2PPTA 2XJSA 7RXNA 4E6YA 5EINC 3MPSA 4RXNA 5DM61 1YUZA 4LHLA 5DM71 2O5JD 4WFN1 4AI3A 4AHWA 2Z3QB 4GS7D 4JAEA 3PIP1 4K9FA 1NNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKO A;  1LKM A;  4AR6 A;  4POF A;  1RDV A;  2LCQ A;  1VCX A;  3KYX A;  3KYW A;  4TPU A;  1QCV A;  1T9P A;  1B71 A;  1CAD A;  2VL6 A;  1B2J A;  1BQ9 A;  1FHM A;  1IRN A;  1S30 A;  4YWL A;  1YK4 A;  6RXN A;  1C09 A;  1E8J A;  4AR3 A;  2GMG A;  2PYA A;  2M4Y A;  1S2Z A;  2DSX A;  1IRO A;  2KN9 A;  1R0I A;  3QVD A;  2K2D A;  1ZRP A;  1IU6 A;  3RYG A;  1CAA A;  1DVB A;  2V3B B;  3RZT A;  1R0J A;  1T9O A;  5IY0 A;  1BFY A;  1DX8 A;  1RWD A;  3SS2 A;  1FHH A;  2PVE A;  1S24 A;  2MS3 A;  1JYB A;  1BQ8 A;  1YV1 A;  1SMW A;  1RB9 A;  1YUX A;  3KYU A;  1BRF A;  2PVX A;  1R0H A;  4YWM A;  1R0F A;  4ME3 A;  1SMU A;  3PWF A;  1RDG A;  1H7V A;  1QYB A;  2KKD A;  4POG A;  1LTL A;  3A44 A;  3KYV A;  1SMM A;  3RZ6 A;  3KYY A;  1RYT A;  4AR4 A;  8RXN A;  1B13 A;  1T9Q A;  2QL0 A;  2HR5 A;  5AI3 A;  1R0G A;  1BE7 A;  2RDV A;  5RXN A;  1YK5 A;  1LKP A;  1IU5 A;  4AR5 A;  3PZA A;  5AI2 A;  1B2O A;  7RXN A;  3MPS A;  4RXN A;  1YUZ A;  4K9F A;  1NNQ A; 
#chains in the Genus database with same CATH topology
 2H12 A;  1PFY A;  2RFK B;  2WB1 P;  4LHN A;  2AQC A;  1T9P A;  1B71 A;  2XJU A;  2VL6 A;  4BY1 L;  3S2D L;  5MFP A;  1VZH A;  1BQ9 A;  4YWL A;  5C4X L;  4AR3 A;  3JR7 A;  3HOU L;  2KN9 A;  1R0I A;  4A3I L;  2XJP A;  4AHY A;  1TWF L;  1DVB A;  3MQK B;  5IY0 A;  1PFV A;  2WAQ P;  5C3E L;  5K2M E;  2R93 L;  1JYB A;  1BQ8 A;  4ZN1 B;  4A3L L;  1YUX A;  3QQC E;  3HOW L;  2PVX A;  1TWG L;  1R0F A;  4ME3 A;  4BXX L;  2J9U B;  1LTL A;  4XXB B;  2AUS B;  4JAD A;  5M5Y L;  3RZD L;  4JAG A;  1YK5 A;  1Z92 B;  2NVX L;  4A93 L;  4G6B A;  3K35 A;  3PKJ A;  2B63 L;  4AI0 A;  3ZG6 A;  5M5X L;  4AI3 A;  2Z3Q B;  4QIW P;  5M3M L;  5GAH c;  1LKO A;  1VZI A;  5EIO C;  4AR6 A;  2XJR A;  3WWN B;  3VPB E;  3S1Q L;  5AN9 H;  1TWH L;  3KYX A;  4A3F L;  2E2H L;  3H9C A;  3HOY L;  3GTL L;  3HJW B;  3RZO L;  5FJ8 L;  2PYA A;  2DSX A;  1I3Q L;  5GAD c;  2JA7 L;  2ERS A;  2R7Z L;  3RYG A;  2E2J L;  3NFP I;  1T9O A;  1BFY A;  2JI2 A;  5JVH 1;  2PMZ P;  3GTP L;  5C4J L;  1S24 A;  2MS3 A;  1RB9 A;  3KYU A;  3H9B A;  4YWM A;  1SMU A;  2XJV A;  1PFU A;  3H97 A;  5IP9 L;  1H7V A;  5MLC 3;  3CQZ L;  2C6A A;  2C6B A;  1SMM A;  3RZ6 A;  4AR4 A;  1TWA L;  5H1S c;  4A3J L;  1PFW A;  3PO3 L;  1BE7 A;  3S2H L;  4B8C D;  5RXN A;  3GTK L;  1LKP A;  1OWC A;  5IYC L;  1ODH A;  3HAX C;  3PKI A;  5GAE c;  5AI2 A;  1B2O A;  2A68 D;  3GTJ L;  7RXN A;  3H3V M;  5DM7 1;  4GS7 D;  4JAE A;  3PIP 1;  4K9F A;  4AYB P;  1NNQ A;  4BBS L;  1RDV A;  2B5I D;  2LCQ A;  3FKI L;  2JI3 A;  2NYD A;  3B08 B;  3S17 L;  3KYW A;  1PZX A;  4TPU A;  2Y0S P;  1QCV A;  3P8B A;  1P7P A;  2EY4 E;  2A6H D;  1FHM A;  4A3B L;  1S30 A;  3GTO L;  1NXG A;  4AHX A;  2HVY C;  5FLM L;  3MSU A;  2M4Y A;  1S2Z A;  5MFZ A;  3M3Y L;  4Y52 L;  4JAF A;  2ZIX A;  4ZN3 B;  5M5W L;  4A3D L;  1IU6 A;  1CAA A;  2V3B B;  4XGH A;  2XJQ A;  1Y1W L;  1R0J A;  3S1M L;  2NVY L;  1DX8 A;  3HKZ P;  1RWD A;  3SS2 A;  4AI1 A;  2E2I L;  2JA6 L;  2PVE A;  2A6E D;  2JI1 A;  2M4V A;  1SMW A;  2NVT L;  3LWP B;  2JA8 L;  1R0H A;  1SFO L;  4UY8 1;  3LWO B;  1RDG A;  1QYB A;  2KKD A;  3LWR B;  5JVG 1;  3HJY B;  3A44 A;  3S15 L;  3J7Y 1;  1B13 A;  1WCM L;  2HR5 A;  3P2A A;  2NVQ L;  4A3G L;  1VZG A;  3S1R L;  2AYJ A;  2ERJ A;  3H99 A;  2CKC A;  3LPE B;  1IU5 A;  4AR5 A;  3S16 L;  3LNL A;  2V0F A;  2Z3R B;  3PZA A;  2PPT A;  3HOV L;  5EIN C;  3MPS A;  4RXN A;  2VUM L;  5DM6 1;  4LHL A;  4X6A L;  2O5J D;  4WFN 1;  1QQT A;  1F4L A;  5GAG c;  4C3I L;  3K7A L;  1LKM A;  4U67 1;  4A3K L;  4POF A;  1VCX A;  2XJT A;  1Y1V L;  2YU9 L;  5IYB L;  3M4O L;  1CAD A;  1I6H L;  2CKA A;  4Y7N L;  1B2J A;  2BE5 D;  3PO2 L;  1IRN A;  1YK4 A;  6RXN A;  3HOZ L;  3H0G L;  1C09 A;  1I50 L;  1E8J A;  5IYD L;  2GMG A;  3LWQ B;  1IRO A;  2A69 D;  2M6O A;  2M6P A;  3QVD A;  3HOX L;  5M3F L;  2K2D A;  1OWB A;  3S14 L;  4V19 6;  4C3H L;  2CR8 A;  1ZRP A;  3J7Z 1;  3GTG L;  3I4N L;  3RZT A;  4C3J L;  2V0E A;  3I4M L;  3PIO 1;  1FHH A;  1WJV A;  5MGN A;  1K83 L;  1YV1 A;  2APO B;  1BRF A;  3FDJ A;  3GTM L;  4TVM A;  5IP7 L;  3PWF A;  4A3C L;  3S1N L;  3GTQ L;  5MF6 A;  3B0A B;  4POG A;  1IW7 D;  2JA5 L;  3KYV A;  4A3M L;  2PSM C;  4AI2 A;  1RYQ A;  3WWL A;  3KYY A;  1RYT A;  4BBR L;  8RXN A;  1T9Q A;  2QL0 A;  3LWV B;  5AI3 A;  2L0Z A;  4AHZ A;  1R9T L;  1R0G A;  1TWC L;  2RDV A;  4BY7 L;  1NXE A;  3IU3 I;  4C2M 1;  3PL5 A;  5C44 L;  2XJS A;  4E6Y A;  1YUZ A;  4A3E L;  4AHW A;  2R92 L; 
#chains in the Genus database with same CATH homology
 5GAH c;  1LKO A;  5GAG c;  4U67 1;  1LKM A;  2H12 A;  1VZI A;  5EIO C;  4AR6 A;  2XJR A;  3WWN B;  4POF A;  1RDV A;  2B5I D;  3VPB E;  2LCQ A;  1VCX A;  5AN9 H;  2XJT A;  4LHN A;  2JI3 A;  2NYD A;  3B08 B;  3KYX A;  3KYW A;  4TPU A;  1QCV A;  1T9P A;  1B71 A;  1CAD A;  2XJU A;  3P8B A;  2VL6 A;  2CKA A;  5MFP A;  1VZH A;  1B2J A;  1BQ9 A;  2A6H D;  2BE5 D;  1FHM A;  1IRN A;  1S30 A;  4YWL A;  1YK4 A;  6RXN A;  1C09 A;  1NXG A;  4AHX A;  1E8J A;  3MSU A;  2GMG A;  4AR3 A;  2M4Y A;  2PYA A;  1S2Z A;  2DSX A;  1IRO A;  2A69 D;  2KN9 A;  2M6P A;  2M6O A;  1R0I A;  5MFZ A;  3QVD A;  2XJP A;  5GAD c;  4AHY A;  4JAF A;  2ZIX A;  4ZN3 B;  2K2D A;  1OWB A;  4V19 6;  2CR8 A;  1ZRP A;  2ERS A;  1IU6 A;  3J7Z 1;  3RYG A;  1CAA A;  1DVB A;  2V3B B;  4XGH A;  2XJQ A;  3RZT A;  3NFP I;  2V0E A;  1R0J A;  1T9O A;  5IY0 A;  1BFY A;  2JI2 A;  5K2M E;  5JVH 1;  1DX8 A;  1RWD A;  3PIO 1;  3SS2 A;  4AI1 A;  1FHH A;  1WJV A;  2PVE A;  2A6E D;  2JI1 A;  1S24 A;  5MGN A;  2MS3 A;  1JYB A;  2M4V A;  1BQ8 A;  4ZN1 B;  1YV1 A;  1SMW A;  1RB9 A;  1YUX A;  3KYU A;  3QQC E;  1BRF A;  2PVX A;  1R0H A;  4TVM A;  4YWM A;  1R0F A;  4ME3 A;  1SMU A;  2XJV A;  4UY8 1;  3PWF A;  1RDG A;  1H7V A;  1QYB A;  2KKD A;  5MF6 A;  3B0A B;  4POG A;  5MLC 3;  2J9U B;  1LTL A;  1IW7 D;  2C6A A;  5JVG 1;  3A44 A;  2C6B A;  3KYV A;  2PSM C;  4XXB B;  4AI2 A;  3J7Y 1;  1RYQ A;  1SMM A;  3RZ6 A;  3KYY A;  1RYT A;  3WWL A;  4AR4 A;  8RXN A;  1B13 A;  1T9Q A;  5H1S c;  2QL0 A;  2HR5 A;  3P2A A;  5AI3 A;  4JAD A;  2L0Z A;  4AHZ A;  1R0G A;  1VZG A;  1BE7 A;  2AYJ A;  2RDV A;  2ERJ A;  4JAG A;  4B8C D;  5RXN A;  1YK5 A;  1NXE A;  1LKP A;  1Z92 B;  1OWC A;  1IU5 A;  2CKC A;  3IU3 I;  3LPE B;  4AR5 A;  1ODH A;  3LNL A;  2V0F A;  2Z3R B;  3PKI A;  5GAE c;  4G6B A;  3K35 A;  3PKJ A;  3PZA A;  5AI2 A;  1B2O A;  2A68 D;  4AI0 A;  3ZG6 A;  2PPT A;  2XJS A;  7RXN A;  4E6Y A;  5EIN C;  3MPS A;  4RXN A;  5DM6 1;  1YUZ A;  4LHL A;  5DM7 1;  2O5J D;  4WFN 1;  4AI3 A;  4AHW A;  2Z3Q B;  4GS7 D;  4JAE A;  3PIP 1;  4K9F A;  1NNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...