1B2RA

Ferredoxin-nadp+ reductase (mutation: e 301 a)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the catalytic role of Glu301 in Anabaena PCC 7119 ferredoxin-NADP+ reductase revealed by x-ray crystallography.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN-NADP+ REDUCTASE)
total genus 92
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1b2rA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1b2rA02
3CC2B 4ZCMA 3MHPA 3CCJB 4WQMA 2YWHA 5H59A 1DDGA 1VQPB 4DQKA 1QUFA 3E1YE 2GPJA 1JB9A 4PC1A 1IJFA 3ZC3A 4ZCIA 2QTZA 1R5NA 2B5OA 3QFSA 4DQLA 4ZCLA 3VO2A 1W34A 4AC9A 4RD0A 2X3UA 1ZUNB 1BQEA 1QFZA 3JQQA 2BPOA 3I1FA 1EP2B 1TUIA 3AVVA 1ZM3A 1K73D 3CC4B 4YAFA 1VQ8B 4ZV4A 3CXCB 4YHBA 4YAOA 4P6VF 1H85A 3QE2A 3CW2A 2QA4B 2ZITA 1YI2B 3CCEB 4HE6A 4LBVA 1KK3A 4G5GA 5DSZA 1G7CA 1W87A 4F7DA 3ZBTA 1E63A 1VQKB 1TLLA 3W2FA 5AN9A 4LBZA 3LYUA 2HDNB 4FWTA 1VQLB 1I7PA 2D74A 1NDHA 4PGOA 4PC7A 3CCMB 3QFCA 1IJEA 2BF4A 1BX0A 4QFMA 1VQOB 4K1XA 5EMNA 4R71A 5GV8A 2QMUA 1EXMA 3CCVB 3W5HA 4NCNA 2R6HA 4B44A 1VQ6B 2RC6A 4ZGQB 1Q86D 1DG1G 4Y9RA 2GQFA 4PC2A 4B4DA 5TR9A 4H9GA 3FPKA 1FNMA 4RD2A 2DERA 1OGIA 1QX4A 3QFTA 3B78A 1EP3B 1ZM4A 1G7RA 3CCRB 1FNDA 1GO2A 2VNKA 3J81k 1F20A 1AIPA 1Q82D 2VNHA 1H42A 2XNJA 3P27A 3OZVA 4TMXA 3ZZUA 1ZM2A 1KTVA 5THXA 1W2BB 1CNFA 2OK7A 1FRQA 3W5UA 3QFRA 1BJKA 1DARA 1D2EA 2OK8A 2VNJA 3LO8A 1JJ2B 3ZZ0A 1GJRA 1JA1A 4C43A 2BVNA 3WNBA 2QN6A 1JA0A 4YAWA 1G7TA 2PMDA 1W35A 1N8RD 1DDIA 4UAJA 2YWGA 3B82A 1CQXA 4M1KA 4QHYA 5TY0A 3OZUA 3ZZTA 1VQ5B 2PIAA 1KC8D 1R5OA 2CNDA 3W5VA 4LC0A 2YWFA 3MMPA 1TTTA 4RD3A 4P3YA 2QTLA 4PC6A 5H5JA 4N3GA 1VQ4B 3AVWA 3CCQB 2PLFA 3WNDA 4Y9UA 4ACBA 4N3NA 3LVBA 1VQNB 3AGQA 4M53A 2CRVA 2VYQA 3WNCA 3AGPA 1EFTA 2C78A 2XNCA 3WBJA 3WXMA 4AF7A 4TN1A 1QVFB 1FNBA 3ES9A 5JBQA 1BX1A 2FX3A 4TMVA 3SJZA 1QGYA 3WBKA 1OB5A 3MCAA 1NJID 1WDTA 1FRNA 2DEUA 1N0VC 1U2RA 3CC7B 1VQ7B 3CCLB 5FA6A 1QVGB 1QG0A 4G1BA 4AF6A 4Y7CA 1JNYA 4FN5A 1EFUA 2EFGA 1ELOA 1E64A 1QGZA 2DY1A 1M90D 3CD6B 3AVTA 4IW3B 2HMAA 4RD4A 4MYTA 4BPRA 4U9UA 1YITB 3LRXA 3E20A 3I55B 3G4SB 3I56B 3OW2B 3FJOA 2DETA 1EP1B 3W2IA 1XE1A 4LBYA 3PENA 3W2HA 1N0UA 1VQMB 3VMFA 3U6KA 1FNCA 1VQ9B 1YHQB 1ZM9A 2J7KA 1KK1A 2BGIA 2DCUA 3AVUA 5TV2A 1S0UA 1KQSB 5KSWB 3G71B 3V76A 1YJNB 3AVXA 4RCZA 2EIXA 3VNVA 3A1FA 4B47A 3G6EB 4YAUA 3JQRA 4RD6A 1B23P 1HA3A 2OTLB 1TVCA 1CNEA 1Q81D 1YJ9B 2XEXA 4NBSA 3CRZA 4B48A 1QUEA 4ACAA 2NPFA 2BM1A 3B8HA 2OTJB 1QH0A 3WY9A 2VNIA 3CCUB 1YIJB 4G1VA 1K9MD 1J9ZA 2BMWA 5HXBA 1GVHA 3VNUA 2AHOA 5GV7A 1KJZA 1QFYA 1KD1D 1QFJA 1SM4A 4RJLA 1KK2A 2BN4A 4M0LA 1EFCA 1QGAA 1E62A 2B7CA 4M4SA 1D8TA 3AVYA 1SKQA 2HCJB 2E1RA 4FK8A 1F60A 2BV3A 4HE5A 4MYUA 4B3XA 4ZGNB 3U6BA 3P26A 4B43A 3CPWB 1GAQA 2C77A 4C0SA 3CMAB 2BSAA 1AMOA 4LBWA 3CCSB 1IB0A 1UMKA 2YWEA 3CMEB 1OGJA 4YALA 3ZBUA 4Q7JB 1B2RA 4PC3A 1YJWB 1R5BA 3OJXA 3CB4A 4RCYA 3W2EA 3JQPA 4RD1A 1GR1A 1S72B 3WYAA 1A8PA 4EH1A 3VO1A 1FDRA 1D1NA 2VZLA 2B7BA 1Q7YD 2RC5A 1K8AD 3QSYA 1OB2A 4J0QA 1EWYA 4TMZA 3OJWA 2QEXB 4TMWA 3OZWA 4TMTA 1M1KD 2QDXA 2BGJA 4M2LA 1KRHA 1KK0A 1XB2A 1GAWA 2BM0A 3U2QA 3W2GA 1G7SA
chains in the Genus database with same CATH superfamily
1SOWA 1ST2A 4K1LA 5ALDA 2B34A 3WAKA 1Q2UA 4AJPA 5KNCA 3GPLA 4QDKA 1XZPA 4B9EA 2WRZA 3JYOA 2AFRA 3I53A 1N7GA 1WPGA 4DWWA 3AIKA 1NVMB 3CCJB 1SCAA 2PZ8A 3DFFA 3I73A 2W6PA 1ZD3A 2WF6A 4E1BA 3LP6A 2AI2A 1NW7A 4WFQA 4YWJA 3GLQA 4ZOAA 2G5TA 2QZSA 1EX1A 2OLKA 4UVGA 3QNUA 5BN5A 3BXZA 5DN6D 5ECGC 3IKMB 3UATA 3V7NA 2Z58A 1W48A 4LTMA 3TL3A 2Y68A 4AT1A 1DEHA 1KZ9A 2HJGA 3NHSA 1AQLA 2JEOA 2WNSA 3NKFA 3R6WA 2XZPA 2MHCA 1IJFA 3IIJA 4JCCA 3Q41A 3UM9A 4DUZB 4LYAA 1T5BA 3G7NA 4FEGA 5BN5B 1BDHA 3WK9A 3U7JA 4IQ4A 2O2XA 2P6NA 3CX4A 5AUQA 3IMKA 1WVGA 3ZQKA 3ZHVA 4I1RA 1KJIA 4C4RA 5U4QA 4FZ3A 2P9HA 3BD8A 1RQ2A 1HM5A 1JX6A 1BZYA 2YHBA 3CPHA 1KI6B 3OQVA 5AM4A 4IXWA 4NF2A 3QEJA 3GEBA 4JOSA 3DR3A 3E9EA 4ZA2A 3TMKA 5GTDA 4IG4A 4BB5A 3W79A 4QBHA 3ZCVA 3F5DA 3U4AA 4B17A 4QKQA 4EYQA 4NBVA 1KI2A 4FFSA 4BZQA 1WF6A 3KOOA 3KSUA 2GXQA 1NUTA 5K3AA 3KT3A 5BQ3A 3RV3A 2FEMA 3JD3A 3KQWA 4A8JB 4GSLA 1P60A 1USKA 3K2BA 4HPWA 4JMLA 3U80A 4C04A 1N2XA 4POOA 3N0WA 3QMWA 4HB0A 3PC2A 1R0YA 1VF7A 1TAHA 3FYDA 3DAYA 3TFWA 4DF3A 3G88A 3HCFA 1IVSA 3WGLA 1KI8A 2C7VA 4QREA 5A4JA 1H6AA 1LEHA 3KHKA 4KITB 1SVNA 5IG2A 3EVBA 1II0A 1WOOA 1NJ5A 2RGUA 4Y2VA 1WULS 5IJXA 1LPAB 2GN0A 3F1LA 5HIJA 5DLEA 3IIIA 2JNWA 4TXJA 4Q4HB 1JG6A 2QTBA 4GXTA 3ANXA 2CDRA 3M81A 1W87A 2EJBA 3RTGA 4TXHA 1HNNA 4NCIA 1ZSYA 2IL1A 2BT4A 3AVQA 1YUNA 2GN4A 4MEJA 4BB6A 2P9QA 1W6RA 1WOSA 4L4UA 3C74A 4PSDA 2DSNA 4QUGA 2WG1A 2QVXX 1LRJA 2WIGA 3L18A 4IZHA 3T5GA 3VZQA 1IOZA 1GXSA 1VQ1A 1ORRA 4PGOA 3FMVA 4ADSG 5G3ZA 2VJCA 3A10A 4Q3DA 2V4UA 2HIHA 4WJZA 1JP7A 2FF7A 2BBOA 1PBNA 1NB9A 1GUDA 3ITEA 3NUGA 4GEKA 1Q15A 4PSCA 2VSYA 3R3XA 1PDWA 1M2FA 2ZW9A 2ZOSA 1TRKA 2FWIA 2JG3A 2AYZA 2XE4A 4WBXC 1COWA 3TMAA 2ODNA 2LZ0A 4DNXA 5A2GA 2J4CA 1QANA 3ADBA 2EJWA 4ZAFA 1Z45A 1UR5A 2RHTA 4GRAA 3LT5A 3GLIE 3MGGA 1XPUA 3ED5A 5MF6A 2PX5A 1BXRB 4OHKA 2W58A 1S9DA 3HLKA 4MWZA 3IUBA 2FKAA 4RKWA 2IZ0A 3EWAA 4LN1A 1N6OA 4WFKA 4WKNA 2HIGA 1TPZA 2QRZA 3K9GA 1YAJA 4ZVOA 3BMNA 4K6KA 3G1UA 4X7MA 4B6SA 2HADA 5E3IA 4YEDA 2V4DA 3O8QB 3VDRA 3IA7A 2JD0A 3LUHA 3EUAA 4KPGA 1SA0A 2HY7A 3G5AA 1HYHA 5FUQA 2YDXA 3OX4A 2WT8A 4PGHA 1HQDA 1U5AA 3PDIB 1DE0A 2WY2D 3UA4A 1C1XA 2ONYA 5DBGA 3B6IA 4HJXA 5F4ZA 2IS6A 3TJRA 3G2JA 4X1IA 5AOVA 3B3AA 1COWD 4PR3A 1H42A 4QG7A 3RG2A 7AT1A 3DAGA 4S0XA 3BX1A 1U6IA 4F56A 1V0JA 3HP4A 1KVUA 3GLGE 4G0QA 4ALMA 5JCJA 2R1TA 3HCNA 4XVUA 1E8MA 3RAPR 2QTRA 4EYKA 1V16B 5F2EA 4QJBA 5HSGA 1HKUA 2NV4A 2X40A 3VXKA 1UD4A 2YV4A 2ZZKA 4JYMA 6AT1A 4LY6A 1RVDA 4DZTA 1WIWA 3IV6A 3KJFA 3PRHA 4J4TA 4NNPA 4XPIB 2GN6A 3L1IA 1B0ZA 4K81B 3ZGNA 5KTKA 4JX9A 2F3QA 5CURA 3U3RA 2MSDB 4YYEA 4Q4AB 3RHFA 4E6PA 3VI3B 2A0YA 4BTVA 4PIMA 5JYBA 1WO8A 1Z4PX 1X19A 5DX0A 3E70C 1C4WA 1I7LA 1ND5A 1T5HX 5ESXA 3X1XA 3B5EA 4ID3A 5H8WA 1NNEA 1DWUA 2CDNA 1TDJA 2EFYA 3GG9A 2JJYA 1HUQA 1M34A 2IITA 1DFGA 2Q1WA 2WTNA 4L7QA 4EFMA 1P4GA 2P6UA 4B87A 1Z88A 1QFMA 3NYWA 5D3MB 5T8KA 3INYA 5LPNA 4YAWA 2BGRA 4UDYX 1Z6GA 4YDRA 1XD9A 2CXUA 2FZEA 2IPOA 2OV6A 3F9CA 4R0MA 4ZYLA 1Z5GA 4P5EA 1R1DA 1HDGO 1ZA1A 5K99A 1YHZA 2A7QA 1A9ZA 2XZLA 2XAUA 2R5WA 1XVVA 4B31A 2ATCA 1I6WA 3VH2A 4OBXA 2VBTA 3HKDA 2WYHA 1L5LA 3OLQA 1YC2A 3RUEA 1TIBA 4FDAA 1MP0A 3Q2IA 5DYWA 4G5FA 4C22A 1C4KA 1FP6A 3M6IA 4F38A 2ECOA 4Z2YA 4IGKA 1JL3A 1UKZA 4YJ3B 3WLRA 4HNTA 2D0PB 1ECGA 4FYKA 1QGUA 2AMVA 2XUGA 2H48A 3E2MA 1D0SA 3TRJA 5EP2A 1U3DA 3GB9A 4M9SA 4OSOA 1FUEA 5BUCA 1UBCA 4DWJA 1BOFA 2OZEA 1FBNA 1PS9A 2WJZB 5JE8A 5I6DA 2F43A 3SJCA 3JZMA 2GTIA 1P8JA 3FYHA 2ZJBA 3L06A 2PAFA 2ZK7A 4MVJP 4X44A 3TOZA 4AO7A 4U0JA 1N7JA 4BU1A 1I4EB 1QS0B 2AG5A 2YHUA 3JYLA 4M1SA 1QE5A 2DHQA 4GX0A 4U9HS 5E9JA 1Q44A 2F1OA 3TTWA 5KDDA 5JCPA 4JA0A 2EBUA 1M2HA 5JZOA 3LT2A 4TTTS 3V7UA 1J5PA 3RYIA 3CGWA 1FP7A 3VGPA 4MV8A 2P3MA 4HTFA 2V65A 3K8YA 1ADYA 4QYTA 3K71B 2HCTA 1NFFA 2JAXA 1SBCA 1E79D 2AVDA 2FNAA 3D5TA 2B2NA 4RS3A 2RGCA 4YRQA 3HU3A 3EEIA 1VBKA 3O4HA 4KLNA 1T9ZA 1WZIA 2YJGA 5JAIA 1QPZA 3D6HA 3H7IA 5EMMA 1T0UA 5KCMA 2HF8A 4B5KA 6REQB 4RVGA 5L3ZA 5IYQA 2PJRA 1RU3A 2IHYA 1PJ8A 3JAKA 2ZU0C 1WDTA 1M33A 2H59A 3KDAA 4HFMA 1BCSB 4TM8A 4AMGA 4G24A 4WNAB 4LRTB 3V1KA 3R4VA 2X8JA 4NYIR 3H2GA 4YR9A 4EJSB 2CLIB 2JVIA 2RH9B 3BRQA 2PKWA 1AS0A 1WQ1R 2PVSA 2Z8YM 4FCTA 1SXJE 2YVLA 1R8JA 2EBWA 3MLAA 1EXVA 5LKRA 3OOYA 4Q12A 4DPKA 4TYNA 1KPGA 1QO0D 4ZZ3A 4MV0A 2O8FB 2CMHA 5ITZA 3KQVA 3FHOA 3A6KA 1FPQA 3NE5B 3VFDA 5DCUA 1JFVA 1NR1A 2AV6A 3BAZA 2H2WA 2CUNA 4C3OB 3K1YA 3PXUA 1J25A 1JU4A 2P2ZA 4FT2A 1MO6A 5IZ4A 2WU4A 3AR8A 4FYJA 1W36B 1AGYA 1M90D 2PH1A 2DUUA 5D7BA 1GPNA 2WA2A 5BOVA 3W5CA 2ZJAA 3SEJA 1XZLA 2Q8NA 2ZB2A 4CUZA 3OFVA 4Z5XA 2H85A 3ZH9B 5T3UA 4U9UA 1XEFA 2AWNA 4ZVPA 4WNYA 4A6EA 2H3EA 2OZLB 1U63A 3DL2A 3NTXA 4X84A 2PUVA 1G8SA 4ZYVA 1P9WA 1Z56C 3H9UA 1JILA 2ONJA 4UFNA 4RULA 2VSXA 2VYNA 3NHLA 2AOUA 1WBJB 3HDYA 3K0AB 3AR2A 1MUUA 2WINI 1SURA 2Q2QA 1E66A 4ZO7A 1EHYA 1NLMA 1Y3BE 5LLTA 1NG9A 2NLOA 2GN8A 2VDPB 1ECLA 2WJGA 3HRIA 3DT6A 2Y27A 3KYBA 4MVJD 5FX2A 2JCYA 3G8YA 4OD0A 3KFLA 5TJHA 5KPJA 1Z73A 1SUPA 4BLUA 3HO1A 3DEAA 1UF9A 1HE1C 4QYMA 4UHFA 1K9SA 4W5HA 1TO6A 1JRLA 5EG5A 4YI3A 5IC6A 4F96A 2QXYA 8AT1A 5TIIA 3KAPA 1XMXA 4ND8B 4ZP1A 2IODA 3I4FA 3BD7A 2A6PA 3I01A 2WUGA 2OXEA 1CYEA 1PL0A 2JGDB 5CTAA 1LDBA 2CBXA 5A3SA 5CR9A 4DGQA 3AERB 1NOIA 1Z07A 2PCJA 4TSKA 4DJEC 2Q3BA 4DC9A 2H1LA 4A4DA 3K35A 3LHSA 4O4JF 1V9LA 1Z06A 3ZYCA 5DBFA 3T5TA 1JHPA 3P9IA 1NNLA 2O06A 1RRFA 3COVA 4WXHA 3ZQJA 3HKEB 4M0CA 2JFZA 4WK0B 4A7PA 1Z35A 4P53A 3FOCA 1R6AA 2J85A 4N0DA 3MUFA 4WOPA 5JBNA 2QNBA 3AR6A 2BELA 4UZFA 5CVVA 4CDMA 1H5QA 2QRHA 3EYWA 2ACEA 1PFUA 4LNUB 1OU0A 4YPVA 4D0NA 1YCFA 4YCBA 5EMKA 3V1YA 2D3TA 2JIRA 4ESEA 4H7DA 4Q4LA 2P2SA 3MF4A 4QECA 4QUHA 4TWAA 5JJ5A 4NCJA 3OIGA 1RWQA 3JQ7B 3QA9A 1QH0A 4EY6A 3WO0A 2C8LA 3WV5A 5EHXA 1F0PA 1VSUA 2XDWA 4OHRA 1AUOA 2QTGA 3F5FA 1XIVA 3GLSA 4OM7A 5LA6B 3O38A 4B1FA 5KREA 4L8LA 3ZS9A 1DO0A 3U3MA 2ZE5A 3PR1A 1KMHB 3D02A 2ZT8A 2O1EA 2WMYA 2WPDD 3AMVA 3PFHA 3QBTA 5JQGA 1WKBA 5E6RB 4RK5A 1CF2O 2B2XA 2PMWB 3DE6X 2PNFA 4I1UA 2CXPA 1GHTA 1PV1A 2Y92A 3IQDB 2Y1GA 2VOJA 4GLJA 4EUEA 2XNDA 2JKZA 4I4CA 4RMIA 3WJ7A 2NZWA 3A14A 4A9AA 4PO8A 1QIEA 1U98A 4EL0A 1VA4A 5DGDA 4Q3BA 4QJ4A 1XZQA 4AN1A 3ZEAA 3KYCB 4UU8A 3TSAA 1E2NA 2YXEA 2NUTA 3RYFA 1ODFA 3Q9LA 1JJAA 5FOTA 3D4NA 1TADA 2Z9CA 4HAUA 3TR6A 3VZDA 3K70D 1DG3A 1KY2A 3CEMA 3B1JA 1ZL0A 2VNAA 2XQJA 3G0IA 4XI9A 3LDFA 3RS2A 4C3VA 3ACDA 3N0RA 1DTEA 3I9V6 5JSQA 4OHOA 3KOWA 3VKWA 4A10A 1O9GA 1CRQA 1GU7A 3D6NB 3KQMA 1Y1QA 4EATA 2R86A 4AKGA 4JCOA 2WTXA 3U5ZB 2X0FA 4YJHA 2CNOA 3KR0A 2AF3C 1Z37A 2PKEA 4G65A 3DE7X 3DEJA 4OO3A 3WSWA 5FLYA 4OQZA 4M49A 2C54A 3VR5D 3I0MA 5CCBA 2ZWMA 3SI7A 4TX1A 1V8DA 4MRPA 4R7ZA 3HP7A 1MZPA 3RSSA 2FLWA 4RW0A 1SVKA 5BWLA 5JBIA 3REQA 1EB9A 4J0JA 2GAIA 4OGKA 4ZAZA 4AKSA 3VPSA 3A3NA 1NUPA 4ZV7A 3CCBA 3M83A 4DA7A 3ABRB 3I6BA 5FTJA 3B6ZA 4CIDA 5BMOA 5LOVB 2VVTA 1JPNA 3IRVA 1IG0A 4IIBA 5TVGA 3NBYC 1H1LA 2ONCA 2P77A 3PC8A 1SBIA 2ZB8A 4CL3A 2YZKA 4ENVA 4FLFA 2GZ2A 3FUWA 2XVXA 3FYSA 3PXBA 3DE0X 3E5NA 5IYZF 4IOJA 4JI7B 2QGNA 4LXYA 3GLHB 3KZVA 3NWOA 3C4QA 2INGX 1HEIA 1NASA 5JH7A 1KI9A 2HMWA 3O47A 4ZJUA 4WLEA 2JD2A 4R7GA 1DBWA 1A8PA 1LBSA 3H5VA 3WYNA 2F3RA 3UC5A 3HPRA 1SU7A 2C00A 4P58A 1D1NA 1P1JA 2VZLA 3BDVA 2O8BB 3TCXB 4R84A 2B94A 4K6HA 3SEFA 4F3CA 4R69A 2RC5A 2I6TA 2HWWA 3CF6R 2EW1A 5JAQA 2AIRA 4ARVA 1ZU5A 1ULUA 1N06A 1T9BA 3W8NA 4EKIA 1UM9B 3OIUA 3F6BX 4D79A 1UAYA 1B14A 3UK2A 4QFBA 1II8B 4FTWA 3SBDA 3WMRA 5L7WA 1XF1A 3HA5A 1KDYA 3DD1A 3SOPA 1JDNA 2WUWE 3VSBA 4FYXA 1M1KD 4YJFB 4FT4A 2JI9A 4Y7DA 2JANA 1TFUA 1I3MA 4YJDA 1P0MA 4PYIA 3CN7A 4M6WB 2B4QA 2I2WA 1VHEA 9ATCA 4ISBA 5HP4A 5L3SA 5CIQA 4L50A 2GEBA 2YZ7A 3O0TA 4BO9A 1R10A 5DNWA 1D03A 1PF7E 4JMPA 4FEEA 4RKEA 3L82B 4XE5A 3OOWA 2YOHA 4ZC8A 3HE3A 1XLUA 3KKEA 1J1ZA 4OQXA 5KX5B 3HZHA 4JB0A 1AF7A 2C3OA 2P3SA 3BCUA 1Y6QA 3V8QA 3QU2A 3D9QX 3MJSA 2NU9B 2YWHA 2H17A 1X39A 1RWXA 4EFLA 1QUFA 1B0UA 1CB0A 3HN2A 4GLBA 1Z6TA 4L15A 5EZSA 1KQFA 1MD9A 1R0SA 1Y3AA 2JHFA 4GRIA 2YV3A 3OC6A 4K6CA 1F6WA 2OGWA 1U8TA 3CXRA 4B46A 2G7ZA 2IYRA 3EBPA 3MQ4A 3KJGA 1XZKA 4AP5A 2V7QD 2Z83A 1J09A 2G82A 1AX9A 3BQJA 3NT2A 2LRHA 1KO4A 3BUSA 3MVEA 1E6CA 2FZWA 3AIOA 1ZIXA 3ER6A 3PL5A 3ZHZA 3V4SA 1CZLA 5BVGB 1P62B 1GTSA 2WFMA 3NONA 5JEEA 4JGGA 3DMPA 3NIWA 3BULA 1YVDA 1NDQA 3KLBA 4CR7A 4PU0A 1RI5A 3LTEA 5CH5A 4ZEVA 3SNHA 4H1UA 1ZVVA 4FNAA 2QTMA 1KEEA 4GQIA 3G68A 1HMYA 4TLCA 2I91A 4NZYA 4W8GA 1OXSC 1JHQA 2B4YA 3IT2A 3ZXYA 4FXUA 2OXCA 2NAPA 3AHEA 1M1XB 4P2NA 3B70A 5KI6A 1DQNA 2WT9A 3VOSA 4UARA 4KC0A 4WZBB 4II7A 5JWRA 3NDRA 4RADA 4NJEA 4D0RA 1P2GA 1ZK0A 4CQMD 3K53A 1FTQA 2IPXA 5DGCA 5DV9A 1AGXA 1RABA 3KUUA 3LECA 2FZKA 2BTQB 3IOYA 2QN9A 3WK4A 1RWPA 2G76A 5EZYB 4D4JA 1R9MA 3ZW7A 4DV1B 4LVUA 3I6YA 4ZC1A 4LF7B 2GRAA 2QBYB 1PL7A 3T52A 4FMCF 4RY2A 4K9KA 1ZD9A 2J3DA 4WLFA 2F3UA 5CD1A 3TKLA 4F7DA 2ZT5A 4R9UC 2HDWA 1RCTE 5BN1A 3T35A 1O54A 1G59A 4RZXA 5FI0B 4MWOA 2CFIA 1N3IA 3LYUA 1OCEA 4XLHA 2WT4A 4QUBA 1EGAA 3SEAA 4FXPA 4Q15A 3HXTA 3NASA 1NULA 5KPDA 2XT0A 4N39A 1A0OA 1DQPA 2VJNA 1ZJJA 4YCAA 4E22A 5IJZA 4WXRA 3HKBA 3TRDA 2BTOA 1Z0SA 4P4SB 1PFYA 1M67A 1RP1A 2A9OA 2AZMA 4WRRA 3WZLA 4EAAA 3BL6A 3GL9A 1G3MA 2Z2IA 3A1UA 4FYWA 4NENA 4ZVTA 3Q10A 1SQ6A 2MOKA 3K92A 1YZVA 3P9XA 1QH9A 5EMLA 2WU3A 3FRJA 3GW8A 4FDLA 3ZGOA 1I0LA 3KHTA 3X1WA 2WW8A 1Y8ZA 1GUFA 1OA1A 1ST3A 3RVSA 1EXMA 4CU2A 1L5YA 2Q1TA 3FNRA 3GZTB 3IVRA 3FFTA 3JQFC 4XCVA 2DQSA 1Q19A 2I6XA 4JX8A 4MW4A 4NYJR 2LW7A 3HN7A 1E9VA 4BVBA 2GD6A 3FPAA 2GX6A 4B33A 1M2WA 5H70A 3CNHA 4YK7A 3VOTA 5KVQA 2BCEA 1L4FA 1XQ1A 2Z30A 3SDBA 2I5PO 1GP2A 4NBKA 5ENVA 4CMIA 2RCYA 4P82A 3PRKE 4J91A 4EAQA 3MINB 4RCVA 3UPUA 3LS2A 2ZUUA 2D3NA 3KWJA 4D02A 2NO0A 4NR0A 4XOUA 1U2DC 5E7JA 1MO4A 5C1DA 2WHEA 4DY4A 4M9CA 3QM1A 2B4KA 1PJ7A 2W83A 3D3JA 4S1OA 5J43A 1GSIA 3GYBA 3VPFA 1DOZA 3DC7A 5ALHA 4NLLA 4YPOA 1AK2A 4RPLA 3DBVO 1OH7A 2Q9UA 1IE3A 3GELA 3JZAA 2AYYA 5DI9A 4BJ3A 3W0LB 2OWDA 4UCWA 4DCJA 3ZPXA 5A3RA 1R50A 1BXGB 2ZULA 3QLUA 4G0MA 1IQUA 5DI3B 3GIWA 3L0ZA 5FPPA 1V8OA 4EY5A 4UUPA 2CNWD 2Q07A 2RCNA 3CEJA 1C7EA 1W2BB 4RNDB 2ZUVA 2C9YA 3DS8A 3X44A 4PONA 2ZQZA 1UQRA 4HQLA 1G5QA 3PG5A 4M9ZA 4NVRA 3INGA 2ODBA 4WK6A 5EINA 4GKVA 3KJZA 3A6ZA 3G2QA 3NQ41 4LVNA 4BE4A 1CQPA 2PANA 3C41J 1A7UA 3TMYA 1HDCA 2ILVA 4WEQA 3TZEA 4D57A 1UP4A 1Y6RA 3NATA 3QENA 4PE5B 1E3WB 1NVFA 5H0IA 2QTTA 4WY5A 5E8JA 3VAYA 2HQRA 4FNOA 1GLGA 1F5NA 1OIWA 4ZVMA 1VJ1A 2BBTA 4UEJA 5DN9A 1L4UA 4G6IA 2AD5A 5FBKA 2ZTSA 3DCNA 3TSWA 2YVQA 1M72A 4DADA 5KQGA 3SYTA 2OO3A 5I9TA 1VTKA 1XRQA 2KVOA 4LZJA 1E9DA 1AKVA 3NAZA 4RF5A 1Z3CA 4WK2B 1I36A 1OE0A 1LD3A 4WXMA 2NADA 4LHEA 4ANFA 2P78A 3IQHX 3ONUA 2XBLA 3RQSA 4XGNA 2M2IA 2JA2A 4P3KA 4ZRNA 3T9DA 1L2TA 4C03A 4NCAA 3AR9A 4F3TA 4DXAA 1LDNA 3PDWA 4Y0NA 3VH4A 3K0FA 4D6YA 4G01B 5KINB 5LIRA 1DXQA 1IEWA 3U1BA 1IXYA 3GRKA 5F9MA 1KC8D 2W2TA 2EQBA 1LPOA 4BVLA 2UZ0A 2O2YA 3EVFA 1WTAA 3DJFA 3U4QB 1F3LA 1NPYA 1PZHA 1QIFA 3K6RA 3V80A 1BWSA 2A1TS 2KS6A 1PTJC 1V3UA 2FJPA 3IE2A 2C0QA 3R5XA 2ZYTX 4GC9A 4HB3A 4ZWNA 2VHQA 2RGRA 4BXOB 1BLIA 4PINA 2W70A 1E20A 3BHMA 1AQYA 1VL5A 1TOAA 1SJ9A 1WCV1 5LMCA 4EW1A 3ZDCA 3H5LA 4G23A 1QWSA 4KI7A 2JFVA 4W8OA 3OEWA 2O2ZA 2H1CA 1Q95A 3CY6A 4L0QA 3UOWA 1UD8A 3AVWA 3W5JA 2FVYA 2PLFA 5JS2A 1QSGA 3IRUA 2NP7A 2ZBGA 3S8YA 1OILA 2PQ2A 1XA4A 4G25A 1FYXA 1N92A 2G4CA 1A2OA 1KU6A 3BM5A 4RDIA 2H92A 3KEMA 4WLNA 1KZ6A 3O75A 3UWMA 2DTEA 2RHLA 2HA2A 3S99A 2WVHA 5F2NA 2IYYA 3OEED 1V45E 4IRXA 4MWCA 3TW8A 3L4BA 4OB8A 4RK0A 3S2YA 3TCNA 4O3MA 3HEAA 4H31A 1JYFA 4B7UA 4MKHA 1YUBA 3LO5A 3X2EA 1RD4A 2C3YA 4DMUB 4MITA 4B84A 2NUAB 4GYYA 2A9FA 1YRLA 3L1KA 4FD3A 3PGA1 4MQEA 4NH4A 3NALA 1P4JA 1SCUB 2FX3A 4JJEA 4OA5A 3KAKA 1BE8A 3FW1A 1M1NB 1NN5A 3ENNA 5FEMA 3OO1A 3MQFA 3LP8A 4DG9A 5AUPB 2GAFA 2L18A 3GJSA 1W9XA 1JG1A 4PZUA 5SZIA 3QW4B 5K09A 1B6TA 1NJID 1VCNA 5A9TA 3DL0A 1KRWA 1VMIA 1SU4A 3ZZ1A 1KEWA 3HU2A 5EGSA 2LUOA 3HLTA 4AJ2A 1Z2CA 2PS0A 2FP4A 3FUCA 2EFHB 3PYXA 5L7YA 3KYIB 4BE7B 2F1MA 2EJUA 1QGUB 2XTMA 3FNEA 2Q0QA 2WSYB 2W43A 4M0DA 3COYA 2FK7A 4YLYA 2VPIA 4REOA 1K28D 3EVGA 2IYWA 3IBSA 5DM2A 4BV8A 2C61A 2CNNA 4LF9B 1HDZA 5MN4A 3WGQA 4BFWA 3CUYA 1BS1A 2P30A 2XWPA 1C9MA 1J0BA 2EV9A 4G5QA 4XD7D 5AKHA 5TEVA 3S28A 1M1NA 3W5SA 3LA6A 2WB2A 1JFFA 5JSUA 4D5GA 3DZHA 1PSWA 1DIOB 2XXAB 2ZCUA 3LI2A 1FU4A 2RE8A 4AF6A 4LRQA 4DLPA 1L7RA 1UD5A 3DBRB 1W29A 2X76A 1PUXA 4V0MA 3T51B 2RBEA 3FGOA 1JSXA 5CIWA 1HYBA 2F1JA 1OB0A 3K05A 3PCXA 4M1WA 5EPOA 4B7ZA 4BPRA 3G0OA 2GESA 4DEXA 3BK7A 3F6RA 5CHEA 5DGTA 3BH6A 4IGAA 4EJSA 1EVQA 3LQYA 2PLRA 2JFOA 3F4LA 2FR8C 4HGOA 3QLVA 3F78A 3IJRA 2BISA 3O4FA 3JQFA 1GKYA 4MGEA 4BFXA 2ZANA 3DT8A 3AKDA 2F4VB 3FF4A 1ANKA 4MVCA 4WWHA 3HWSA 2BAGA 1KZ1A 3ENZA 5AJVB 1M73E 1P17A 1AS3A 4KE6A 2GZAA 4GOXA 3ZCUA 3QLTA 2IELA 1FVHA 4FXOA 1UDRA 5DM60 3NEJA 1T5SA 3KE8A 2PGOA 3D4PA 4RTSA 2UAGA 3IAAA 3C5VA 4FGLA 4HS4A 5JECA 4MOWA 5FOVA 4A6PA 1V2HE 3REOA 1BEEA 3HNPA 2YMPA 3ROKA 1SCKA 4PANA 3KDPA 5J5AA 3ZLJA 1I18A 1XDBA 1H2YA 3FYUC 5TLSA 3ZTTA 3ZNNA 4HT3B 4ZI7A 2IEGA 4IDAA 4MVXA 1ZGJA 3C1AA 3T61A 4JR2A 4LYJA 3C45A 3AWIA 5EUQB 5F5XA 4JFAA 3PPXA 3SPXA 4BO2A 2P9TA 5HIAA 3P9RA 1JI0A 3LCUA 1K86A 4AWXA 3DDHA 3TTTA 4Z86A 1L5HB 2LNDA 5KYYB 3WLNA 5I3CA 3G13A 1SZPA 4FONA 1GNRA 1EFDN 1D6SA 3GT4A 3G8AA 1JT2A 1C3LA 1KEZA 4V1CA 4J16C 1E7RA 4YEJA 1RJ9A 2AT1A 4QUIA 1L5NA 3ZWAA 2QEQA 4XGQA 4B76A 4E46A 3MGAA 3FKSD 3K4QA 4GZ5A 3D4BA 4X64B 2L19A 5E3JA 3P7MA 2O0HA 2R6FA 1Z82A 5JJKA 1KAQA 2JLYA 1OX5A 1HBJA 3HXPA 4KPUA 2CHEA 1EK5A 4E3ZA 4TUYF 3TZBA 1KZ7B 4I7EA 1SCJA 2OHIA 4MXDA 1K9MD 4UEQA 5D6OA 1YGYA 4ITUA 5DLQC 3VNUA 2OVFA 6LDHA 3EPKA 1XFAA 3NHMA 3WLSA 4INPA 4BRZA 1K7SN 2J08A 1BGWA 4OB7A 4A8PA 3HDTA 2TMKA 3MRTA 4FKZA 2GNAA 1HFEL 1H8HA 5LB4A 3ELYA 3KDSE 1K3UB 4KWHA 1D2NA 3CH5A 3EAFA 4AW9A 1EFPA 1YFLA 3GDOA 4EIWA 3IAXA 1E2JA 4GECA 4UNNA 5GWXA 4EHNA 3GRYA 2DYIA 5D8DA 1M2OA 2JK1A 5HS6A 1YTLA 3LBAA 3CISA 1QGAA 3WQZA 1UCFA 2AXPA 1D8TA 3OLCX 1HQCA 3DVAA 1M6VA 4HZIA 4TXNA 1AO0A 5FAXA 4GOOD 3L84A 4A03A 4EZEA 2FMTA 3VR6D 4DCMA 3ZV3A 5I4BA 3C3WA 4IJKA 4B3TB 2Q6KA 2WDZA 1EB8A 1V25A 2QVBA 1GTVA 1N9ZA 1ZNQO 5EUCA 4N48A 2BGNA 3L8FA 3OUTA 3AJ8A 5KNBD 1OAAA 1CZHA 3S1AA 4OBBA 2FG5A 3IPAA 1K2WA 3OG9A 3P26A 3OZEA 5CLGA 4ES6A 3C6ZA 3ESZA 2EGHA 3GQBA 3BILA 1J8QA 4WNIA 1ZP6A 5EWMA 3ZUPA 4ZIRA 3DTVA 5J40A 3U31A 1HEUA 5JAUA 5K8TA 2GYUA 1MLDA 2CL5A 4A23A 3B53X 4EB6A 2Z4SA 2YXPX 2A88A 3ASRA 1EE9A 4MWEA 5K0FA 1H0HA 1JEYB 1BCSA 2FJ0A 3IODA 3CF0A 3O2QB 1F7VA 1FS5A 3UAXA 2JLQA 3ACCA 1H3NA 4JGBA 1B2RA 4ZKDA 2Q5HA 4J7AA 5C81A 4Z4CA 5LXTF 1Y8RB 3B1ZA 2ATXA 3SLKA 3AKYA 3AXSA 3PL1A 4NPAA 4N8EA 1JHDA 4KU4A 3JQPA 4GM1A 4QPZA 1QCZA 2PWBA 1IULA 4RD1A 1LBEA 2OM6A 3IAM6 2V45A 3LH5A 2UUBB 1OAOA 2WV7A 4DLBA 2O1XA 5A89A 3FMGA 4RXTA 4IDDA 1W30A 1FLNA 2H2AA 3E8SA 1P1CA 2OV8A 3W3ZB 1N05A 5BV0A 4I3GA 2BUCA 3JQ9A 4L6CA 4M99A 2FFHA 4I1VA 1JDJA 1UKCA 4IJ5A 2EF1A 1CJVC 2ZSHA 2Z5LA 3R23A 2AK2A 5JS7A 1CKEA 1GQQA 5I8PA 4ZEMA 5LQRA 3IR6A 2H3HA 5H68A 3TWOA 2QTCA 4GQNA 1XNJA 2LD4A 4OH1A 2RI0A 5THKA 4JUAA 1KVRA 2NU9A 1A2QA 2ZBEA 4DCGA 3VKVA 2Q46A 2BI4A 3G82C 3PR2B 4Q1AA 2FMXA 4DBVO 2VJJA 2POQX 3SM9A 1X1QA 1V3TA 3KXPA 5HMMA 2DHDA 4M1OA 5FPTA 1YDMA 4XEUA 5DP1A 2O2HA 3V4OA 2R2AA 3DFUA 4KAJA 4PLWA 4U6QA 2GREA 2O2CA 4Y1RA 1ZWKA 4CCYB 4CF6A 3OKPA 1RXEA 2HU7A 3EC7A 4C7OA 4WZAA 1F1JA 3VI4B 3ZXIA 3AM4A 3KKKA 1Y4DE 4LHVA 5BSVA 3FWKA 2OOSA 3EQ6A 4I55A 4RYLA 4ZOBA 3VZRA 1MJHA 3W9UA 5BQXA 2IIPA 3FGNA 4LJ5A 1YK0A 5ADWA 3IUJA 4MGZR 5HA5A 1M8GA 4YUVA 4DDMA 5IP5A 3RV4A 4L5JA 2IBSA 2W71A 5FTMA 1JIQA 3VKGA 2Z2YA 1YHYA 4RK6A 1CDOA 4LJAA 3LVFO 3STUA 4ZT3A 2GQ0A 1JB9A 2YMQA 3W9SA 2W6ZA 3JW8A 1Z63A 2P0EA 2WWWA 4R81A 1ZGBA 4JBXA 4U7TB 4U7GA 4B6GA 2PUGA 4ZCIA 3D8BA 3GV0A 1RDFA 5B36A 1VCOA 2C31A 2QD5A 1X15A 4DQLA 4BAUA 5KKNB 1Y9DA 2X5XA 3PFWO 5T6MA 4E33A 4YMUA 4I4TB 1UIMA 4IX9A 1XQWA 5A0FA 3Q6IA 3FHJA 3QI7A 5HRUA 4ZTZB 2J31A 1PUIA 1M2KA 2IGBA 2Z2JA 3P2KA 4U4AA 3QF4B 1QFZA 2A0UA 3GUUA 5MN6A 2ZJ4A 3E03A 3F8SA 1EH5A 3KSDO 5C8ZA 4QELA 2ZJYA 1VIVA 2WJ4A 3A37A 1FL9A 1RWVA 3FSGA 2WNHA 3R3ZA 1SQGA 3KQKA 4DRXA 4S2UA 3V8NA 2OD2A 4RM0A 5CM2Z 2X1HA 1QM5A 1UT5A 2FPMA 5BVHB 3CC4B 2PV0A 1TGYA 5E4YA 1FDTA 1GUZA 3B36A 3H5IA 3NIGB 5HIMA 1Y34E 3D2CA 1MT3A 5LOVF 1I6LA 4PRZA 3QEMB 2OHXA 5DM70 3DV0A 1CG6A 1H4QA 3GCWA 2QRVB 3X1JA 3PJFA 4EBFA 2XMCA 4HV4A 4UTVA 4MV6A 2YVKA 1IIRA 1U9CA 1K4YA 3EIFA 3PB3A 1OVMA 4LECA 1CQJA 2IS2A 2OHGA 2Q3JA 3Q5DA 3U3KA 2BHRA 1MHTA 2F7SA 3ZV7A 1BVYF 3B2QA 3CCEB 4WCFB 4BHTA 5IVPA 3ESRA 2O5VA 4Q3AA 3STWA 1MV8A 1OX4A 4MLDA 1HFJA 1N9GA 4F92B 3N2GB 1E18A 3H5WA 4IWNA 3TLJA 2WQ7A 2QZ9A 3E58A 3UHJA 1RJ9B 1XJQA 1Y5IA 5AN9A 2ZR8A 3O0DA 5E9WA 2WSMA 4LKOA 5EXPA 4BMZA 1AE1A 4OHWA 4W1SA 4YV7A 3DVQX 4GEGA 2ZYHA 4X3PA 2AOTA 1PNVA 4F11A 2CFOA 2IZZA 3T4UA 1R66A 3GOQA 2D74A 4Q82A 1EWVA 1HLDA 1LDYA 1W4RA 2VJMB 3A9UA 4KGXA 4XJVA 2WE7A 3ZNOA 4BVHA 5JD5A 3MSXA 4JS0A 4LI0A 1B76A 1GZ5A 2P11A 4QUZA 1N5IA 1U8XX 3CZCA 3FMIA 3DAHA 4UFPA 4C20A 2QS9A 3J7AC 4NP6A 2Y1EA 4ZCRA 2DBQA 4XNFA 2D13A 2JJ1D 2YCLA 4RHYA 5ALSA 5SZHB 3SHWA 1SKBA 3T3EA 2GFHA 2QX4A 5JADA 1OZGA 3UCFA 2C8KA 2HLNA 3CEAA 3LPAA 2BONA 2V8BA 4RK4A 4TS9A 4Y2UA 2QMUA 5FBZA 1IU9A 2A0WA 3Q6NA 1Z16A 4KXLA 4KYTA 4MICA 1W96A 1SXQA 5A5DA 4HLQB 4EW3A 3AI2A 4ZICA 3DMNA 3EXG2 4FQ5A 4E07A 1ZI8A 2JGIA 3A3KA 3JD4A 5C9ZA 4ZRDA 4LZWA 3ZS8A 1XZAA 1OYVA 1JEQA 1KH1A 4EYGA 4WMLA 3N28A 4WLUA 5T41A 5D1HA 2FWAA 3IEKA 4P7FA 4EPTA 1EWRA 2PA3A 1E7SA 3AJDA 4KH1A 3Q39A 1KXZA 5IZCA 2WQ6A 1TA4A 3KPWA 3OLYA 4PPGA 3ZY2A 3ZCTA 4LQCA 5CG1A 1MEEA 3M33A 1S8AA 4ZT6A 1B2LA 5DYNA 3ASUA 1U3FA 3HUTA 4X3CA 4YGYA 2HA4A 1ZJ5A 4S24A 1OH6A 2ODAA 1UZMA 3HBJA 4P36A 4ZAXA 1VB5A 2E48A 2BMDA 3NV7A 4Y8VA 2VTVA 1G7RA 4EY7A 2W42A 3BZBA 1XQXA 1MB3A 4KO2S 5DYGA 4N0EA 1A96A 3HVHA 3ETNA 3Q2KA 1AIPA 1A8HA 2AOXA 3NYQA 4KEAA 4YMSA 1L7PA 1PG0A 5GOTA 1M1YE 1ZJ4A 2B0JA 2V6GA 1SBQA 4TMXA 3EGWA 5LCXA 2OXTA 3TQQA 5L4LA 1LZKA 2WG2A 1CDDA 3CLRD 2PY6A 1E0KA 4OXIA 2X6TA 2R1ZA 4KREA 3B1YA 1UPTA 4O4IB 2CJPA 3HM9A 2OK7A 1ZMOA 5HEKA 3DZKA 5FXMA 4OI2A 2O3TA 1RFLA 3ESDA 2JZCA 3JALA 1ZX1A 2C83A 1UANA 3OQOA 1F0KA 4ERNA 4N40A 4TLAA 2B83A 2DCMA 2OMEA 1W5BA 3BTOA 2OK8A 3OX2A 2Z5GA 1I1HA 2F64A 2VJKA 3O3CA 1NJGA 3INRA 1PK8A 2NYRA 1B8VA 3EEFA 5KYNA 2YYAA 1LTHR 3RS7A 1ZITA 5JSKA 4L2IB 2DAPA 3TYXA 4RJTA 5EHZA 3AWDA 3LNCA 1GPMA 1S02A 4R8RA 3OU6A 1XQVA 3RYCB 1V71A 2BC9A 4JB2A 2ZZNA 4MS1A 5DPMA 1RWOA 4I5FA 2A7XA 3DKKA 1J39A 3W6NA 2QIPA 3IAS6 1VI2A 2OP1A 1SVUA 4JQYA 4UM9D 1IJBA 2IP4A 5F2KA 2VXBA 4F71A 2DR2A 2GJ8A 3NGMA 1F7UA 3H16A 2E49A 4HADA 1DDIA 1DQZA 5FRDA 4KGVA 3UY4A 1AZSC 1NAHA 3GEIA 3MELA 4U7PB 1ZGHA 4D3DA 4DB4A 2E4YA 2R6R1 4RGQA 2BE7A 4BCBA 1Z2OX 3IQWA 2H9AA 1WE2A 5FUXA 4D9FA 2VDWB 1H2AS 1KS9A 1RJEA 1IMJA 1PVVA 1ZLXA 2VDOB 3LGXA 2OKCA 3O82A 4OHMA 5KNCH 5DHAA 4XQFA 5CK4A 1ND6A 1R5OA 2ODTX 2CNDA 2R84A 2JFXA 1N57A 3QE3A 4OP1A 1Q0UA 1SQ0A 2CLOB 1FE8A 2FUG1 4LDJA 4NJMB 3V97A 4BN0A 4CDNA 4DCVA 5ITZB 1FP4B 2YWFA 2EZ4A 2WTEA 4CFYA 5KTYA 4REQA 4U02A 1KIAA 4UREA 2FQWA 3KTDA 1HFKA 3HVJA 4JQOA 1AZWA 1LX6A 5LYJB 3TX2A 1IBKB 6PFKA 3AILA 1FFBA 4H1HA 4HD8A 4IIFA 4RORA 4WASA 3TOXA 5J2TF 1MX5A 2XWJI 2G72A 2A67A 2PQ6A 5FOSA 1MJFA 2DWPA 3EW7A 2PWAA 2RBGA 1G21A 1VQNB 3E05A 4J1SA 1GWNA 3N2YA 5BWCA 4EX7A 4Q1VA 1MC8A 5HQ3B 1I80A 1P1RA 5JZMA 1L4MA 2GKOA 1WHTA 1SUCA 3WIUA 4N49A 5ALKA 4NOLA 4DPMA 2HRDA 1JPVA 1Q0ZA 1ZN7A 4FCVA 2RGNC 3RIEA 2XNCA 2FXIA 3WYFA 4X24A 4KXVA 3GGJA 2C57A 2X5NA 3QOFA 4R40A 4XWWA 1NUHA 1OSNA 1QK5A 3V7WA 5JSZA 2WAAA 4EOGA 4X61A 3CH4B 4LCJA 3S40A 3TIVA 3UJPA 4UTOA 2I4NA 4C0JA 2VOEA 3OTWA 4JP8A 1LW7A 2H4WA 1WQ4A 3RK4A 4IDPA 3OPYB 2UZAA 4HDSA 1DRKA 2GOYA 1G21B 2VG8A 5CHYA 3IT0A 1Z4OA 3VYRB 4X7CA 3PHLA 2MYNA 1BGXT 2ZJ0A 2ZSIA 3M1AA 4HAXA 2X42A 2R65A 4O8ZA 3A32A 4TXMA 3GUYA 3R09A 2GPSA 1WV1A 4Z4SA 3OETA 2WZBA 4BX0A 1OWOA 3IOEA 2G77B 2Z1DA 1RRPA 1L9XA 2GYWA 4K6OA 3RCBA 1MJ5A 3N2LA 4BOYA 3D2AA 1RHJA 1YONA 4QPDA 1SVMA 5CA0B 2AA3A 5C7YA 3NCHA 1OT5A 3HABA 4GKKB 1QTIA 3EMKA 5T7BA 4FDVA 3A35A 4HCJA 2MJLA 3OE7D 1WMFA 1XXHA 5FR2A 4Q1BA 1Y4UA 4YP0A 1BQ3A 4H3SA 3M9XA 1R37A 5G0WA 4FU0A 1X7ZA 2IXEA 3EOAI 4IKOA 1E60A 2JAQA 2ZE6A 4LK3A 1W85A 4A0SA 5JU6A 2XRZA 4Y7CA 2OORC 2PZFA 3KWLA 1NBMD 1R8XA 5KVVA 4IW3B 5A62A 1D2RA 3DV9A 2PGLA 1G60A 5EGNA 2K5UA 3L0SA 5KW9A 3F6CA 1XBTA 3GROA 4E7OA 3GMIA 3ZCRA 4S1WA 1KE2A 2OC4A 2HD4A 2VHEA 3RFVA 3WR5A 4OHYA 2XB6A 2JI6A 1YQGA 1ISGA 5JD6A 2H06A 4UUMA 4HK4A 4TVOA 4HF7A 1YSCA 4KB5A 2ECQA 3FJYA 5EXEA 1UP6A 2D0IA 2LBPA 3HYSA 1QYVA 3EA5A 2ILTA 3PQ4A 3FPPA 1VQMB 2D2FA 3D31A 2MSNA 4WK4B 3R3WA 4HLCA 1MNAA 5AKXA 1FS6A 1I2CA 4GSKA 3A9CA 5AM0A 4RQUA 4TQUS 3L93A 3FUVA 1DO2A 1ICEA 1VLJA 2DKFA 4O4LB 4IDBA 5F33A 1M6NA 1TMKA 3O1LA 2YNMA 1GLVA 4ZO4A 4OPMA 3ESCA 1YWGO 1HFWA 1XFOA 1S0UA 1SD5A 3SHTA 2VWGA 1I4TD 1JAHA 1P72A 1KQSB 1XNGA 4BO6A 3EEOA 3SVLA 5HFJA 2FSUA 3RANA 3GLGB 2FEKA 3ETHA 4GBJA 2HHAA 4K9OA 1XEXB 5GONA 1R15A 2QMYA 1ISHA 1T3ZA 4JP3A 3O4IA 3RU3A 2OFWA 4CQMA 1IN8A 3H9CA 4P93A 4CIVA 2OBTA 2ACVA 3UA3A 2R0QC 4WGGA 2NXCA 4RKQA 1ABFA 3FPLA 4YAUA 2XCSB 2BY4A 4TM7A 3KZCA 5TPZD 1HA3A 1POWA 2VT7A 3HKBB 1SUEA 3DW3X 3I9NA 4ZU1X 1PD0A 3RWBA 3K2QA 2WWHA 4Q66C 3MMNA 5A9SA 2Z8ZA 3E2IA 3FZNA 5DNVA 4D9MA 4NJMA 3QHAA 4HVCA 3LF2A 2QLFA 3UKJA 3EEYA 3PWKA 1LBIA 5KJCA 2QX6A 2VR1A 3DCYA 2XYVA 2IDJA 2JVKA 3MOGA 4I9GA 4MI3A 4F1KA 5AVXA 4AI6A 5AJHA 5ARBA 1V4VA 4HVTA 1W9MA 3R7AA 3TL2A 2C98A 2O07A 5J1SB 2PUWA 1NLYA 4EY8A 4TUYB 1YIJB 4TLDA 3DAFA 3GF4A 3D8NA 5T4BA 4EW6A 2B8JA 1K6IA 4AJHA 5K6AC 2XF2A 1JKFA 2H4HA 1PVDA 4XKVA 1PL8A 1U8AA 1L5SA 2H1RA 3KJXA 4H59A 4MO9A 1D2HA 1YS6A 2I3GA 3NWEA 1QHEA 4KYUA 1Q11A 2CSUA 2R7LA 3DO5A 1V16A 1L7BA 3IBGA 1C9YA 1V6CA 1Z33A 2WSBA 3FLBA 3KXLA 2LIVA 5F73A 2PU7A 5H9VA 3DP9A 4G67A 1XO1A 3DZCA 3N5CA 3VBCA 3GAZA 1KY4A 4NH0A 2BFBB 4TV9F 3FVRA 1G5TA 1N8NA 3EQ9A 4MKZA 4DBZA 2FCAA 2P2DA 3D4OA 4FE7A 3GZJA 4YONB 2XYGA 3WAJA 5GIOE 4RJLA 1V43A 1Z0JA 1F17A 1Q1EA 3FUTA 4KNWA 4YJ3A 3TLGB 2GAOA 5EZQA 4YO7A 4NTZA 2VO1A 4BN4A 4R68A 4BRUA 3ELBA 3GEPA 4WDQA 4MW1A 1ZJ6A 1G5RA 1EG7A 1Z5OA 2X6QA 1WVIA 2HRQA 2W98A 4JQCA 3R9IA 5C1IA 2HLDA 2R1VA 4A1FA 4XONA 2AOVA 2BHTA 2VDQB 1LSJA 1PQWA 4ZFNA 3N3AC 5BORA 1HDEA 1UMCA 2EF0A 2FDXA 5J2UB 1ZC4A 3FPJA 3N0XA 3EZ7A 3GUVA 3O2JA 4F93B 4ENUA 4XGRA 3H2JA 3ND8A 2RGEA 4HE5A 1YA4A 3OJEA 1ESCA 2EATA 3WLHA 4CMGA 3H4TA 2R5FA 5IM5A 1OA0A 2KW5A 3WRWA 3TRFA 5KOHA 2C77A 4C0SA 1JMYA 3NRBA 3UIEA 2OHFA 1MIOA 3A6DA 5LM3A 2AN1A 1UPBA 2J9ZB 3ROPA 4LKRA 3IAM1 3FDJA 2ZVPX 3SQWA 2EWMA 2YW9A 1WV0A 3IPYA 4KK4A 4YUXA 3VH1A 5A5GA 1L7XA 1XZGA 3JZFA 1GV1A 1DS6A 2PS1A 2VPYA 2NT3A 5C8YA 1QHIA 2AEMA 5IYPA 1JFTA 3DZGA 1KETA 5DOZA 3I52A 4Q7JB 3NM6B 3TTUA 6GPBA 3CNNA 2BFDA 2Q99A 4IG9A 4IHJB 4FZ5A 3EGEA 4EKNB 1ZM7A 3RS4A 5C4MA 5CDTA 2CDCA 4MMYB 1HNZB 1JS1X 2AMFA 1UD2A 4YXFA 2I4TA 5JD3A 4M6WA 5TT0A 5CCXA 1YQUA 1YS9A 1TEXA 1E1NA 2P2GA 2Q3HA 2YWXA 3F49S 3ONEA 1DKRA 1UMBB 3QXJA 4Z9FA 5FOUA 5FUWA 1E2PA 2C5LA 1RKUA 1KTIA 5DTIA 3TD6A 1G9XA 3H0KA 4ECAA 1SU6A 5BSUA 1JHRA 8OHMA 4DFDA 1E43A 1Q7YD 2J9XB 5EESA 1W36D 3P0IA 1IM5A 1MU0A 1JHXA 1K4KA 3FWYA 1MPXA 3H1EA 2XY4A 4Q4CA 3BT7A 1DZIA 3UWOA 8ABPA 2PL3A 2QEXB 4QHTA 3WX0A 4HFRA 5AESA 5FDFA 3TG8A 1RPZA 3VC3A 2FSIA 2GKGA 4D8VA 1A5SB 3N53A 4ZVUA 2YZ2A 4NV1A 4UVEA 3GP3A 3GFTA 2Q45A 1WEKA 2C4NA 4B8WA 1QOPB 4J3NA 1FFGA 2IUSA 3D8TA 3QU5A 4OHCA 4ARAA 2PRYA 2Q3LA 1ZL2A 5ALVA 2QAIA 2A0KA 2CF4A 3N8KA 2GK4A 1CIVA 3R6GA 3NORA 2GJPA 1WB6A 1GPJA 3MAJA 2E6UX 2PRKA 1T0JB 2JGMA 4RV5A 4H15A 2UXDB 2VDRB 1XF9A 3LP5A 5JNWA 1JHYA 3NKVA 4MB0A 4LMRA 3HYNA 4JEHA 4LRUA 5IHPA 3T9AA 2OYSA 1ACMA 2YR0A 5FL3A 5K20A 2KBEA 1R6DA 4OYHA 4B7AA 2YL2A 1YRWA 4ZAWA 3Q8WA 5FT9A 4O4IA 2VATA 4NMMA 1ZONA 1MDBA 4Y2HA 4BLOA 3E1YE 3KUXA 3RKUA 3AUTA 1QX3A 5MFZA 1JALA 2VEOA 3CWZA 3UNXA 1KEPA 3C7DB 2F6RA 3VNBA 3D7KA 2WTUA 2HCBA 1CVLA 3ZKAA 3G2KA 2A78A 4AD8A 1TUEA 4UC0A 4Q00A 4W9MC 1Z8NA 4A15A 1XDGA 1K7XB 2GJKA 3QWAA 4JFRA 3FFAA 3REGA 5LR6A 2B5OA 4QARA 2H0AA 4HNUA 2TMDA 5KTNA 1FBTA 1E5DA 1HDXA 1DC5A 5EJIA 1QNFA 1KJWA 4K6GA 2I3ZA 3IEXA 4ENPA 4F2HA 5M29A 1Y89A 5EJFA 1HKHA 4CM9D 1KWKA 3JAWA 2EX4A 3N9IA 5J3OA 5AVVA 2GVNA 5DM1A 3LRPA 1QCYA 4ZVKA 4GF5A 2P7HA 3J7TA 4RHFA 1GAEO 3OZAA 2GZMA 4RV9A 4XUGB 3WMFA 3H99A 1LWOA 5JOQA 2V7QA 2OBXA 3HA2A 3I3OA 4BECA 5IAEA 2IJGX 2PZMA 1CZRA 2EHJA 3AESB 1GEGA 1GTJ1 3QP9A 2H54A 1ZFNA 4KGZA 1Y0RA 2WTMA 1FRZA 4O2LA 5I7HA 1WDKA 4GNKA 2P6PA 1UEJA 3Q0TA 4CMBA 2AFIB 4NFSA 5IBPA 3EZGA 4JAVC 4JLSA 1E3TA 4MWSA 1MBZA 4Z7QB 1W1WA 3BDAA 3IULA 3NIFB 2G09A 2GA9A 3ILYA 4WL0A 4ALJA 3BB4A 4YCLA 4HI0E 5P21A 4N5IX 2H52A 1U2QA 2JCBA 3IXMA 4JLDA 4FW8A 3UMMA 1CRZA 3TZ6A 3AY0A 2MMCA 3M6FA 2VBUA 2V97A 4LZZA 5C53B 1ZEJA 3PUIA 2TECE 2Q6OA 1KI3A 1R88A 1RZVA 4KX5A 1UFOA 4QBFA 3PPYA 4TSFA 2N42A 3CLSD 4IY1A 4XVHA 1EUCA 1BD4A 3BD6A 4ARUA 4LBZA 4R2JA 5CYOA 3DVAB 3KE9A 2X9NA 4LXHA 3AUFA 4ND6A 1QCCA 1YOVA 5FFNA 4NMWA 4ENWA 3STXA 1Y5NA 3HP1A 2YIVX 4EFKA 5HS4A 1TPYA 1U02A 4MDFA 1Z28A 1GFZA 4KWCA 4RIIA 3ZDAA 2GPYA 2IVFA 3G9XA 4OI1A 3RHSA 1Y5MA 1BU5A 4BL5A 2Y6UA 3GIDA 4YJGA 3AUUA 5DX1A 2W8BA 2LTAA 4JIMA 5F3RA 3ZCSA 1M2EA 3V8EA 4QFMA 4P26A 1KS2A 2VEDA 5DNUA 1NY6A 2PGIA 4YP9A 3EPLA 5EE3A 4KLCA 4FI3F 3SICE 3ZLTA 5F5NA 1QIJA 4U00A 3WGZA 5EIXA 4HZGA 2GCEA 4PPNA 1ZUD1 4UOQA 3BVPA 1CQWA 1THZA 3L7OA 5COQA 5ES3A 2R6HA 3DULA 5DNDA 1D09A 3VPAA 4CKCB 5KKAA 2YY7A 3BEOA 121PA 4N7MA 3DWGA 4KV9A 1JQAA 2H57A 2WD7A 3BL5A 1L5VA 4QUAA 4AZSA 2IDZA 2ADMA 6CHYA 1PSZA 4FBGA 4IUBS 5JATA 4EHDA 4DR2B 4EPXA 3U3JA 4HG2A 1E3QA 2VPXA 1FFWA 4RD2A 1KAOA 2HSDA 2NTNA 3BGWA 4J94A 3RS5A 3W5IA 4L16A 4AUKA 3RREA 1I24A 1SNYA 1VLQA 5PGMA 1QKIA 2G63A 1IOLA 1A7JA 4EG4A 1EP3B 4F46A 4HUJA 5J4LA 2WZDA 4KODA 3RAFC 3HWRA 3MPUA 3FY4A 2NT4A 4DK1A 3Q72A 3QFFA 4BEJA 1USVA 1XMQB 2J9RA 1X42A 5L40A 3E9ZA 2AD1A 3GFGA 3FCUB 1UWVA 3HFRA 1Z62A 4URHA 3WLJA 3EIQA 1X9HA 4ZVLA 1WY5A 4MAFA 5E2BA 4R16A 2G6BA 1O7JA 4G09A 5A6VA 1LBQA 3RVDA 3H1TA 3I8XA 3DCIA 5B4UA 1DKNA 2Z5VA 5THXA 4C4TA 5A2QA 2ZRKA 3TFQA 3MWFA 4NECA 4LW8A 2XNSA 3BERA 5BYAA 4EA8A 2UVQA 4GVLA 2P9EA 4YJKA 3LMKA 1ADFA 3ZQ4A 5K05A 4BY9E 5EY5B 3N5KA 4Z6KA 2C3MA 4DMKA 4CF7A 5EXSA 1BFDA 1QVZA 2AK3A 3U4DA 3CCFA 3LO8A 1TIKA 1Z68A 2J41A 5CDUA 4WSOA 5BRJA 1VBFA 2ZRJA 2ZVDA 1SPXA 1RC0A 2RB5A 2CMDA 2ZRIA 3BWYA 4RK1A 3UMGA 3ZGVA 1F0NA 4WOCA 1YQWA 4DCPA 3Q3JB 4KIUA 2Q0XA 4EMUA 1M74A 1P9RA 4I4TA 3SE7A 2CNWA 3H9QA 2B3TA 2H2FA 1H8HD 4D8WA 1NW5A 1C7JA 1VL6A 4C2UA 3C1UA 3KBBA 2IYVA 4OJTA 4BP9A 1E1MA 2XCLA 5C3UA 1SO8A 1VKJA 3GIRA 1RIFA 3HBAA 2ZJ5A 3GGOA 1OLXB 3DBHB 1G7TA 1AGNA 1U04A 3HKEA 3KC2A 4GSYA 2G0NA 3RBAA 3ZD6A 5LA6F 1M6EX 4CLEA 3E53A 1ZR2A 2VQDA 3C3CA 2IXDA 5B1IA 3O8BA 4J1NA 4Z9XA 3PNOA 1IDN1 3LWNA 1NN3A 3PQ2A 4D96A 4TV8A 4DAOA 1QP4A 2I6FA 3HI4A 3EFOB 4UHEA 4MRMB 4NABA 1ZC3A 1WCWA 4OHXA 2VAVA 3KPJA 4N5NA 3VJKA 3PPWA 4JI5B 1TD1A 4A73A 1YR8A 2QW1A 1C8KA 3BWBA 3GU3A 4JITA 1EJ2A 3N6RA 4YH1A 1DAFA 3M0EA 1HI9A 2CK3A 1Z0IA 4UU0A 2W2LA 4YDHB 3H3JA 5DHFA 3T7IA 1L8LA 4F2WA 2J33A 1D0VA 1GCUA 3DYIA 2ZI9A 3LQRA 3UUEA 1OKKD 3QLUC 5IYRA 4RANA 1TTTA 2ODEA 2TSYB 4GIBA 1WXEA 4CG0A 1O8BA 1I4DD 1Q7BA 4R8MA 4MWBA 3CLTC 2H4ZA 4LXUA 4R2WA 2H7XA 3C7CB 4LFCB 1KHTA 4FHFA 1BYUA 1MMFB 4P12A 1PFWA 1U2DA 4ZTUB 1Y98A 2XGOA 3P0HA 1GG5A 2OKGA 3REQB 5DF1A 5KC8A 5LFAA 1CEEA 1PLKA 2VSNA 1L5KA 1GN8A 1RMTA 4EEXA 4P22A 3LPMA 3R0IA 4R1UA 3WC4A 1JTVA 5IJWA 1UAGA 3PQ3A 5ETJA 4W7SA 3ZE6A 3IHLA 1HE3A 3EODA 1ESNA 5AIBA 3B9BA 3P71T 2A5JA 1YQTA 4JI3B 3JTMA 4DQXA 1YB1A 1Z0FA 3RT7A 3USES 1EBUA 1V5VA 4C4ZA 4TN1A 1B43A 1NDUA 1P6UA 3ZCPA 4RTOA 2O59A 4OHUA 4IJMA 1JAYA 5K0BA 2O6HA 2B99A 1ADGA 5T57A 5JS8A 2E4WA 4HWRA 1YJBA 3C6MA 3JQAB 2I7VA 3ND5A 5BSRA 2DBZA 4Z7JA 1A2KC 1E4YA 1W5AA 4G89A 1KVQA 4WOJA 1XI2A 3A6FA 4OHZA 4LWOA 4CJXA 2LCFA 1YDEA 2HJSA 2DQYA 4GGOA 5CFMA 5IF9A 4BNNA 3E84A 2BR4A 3IIMA 5EA2A 4XR4A 2X8LA 2PEYA 5KVCA 3K3PA 5TARA 3O7MA 2VT2A 3ETDA 3ZIAD 3SJBA 1GZDA 2IYNA 4FS3A 5EKSA 1TYDE 3P5SA 3Q3EA 3ZHOA 1RRVA 4EA9A 2EGGA 4CTOA 4NI5A 3O73A 4YMTA 4MZDA 4QGBA 1FCJA 5BY2A 5ALNA 5GGXA 3IOCA 1KNXA 1PT7A 4ZI3A 5FD8A 2QMEA 3TB4A 4TVSA 5DU2A 5GZ1A 4EITA 2I6UA 3M1IA 1EG2A 1H3FA 3OT5A 3PHGA 4IDGA 2GXAA 2DY1A 3DUFB 1PRYA 3DTNA 3L2OB 4MRVA 1R4NB 4Q3EA 4F0JA 5UKDA 4GLLA 4ZQIA 4QIHA 4X1IB 4BKPA 4NCXA 1FW6A 3ZJYA 2ZTMA 2F1LA 1OZHA 2P9GA 2XA9A 3Q4GA 4ZYWA 4XD7A 1MX1A 3PDIA 4TTVA 5LP6A 2ZRDA 5GJWC 3U40A 4DNQA 3QTLA 1JVBA 4XX0B 1L7NA 1V9CA 1EYZA 2ZBQA 4WI1A 4M0KA 3SJUA 3FAZA 5IKEA 4HYYA 1W7AA 4YMGA 1ISPA 3MK31 2GASA 1GA6A 3QVMA 3CA8A 5BT9A 3O8QA 3BXXA 4DANA 3PLAE 1XD8A 3U4IA 1G19A 3CZ5A 4QXOA 4CLXA 4EG8A 4H7EA 3IVXA 4XQ0A 1HOXA 4RO0A 5AVTA 2BJWA 2QJWA 1NYQA 4OL0A 4H1TA 3KJHA 4PZ9A 5AI6A 1SVIA 2C4WA 4JWKA 1M2NA 3CT4A 3EDRA 3TW8B 2XSZA 2HPZA 3EZXA 3R7LA 3BMCA 1UM8A 1X8LA 2I0FA 2FPOA 1QHHB 4N03A 1JJBA 1E5TA 2CMKA 4MSUA 4ND8A 3V8BA 2QM8A 1YJNB 3MN1A 5IAOA 4IIJF 3TB6A 1ODLA 2GBLA 4YDQA 2EIXA 3ONWA 3VPHA 2XIJA 1SMKA 5I4CA 4KYIB 5ENZA 1MF7A 3O9MA 3P9CA 3SFTA 3U49A 4KNVA 4CM7A 5ADUS 3IC5A 1J2EA 4WBNB 1QRUA 1SCNE 1I3KA 1JR3D 1Z4MA 4A6XA 2HSJA 3B3FA 5GY7A 1E3XA 5LZ7A 3BQMB 3ASYA 3VYTB 4R05A 4G9EA 1QYIA 1M34E 1Q81D 1U8YA 4RMJA 4X7FA 2RGYA 4QPCA 1MJNA 4EG7A 5FFMA 3LZCA 4I66A 5F2OA 3W3AH 1WBBA 3KXDA 1BVHA 1N1EA 4L8YA 4KHPB 4RPDA 5JCOC 1QUEA 4RM2A 1GA4A 2NZXA 3RT9A 2AJBA 3Q7RA 4HN4B 2OSVA 3DEYX 4DIMA 3WY9A 5HJ5A 5I7SA 2ODPA 2X14A 3X1MA 1XEXA 3DMDA 4NMHA 3M6XA 4MVJH 4PLHA 3RVMA 4X62B 1E4EB 5DIFA 1WAMA 2PGAA 1HO3A 4G1VA 3NIBA 5IANA 2JH8A 1Y48E 1NKSA 4HNVA 3IELA 2JJMA 2XEDA 2Z2XA 4PFJA 4WHMA 4X1YB 2X6WA 3CSSA 5SZJA 4BB9A 3M5WA 1JG4A 1GPKA 3PF8A 3K0FB 4XJXA 2VF5X 5D3MA 1QCDA 1GUYA 3A4YA 4PNHA 3GP5A 1KFEB 4U6SA 1BG6A 2VN8A 2YFKA 4Q18A 3UUWA 3ZWNA 1KD1D 4K6MA 1TCBA 5EE0A 4BQIA 3QIVA 3LSTA 1DRUA 2GXSA 3ELUA 5J2UF 4WZ6A 1YZQA 3THXA 2A1UB 3ETGA 4P3PA 4LFAB 2GFQA 4G7XA 1C1XB 1XDSA 2GO7A 2BN4A 4HO1X 4KRXA 4UAUA 3KO8A 4YRDA 1OPRA 2RDMA 4NFLA 4AUMA 2H4JA 1G2OA 4QG3A 1I7QB 2ZBPA 1CCWA 4KVZA 5HDBB 4BBPA 2N3ZA 1LY1A 3ZJUA 2N1MA 1N1DA 2FN4A 1DTWB 4KH0A 1EUYA 1E0AA 4XDHA 3JSAA 1KXJA 3B12A 2QZJA 4JROA 4MQEB 3UHAA 4PSUA 2JW5A 5CB4B 2M1ZA 4PZ0A 2C99A 2W6ID 3A04A 3LGAA 2IHKA 1ZOLA 1V96A 3WRYA 2VAPA 1CQZA 3F71A 1R0BA 2ISSD 2NXWA 3R5JA 4BNGA 2V4ZA 3KXKA 4KQHA 4B3XA 1FQKA 4RY0A 3USZA 3WYCA 5JZBA 2K2WA 1G55A 1YRAA 1JN0A 3QW2A 3UOAB 5CXXA 4BZXA 3AR4A 2BGGA 4G9GA 3DL4A 2E4XA 1P74A 3UTDA 1QHXA 1OJLA 3INTA 4OSPA 4TYPA 3P32A 5F98A 1MVLA 1F2TA 2ZQ5A 2DLCX 5JRJA 2Z6AA 3K0CA 1EVIA 3DOUA 4J9UE 4A8HA 2REQA 1NWCA 1YC5A 2GD2A 1H6CA 1UZAA 4KG7A 4OLBA 1ULAA 3OKAA 2PXXA 1MC5A 4KQ9A 3AF3A 4ZD6A 2NSHA 2FPXA 3TIXB 2NU8B 3II6X 2NO1A 3L1JA 4HQFA 4JELA 4DLRA 4URFA 4LDPA 2Y67A 2X23A 1WS6A 1J23A 3CPXA 2C2ZA 2X22A 4XQGA 1JQBA 3RVJA 1EFKA 1YVRA 4NBRA 3DKRA 3PD1A 5K45A 4GR4A 1NUUA 5GP1A 4LOIA 1DV2A 2GM5A 1JDSA 3S6JA 2ZM6B 2ZUCA 4GZ6A 3U44B 2DC1A 3GXOA 3IIKA 4KBGA 1KJ9A 4XW2A 3MBIA 4YGXB 3T5MA 3KT0A 2DQKA 4KO8A 2QU8A 2HLPA 3GBPA 2OYNA 1AZLA 3IO3A 1FU7A 4MPTA 3GO4A 1S2GA 1Q16A 1U0TA 1X3SA 1Y0BA 3H2ZA 3AP2A 4K9PA 1NC3A 1B8NA 1TU3A 5B37A 4EBBA 4S0ZA 1FDSA 5DXFA 1QJ4A 5CB8A 5I9IA 1XALA 1EWYA 1SG9A 3L4EA 5EWJA 1LJ8A 3DE5X 2ZIEA 1QIHA 4L1KA 1X7XA 1CE8A 1UPCA 3S3TA 2C42A 4B83A 2OTCA 2PWZA 2WUDA 1UKYA 1Y6ZA 3L7IA 5HF6A 3RUIA 1C0LA 4AG6A 4RFLA 4XRGA 1FUKA 4FFVA 4PFKA 4PGGA 4YRRA 2Q7OE 3FI0A 2CCGA 2AFHE 1OAKA 3H4MA 4DQUA 2IUEA 2R6GA 2CEKA 3SQXA 3ETLA 4MVJI 3OQJA 4HAZA 3W2GA 4PFSA 4QSHA 4H7FA 3EUWA 4P9NA 2IOFK 3WQHA 4F5ZA 3S81A 3L4BC 4FGZA 4G36A 1ZUNA 2QD1A 3OLWA 4NZ9A 1OFGA 2Q4EA 1NW3A 2XGGA 1YMQA 2YRWA 4GWGA 4L95C 1FOEB 3SS8A 5JNLA 3WGNA 3VV3A 4XDYA 1YVPA 5ILOA 4KVAA 3GLFE 1R0WA 5CU7A 4UHJA 4YAIA 5DBHX 2O57A 4WQMA 5AYVA 3TZKA 4JT4A 4P86A 4IDNA 4RVSA 3LVQE 1IM2A 3M6LA 2FZCA 2YYSA 3CLHA 4UVHA 5DBIA 2IEDA 2F59A 4JLBA 1T2AA 3NWBA 1LPNA 2E2WA 3FDZB 4QATA 4Q4JB 5GVSA 2NYVA 4IIXA 3EPJA 2H9IA 2NO7A 3GLUA 4U9IS 3BGSA 3E7XA 1SCBA 4RTKA 3U7FB 4L78A 5H82A 3GRAA 3V33A 4DA6A 2J3IA 4DJTA 4PNZA 1GKUB 2C5SA 3QMMA 1FFDA 4Q34A 4OU5A 2REOA 4BNWA 1X8KA 3KKPA 2HQOA 1VHJA 4Z4WA 5CA0F 4I81A 2ONZA 2X5KO 1OFTA 3OQHA 4DNTB 3GYGA 2BFNA 1JFSA 4X0EA 1U3WA 1CFZA 1VE1A 1H1DA 3PLRA 3M6VA 1DRJA 1TM7E 1UKBA 2X77A 1HLFA 5AJYA 5E6SA 1GGMA 1B0AA 1XRRA 4GR5A 1A9XA 4PXAA 2NU8A 3E5MA 4EYSA 3MG9A 4JBHA 3TLGA 1ZHHA 3WV4A 4B32A 3OI7A 5CJJA 2HSEA 2O3QA 3K4PA 3IHKA 1ZCZA 5LYYA 5TMDA 1UZLA 1AUPA 2H29A 4M8SA 5IHXA 1YS7A 4KDFA 4IICA 3A6GA 5FADA 1U7XA 3EVCA 3CW9A 4XFDA 2IXFA 4ZZIA 5FWXB 5C31A 4P1ZA 1VSBA 1TECE 4ZV4A 3R2JA 4GFDA 2X1VA 1KAEA 2FPSA 2PE5A 5B30A 2ZYSA 2JGJA 2OGZA 3AUXA 4TL8A 4KIFA 4MA0A 4N3BA 4KE9A 2O3JA 3KHSA 1H85A 5SV2A 2P1RA 5FL7D 4C5CA 2QA4B 1RI2A 4COKA 5LWHA 4GMKA 3SZMA 2PDAA 1IJKA 1Q1GA 3LUCA 5CMLA 5CLHA 1IMOA 2PE3A 3VU3A 5KO2A 4N5DA 1K7YA 4G5GA 2NZUG 4MLCA 2CLDX 3OZRA 4WCVA 5AKYA 3URKA 4JBYA 5BR4A 2Y0DA 4W5OA 3U60B 3X0DA 1MB9A 3R7FA 3BHNA 5ALEA 1Z5VA 2BGMA 1NBAA 1O97C 1ULHA 2XYHA 3BB1A 4ROTA 3RGWS 4CETA 4OQYA 4ZARA 2IEAA 4JENA 4IEFB 1Z8FA 3GBVA 3MWKA 3UWDA 1VMAA 5JUWA 2AZTA 1QHSA 2ZUFA 4Z99A 4JLNA 1QH1A 4LA4A 3LC0A 4OK3A 2QL6A 2J6CA 1FDIA 4F60A 1I1QB 1UD3A 1VA5A 4C6SA 4K1XA 5EMNA 2WHRA 1NIJA 4YJFA 2X4LA 5HCNA 4GQBA 5GV8A 1VZ3A 2LCIA 2QYOA 3KS9A 4NY1A 2VAMA 2IHBA 2Z9DA 4OBEA 3L6EA 1OXMA 2QJRA 3AUKA 3MA0A 4CKEB 4PXSA 4RFVA 3W5HA 3M9LA 1YS1X 4JT2A 3T3GA 2D1YA 1U1FA 3A9VA 1P0IA 3FTQA 3MD9A 4TRRA 4ZGQB 5DW0A 3UF0A 4UAGA 2DHCA 1DPGA 2OENG 4FGSA 1VM6A 1PLLA 3W1EA 5FNVA 1YOBA 5BOSB 1GVNB 1YACA 3TDNA 4C3ZA 5G4KA 2D54A 1KEUA 2X0JA 3C8MA 4KXXA 3BKXA 4KXFB 1RYZA 2F1IA 4MLPA 5ECDA 1L3BA 1NVTA 4MQUA 4P3NA 4PTLA 5MGBA 1FQOA 1WZCA 5DDIP 5LXTA 1QX4A 3VM6A 4DMHA 4PRYA 1QQTA 1PV4A 4C5BA 1LNSA 3PXCX 1MQ9A 2QGZA 4NAVA 3OPQA 2BGTA 2P9BA 1Y9JA 3CCRB 2CN1A 2WIJA 2WU0A 3D8UA 1D1TA 2UZIR 1SU8A 4INZA 1GO2A 1M66A 1TKAA 3QPDA 4GW3A 4RUKA 3LA8A 3RPEA 5JAZA 4LSWA 1VFPA 3L7LA 3L40A 3IBCA 4PN3A 4CM6A 4ZYXA 1QZXA 5CB0A 1B42A 4R2IA 5FJIA 3O95A 3WMGA 2M6RA 1ZCBA 1C9NA 1TVKA 2AUTA 2GEJA 1U4SA 2C20A 3JS5A 3P9PA 4FX2A 4NK4A 4JSRA 4BP1A 2A9QA 3TAHA 4Q05A 4FYIA 3SZRA 3GLVA 1XZEA 1FRQA 1HE4A 3OCVA 1LSUA 5G41A 2X0NA 3VHLB 3NHFA 4IDOA 4HNSA 4LJKA 5EFOA 5HUHA 3QE0A 3BWCA 1DARA 1D2EA 3R40A 4DBLC 1GGJA 3LKVA 3PJDA 5T4EA 1TQDA 2WD9A 4UPDA 3U17A 1GZ6A 1NV9A 4JBWA 2BFEA 4BCDA 3L7YA 2R62A 3PT5A 3PXDA 2POCA 1G42A 1KYVA 3KZMA 2WWYA 4AKIA 1UD6A 2GDJA 2ZSJA 1YJAA 3DFMA 4MQLA 4MVJG 5BV7A 2NXEA 2HK9A 3DWFA 3DVSX 4S3MA 5A6SB 2PBRA 4LJYA 3WBBA 5TDHA 2IU4A 1UBJS 2YXLA 1GU1A 1NA5A 3WDKA 4F6RB 2R2GA 2ZIVB 3EXEA 1ISMA 1O0SA 1DCFA 3OZGA 3LQ4A 3RVQA 2AMJA 2OA0A 4IVQA 3KQTA 1V37A 5FFFA 3OP1A 1J70A 4ZOCA 4DSZA 3R0VA 3G2OA 1NE2A 1PGPA 1ZK1A 3MJ4A 5JJCA 5IS2A 3PVCA 4OGLA 5CYPA 4CCAA 1YK1A 1P1IA 3A3OA 3ZZTA 3BREA 2PBLA 3LX5A 4M21A 4YT8A 4OQQA 2IS4A 2PX4A 4XH9B 5FKJA 5FBQB 1JR4A 2WIAA 2J4DA 5F3WB 1NJ1A 2JFQA 3O4RA 4M1QA 2E18A 1OV4A 5ALOA 3WHPA 3K15A 5AW8A 3T1NA 1VPDA 2DUWA 3GDWA 1EQAA 3I8SA 3ZV6A 3HL4A 4XOPA 3S5JA 2ZBUA 1L5WA 1AD2A 3HCDA 5I4IA 4B3RB 7MHTA 1VLVA 1JMKC 3BMOA 1E9AA 1JKIA 4FKBA 3AU8A 4IIJB 4Z4EA 2VQ3A 1U3CA 2Y1KA 3DDZX 3SX0A 1K3TA 4HQKA 5TXGA 1Y3DE 3F6PA 2B0CA 2ZZMA 1IATA 1TMGE 1EZZA 1HX7A 1FTNA 1GILA 1RHQA 4ZQHA 3PVDA 1T0BA 1XAJA 1Z22A 2C2GA 3N0VA 4NS1A 2NUPB 2Y9PB 2E55A 3GG2A 3FPSA 2F1HA 1T25A 4KKVA 1PT8A 1WXXA 2MDTA 4XD2A 4C29A 4G85A 4EQ6B 1O94A 4MDYA 1TK9A 1IUKA 4F5EA 4NEQA 3MCTA 3ZHXA 2AFHA 2C78A 4OOVA 3HVUA 4Y6QA 1Z47A 2RGNA 3NYRA 2UZ3A 1RS0A 2B8EA 4XQ9A 3EQ2A 2ZJ3A 4DSUA 1VBMA 1G2QA 3TUIC 3ES9A 2I7DA 3HJAA 2WKPA 1ONPA 3KEOA 3LQEA 5BW8A 4XLTA 2WHYA 2ROQA 4BKUA 5JIBA 4E15A 3E7WA 3HZZA 4EG5A 2QM3A 3MYRA 1HK7A 3NETA 1RJDA 2DHRA 4BUZA 3TLCA 5LNK6 5AVOA 4TRNA 4BTEA 3EVZA 3NHZA 4MQ6A 2VYVA 2WJWA 1GQFA 1LH0A 1DJOA 4BMXA 3KRTA 3T8YA 2D59A 1HT0A 3PV0A 3MWEA 4HX2A 5A7FA 2Q5IA 3G9TA 3ZCXA 4LF6B 4UUAA 2LR0A 2OHOA 3Q5EA 3F5QA 1GZ3A 3EGIA 3FHCB 4MQFB 4X63A 1D07A 4Y2XA 5SY4A 3WDLA 4FWIB 4UAVA 3UFXA 1YGPA 1JGTA 4L3VA 3E5RA 4LQ4A 4K05A 3W6PA 2XGMA 3KB8A 4NHOA 5INTA 3KPUA 2H2DA 2Q5QA 4FD2A 4F8EA 3S2GA 4XSGA 4FOPA 1Y8QA 4QTZA 2K6GA 1QGZA 1J2UA 5EKXA 1JJIA 3RI3A 1YDGA 4XIYA 4KR9A 2GVZC 1N5RA 5E1OA 2MTBA 4QUJA 2Q2VA 5J3JA 1YITB 3B8EA 3ITKA 2C0PA 4QV2A 4HTAA 3DOIA 4J0IA 3HY4A 3UJ7A 3HFJA 2WKRA 1NX6A 3UMFA 3JATB 4EG1A 1T15A 2WK1A 3NOOA 3Q0IA 5HNKA 1CR1A 2OZVA 3FPBA 3R7NA 5A3QA 1W0KD 2KSQA 3ZGLA 4EA7A 1A27A 1UBFA 1BS9A 3QOWA 3KB6A 2HGZA 3QPWA 4G81A 3JATA 4UM7A 2QNIA 1O58A 3KCQA 3NV9A 1QG4A 3NTVA 3DH0A 4ZOQI 2GUGA 3F3SA 1N0UA 1XWFA 4J1TC 3ANYB 3GJ7A 1ZAYA 1E1DA 2Y0CA 4Q9LA 1ISRA 1WVMA 4BFLA 4OOSA 1REQB 1GKIA 1SUIA 1TQ4A 3GMSA 2XH8A 4EO4A 2AX4A 5IABA 2OG1A 4E5VA 2PJZA 3UK0A 3CZ9A 4TT3D 1JECA 3WVNA 4DMGA 2ZI4A 4DSTA 4L74A 2X4GA 3CNQS 3OZBA 1LPMA 1NP6A 1P3JA 3GRRA 3P52A 5ALRA 3TIIA 3ISJA 3S70A 5JMOA 2WVJA 4R1LA 1G4UR 1FNSA 3TE7A 4X91A 4AKEA 2VTEA 2NV2B 2PWYA 4O2RA 3V9PA 2B92A 4ENQA 1XZFA 2HH9A 1AJEA 1N3LA 2GT1A 3LFUA 1GRQA 4MAAA 2HQBA 2XUKA 3DDCA 4HPXB 2P2LA 5E4JA 4CV0A 1NURA 3IJPA 4YRSA 3G6EB 5AI8A 1DJLA 2DR3A 2YNMD 3JR3A 1VCIA 3RO7A 3H2HA 1CNEA 4JEMA 1AUXA 3TAUA 1YJ9B 1X74A 5LBUA 3I12A 4A16A 4DQDA 4RAOA 1QGED 1SCQA 2AXQA 3NNDA 4ZOLF 1L5HA 5JLJA 1BXKA 4ZI2A 3NJ8A 4PLGA 1EK2A 4YDSA 4BO8A 1TCCA 2GHRA 2PSJA 3LLMA 4AJ1A 4AJ9A 3PUWA 1X2EA 5K0CA 3BXEA 1MGPA 3TW0A 4CFSA 4R2HA 3WA7A 1P5HA 4ALIA 1Z83A 1V26A 2NPOA 3LIIA 4U7WA 1J8MF 2W2XA 1GNVA 3WRYC 1KSJA 2FSVA 2ZXHA 1KMIY 2BM8A 1X7ZB 4NICA 3I9FA 1K08A 1KI7A 2QAGA 4I2VA 3MHTA 1EUZA 4P25A 4K9NA 1I9GA 2AHOA 2RIRA 3P97A 4LNHA 3L6OO 2HJVA 3CZRA 3I23A 1KJZA 2XMRA 3LC1O 1E9BA 4FQ8A 4RM3A 5C5IA 3O9VA 5I48A 3OEYA 4JUDX 1HLPA