1B2RA

Ferredoxin-nadp+ reductase (mutation: e 301 a)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN-NADP+ REDUCTASE)
publication title Structural basis of the catalytic role of Glu301 in Anabaena PCC 7119 ferredoxin-NADP+ reductase revealed by x-ray crystallography.
pubmed doi rcsb
source organism Nostoc sp.
total genus 92
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1b2rA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1b2rA02
1F60A 2DERA 1Q86D 3A1FA 1YITB 4EH1A 1JA0A 2YWEA 1FNCA 4P3YA 1EFCA 3WYAA 1Q7YD 4H9GA 3MHPA 1BX1A 4RCZA 3OW2B 3OZWA 4ACAA 1OB5A 1Q81D 2HMAA 1NDHA 3WNCA 3LO8A 3CMEB 4DQKA 3J81k 1QFYA 2X3UA 4IW3B 4LC0A 3MCAA 1EFUA 1FRNA 2BGIA 4LBYA 1QUFA 3B8HA 3WBKA 4RD4A 1S0UA 4NCNA 3W2GA 1BJKA 1A8PA 1G7SA 4ZGQB 1G7CA 3QFSA 4Y7CA 3LYUA 3B82A 1ZM2A 2QTZA 4ZV4A 1D8TA 3CC2B 1VQLB 3W5VA 2BVNA 2BM0A 1TVCA 1BQEA 1M1KD 1FRQA 1W34A 4R71A 3CPWB 1ZUNB 4PC6A 4AC9A 1H85A 4NBSA 1K73D 2PMDA 1JB9A 4RD0A 4TMWA 2B7BA 3QE2A 2OK7A 3E20A 4YAWA 4YALA 4AF6A 1YIJB 1VQOB 1FNMA 4TMVA 1EXMA 1TUIA 4B4DA 1CNFA 2BPOA 4TMTA 1AMOA 4RD3A 5EMNA 4B48A 4PGOA 3CD6B 4FN5A 5THXA 5TV2A 1K8AD 1KJZA 4B43A 1NJID 4M53A 3ES9A 4B3XA 4RD1A 4PC2A 2QDXA 3E1YE 2PIAA 1F20A 1YHQB 5GV8A 1QGYA 2D74A 1KK1A 3WY9A 4B47A 1QG0A 4Y9RA 2BM1A 4Q7JB 1OGIA 3ZBUA 4YAFA 4LBVA 3ZZUA 2XNJA 3FPKA 4TMZA 3G71B 4TN1A 1DG1G 1QUEA 4ZCLA 3I55B 3AVXA 3W5HA 3WNBA 1QX4A 5HXBA 4BPRA 2OK8A 4G1BA 4FK8A 2DY1A 3ZBTA 1R5BA 2GPJA 1KTVA 2BN4A 4AF7A 2EIXA 3G6EB 4N3NA 1CNEA 5FA6A 3AGQA 4UAJA 1VQ7B 1N0UA 1KK2A 1QVFB 1GVHA 1YI2B 1S72B 1B23P 1EP3B 3CW2A 1GO2A 3OZVA 4B44A 1QVGB 1YJNB 1W87A 1KK3A 3VNUA 3FJOA 3QSYA 1QFZA 2CNDA 3WXMA 2QEXB 5H5JA 1VQ9B 1N8RD 1G7RA 3QFCA 1OGJA 3AVTA 5GV7A 4LBWA 3W2FA 1R5OA 4HE6A 1ZM4A 1JA1A 1VQKB 2CRVA 4N3GA 1GAWA 1VQPB 3W2HA 1CQXA 1HA3A 2BV3A 1OB2A 2PLFA 3I1FA 1GR1A 3VO1A 1KC8D 2HCJB 3CCVB 4MYTA 2E1RA 1YJWB 1QGZA 3CCMB 2GQFA 1G7TA 4ZCIA 1BX0A 2BF4A 1IJFA 3OJWA 1IJEA 3CCUB 3VO2A 5JBQA 3MMPA 1YJ9B 2YWFA 3CCSB 1EP2B 1ZM3A 4C43A 4YAUA 2XEXA 2FX3A 3P26A 3G4SB 4ZCMA 3V76A 2VNJA 3OJXA 3LRXA 2VNKA 4QHYA 4U9UA 3QFTA 3CCQB 3CC4B 1EFTA 2DCUA 3CXCB 2RC6A 1FNDA 1ZM9A 2VNIA 4G5GA 1FNBA 3W5UA 2QTLA 1Q82D 4ZGNB 4DQLA 3P27A 2HDNB 2XNCA 3AVUA 5DSZA 4RD2A 2R6HA 3LVBA 2AHOA 1JNYA 1JJ2B 3CB4A 4F7DA 2QMUA 3WBJA 1WDTA 1E64A 3SJZA 1IB0A 1GJRA 1VQ6B 2YWHA 1XB2A 1KQSB 2BGJA 3U6BA 4PC7A 4Y9UA 4C0SA 4HE5A 2DEUA 2QN6A 1XE1A 4FWTA 3QFRA 1SM4A 2QA4B 1DDGA 5AN9A 3JQQA 4M0LA 1VQNB 3CCJB 3VMFA 1E62A 3OZUA 3CCLB 4RJLA 3CRZA 4P6VF 2EFGA 1QH0A 2C77A 2J7KA 1KK0A 3CMAB 1KRHA 2B7CA 4WQMA 3W2IA 1TLLA 3CCRB 3AVVA 5KSWB 1D1NA 3VNVA 1E63A 3AVWA 4G1VA 1VQ4B 2OTJB 1DARA 4M2LA 3ZZ0A 3U2QA 3CCEB 1KD1D 2VNHA 1W2BB 4QFMA 3PENA 1R5NA 2NPFA 4PC3A 2ZITA 1QFJA 1J9ZA 4YAOA 2DETA 1TTTA 4ACBA 2RC5A 3I56B 4MYUA 4PC1A 4M4SA 2VYQA 1VQMB 2VZLA 3AGPA 1H42A 2BMWA 1EP1B 5TY0A 1W35A 1B2RA 1FDRA 3ZZTA 4TMXA 3JQRA 2OTLB 2C78A 1I7PA 1SKQA 5H59A 3B78A 1VQ8B 1AIPA 4K1XA 3WNDA 3CC7B 1N0VC 2BSAA 4RCYA 4LBZA 2B5OA 1ELOA 1QGAA 3AVYA 3U6KA 1D2EA 1GAQA 4M1KA 4RD6A 1VQ5B 1UMKA 3W2EA 1K9MD 1DDIA 2YWGA 1M90D 3JQPA 4J0QA 3ZC3A 5TR9A 1EWYA 1U2RA 4YHBA
chains in the Genus database with same CATH superfamily
2ZGVA 2BT4A 5EZYA 3DO5A 1NPTO 1F60A 3VX3A 3SXUA 4OFBA 4PNZA 5JS8A 2IIVA 5IJ0B 1CCWA 4EKDA 3B7WA 3ELBA 1DKLA 3I2KA 5AW2A 1B8VA 1EFDN 4O8CA 1H6AA 1YIAA 1U9IA 3GJZA 4P82A 4JELA 4AK9A 5C3MA 5L3ZA 1YC5A 1ZWKA 4ANFA 5D51S 5ECDA 3OLYA 3OLZA 4INPA 4O2LA 2GF0A 2W71A 3P32A 1ESNA 5EGNA 4TXLA 2ZRQA 2C9ZA 1P1BA 2X14A 1EFCA 1PG2A 3M9LA 4UHFA 1N2CB 4ZVOA 2P6RA 2FVXA 2QDKA 3D2CA 4B6QA 3SEJA 3SC2A 4DKJA 1JF8A 3TD2A 3E2IA 4YY3B 3HU5A 3MWDA 1DMSA 2XD9A 4U39A 1SKYB 1SXJD 2P5YA 4WRRA 4U7PB 4E09A 1OWNA 2PS0A 3IB6A 1BVYF 1KJNA 1QP7A 1DNPA 2JFYA 1PJ6A 4HFNA 5EI5A 4B3BA 4E0FA 4OYRA 4LBYA 5TE9A 5D3ZA 3KKKA 3B8HA 1E7SA 1RJGA 3MCWA 3OFJA 1S0UA 5JD6A 3A7DA 4WKNA 2K5UA 2XZDA 1SKUA 3NS7A 4MXDA 4DSOA 2B2CA 2EKZA 4EB0A 2DH5A 3OZCA 1NVVQ 2F3SA 4HADA 3KLPX 4EUFA 3KZKA 4KI7A 1W93A 4DC0A 5CG1A 1XNRB 3N2KB 5CCXA 3LHIA 2ACEA 4ZCPA 4WEQA 1KA9H 2QM0A 1T5OA 1NBOA 4C5CA 3FYHA 3KAQA 1KZ1A 3KL4A 2DYKA 4JLNA 4G8JA 4F85A 4UTPA 1ONSA 1LBQA 2FW7A 3ENWA 2GUGA 2JJYA 4FN4A 4O59O 4RIFA 2X86A 3DDUA 1DPFA 2OBBA 2A5JA 5EIXA 1NY5A 3LLMA 1GCGA 3BB3A 1GRQA 2XXJA 1PKXA 3PRHA 4HTFB 4GX2A 1H5UA 3U0VA 1K28D 1EX6A 2PBZA 4JL6A 3N39C 2ZPUA 4TLAA 1G3MA 4NV1A 2AEFA 2ZBFA 1T0JB 3LX4A 5B3JC 2YC4C 1ZGAA 2FRDC 3L8ZA 6ABPA 1TB4A 3QUCA 3Q1KA 3WAKA 4NLLA 1Y7PA 2OFOA 1JAYA 1RRKA 3P0FA 4R41A 4NPAA 4MV8A 3EDOA 3E20A 3UMGA 2RE8A 2Q1WA 1P4RA 1Z8FA 3E7FA 3ILSA 4RPJA 1OAAA 3TPFA 4ZT3A 5KNDH 3OOEA 4L16A 1LF0A 5I7SA 1V6CA 3TIXB 1PE0A 2FSVC 2AYZA 3KBBA 4UBMA 4L27A 4B7ZA 2WJ4A 3EYWA 4XLFA 2DWCA 3EZXA 5K0FA 2OLEA 4MUBA 4PQEA 4BNGA 1PT7A 4EL0A 2Q8NA 3DJYA 2X23A 3PTAA 2BGNA 1G0OA 1LA2A 1NLFA 1UWCA 4OQZA 4P4TA 5DBIA 2OXTA 3WLEA 8OHMA 1Y1PA 4E5NA 1NL3A 1QHHB 5HW0A 4LMRA 3PA8A 1QIKA 3OQ6A 3MOIA 3V80A 1VLLA 2WU3A 4J29A 1E4EA 1UMDB 3OTIA 5JD5A 1U3TA 2NP6A 1KMHB 3MT8A 4YK7A 4CM5A 1IEVA 4EB3A 1UH5A 2ZT6A 2QK4A 2BKAA 7MHTA 2MMGA 3QLTA 5T8KC 3HJUA 2B4YA 4R01A 4L0QA 1L5HB 2C3UA 4L5CA 5B2EA 3AYXB 2C57A 3JYHA 2VRNA 4B43A 3H9JA 3EXG2 2GA9A 3PD7A 4NVRA 1E43A 4CIYA 2H1HA 2RI6A 2HK9A 3ZVLA 5CYGA 1CBUA 2VT7A 4DCJA 3E9ZA 4H4DA 2X5NA 1D09A 4XGIA 2HIHA 4WH0A 4YMLA 1N8SA 2NTEA 1PJQA 3FJ1A 5EPUA 1XO1A 1WXGA 1IK4A 2RHLA 4MR7B 5CNKA 1ESZA 4H7KA 4QUBA 2QYOA 3WGKA 1QG0A 1GPUA 2P5SA 3EEIA 3HN7A 3DFFA 4XIJA 3PI7A 3WKAA 4X3CA 4BDTA 4G5QA 1RC0A 3PFHA 4LV6A 3X2SA 3CURA 3TW8B 1DEOA 2A7QA 2NVWA 2EIHA 3FGPA 3H7AA 3QOFA 1UP4A 3SBOA 1GGKA 5GM2A 2PZ8A 1QGDA 2OD9A 4PY2A 5HF9A 5F9HA 1J97A 5LQRA 3RGWS 4TLDA 5TQ0B 1FDVA 3G0GA 4D9NA 2CSXA 3GLHE 4A92A 2RHTA 4EY4A 2W8ZA 5DTMA 1NW4A 2QTBA 5HDBB 4LK3A 1Y1SA 1AUXA 3ICVA 3RRFA 4FK8A 1MXHA 4XUGB 1LB1B 1YK0A 4HQNA 4J03A 2NTNA 4JJZA 4NYMR 4QT4A 2XWJI 4AMBA 1M2FA 1JEOA 3ZHBA 4XM2A 2P2ZA 1AA6A 3IGFA 2IYFA 3OESA 5ADWA 1GWNA 4JOQA 4CMCA 2E3JA 2JFPA 3L49A 4F9GA 4N49A 1JIIA 1DQZA 5FPTA 1NBMA 4OBEA 2WUGA 4BVFA 4ZV9A 4Q93A 5LMNB 1VCNA 3K4PA 4NDAA 3DMTA 5A5EA 2C4KA 1K9VF 4IJVA 4LHXA 3GPIA 4HH4A 1ZIPA 4P92A 4U63A 4G8BA 5CH8A 4V1CI 4QYIB 4WZBA 2IHNA 2WZBA 1WA5A 3KL2A 3QXSA 4NBLA 3DKIA 2IEBA 3ZJ5A 1FS5A 4HQLA 4F2PA 4CGZA 1XZPA 1JVSA 2FK7A 2RBKA 3ODGA 2ONJA 1NBIA 1P6UA 2OL4A 3W8FA 3FWYA 2XVYA 1DXQA 3BMNB 1PZNA 4I50A 1OBOA 4JP8A 5ALTA 4N8SA 1K7CA 3LQRA 4A0FA 4ZCQA 5LLDA 2W2LA 3WXMA 1XL1A 2XH8A 1BDIA 1XN4A 2XA2A 5DGHA 5CXSA 2HF2A 5K3CA 4CMGA 4HRAA 7ABPA 2IKQA 3BPSA 4EY6A 5JD4A 2YYYA 1I4OA 4RS3A 3P2OA 1IMJA 3W2FA 1O7JA 4UUNA 5I5EA 3OHPA 3NZEA 1JDBB 1WXWA 4GUAA 3HP4A 3L4EA 1N05A 2Y0EA 3PR1A 3PIIA 4PZCA 5H3CA 3ZDYB 3QITA 3R6DA 4YCMA 4Z4FA 4HXGA 3RK0A 4DZRA 4KQHA 4NEQA 1BOFA 4OOEA 3AILA 4ZDWA 2PMEA 1E9BA 3HDHA 4D4HA 4Q00A 4D9HA 4BO8A 5KX5B 4L72A 1BEUB 4DHEA 4QHSA 1DQNA 4LJYA 1CQXA 2H08A 1AKRA 1VG1A 2H2GA 4BNUA 2IDJA 3ABZA 3UF0A 4DPLA 4W6ZA 3TM4A 1VKNA 3BH6A 5KX5F 3C6KA 5LXTB 2JRCA 1Z2OX 4MV3A 4FTWA 3TPCA 3WGZA 3EC1A 3F78A 3RUAA 2HTFA 3IUSA 5LXTF 2F1IA 1XMQB 3BJZA 5REQB 3G7SA 2VQFB 1RRVA 2C4VA 3DF7A 3GEEA 3R3WA 4H7FA 4X41A 4BHTA 2V45A 4LNUA 3FETA 1NF2A 5ALHA 4PO9A 4HAYA 4UU1A 3DO8A 2TMDA 1Y4SA 1WPXA 2G7ZA 2VH1A 1Z7EA 3EMBA 3L2OB 3LAWA 3QX8A 2H4HA 4IFBA 4IXMA 4RQAA 1FU7A 1RQRA 4FZJA 5JH7A 2YHIA 3LFHA 3OFKA 2G5CA 2I4IA 1PO7A 1XCJA 3MS7A 4AMYA 4YCJA 4E0BA 4C05A 2Z4TA 1DLJA 3TL3A 3V4LA 6LDHA 2IXTA 5JBQA 4G0PA 2O0MA 4I9GA 2K2QB 3WRVA 3K09A 4WCFC 2ZW9A 4JR0A 4ARVA 4RXTA 3SIXA 3T9FA 4ND8A 2WJWA 5EC8A 2WY2D 4RFSB 1NJ6A 2BRUC 2V4MA 4QUDA 4ZKEA 3WRYC 1L8OA 4JJEA 1RJ9B 2O2YA 4RK7A 1X74A 4BTEA 1OHHA 3AKZA 3KQYA 4JJAA 5HRUA 3K0AA 1LK7A 5JJBA 3MD9A 2ZRHA 3NHSA 2TMKA 3HR7A 1HMYA 1I13A 1QPGA 4JYMA 2C3MA 4S1TA 1UAAA 3B12A 3ESBA 1E3DA 3LBIA 3V4FA 2BDUA 1ORIA 1Z6YA 2ROQA 4H7EA 4IIJA 5JS6A 2F9FA 1RPTA 1NMEA 1X7WB 5EGSA 2B0JA 2Z1MA 4CG0A 4U9UA 1GUYA 2VSNA 2XOKA 3OE7A 2ZJ8A 3EZNA 4RTMA 4A2WA 2DB3A 1DBVO 5K3AA 4B83A 1KFBB 2XMQA 3GMTA 4PPQA 3D6NB 4TZTA 1ZM9A 2BFCB 2OFWA 2P9EA 1KNXA 3DLCA 1LD3A 1P2FA 2EZ8A 4JX8A 3CLRD 1HRKA 4N3AA 1QS0A 1P4AA 3H65A 4MPRA 1QYWA 3HEMA 4PICA 3RIHA 1ZKMA 1IOWA 1XTRA 2EQ5A 4Y3UA 4R0MA 5JSZA 4NQZA 2GM9A 2QVBA 4PLYA 5AK3A 3IQZA 3VKWA 4ZAVA 3NBKA 1WVGA 4HVCA 2IHBA 1T1JA 3QWFA 4LGCA 4MKXA 2PBLA 4CL3A 2Y0CA 2AEJA 4R5MA 3U61B 2IY9A 1TD9A 1T8RA 2QNIA 4AMVA 2H4WA 4BY9E 1RW4A 3NBQA 3WL3A 3G0BA 3DWFA 5CTJA 3HNRA 4BKOA 3DKPA 2GOYA 1GEEA 2EERA 3OC6A 3W6UA 4JSTA 1U6IA 1N7JA 1EE9A 1O97C 4OQYA 4MWSA 4RWEA 1Y98A 1C0EA 1GQSA 1SUEA 3GOQA 3HRIA 3Q85A 4D79A 1M66A 4G1CA 1M2WA 5CLGA 1GYQA 1GJRA 3A9TA 1C3XA 2E21A 4C2TA 3SK0A 2G82A 1JKFA 2A1UA 5JCPA 4RE6A 1IL0A 4PC7A 4MDEA 3V8RA 4ER3A 1Q7CA 4D25A 1SUDA 1B0ZA 3OQMA 2EAUA 1GP2A 5B1YA 4F45A 5KYUB 3B6MA 3C7TA 1QHYA 2HY7A 1R4MA 1RRPA 1XXHB 2RI0A 3CHYA 4IHJA 1ODKA 4X45A 5TQ2A 1L7AA 1GCAA 4LMPA 4OK6A 4O0MA 4XA8A 3PYMA 2Q6IA 1CUDA 1DXYA 4OKSA 3IAS6 3LP6A 1W0KA 3M6WA 3JQQA 4UTVA 5AIAA 1E20A 4FJ2A 2FPMA 2NSHA 1W49A 1E5DA 3EVBA 2PH5A 3HA2A 2CL0X 3IOYA 3R77A 4K9DA 4AYXA 1F8FA 4GMDA 3HH8A 2UZAA 4BKMA 3WIVA 3LDHA 4QTYA 1MA3A 4K0KB 1KFKB 3N0XA 2Q7XA 3Q4GA 3WMFA 2PBFA 4BV2A 4DS3A 1BYUA 1CUYA 1WQ3A 1QH0A 2EBFX 5I6DA 2XVZA 3DGEC 1FBTA 4CF3A 2O9JA 4P1VA 4FILA 2NU6A 2ZJAA 2G6TA 2PKEA 4WQMA 3INYA 4X63A 4F71A 1MO6A 5C3UA 1XI2A 3H3JA 1E63A 2QUKA 3C14C 3C6QA 5KTNA 1F7UA 1PP4A 1NV8A 4P7KA 1T6ZA 1F6WA 4TL8A 2X53S 1NJ5A 3MT9A 3UA4A 2MTBA 3F8TA 3W6NA 3ZKWA 4OTZA 3BD6A 1P31A 2YUIA 3HB9A 4HLQB 4WADA 2AMVA 4I5GA 3OLQA 2CHGA 4L51A 2XCTB 1HDXA 1ACMA 1QLWA 4TKUB 5HE9A 5K51A 1KTIA 4FIZA 3GGDA 4GH5A 1PSWA 4FSHA 2JFZA 1YU9A 4UVIA 5TS2A 4Q82A 4R1MA 4AVYA 1MABA 2HO5A 5DB4A 2JFGA 1DEHA 1NW8A 4LPSA 1ZD1A 3GVKA 4MQUA 2AFIB 3IUNA 2FFHA 4ZU6X 1GAEO 4DV0B 4QGFA 3P71T 3VBEA 3V8NA 1W8IA 1Z88A 2NU8A 2V7WA 1RS0A 4TYQA 4B87A 2BGLA 6ADHA 4XLCA 2XSZA 3O6VA 5TJHA 3M70A 1VJTA 1MVLA 3GJTA 3OLVA 1JT9A 1OXMA 4I1IA 1XRLA 4B0PA 3EXHC 5JO9A 1P1FA 4PYMA 3AGPA 4ZT2A 3PQ7A 1Y6ZA 1H42A 1XVIA 3NOQA 4LCJA 5KTPA 4FBMA 2EATA 3L7IA 4YRMA 4X6LA 5EWMA 1QNFA 4IV0A 5EERA 2J5XA 4BMCA 4XQFA 4PFQA 4RVHA 2CUZA 1AQ6A 2HH9A 2I34A 3U3RA 5LP6B 4ZO7A 5K0SA 3WLRA 5AK6A 5I01A 1PT5A 1DBWA 1WB4A 3R3HA 5E3IA 2QZ9A 5EQJB 3IIJA 2D62A 3W9BA 2EJBA 4DJFC 1FVFA 2ZBVA 5LP6F 3W78A 4DA4A 2GNOA 2CE2X 3MF4A 3GDWA 10MHA 2P35A 4RPCA 4HAIA 5AXAA 4URZR 5JDIA 1DTWB 1PK8A 5T6BA 1Y9AA 2NUTB 1X8LA 3DAPA 2PX0A 3D8NA 4BFSA 2RI1A 2W6JD 1PW5A 1YI8A 2IYNA 1M8KA 1VLOA 1Y37A 2NSJA 4M1KA 3PE6A 4U0KA 4UNNA 3VR3A 3TECE 4FC6A 4UHBA 1I1QB 1RQNA 5L4SA 1YRWA 4RANA 4X64B 5DOZA 3LUPA 3FFAA 4AW9A 2PGOA 1AMUA 3FCEA 1A9SA 1S3FA 1VL1A 3LXUX 4OBXA 3P0EA 5G53C 2P0EA 3SLGA 1UQRA 1JKXA 1XTZA 1TC1A 1ECJA 1YHZA 3LY7A 3RT1A 5B12A 3QFHA 2O1SA 1LNQA 3JQPA 2JFVA 2CWDA 3JRNA 4DM4A 4FFSA 2X5JO 2BDEA 5IZCC 1X7YB 4IXTA 4ZU3A 4DUYB 4DLAA 3NYQA 2VSXA 4WOJA 3HKEA 1NVMB 2CKMA 4HUQB 4XRRA 2RGAA 2FWPA 4K9NA 1QK5A 3PXAA 2NVBA 3VFDA 4EVSA 4EH1A 2VRCA 3I12A 2JEZA 2E9SA 4F92B 2QP3A 4ITVA 3C6YA 1TJ5A 3OQNA 5LOVB 4FUQA 5WRFA 4W9NA 1LNZA 1NATA 2XV1A 1A0OA 4Q48A 5DHUA 3S2ZA 2CD7A 4ETMA 5BV8A 2HWKA 4W82A 4H6XA 2ZB8A 5LOVF 1F9AA 3RI3A 1TEZA 1UK9A 4XQCA 1FP1D 4G85A 4RJKA 3O4IA 2JKYA 3SXPA 4L50A 5A6SA 1IYZA 5G02A 3LNNA 1TIKA 1B43A 2GB4A 4J2HA 4ZOBA 1REQA 4ESEA 4RCZA 2FR0A 2QSJA 4O0LA 1FU4A 2IYUA 1ZGHA 2V7TA 2I9KA 4M9SA 2TS1A 1J8FA 5D5HA 4DQKA 1XZGA 1KJYA 2OCKA 4K0RA 4KL8S 2FKNA 3WV4A 4KJXA 3QZUA 2GHRA 1ES9A 3P9NA 5DASA 5FTNA 4EIWA 1BE0A 2C42A 4BKQA 3U4QA 5SYAA 1FRNA 4JC8A 4H59A 3VOBA 4F12A 2P90A 3AW8A 3NOOA 3U4IA 3EGDB 5HF8A 5HS4A 1BDJA 1PR9A 2AR7A 1UFVA 4W1PA 5C37A 5MN6A 1FMLA 1GQRA 2PGDA 1ZCAA 2JFHA 4IJ5A 4JC5A 4YRTA 5IW8A 2QJFA 5A7FA 1DWOA 5FWYA 4MP3A 5CH3A 2GZMA 4QLOA 1RWOA 3W1EA 1VE1A 3ZR4B 4EGFA 4JIMA 3RSFA 1YZYA 3RVMA 5BSYA 1Y5NA 2GEVA 4D4MA 2LCFA 1TAUA 4PTZA 1UEJA 4JLMA 4UZSA 4XCVA 1PUXA 3CYFA 4HLDA 3X0DA 4F5WA 4DK1A 1W36B 4CQJA 2FEKA 3DZKA 3OTHA 1Z36A 4DF3A 4Z7QB 5FJJA 1M2VB 1YSCA 2IU4A 5CX4A 1FS6A 2FWAA 4FBLA 3LBAA 2ZWPA 5CT8A 4LVOA 3ZX4A 1Q92A 4ZANA 1NV9A 1W4AA 3JZFA 3K6RA 1NYLA 3LFTA 2R7LA 3BMQB 2C96A 4HX5A 4KOAA 3VDMA 1YB1A 3WQSB 4HVAA 4OHRA 1Z7GA 2G17A 3NRJA 2ZE8A 3IVGA 1V5IA 1RKXA 2ONCA 3CLSC 4G4SO 5A89A 4UBOA 2C07A 2CXOA 1LBTA 2O3JA 4C7JA 1JKJA 1LQTA 3DE1X 4C0JA 4YAGA 2CSUA 2UZ3A 3CGWA 3HFGA 4J0EA 4QO8A 5MDHA 4MRAA 1ULZA 2QRZA 2DPYA 1XA4A 2ICAA 2IGTA 1RHUA 5F33A 4CBVA 3C15C 2A5DA 3ANYB 1G5QA 1TJ3A 1Z5ZA 2BH9A 2N0SA 3DEFA 2WKPA 3G7UA 4OQFA 5A71A 1Q19A 2BMJA 4K03A 4QAJA 1WZCA 3B9QA 4YJHB 2OGUA 3WK8A 3DUFB 1T9KA 4RKFA 4RLZA 1IM2A 1LC0A 3GRCA 1E3EA 3KV3O 3PL5A 1H69A 3ELYA 3G5AA 5C31A 1AB6A 1NXTA 2ZREA 1Z33A 1U5CA 4KE8A 4OP2A 2ATCA 1JQKA 3A1DA 4G1UC 1ZK2A 3RS7A 4JGGA 4HV4A 5JANA 5KTOA 1O4VA 4EGJA 2RBEA 2J09A 2ORED 4URHA 1CE8B 1QWOA 1P4HA 2OHFA 3RUEA 1COWD 4ZYUA 1PJ4A 2ID7A 3DMPA 1QVAA 3MJEA 4FGLA 4Y2TA 5HVNA 4D8WA 3H2KA 4Q1EA 3KQLA 1KP3A 1ZXLA 3CJRA 2BGRA 5K3BA 2Q9CA 3KVRA 2I62A 3NOVA 4QEDA 2CXNA 4UARA 2VBCA 1R37A 4UMFA 4DT1A 3RWMB 1HDEA 4MCJA 2H2HA 1QZXA 4CKWA 1K08A 2Y92A 1YAJA 1FEZA 4UULA 2ODEA 2HRRA 2VN8A 5ALIA 1C7QA 1PQWA 4R0NA 4YP7A 5BNTA 1PR6A 1UPFA 1YWGO 3DONA 1YVRA 2H1LA 2NX2A 2Y05A 1KO8A 4TM8A 1LNSA 5BP7A 4NSNA 1AO3A 5IASA 1UBSB 3F4BA 3JZAA 1BS1A 1MB2A 1YB7A 2JLAA 3QU5A 4DDVA 4UBKA 1E1CA 1I3KA 3CPEA 3E0XA 4HDOB 3NGMA 1KQ3A 3Q8WA 4TUYA 5D85A 3ZDDA 3CRMA 4GXQA 4B46A 2WLTA 5KWSA 1MVOA 3R7WA 3DZGA 4JQOA 1V3TA 2UZ0A 4FNAA 1ZNXA 2P8SA 1XCGB 4ZCLA 1CJUC 1NMZA 2IGBA 1O96B 3H9UA 2O3TA 5CJ2A 1PV1A 4BN0A 2CL7X 5BV2P 4BVLA 5LQSA 1DX9A 2OEPA 5KB3A 4ON9A 3OHMA 3IBFA 1SELA 4A0RA 1EQAA 4HDKA 3QXGA 4BFYA 1VLMA 3M4YA 2V7QA 3V4ZA 4QQ8A 2EG5A 1T91A 4OMCA 3FY4A 3KKEA 5A04A 2E5LB 1ZZEA 1JH9A 4NJMB 2M9MA 1C1HA 1V95A 1E3SA 3V1UA 3WR5A 4JASB 5CFZA 3D4OA 4KQEA 4EW2A 1NN1A 3N87A 4P3XA 3K31A 2JLZA 1HNNA 1XJ5A 2IE0A 2IYTA 3OCYA 3P2YA 3TVYA 3H97A 1BPLA 1B00A 2HDWA 1QG6A 4I6GA 1N57A 3ENNA 3JV7A 6GPBA 2J32A 4IDDA 4YUAA 1UFOA 1VQ1A 2WA2A 1ZCZA 1RWBA 3VAYA 5B6JA 2GA8A 1L7VC 1TTHA 1TA9A 1T4MA 2DUJA 1EUCB 3CH5A 4X85A 4J16A 1TQ2A 2EFDB 1V39A 4YJ3F 2ZAOA 2M1ZA 2ODAA 1R8XA 4E5PA 3H16A 3EEOA 1V7ZA 1JHOA 4QTUB 1Y82A 5FCDA 2D8MA 3IQEA 1MHPA 1ZLYA 1ZCBA 1BHJA 2P9BA 3GI1A 4NFYA 1RI1A 4RENA 5T3UA 4TYWA 3TNYA 3H9CA 2JRLA 2IP1A 3MCVA 4F46A 2CRVA 4N3GA 3TSCA 4A6XA 4RPIA 4IAOA 4AKEA 2LCQA 5JSKA 4YUZA 3ACDA 3BKXA 3WTCA 1AK2A 3L7AA 1K8QA 3C8MA 1BCSB 4EKYA 2BFEB 5IX8A 1JZQA 1UZNA 1US8A 1KQFA 3L79A 1XKTA 4Z4CA 3MXOA 2HCJB 1JFFB 1MW8X 4IQ0A 5CDFA 1U0OC 2PWBA 1GUFA 1LWOA 1N34B 5AO9A 4CLEA 1Y3HA 1CQPA 1XGKA 1MAVA 1KDVA 4HVLA 4QJ3A 4A8JB 2HOQA 4Z8YA 1BS9A 2VHCA 1F8XA 4FGKA 3MEQA 3WL8A 1KU0A 2G06A 5LQCA 2PRKA 1NYRA 2UYGA 2WIJA 3VOSA 5HTKA 3QENA 3T06B 1QH8A 3PDUA 4G9GA 1DC7A 1FFCA 3ICOA 1I0IA 3RVQA 5DX8A 2OPHA 4PLTA 3ZWNA 8LDHA 3GUCA 5ITVA 4NCHA 3H17A 3P9PA 3VO2A 4J0DA 3A0UA 3S1SA 1OU4A 2VF7A 1JHAA 4RDCA 1HC7A 4XORA 1BRTA 4HB4A 1Z17A 5EIAA 1OXSC 3T35A 3DE6X 1FFAA 3DWGA 3K1AB 4IDBA 2ADFA 3BJRA 4KAAA 1M33A 1BD3A 2QYHA 3A8IA 3FWPA 4JBXA 1VF7A 2PKQO 2RG7A 3DMTC 1XPRA 2WJYA 3LKZA 1TTPB 5IDXA 1BXRB 1C3LA 2PN1A 1XN1A 3GRKA 1BXZA 3I9LA 5EWJA 5FEMA 4A4DA 4MSUA 3EH2A 2KJQA 4E7OA 2BMEA 4EA7A 2VRWA 3QVSA 3IE1A 4WCFB 1IN4A 4UM5A 1JG2A 4P36A 1Q44A 4YRIA 2PPVA 1KIAA 2A9QA 1KGSA 2XZTA 1X7XB 3D0KA 4DIDA 5M34A 5HIAA 1SIUA 4IHQA 2COEA 4PAWA 4M37A 3ROXA 1WOPA 2XJ4A 2QN1A 1KYYA 1CQIB 2XBLA 2D1FA 2QVYX 5H1YA 5BV7A 3LBHA 1HDRA 2JBAA 1DRVA 1QQ6A 4IF4A 3N2YA 1ZW1A 3RPEA 4LISA 3R7LA 1GM5A 2J33A 3W9UA 1YS9A 4KK4A 2HHCA 4QVGA 2KS6A 3LUKA 1W6RA 1X13A 3MMNA 4MJLA 3SBDA 3SNHA 4KDFA 3ZNPA 5HOQA 1H0KA 1PTJC 1JG1A 3AHEA 3FWKA 2IEGA 1PYOA 1P39A 5L3VA 1PWEA 2CCJA 3SICE 4FCCA 1FLAA 2ZZMA 4IIXA 5LSAA 2X7HA 3F4KA 3E70C 4LOKA 4YCLA 4X7CA 1ZVQA 3EH1A 2BHRA 3HKCB 2UVPB 3UK1A 2J67A 4DG5A 5K0TA 2BEJA 1V0EA 1Y0YA 1GT6A 5DV9A 2C7OA 5D7BA 4WLEA 3KXKA 1GILA 5AI4A 2E48A 4IIYA 3EHDA 2FQ1A 3V4SA 3K2IA 2PWYA 1KY4A 3E3OA 5BSVA 5A4JA 2R25B 1CZUA 1VECA 1FSZA 4FC7A 4LFBB 3NIGB 5KJEA 2F1JA 4MPPA 1N5OX 3WJ2A 1XKXA 2C54A 2H16A 4XPIB 5CYOA 1Y0RA 4L5YA 4EPXA 3WC4A 3A37A 3L8CA 4O4JB 2VTEA 2LRHA 4X8MA 4LDNA 3KT8A 4RPHA 3CVXA 4I3GA 1HPLA 1OIWA 1TUEA 5EJFA 4I2NA 2G1AA 4NH0A 1UKCA 1AO0A 3D64A 3PE3A 4RVCA 4O4JF 2JGKA 3JU4A 1EJ2A 1KQSB 3O26A 1J4AA 5PGMA 4QOIA 4ZTZB 2QI9C 5KNLA 3W34A 3K09C 4MYHA 4GBJA 1UAGA 3PNPA 4AG3A 1C30B 1ISFA 4OYLA 1Q0ZA 4WK6A 4DG9A 3ESQA 3DZ8A 2GD1O 3Q7SA 3S2EA 4BEBA 4NZYA 2Z2ZA 3F9CA 2V3CC 3HKDB 2WIFA 2VBFA 1NASA 1XHFA 4LJ7A 1RYZA 4WI1A 1E3WA 1ONOA 4F1WA 1I94B 3GVPA 3PA1A 3KB6A 4OFXA 4WCVA 2IYSA 1Z7YA 2R5WA 4R6WA 3IAS1 1J5XA 3GLTA 1BMFA 1W0JA 1JB1A 1SBYA 2BYTA 3DVRX 3K0BA 1N1EA 4KPGA 3PL1A 2AEEA 3U40A 5J59A 4FHEA 4HYEA 3UN1A 1QVRA 2O5VA 3IDQA 1AKTA 3NWJA 4XH9B 2XGMA 3I2GA 1L3CA 2C5GA 2XWQA 5FLEX 1LSJA 2I71A 2V0CA 1CRQA 3CLTC 5KSWB 4K6GA 5CB4A 4Z49A 2ZB3A 1TDJA 2HJSA 2NUPA 4DG8A 5C5DA 1ZGCA 1ZUD1 4MDHA 4ZI2A 1NJGA 5L7WA 4F3NA 2W22A 3REQB 3KVYA 1PG0A 1SCJA 1UEIA 1YR2A 3GAFA 3Q3CA 4KUEA 4M36A 4UAVA 3RVDA 3O3OB 1W29A 3CCEB 5G40A 2VNHA 4LZWA 5DEIA 1EDOA 4MS3A 3FKQA 1YR8A 1JL3A 3GNLA 1E7MA 2B36A 3PENA 2FUG6 2W2LD 2HSWA 5JJKA 1CSEE 2GVZC 4N1AA 3F73A 1NIJA 1YNOA 4MWEA 4DMGA 1KQNA 3TSAA 2ZITA 2UZIR 4YLEA 4UEOA 1EMDA 3E27A 4KVAA 1PFQA 2O0HA 3QVXA 1GQFA 1YV9A 3PPYA 4O4LA 4DANA 4OQPA 1DC3A 2FN9A 2FZCA 1WULS 3RE1A 4HDAA 1E0JA 1UBMS 2E85A 5EJ9A 5F4JA 3K9HA 4Z6KA 2RC5A 1ZEMA 4Z99A 5BN3B 4R3NA 2OBFA 1V3VA 1NDUA 1PQYA 4XEHA 1NF3A 4Y9TA 3R6GA 3AL3A 1QFMA 2EJCA 5KYVA 1GPMA 5JUWA 1ETUA 3ESYA 1KBQA 3KU1A 4TMXA 1E9AA 5TB5A 3ZE9A 1OIVA 2IC5A 2X7JA 2Q21A 3TW0A 5ITZB 2LBPA 2Z43A 4FFRA 3PEFA 5ICEA 4G81A 5DIFA 3RR2A 3TVTA 1EVEA 3DZBA 3M9WA 3V8PA 1M2HA 2V74B 2WIKA 4RX1A 1L5KA 2VDVE 3DXYA 1FS4A 2V6IA 3OQVA 3EXFB 3QF4A 2AC4A 4XONA 4OP3A 4TLCA 3LUHA 2GVNA 1C9JA 2X9LA 4CM4B 3RTGA 5BOSB 3QVMA 1Q1BA 3U3XA 1H2AS 2V4UA 4FFLA 4WZAE 3GPDG 4LBZA 4Z4TA 1RJDA 4XM0A 3EWIA 5I7AA 4IWYA 4OH7A 4C7VA 3G89A 1JX6A 1OLXA 1X2BA 3GX1A 3WK6A 1I0LA 4FOLA 4HNUA 3GJXC 4E88A 2Q28A 1G4AE 2P2GA 1KXJA 5KSPA 4N8EA 5FL7A 2X8KA 3PQ6A 3UH1A 5K8VA 5DT2A 4L5AA 1VG9B 2OGWA 3IBYA 2FFQA 1MJFA 1JFLA 3ORQA 4Q02A 4YMWA 1P7VA 2YFQA 4Y2SA 2IUYA 4LCEA 4ZHQB 4DQ0A 1CDOA 2YWGA 1YBFA 3DNMA 1WNTA 4EFDA 1ATIA 1VYUA 2NXJA 2ZQZA 3BXXA 1VA5A 4LXHA 1WSVA 2FQYA 2LD4A 1XTIA 2HA0A 2J9FA 3IEIA 2IYQA 4ZHQF 2QRNA 5IN5A 3PYLA 4L9WA 4PYKA 3W5SA 4R7TA 2CLCX 1AGNA 3MWEB 4IVRA 1GUAA 2FZWA 2G80A 4OOVA 3NT5A 1IBLB 2JLRA 2LGJA 1LQUA 3N05A 4P6YA 8ATCA 5KWIA 3PNYA 3RJ5A 3GVLA 1GZUA 4KGXA 4ZU1X 1N6KA 3IEVA 1NB0A 1U5BB 3D8RA 2FCAA 3P4XA 4Z4ZA 4Y2HA 2HFKA 3OE7D 1JR4A 2HNBA 1WTHD 1JFVA 1C4OA 1Z4OA 2JPDA 4R2KA 3CKLA 1C80A 4XIGS 2VWQA 4H0FA 1DC6A 5E2IA 1NSTA 4DDUA 4K40A 1A1SA 4ZFNA 1M34E 1TVKA 3SLNA 1RBZA 1T3GA 4NMHA 1DINA 1W75A 1U7TA 2ZATA 3OQHA 1CULC 3TRKA 5BNWA 5EXEA 3IP1A 1U8AA 1HV8A 4PGGA 2ZVJA 1I4DD 1JQDA 2P79A 4G9EA 3SJAA 2VDMB 1KYTA 2IF2A 2XMGA 1GTJ1 4HUTA 1QFYA 4I99A 5B2FA 5GJBA 1ODJA 3HCBA 2CD9A 1KMMA 4MRMA 5GVSA 3D3EA 5KYGA 9LDBA 2AG0A 3LIPA 3A3NA 1Z22A 1NHWA 1SBCA 3EBOA 4UNSA 1G7SA 2GKGA 2CZGA 4CDRA 3JW8A 4RE5A 5PNTA 3WLHA 4YPOA 5JDIC 2Q9UA 3H94A 4TQGA 5A7GA 1HDIA 1P60A 2TMGA 5FNVF 4J0CA 3CP2A 3ENZA 2A6PA 3OIUA 4K2HA 3VJLA 5GOZA 5I3ZA 1Y0BA 3KKPA 3DCJA 3HL4A 3N70A 2AMLA 4DQDA 4JI1B 1IWOA 1PHPA 5LLSA 1J90A 1Z45A 1A8HA 3RHSA 3E35A 2WVJA 5C7IO 4UQPA 1PQ4A 1U04A 4J3JA 2BVNA 1U7UA 3GLHA 2UV8A 1OXXK 1K4MA 2CNWA 5CGZA 4C5BA 3HA5A 5TF4A 1LCIA 1UPXA 1IHUA 3EZGA 2M6SA 4LRUA 4U7GA 2HCBA 3LTNC 3WMXA 2CJXA 4I8DA 2NYUA 5KEIA 1R4NB 1GGNA 3EZLA 4JYAB 1VPTA 1U3GA 3IEXA 3SLRA 2BFDB 1KY5A 4CMAA 3DOUA 2AFRA 2HW8A 4AC9A 4LI0A 3UEOA 3BQJA 4RVGA 1ESMA 1NTRA 1JB9A 2F9LA 4B2PA 3QEJA 1U2DA 2QD5A 4JOCA 4FYMA 1AN0A 4MTCA 5FD8A 2R4UA 3ZWQA 4YALA 4IILA 4W9NC 3T51B 1RIFA 1VL8A 5GAJA 4ZDKA 4L7VA 4JSRA 3LPNA 1ZITA 3T4XA 5KUTA 5LWQA 3HWSA 1UP7A 5DM4A 3LT4A 4E22A 5BMVA 4DLYA 1E3TA 5AJVB 3THXA 1AURA 5IYPA 2HPZA 2QPOA 2XUKA 4RO0A 5E1BA 4QG7A 4Z4SA 2VPTA 3PT5A 4P4UA 3FDJA 4NULA 3BILA 4QWMA 4MP6A 2NO0A 3IKVA 4D97A 1KDPA 4REQA 2O2HA 1P44A 2HNKA 1JSZA 3Q2IA 4L4YA 3AEUB 3S8MA 4MAFA 2F1HA 2ZOSA 5CM8B 4CW7A 1KI3A 1I3LA 2W8BA 4OHBA 4DMFA 3PNOA 4MA0A 1WP9A 1SWWA 4GPZA 3E81A 4N7MA 4X84A 1IVYA 1DUIA 3QEMB 4LAFA 3RANA 4YEJA 1YCDA 3A2MA 4XDZA 5CAEB 1H93A 1XF9A 4EJ6A 2VQ3A 1MD9A 1NUPA 4TS4A 1DSSG 3H83A 5BSTA 3HPRA 5DBFA 4V3CA 3BSFA 2IP4A 1F3LA 3ZJYA 4D6PA 4DMKA 4EG7A 2J59A 1T9BA 1W36C 4B7CA 3TH5A 1P8JA 1MENA 3CPJB 2W2NA 3TXAA 3UUGA 4KUHA 2ZSKA 1JAZA 1LS1A 2HMYB 4X6XA 4KPFC 1MMFB 4LYYA 5K6TA 3GRYA 2P62A 1NW6A 5TRTA 5EQDA 2BM1A 1P3DA 3H5OA 4LMAA 4WN9B 4Q9KA 2Z83A 4ENPA 1AXRA 4PBRA 1CDEA 3K8ZA 4AWBA 5HYVA 5FWXA 1P2TA 5KIAA 1E3ZA 5CFLA 4MRSA 1GPJA 2BGUA 3P4YA 1QCZA 3GIDA 1KVQA 3HTXA 3DBRB 5LPNA 3AOGA 4D8YA 1HF3A 1OILA 5CUQA 1QO0A 1MV5A 2H1RA 2V55B 1Z35A 4E1BA 1AE1A 5EL0A 5L3QA 4E70A 3B3QA 1G20B 1TOAA 2X6QA 4ZYYA 1VLQA 2VHXA 3NI2A 3ZE7A 3E6AA 2F3UA 3UXEA 5ARCA 2EP8A 3D7NA 1PW7A 1SQ0A 1U8YA 3GQBB 4OX9Y 5BYJA 3OJ0A 5DSTA 3V48A 1C3VA 2AZXA 4PSAA 1P7YA 5BVHA 2QPTA 1ESEA 5LQMA 1CVLA 4JXJA 2HU8A 2A9JA 4N3NA 4MQEA 5FA6A 1MO3A 2OXCA 1EI9A 3AGQA 1TQ8A 4OSPA 3T1OA 3HJBA 1QVFB 2WVGA 3KTFA 3L6BA 3Q6MA 5EKSA 3RIXA 5HIKA 4P84A 2C82A 2RIPA 3RB8A 3RIMA 1DQRA 4HF7A 4TV9B 1T34A 2YVKA 3VR2A 4GUDA 4L8LA 3HWX1 4MVYA 5CPFA 1TU4A 4S3MA 4N0QA 2VRCD 4ZQHA 2VJYA 5HJ5A 4JI5B 4TV9F 1PJ2A 4ND2A 1KK3A 2DUWA 1IONA 4QSMA 3QXXA 1HLPA 2HHJA 1DQSA 3VNUA 1B4DA 2CHFA 3GEMA 3IR7A 3EEYA 4JVSB 4E13A 3UV3A 1PEYA 2RCNA 3DL4A 3R6KA 4TTIA 3GJ6A 1T8SA 5DGXA 2BFWA 5EQFA 3KU4A 5DW0A 1F38A 1XZIA 4ND4A 3K32A 1ZGZA 1M5RA 2IUTA 4ILEA 3NHUA 1B3RA 1WOOA 3WIBA 5GV7A 4C7OB 1XAJA 1V8PA 4DNTB 1VJ1A 4O29A 5DNAA 3ZW9A 4EQ6B 3GDHA 4FZ3A 4CV2A 1LSOA 1RQPA 2XTAA 1R5OA 4RZ3A 1GSAA 5DCYA 5AOVA 1R7RA 1HT0A 1D5CA 1RWVA 2R8YA 3H4IA 3LCJA 1QP4A 421PA 1RCFA 4CDNA 3GLIE 3NBYC 1TM3E 4IDHA 1AKMA 2ZRBA 3AF3A 2WILA 4KQKA 3Q9SA 2MOKA 1NVVR 4EEZA 5AW3A 3JYOA 1NNUA 2ZYUX 3RREA 3KZOA 2HRZA 4QZVA 3W3ZB 4RA9A 4QU9A 3VR1A 1UJ2A 4Y0AA 4KXFB 1R6UA 3DAFA 4PRKA 1UKAA 2BFBB 2HM7A 2JFOA 3DBHB 4IDPA 4U7HA 4EYGA 1SOVA 1Y48E 2XPCA 4PHHA 2VIIA 3UGTA 1GRVA 3X1XA 1N08A 3Q8KA 5LCXA 3HK2A 2Y0DA 4MHTA 2Q6TA 2W2MA 5AJWA 4MGYR 4C03A 1CY4A 2QT9A 2ZJ6A 4P3PA 4X92A 2PRZA 3BCDA 1CZNA 1XHEA 2RGWA 4MAMA 3AP2A 4Q7EA 4U00A 4NBWA 1DWQA 1QHFA 5KJ1A 4PW0A 5H16A 4Q18A 2I65A 5TC4A 3OKXA 5HCUA 4L02A 4PABA 1AF7A 1SHKA 5FXMA 1G8AA 2FVGA 4OHZA 5ILOA 4DR2B 1K7SN 1IJEA 1DRKA 2ZP1A 1NVDA 4TN5A 4Q4AA 1OE0A 2VDKB 5LKRA 1YVPA 3REOA 1MX1A 2B2XA 2Q2WA 5HIMA 4W5WA 1WXEA 4H0CA 3IELA 2WJJA 5T41A 4I1OA 4P4NA 3RYTC 4CDGA 4EFMA 2YWFA 2DPGA 2J30A 2JGNA 3HY4A 3RWOA 3ZCRA 2F3QA 1H94A 4YCNA 3U3DA 1UJ4A 2O3RA 3U4HA 4DCSA 3FSEA 5LU8A 5EEGA 3V32A 4KYVA 1BCRA 1KBZA 2AOTB 1HLGA 4XTRA 1J09A 1T0HB 1NG1A 1XQ6A 2XEXA 4IDQA 4NOJA 5BO5A 1W9HA 4MV5A 2JASA 3EVDA 2E5WA 4TL6A 1EXDA 3O4RA 3M2PA 2Q2OA 1TO6A 2VSQA 4B2LA 4Q9IA 5CNIA 1DUVG 2D9RA 2H65A 4ZCRA 2BEWB 3GN2A 2H9AA 1UUFA 2AKEA 3TLYA 1B8OA 1M1YB 1QFXA 1SEPA 2W2TA 3R5SA 1TYEB 1YJ5A 2XQKA 4CVNA 1HKHA 3HB7A 3SEAA 3FBGA 1BU8A 5IJ0A 5GY7A 2V7GA 4G1EB 2YN4A 2XXAB 3UY4A 4G0XA 3K71B 4QBIA 4ER5A 2AB0A 1S6YA 3AQ4A 1SU4A 5G0WA 2J3KA 3WHLA 5DM60 4OP7A 4ZK2A 1NVGA 1UBCA 1LX6A 1CJCA 4X91A 3P4UA 3LLVA 3I76A 2VNIA 2ZR0A 3L9XA 4DIKA 1JWLA 1T1RA 1FFYA 2R6JA 1TUBA 5DDIP 1CYDA 5DHQA 3ICPA 3AHDA 2D4AA 3VM6A 3T3HA 3ZJTA 1S7CA 3FGNA 1TTQB 1ODIA 3FTDA 1Q0SA 2WNHA 3Q3JB 3K6SA 2NIPA 5AVKA 4FFBA 4I0WB 2V7PA 2VEDA 1GNSA 2CLKB 1MIOA 4URYR 4RD2A 2R7KA 1GU7A 2YZMA 1EG7A 1V8OA 3RVSA 3DNPA 1DAIA 3MCTA 3PQCA 5H0IA 3T99A 3UW1A 4NX2A 1AHIA 3TK1A 3OEHA 2XMPA 4CQLA 2FF5A 4M9QA 5B58T 2I1QA 3CB4A 1G5HA 1PBTA 3ZBPA 1E0SA 1H1LA 3MPUA 4GYYA 2FEWB 2PJUA 3FDIA 1UADA 3SQOA 3TKLA 2RIRA 3QY0A 2Y1LA 4JI4B 5DSXA 4A6EA 5DHRA 5JCJA 3O3NB 2NPIA 3OSUA 4YDSA 3SLKA 1XZCA 4ZJZA 3M8KA 2ZWAA 3U6BA 3WLLA 4G4IA 3BRCA 2F8LA 3H04A 5L95A 2REQB 4F5DA 1JKMA 2Q3HA 3FTCA 2ECFA 3QELB 3H87A 5F5NA 4DIBA 1WEKA 1WKCA 2DEUA 1EXNA 1TZKA 1XA3A 2Y1XA 3FDZA 2WD7B 1V41E 1WCIB 4X1KA 3TFOA 2XUZA 4L2IB 4H15A 5C5CA 1AGXA 4OFZA 5FLYA 3N0WA 4KXNA 2IDMA 4DCTA 2G5GX 2IYRA 3FCCA 3IP5A 3E3LA 4RCVA 2ZJ4A 4MQBA 1LLCA 2V7QD 3FPBA 3VI4B 3Q40A 4BV3A 1AB5A 3B8EA 3MRVA 1AMNA 2XB2A 3LT1A 1YK1A 2E4YA 2YCLA 5J5VA 2XTMA 1QHEA 5DKFA 3PXCX 4F4CA 2QYTA 4OG2A 1SZPA 1ZXXA 4ERXA 1FW6A 1FP4B 2EW8A 5E9JA 3B5JA 2C7GA 2ZKIA 1JLMA 2WUFA 1EINA 3BF7A 2RHWA 3CE6A 3L7MA 4FCTA 4LHYA 2LNDA 4OGWA 3VNQA 4ML3A 2FA9A 6AT1A 3I9V6 4OAOA 1PJ5A 1KSJA 2HBZA 3AUUA 2QPAA 2WU1A 1E9SA 2HREA 2PSJA 3OMWA 4IDEA 4XOUA 3RS5A 2AOWA 3IP8A 1Z9BA 3UK2A 4OIMA 5ADHA 2O6LA 2R6CA 3FTPA 4KNVA 5K8CA 1U4NA 1Y3DE 1WCV1 1DARA 3Q72A 2ERYA 4U8GA 1X2EA 1XYGA 3ANNA 3WWOA 4PNPA 2EZUA 1OKKD 1G5FA 3WO1A 1XT6A 3GZNA 3RS3A 3Q9NA 4P2BA 3FVWA 2HV9A 1MB0A 5B30A 4R31A 1XZAA 1U1FA 2FUG1 2R00A 4K88A 4MWZA 2V7EA 1JI0A 3KVNA 1J9ZA 5HZGA 2JJ1D 2Z2XA 1O0CA 5INTA 2H7XA 4DV4B 1ZK4A 3VISA 4K6KA 2ABWA 3CW8X 2RG1A 3BTOA 1PD0A 3O2SB 3GFFA 1H05A 1XPOA 3U7QB 4BV8A 1NRKA 4PC1A 3HUUA 1NXQA 3LQ1A 4F11A 2AQ8A 2P3LA 3ZGNA 4XARA 3KAKA 3UAYA 4WCDA 4F8JA 3PLAE 4XX0A 2CB0A 3ZI0A 1E2HA 1GA4A 2GS9A 2JI8A 1CHDA 1YGPA 2FE4A 1L5WA 2A94A 5GPBA 2XBMA 3NAGA 3QKSB 2GRUA 3E2PA 3LT0A 4TS9A 4DC9A 1DJMA 1KHTA 5ERYA 3Q5DA 3L7YA 4EZEA 1I7PA 3RYCB 2W2PA 3EEFA 5DRYA 1RLTA 3NHJA 2EL7A 2C4WA 2EJTA 2CBXA 1P2GA 3RLFA 4R1LA 1Z68A 4BO9A 5FX2A 5E6RA 2E1BA 2I4OA 2QZPA 4V0QA 1L7MA 2NZJA 2VBVA 2Z9DA 3LOPA 4H3VA 1Z4QA 4CKEA 1VC2A 4GOOD 5HCNA 1TO2E 1X86B 3GWGA 4OATA 3JVEA 4XSVA 2IE8A 2O8EA 4OO3A 5AVUA 3WG9A 1GHTA 1PZXA 3M49A 3MRSA 4HWSA 1CUXA 1CQJB 1D4FA 3AB8A 3R3ZA 1VI2A 5EXSA 2WLSA 2GEFA 1WMAA 2I99A 4BNWA 3PV0A 4MLDA 1EFRD 3EA4A 3PWSA 3CZMA 4DDHA 1P5FA 3WJ7A 1LUAA 1XL0A 3W2EA 1NKSA 2BSXA 1K9MD 3GNQA 3WK4A 4A0QA 2DR2A 3H6KA 4LWOA 4TZ0A 3W1WA 4OQNA 4NZMA 3PITA 1MTZA 1SVOA 3CIOA 4ZQBA 4XVUA 1M90D 1OWMA 5E4YA 3KR0A 4BJ5A 3EGOA 4F04A 5BWMA 4JJFA 5G41A 4L3WA 3VI3B 1JLRA 6REQB 1GRCA 1OX6A 1EWRA 4P7BA 5I47A 1U0SY 2JFWA 1EHIA 3CBGA 4YAUA 2IYWA 1H2FA 2QL9A 3TMAA 4ZYLA 4C22A 3BIJA 1RPNA 3BTVA 3CLKA 1MX5A 1N2XA 2FEOA 2A0FA 1MA0A 1I8TA 3PA2A 1DAPA 4MKRA 3V7NA 4KLNA 1GU0A 1DEKA 4IMIB 4JFAA 3JR7A 5AJHA 3ZWOA 1PL8A 3B1XA 2KMLA 1CP3A 1ZS9A 1DC5A 2IFTA 2GARA 3HQ4O 3O82A 5J2TB 5T4BA 1W7AA 2IU0A 5I8ZA 4Z3DA 3TMKA 1RAIA 1AV7A 2IDKA 2Q4EA 3BWVA 3QNWA 4ZOEA 3A35A 4P3YA 2H18A 3A70A 3HXMA 1ZU4A 5J2TF 4ETIA 5HQ3B 1N0WA 4GRIA 2IXFA 1CJVC 3MTJA 1JJAA 2BZ1A 3ICQB 1X7DA 3JQAB 3QLEA 3EGXA 5AH0A 1OY1A 1Y80A 1SVSA 2AZMA 2FG5A 1JSCA 3INRA 5AR1A 5BUQA 2DULA 3KETA 4U6NA 1OF1A 4ZO8A 5KO2A 1PG5A 2AXPA 2VZ9A 3A3PA 3PLRA 4UFPA 2X8BA 4Q9DA 5FIUA 1J42A 1PR0A 1P1RA 3C39A 2I4MA 3KE9A 2YW9A 1JIJA 3TD6A 4B5KA 2QBYB 5EJGA 4B3GA 3GAAA 5GP1A 4AY5A 4J94A 3COWA 4E3WA 5JZBA 1NVUQ 1YHNA 1H2HA 1NBHA 2FEAA 2WTBA 2Y68A 2H1SA 3HEAA 4H4EA 4TL7A 3GWZA 3E1GA 3TZQA 3TLMA 3L6DA 4JEMA 1V11A 4QUIA 3OIVA 5SYNA 5BUSA 5H4GA 1Z0IA 3V1NA 1D6JA 1U9ZA 3H42B 2W93A 1U9JA 3ZY6A 2VO1A 1KZ4A 4FHZA 1O2DA 1TGYA 1CETA 5F7OA 3B82A 1DE0A 3ZHUA 3A4MA 3CZ9A 1NVEA 3PD1A 2H2FA 3ROQA 3JQ7A 3DE0X 5ABPA 2VSFA 3Q88A 4W5TA 2XT0A 3A4NA 4UHCA 2ZI6A 4GPIB 7ADHA 5E2BA 5DNDA 1OUMA 4WIAA 4RW0A 4K26A 1Z12A 2JZCA 5LNK6 4GXNA 3HY3A 5DI3B 5B2ZA 2KBEA 3L7BA 1F12A 1JHMA 1NONA 1ZH4A 4R71A 2P6MA 2PYZA 3ONEA 5K4AA 5M3BA 5EJ7A 3LVRE 2GCNA 5BR1A 5D01A 2ATXA 3JYQA 1IBRA 4A03A 1A5TA 4W7SA 1PZEA 3C5EA 1JIUA 1N5JA 3LY9A 4H3HB 3UYLA 4AT1A 1EIWA 1HE8B 1KAQA 4G0QA 3JD1A 1W0JD 5ED4A 4RD0A 1EGQA 2I2DA 4Y2XA 2BUAA 2WNSA 2HPHA 5FI3A 3RS2A 4FR0A 4MEJA 4ZDIA 3QVUA 4IINA 2G09A 4BRSA 4OHXA 5T5QA 1P75A 5J1TB 5L6LB 3QOWA 1GPWB 3DT6A 3E61A 4Y6QA 3ZK7A 1A97A 1RDFA 3BWYA 1L8XA 2GPYA 3OQIA 2JFQA 2CY0A 3EFEA 2VYCA 5BV1A 2ZSFA 1UXIA 1CNFA 2ZAMA 3F90A 5J58A 5TNXA 1U1CA 1RLJA 1U28A 2GLUA 3MTGA 4KK3A 4S24A 3VOTA 3W5JA 4EECA 1R9GA 3U26A 5I45A 3N28A 3WKEA 3WNQA 4MKIA 3C3MA 3ED5A 4BUCA 3BGSA 3KLMX 4F6LA 3EK2A 2IK8A 3OFND 1MFPA 1V3QE 2P9QA 4B48A 4MPTA 5K5EA 3G0IA 2JFNA 2LTAA 2GDJA 1S2DA 2I5PO 4JKOA 4WINA 4CHGA 2HRQA 3C87A 4EJSB 4M1SA 3HM2A 5L4LA 2QE7D 5HTOA 4KRFA 1DDOA 2LDXA 4L95C 2W2KB 3PHGA 3GVCA 1Z6ZA 4JWTA 1UDRA 3EARA 4JB0A 5CD9A 1JEQB 3OEEA 3LBFA 1HXHA 3T61A 4W4TA 3TX2A 4AXBA 2HU5A 3HDTA 4ZGWA 2AN4A 1J9EA 3JAWB 2N9UA 3NC0C 1RLOA 1XR3A 4FMBB 1HE3A 2O8DB 2B4TO 2D74A 3PNQA 4JVMA 1MAWA 3G1TA 3O84A 1OD6A 3GVXA 1V1RA 5EZ6B 1ESCA 4DPKA 4Y9RA 1YE3A 3UJ8A 2H52A 5EKTA 1ADCA 4OHFA 3PFWO 3I5XA 1AZSC 4BNVA 2B69A 4MUGA 4G41A 1PJ7A 3TD9A 4DR4B 3OH8A 5ALKA 1K5HA 3ZZUA 3QJYA 2F1KA 3ZHYA 1M6VB 1PVVA 4LXXA 4ZVRA 1KMCA 3IR6A 4FQ5A 4LYDA 5DCUA 4CN8A 4TMZA 4EFLA 4ZCTA 1EFVB 4EYEA 3AG5A 5E0OA 1NP3A 3W90A 2B78A 2WU8A 2ZU6A 3PPWA 3PT9A 1Z2AA 3SDSA 1K88A 2O57A 3KPJA 4DYDA 4IX1A 2JHFA 4I81A 3Q38A 3C0KA 3TI9A 3ADPA 5KPDA 13PKA 2W5UA 4G4JA 4Q4JB 1MUUA 4JD5A 5I9NA 2VOJA 4CLRB 1ZJ4A 2FPKA 1GV1A 1DC8A 5IYQA 4KX5A 4KV9A 2OB1A 2P2LA 2OK8A 3EDYA 3KHSA 1ZZGA 3QQPA 2JFFA 3GV0A 4MP8A 2OESA 1EGAA 4GOLD 4HDMB 4X20B 3R5HA 5DYWA 3PQ3A 5JPDA 2W2QA 3GELA 1AOXA 3QX9A 5JSUA 3HM9A 3YASA 3NIDB 1E1YA 4JA0A 2CDCA 1QK3A 4Z9BA 3OE5A 4KJZA 1RZ3A 1YL6A 2Q5IA 2V98A 1ZOPA 4YNBA 3B5EA 3A26A 3CNBA 4NBTA 2O4CA 3QKIA 1BKYA 1G8PA 4FWBA 4NV3A 5TDHA 2P41A 3I92A 1YZKA 2Y66A 1TA0A 4X7BA 1URPA 4YPFA 3DBLB 5C81A 1N7HA 2EU8A 4KHPB 2BAGA 5EJ2A 2R44A 4HDCA 1AQIA 4MW7A 1C2TA 4LY3A 5IBQA 1AUVA 1SQGA 1QHNA 4M49A 2QNRA 5IC6A 1SC4A 3VU1A 4B82A 1HTWA 5FDFA 3I64A 4HWGA 3WZMA 4OUKX 4TTPA 3FJOA 2VDJA 3QSYA 1WHSB 1HE4A 3FCSB 1WU7A 3G8AA 3NORA 4QOHA 1IRIA 2Q2VA 3SS9X 4DMLA 3QYPA 4X6UA 3AI3A 1JDTA 2HGZA 2JIBA 3DE5X 3GCDA 1GPNA 2PX2A 1DS6A 1OGJA 4FGSA 1QTQA 2Q6LA 3EZYA 3HXPA 4GQAA 1NFFA 1NXXA 4BX9A 1L7PA 4BVKA 1W48A 1YBVA 2OQRA 4RJTA 2Z2JA 2ZETA 4FDMA 1R0CA 2WM9B 3WE7A 3I2HA 1II8B 3X43A 5IULC 4P4SB 2H51A 3DLTA 5KOIA 4NE9A 2JH3A 1CC1S 3HJGA 4ATNA 4RTSA 4IIEA 3BAZA 4QYMA 3MTQA 1RXUA 1LPMA 4CV1A 4LF6B 2FKAA 5AXBA 1U2QA 3DMRA 3EUWA 3H99A 5JAMA 2PLFA 1PV2A 1NVXQ 3Q6IA 1GR1A 3WWYA 4B71A 3RVJA 4D0RA 3IOMA 2OORA 5JW6A 3OTWA 4YRJA 1XZBA 1HQCA 1TYZA 2J7PA 1VJSA 3PD0A 4HXYA 2Z8YM 4NU0A 5F1PA 4DCOA 2DECA 4BOYA 5T4FA 2J0UB 4BTLA 1UDAA 2AC2A 1XJQA 2NYVA 3WDKA 2WR8A 2GD0A 3PX7A 3PGJA 4XIYA 4ZCIA 3V6MA 5E6SB 1Y33E 3V2UA 4RPKA 1O9BA 4L07A 5JECA 2OV2A 1XQ9A 5KYXB 1YKFA 1VSBA 3S27A 2PCJA 4X24A 3VYWA 4IG4A 2AG5A 3ZW8A 2X0JA 1P5ZB 2HXGA 2YWBA 2H92A 4J1SA 4D3FA 3NDJA 3VDXA 1RBYA 5IF3A 4XCQA 1UK6A 4JKYA 4JI6B 3IQDB 3SC6A 1SA0A 2X9QA 1SXJE 2CUKA 4RQTA 3VR4A 3E1KA 3A25A 3RFCA 3UUWA 4KE7A 4X7EA 2CNWD 3G3EA 2ONKA 4ZAWA 2CFOA 1YFZA 4TQ9A 1PKVA 4N65A 1UR5A 3I28A 4D6YA 1T10A 2ZUTA 4JLVA 2NZXA 3D6MA 1RTTA 1Y63A 4M99A 4OXQA 3L0IB 3LUAA 5IKPA 5CXQA 1M8FA 5IWCA 4YMHA 2O54A 1ZJWA 2O7RA 3W4JA 4Z9FA 4EUEA 1DI0A 1BMTA 2GJAA 3MWFA 3NYIA 3NP9A 4F2HA 5JS7A 1R4ZA 3VHQA 1WXIA 4PINA 3U37A 3ZCQA 5E6UA 1IZ0A 1MQ8B 3P26A 4HWRA 4LECA 2IYYA 2ZXFA 4D44A 5KWEA 2XUQA 2OBYA 4RJJA 1WDKA 4ETWA 1A8IA 1ZBQA 3R3JA 2F9MA 4JBYA 1NF9A 4O63O 2ODQA 2OA0A 3RCBA 3CE9A 5BWCA 5GTDA 3UJHA 4FI3F 1XE3A 2FRVA 2VC2B 4MUAA 2OHXA 2RAUA 2VTBA 4RJ2A 3QU7A 4FM9A 2CUTA 1A9ZA 2IZ7A 3OOYA 4OHCA 4QFBA 1BDBA 3BCSA 2WJZB 2YV1A 2Q5EA 3TIIA 1ZGBA 2IODA 5BVGA 5CBPB 5JQGB 1SU6A 3HA3A 1JQAA 2QTLA 3DV2A 3N2EA 4P83A 4PQRA 1V37A 3RRZA 3ZQ4A 1KQPA 2QN8A 1VSUA 3IYLW 4K7JA 5JQGF 2R1TA 4QV2A 1E1DA 3BSYA 2XNCA 3JRWA 1CJBA 4Q1FA 2AKAB 4IH1A 2HHLA 4RIHA 5CDGA 3NQ41 3HNPA 4GBGA 1QHIA 3N2NA 5DYTA 3K5PA 3AFGA 1JU4A 4LZPA 4L6CA 3BKWA 4YDHB 3UT5B 1TGVA 3WVNA 4EA9A 1RXCA 3CKMA 3KPVA 4EGCB 3I32A 2PANA 5ER9A 1K4KA 1GL9B 1OZHA 4OI1A 2EJWA 3ZK8A 2F1MA 2CF4A 3FF4A 4QU5A 3VH1A 2CHQA 3EAFA 3EGDA 3NDBB 4V0LA 1G98A 3SJZA 1A88A 2H07A 1MW9X 4WXMA 1KZHA 3JYPA 3VYTB 3CKYA 4OJMX 1JPVA 5AT1A 3WB9A 1U2GA 2VJAA 2W6ID 3FKJA 3BMXA 2UYHA 2BMVA 3WDLA 3HNOA 3WGJA 2GPAA 4MRVA 1XD9A 4FEEA 1YQGA 2ZBPA 2GYUA 2XGOA 1B6SA 1Z56C 5SY4A 3PS9A 4WL0A 1AK1A 4WZAA 3R0XA 3U44A 4Y9SA 3C24A 3PRKE 1N4DA 2OAP1 4MB6A 4C4XA 4E5MA 1IPHA 4BVAA 2WTXA 1KH3A 5E6TA 4Z86A 4MW4A 5C53B 5LJLA 2I7XA 1UM9A 3ZU5A 2I3GA 3AVQA 3GCWA 3OO0A 5D3KA 1M2GA 1N3LA 4V3BA 3ZLJA 1Z26A 5HX7A 5I9BA 4ND3A 1W30A 121PA 4ENVA 1C14A 1TLFA 3AUFA 4CTJA 5ALUA 3OZUA 2H2DA 5LYJA 3TQTA 2IU6A 1DKMA 5BSXA 2AVDA 1NJ1A 1TQHA 1G9XA 2R65A 2YWJA 4RJLA 2FPIB 2ZJ3A 2JIZD 1I33A 3L02A 5KKAA 3LVFO 1NM5A 1KK0A 1L5VA 3AJEA 4NNOA 2WE8A 3ZE1B 2OCYC 3LUCA 3NANA 4HS4A 4UNQA 3BN3A 1HO3A 4CMIA 3NTRA 4K6HA 1OAOA 3Q6NA 5LWHA 2G4VA 2AXQA 3ZLUA 2VDWA 5JMWA 3S81A 1FTQA 2GEJA 1E66A 3ED1A 2G9RA 4IKOA 4BVEA 2BEUB 5BN4A 3Q0EA 1COZA 4PLFA 2OVBA 2A9PA 1JDPA 1SOUA 1W2BB 1LPOA 1QRUA 3JZIA 1N2GA 1R5NA 1CUZA 4PLVA 4TYPA 1UJNA 2A9OA 4NF2A 3WIDA 3I3OA 3IKTA 3SQXA 5FO1A 1U1GA 3BOSA 1B93A 4ITUA 5C0OE 1M34A 5IKXA 3ASUA 3CX6A 3RFTA 3ZLVA 2D0OB 4OREX 1GGFA 3MJDA 1A50B 2YJ4A 3BXGA 1ISHA 3L6CA 4GYKA 4EX7A 1PRYA 1DIAA 2OWDA 3IMEA 1G59A 2NNWB 1IDN1 3KJZA 3THWA 3TLEA 3NX4A 3M2TA 3EOZA 3ZGZA 1XZJA 1WJGA 2WJAA 3CLHA 4GQBA 4KDRA 5JXHA 4YGXB 3KFVA 3JZDA 1YCGA 3N74A 4FZ5A 3LQQA 1S2NA 1AS3A 4LDPA 3AHHA 4A2QA 1I2AA 4HWPA 1W35A 2OUKA 1KVTA 1XQBA 1VJCA 2XDQB 2QP4A 2HL6A 1LDBA 1E5VA 2XVAA 1ZOOA 3Q11A 3K3PA 3U4CA 2WWVD 1S1CA 1Z06A 1P0QA 3HGMA 3JQ9C 3MWYW 4OL9A 3TXXA 5CIYA 2DFLA 3IJEB 3SVTA 3NP7A 2FEMA 4Z4YA 2DFPA 3PPIA 4K1XA 4KU4A 5K3SA 1UWLA 3EAQA 2QIOA 2DOGA 4MMXB 3QV1A 1EGHA 3D6TB 1NI4B 1W44A 2OO5A 3I9NA 2OCLA 4EBBA 5JR3A 4UM7A 5K20A 3PVSA 3O3CA 2E55A 2ZVDA 2FI1A 5TRDA 4MKGA 4DLRA 3U6KA 1DJLA 1EQUA 1K75A 2IOHA 4ZYWA 4V0ME 2H1WA 1R8SA 5AXCA 3OP1A 2QAJA 5K8TA 4HRVA 2CK3D 1FFSA 3FZNA 2WICA 2QGGA 3C8DA 3SQLA 4YUVA 1O8BA 4Q1BA 2ODWA 1U8UA 2QP9X 1JN0A 3GY0A 2DFKB 4JBHA 4UDOA 1XNJA 1F2UA 3RYFA 6PFKA 1UC8A 4CKBA 2X6WA 4EY3A 2HLDA 4X0CA 1H2WA 1PFUA 1N1MA 1ZH6A 2HWUA 3DOFA 3ETJA 3ESCA 5KTKA 3F5QA 3SF0A 5JEEA 3ZZNA 4GL4A 4LEIA 3QPBA 1S4MA 4YHBA 1BWSA 2W43A 1XCMA 4FT2A 1KDYA 4E1AA 4EI2A 4M1WA 2IBMA 3FMIA 3I5YA 4CTNA 1VE9A 1PV4A 1NMXA 1T3ZA 4MPJA 3E9NA 4BIIA 2A9VA 1YITB 1CZHA 4CEIA 1JBQA 4ZZIA 5NLLA 2HSZA 2QR5A 4AJ4A 1PJCA 3ER8A 4CIDA 2ZS7A 2R00C 2C8VA 3HB0A 5B6IA 4YRCA 1O5TA 3OJEA 4K46A 3VTZA 4CQNA 1ZIDA 16PKA 3UNXA 5A4MS 1G6KA 1P91A 3NEJA 1XMSA 2DP4E 3NE5B 2IOFK 2A4KA 1QTRA 3AFOA 3D31A 4AFNA 3DVQX 4IEIA 2EGUA 3A9SA 1Y8CA 2QAIA 4ZOLA 1DG3A 1XK7A 4DV6B 1KZGB 4RHTA 3O8DA 4H9GA 1JKIA 5A3RA 4OLBA 2NSLA 2FSUA 2I7DA 3O9MA 3JD0A 4CETA 4DLWA 4D26A 2VJQA 4TWBA 3BC1A 5HF6A 4Z4EA 2Z5FA 4OP1A 5IP5A 1YRHA 1BW9A 1K0UA 3IJ5A 3RK1A 1SVUA 2GBCA 3AY7A 3PKJA 2JLBA 4KXXA 3DT8A 1KP9A 2V5UA 4PLWA 4IO0A 5B6PA 4ND5A 1RWMA 4LC0A 1QZTA 1SD2A 2I8LA 3E84A 3FMVA 4Z0NA 2B6HA 2BHNA 2VT6A 2BLNA 1Y3BE 1T6XA 2JAPA 6Q21A 5IH7A 2QLBA 3OECA 3VSDA 3OEHD 2VF2A 5FB3A 1BCSA 1YHYA 2C59A 5EESA 5FBWB 5IFKA 2W58A 1V6AA 4UTXA 4ASUA 3GFPA 3TUJC 4DOMA 1XFOA 4ZGQB 1Q1NA 2QRUA 3CNEA 4KR9A 3OX2A 1R9JA 1D4AA 5G1OA 1H8EA 2BOVA 3CLVA 3GUVA 1IPEA 3FVTA 3SF8A 3GNTA 4LJ9A 2C3OA 3TR5A 4RDLA 5JCJD 2QTZA 1WRBA 2J5KA 3U7HB 3ZLBA 3HO6A 1UANA 4XMYA 5BSHA 3VGJA 4EB6A 4F84A 1Y1RA 4AP5A 1WZUA 2GD2A 3C5HA 3F5DA 3SE0A 3H1BA 5JYDA 5TJ9A 1ZNZA 1L7DA 2E4WA 3EVEA 4QYXA 4H7JA 3SM3A 1ND6A 2JANA 3UGKA 3GRAA 4UEQA 3VU0A 3KSAC 2DBZA 2WTAA 1KKUA 1MC4A 1P17A 3EF0A 3OWXA 3HYNA 4R4JA 5K8UA 1H2BA 1M3SA 1VKZA 5FPYA 3QQ5A 5LNK1 3P5SA 2GZ1A 4KUGA 1FRFS 4MUJA 1I7SB 3ONDA 2WPDD 5CBKA 2SCUB 4GSLA 2FG6C 3ZI7A 4UUBA 4BFCA 5MHTA 1E96A 3T54A 2AMJA 3KELA 5FBKA 1CLEA 2FPWA 3SFVA 5AWFC 1OXKB 3L82B 2WWIA 3L18A 2F62A 3AXSA 1LRJA 2PZBA 4YAJA 1GADO 1PS8A 1YRLA 4RH1A 5A06A 2FEXA 5L4NA 3LUJA 1J2JA 4QYTA 1G5PA 3WIOA 5FHQA 1E6MA 2ECKA 4BMYA 1OA0A 1YIJB 1OA1A 2L0XA 2L19A 2Z3ZA 3HN2A 1XLTC 3KZNA 5EMLA 3V8QA 3N59A 2A3RA 5CDUA 3L7DA 4NENB 1DBPA 4YH1A 4C30A 2D5BA 2XKBA 1X7XA 5HJ7A 3OJOA 3W7BA 2W4QA 3HFSA 1G291 1PNRA 1CQIA 3AU9A 1HDCA 5DK4A 3FNIA 4GZLA 5FULA 4QUGA 3DP7A 5L8VA 2C2BA 4MVXA 1WP4A 3M6AA 1UJBA 2GZRA 4GW3A 5KHAA 4HI0E 5J5AA 4MS4A 4GT1A 4ZPJA 5IYRA 2A33A 3ZV3A 1M83A 2Y76A 3UZUA 3CD6B 4FYHA 1OFTA 5ELLA 5B1SA 5IDYA 2NO7A 2UKDA 4MW1A 1D0IA 4XB6B 3GLIA 4NR0A 2AJLI 5G4KA 1HOXA 1RYBA 1TFUA 5FPQA 2PVCA 3SEFA 1FTYA 3DWIA 1HFEL 2Q1YA 4HNSA 4BNZA 3EWSA 3HSYA 1EXVA 3VX4A 3ASSA 1PUJA 2Z57A 2RHGB 1OMOA 4G9BA 3P20A 4QLAA 3V7AA 1YHQB 2OHJA 2SKEA 2HEGA 1CKEA 4TWAA 1HE2A 3T3MB 2JAQA 3AYZB 3NRBA 3MJVA 1S7GA 3K6KA 4GR4A 5EQTA 3ND9A 2HWYA 2QSZA 1NPDA 2X22A 1CU1A 4BTVA 5E4JA 2CZCA 3R7FA 3FI0A 4R2IA 3EXG1 4DE5A 2P2DA 5IG2A 1SRRA 3F8WA 2XNJA 3EIWA 3GRVA 2VHTA 1D1TA 1MH1A 1MO4A 1VHTA 2K7ZA 4RFVA 1YIOA 1Y5MA 1Z6GA 2WT9A 2B8WA 2YRWA 3I73A 4JBGA 4AZ3A 3C7AA 4PPFA 5J1SB 3AM1A 2CNKA 3HBJA 3T56B 2QXTA 3JTMA 5IVIA 4HOYA 1HTBA 3PIRA 3FNFA 4RPDA 4YCDA 2H63A 1IXYA 1ZISA 5H83A 4C6HA 2UYCA 5EIOA 1YGYA 4RA6B 1IBKB 3AHCA 1E6WA 3C4QA 3L0OA 4UOZA 3ZBTA 3H1PA 2E0IA 2QQEA 2PL9A 1XVLA 4R98A 3OOJA 4ZN6A 1RP1A 2ATEA 1ICIA 9ABPA 1FXWA 221PA 2O6HA 3DPUA 4ITRC 2YJ6A 5D5PA 4OMDA 1CNEA 1K27A 1U28C 3OTGA 5JNWA 1XELA 4UAJA 4N5IX 4R7ZA 2K6GA 1GSOA 1VQ7B 2C99A 4IQ8A 5G0TA 3WYGA 5JAIA 4NE7A 4M1YA 5KMGA 4YRNA 3JQ6A 4OQ4A 2DF8A 3WMRA 1YXMA 4RDIA 2ZJ7A 5K0ZA 3FYUA 1B6GA 3PQ2A 2W70A 1XRRA 5CJJA 1M6HA 2WIGA 3REQA 3EDQA 4L73A 1MU0A 4UPVA 4WOKA 3G5LA 3KJQA 2UXBB 4PCAA 1QU3A 1RI2A 3QVGB 5JTUA 1S8FA 3TSOA 1UBFA 2O0LA 3U31A 4AZWA 1G6Q1 1RC1A 5F5LA 4CL2A 4YIKA 1TU3A 1WOYA 3N8KA 1ISMA 4B84A 1NW3A 2PT6A 2YW2A 2QUIA 2ZBQA 1F4PA 2WJ6A 5JBIA 4Z53A 1I1NA 4B6FA 2RGUA 4JXXA 4D46A 3GW8A 2HI0A 1ZI8A 3WGGA 4KP7A 4U1RA 4JLOA 1MAUA 4M54A 2GPSA 3WHPA 2JAUA 4RMIA 3I39X 4XPZA 4PTLA 1YTUA 1R10A 4M87A 3N5KA 1U2PA 4L28A 3ERCA 1Z18A 2GESA 4RXMA 3TAHA 3TMYA 1HA3A 3KQWA 4JU9A 4QPNA 5K4GA 1JFTA 3GUHA 4QQFA 2ZJFA 2IOQA 3NEAA 4ZQEA 3DZCA 4DEXA 5BRNA 5CYFA 2A35A 4J76A 3E8SA 3IODA 2E1RA 2HBYA 4G37A 3WOHA 1A9PA 3HU1A 1IHYA 5ITZA 1E2UA 4LSMA 4YAKA 1BEEA 2JFXA 3KAJA 1LFDB 4Z1MD 3IEMA 1G7TA 1R0ZA 3AEQB 3FJYA 1AQNA 8ADHA 2RB4A 4US0R 1JEDA 1RACA 4KZKA 5BSRA 1DFHA 1NR1A 1GTSA 3EVZA 1YASA 3DKKA 4LOHA 1MAAA 2FFJA 2XR1A 2YINC 4IOMA 1WXHA 3LS2A 2QVZX 1U0FA 2OOSA 2CN1A 3T7SA 3MUOA 4RZHA 1ABFA 2J9XB 3ETEA 1IQRA 3LYLA 3REFA 1RSZA 3TTUA 1KOGA 1I4LD 1MB9A 3EAGA 2VJMB 1I3MA 3HDVA 4ZQIA 3HCWA 4YFYA 1SCBA 2AOUA 1ENZA 2I2CA 4GNRA 5IT4A 4W9MC 1EP2B 2RHJA 1DRWA 2AE2A 3JPYA 1ND5A 1QWSA 2B1RA 4TRMA 1L4GA 1YULA 4CQMB 3HGTA 2PUWA 1A9YA 4PYIA 5CFMA 3TVDA 5KSOA 1Z75A 2EW1A 5JNVA 2XLCA 2FPRA 1SZJG 4LRXA 2ZIXB 2IPOA 4J0GA 2Y2UA 1CV2A 4YMGA 2FFAA 5IS2A 4M9UA 4B17A 1TZBA 5JY1A 2VF8A 2RAVA 1U5BA 5DM0A 1UWVA 3RS9A 4CNQA 1RWNA 4PN7A 5IVDA 1QF6A 2R48A 2OZLA 1FNDA 2XQVA 5IAKA 1I3OA 2R66A 4BZWA 4AROA 5JS2A 4MAAA 1UMCB 2R1UA 3RU3A 1JDZA 3P19A 1OIXA 1B76A 3OUUA 1HDZA 3TWOA 4FNGA 2EWVA 4HB0A 4QDTA 1BDHA 3MBIA 3IA2A 3V6LA 5IJ9A 4FD2A 3U19A 4R51A 1TRHA 1ZUIA 5B37A 1JLSA 3AVUA 4TRRA 4BWVA 1UAYA 2OORC 1KYQA 2W6CX 1UKVY 3JYNA 3BL6A 2GBLA 3A1UA 5EN4A 5ALJA 2R6HA 3FOWA 3MWKA 4MHSA 4OXNA 1L4HA 2YMQA 4HWOA 4W5OA 1KMQA 1O6CA 4F5ZA 1C3OA 1I1HA 4BWYA 5FEUA 1RPZA 3F7TA 2AJBA 4D74A 4DR5B 3NHAA 3DE7X 2C2XA 3MIIA 4FCVA 1T8YA 2OAQ1 3QIVA 2VHYA 2GM5A 4Z4VA 4FHDA 4LY0A 1P61B 1X8XA 4MGKR 4AJNA 4D9JA 4F7DA 3CVVA 5KCMA 2PUHA 3N2GA 1YA6A 1WDTA 1YS7A 1AG9A 3VNRA 2X0KA 1P5JA 2QLFA 2X6XA 1A71A 1EEHA 3I8OA 5AUQA 4BECA 3VV2A 5LZ9A 4JYPA 4GE3A 1IOZA 3M1LA 1HYQA 1QO7A 4IIBA 3R7BA 4MV4A 2CHUA 3T5DA 2GTPA 5U9CA 4OQEA 4JBIA 2WU0A 4QUKA 2Z1DA 2J0SA 3E58A 4RLQA 4BAGA 1IPFA 5COBA 2BFAA 1OWOA 4LHEA 3HB1A 5BSMA 2D7JA 2JCBA 3JWGA 4DY6A 5C1BA 5K9ZA 4KPEC 1ABBA 1FFXB 2JD1A 2VVTA 3EIHA 3HB5X 4RIEA 3ELDA 5AOCA 5CEJA 3MZ0A 2RGGA 4N3BA 2G25A 1Y8QB 4E14A 1OWLA 1XE1A 1KEWA 2F59A 5EUMA 5H3HA 1OXVA 3SKXA 3CGGA 3U3ZA 1WY7A 3BIXA 3CN9A 3WLPA 4D9BA 4QBTA 4UAGA 4I4TB 3UJ6A 3M6LA 1IN8A 4IS3A 4C0HA 2E18A 1USKA 1DJQA 2R3SA 1D6SA 3JTEA 3FPJA 4LWQA 4XDYA 5K0GA 1N3IA 3H3XA 2O7VA 1VKRA 5JMTA 2IPXA 2ECQA 4FX5A 4I4TF 4MEAA 4TTAA 5ADUS 2MHCA 2CF5A 4P6VF 1ZN9A 2D2XA 2CKDA 3ZZMA 1G21E 3FRHA 1BU5A 3EOAI 1MLDA 1IY2A 4EHIA 3FRIA 3KJNA 1NN3A 2GXSA 3FYDA 1HDGO 1Z07A 3H4VA 5K3FB 4EHJA 2XMRA 1W581 4N0DA 4W1SA 4G1VA 3JQDA 3LW8A 5JDCA 4HTAA 4PG5A 5AM3A 2ZIUB 4J49A 1JW9B 3DGFC 3EQ2A 2M32A 3KQPA 5A9TA 1G63A 4DWJA 5KYYA 1VGQA 2WQ6A 2XW6A 1C9DB 1DP4A 1UJ6A 2FF7A 1I8DA 3U4DA 3CLUD 1CF4A 3NATA 4XI9A 1QF7A 4CM9A 3EY4A 3UC5A 1YAHA 3TW4A 1ZRSA 3F9IA 4DJAA 1C7IA 2PX6A 1HYEA 1O4WA 1V25A 1QGOA 1I6MA 3FVVA 1GGMA 4QUHA 3TXYA 4DLXA 3EG9B 4WLOA 1DAGA 4KCGA 3C98A 3A06A 4P5DA 1ISJA 1XSEA 3WTBA 3KYJB 4BYGA 2PV7A 3O83A 3OPNA 4UJ5A 4URVR 3QEMA 4IVPA 1DO0A 1DGQA 4B4OA 3AY0A 3N2LA 1UJMA 3LWZA 5LC1A 1QIHA 3UMSA 5HM8A 3RJZA 1DIGA 3O92A 5C5EA 4PPGA 1M1ZA 4Q0MA 4TSKA 3K70C 2DXIA 2D0DA 3ILXA 2XCIA 2GEDA 3HGQA 2CVHA 1TZMA 3K1YA 3LC1O 5CX1B 5F64A 3WP0A 1JR6A 3NBZC 3T5MA 1U2GC 4EARA 5CNJA 2FUEA 1NPYA 2VWHA 4FOPA 3IE0A 2ZRNA 4QRIA 1G4HA 4B4KA 3NDRA 1TJPB 4BXOA 2GFQA 2GCEA 3S0JA 3BA6A 4Q4LA 1J7JA 2QR3A 3KKNA 3ZZTA 1YONA 2NO6A 3F2VA 4FB5A 1UZAA 1XD2B 3GCZA 5F7ZA 1FX0B 3PUVA 1EB8A 1KYWA 2XDWA 4HP8A 3WAJA 1VQ8B 4PRZA 2IUFA 1L3BA 1R6VA 3M83A 3WL6A