1B2RA

Ferredoxin-nadp+ reductase (mutation: e 301 a)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN-NADP+ REDUCTASE)
publication title Structural basis of the catalytic role of Glu301 in Anabaena PCC 7119 ferredoxin-NADP+ reductase revealed by x-ray crystallography.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 92
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1b2rA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1b2rA02
4RD6A 3CB4A 1GJRA 1GR1A 1G7CA 2QEXB 2VNKA 1OB5A 2GQFA 2DERA 3OJXA 3CCUB 1YJWB 1F20A 2DY1A 4M53A 4RD3A 1N0VC 4N3GA 2HCJB 5TR9A 4N3NA 3WNBA 1KJZA 2QDXA 3QFTA 5GV7A 3ZBUA 1BX1A 1JNYA 3G71B 4AF6A 1D2EA 1TUIA 3LO8A 3CRZA 1YJNB 1FNDA 4YAWA 2DETA 1VQ6B 1FNCA 2B7BA 4LBYA 1KK2A 1GVHA 2BM1A 1CNFA 1FNBA 1QX4A 3W2EA 3AVXA 1BQEA 2VNJA 3VNVA 1ZM3A 1ZM4A 3LVBA 4RD4A 1G7TA 3CCVB 2QA4B 3U2QA 4Q7JB 1KK1A 1WDTA 1E62A 2BV3A 2R6HA 1VQLB 1GAWA 1U2RA 1XB2A 1E63A 3LYUA 1ZUNB 4YAFA 1FNMA 1Q86D 3SJZA 3CCJB 1AIPA 3U6KA 2HDNB 2DCUA 1YJ9B 1BX0A 3W5VA 4P3YA 3WNCA 3W5HA 2VYQA 2AHOA 1EP3B 4LC0A 2QTLA 1VQKB 1K73D 1F60A 2C78A 4UAJA 1W87A 3QE2A 3ES9A 1VQOB 4TMZA 1YI2B 1BJKA 2VZLA 3I55B 1QFZA 2QN6A 1CQXA 3CCLB 4ZV4A 4B4DA 1QG0A 4C43A 3OZUA 4ZCMA 1Q81D 1JA0A 4ZCLA 1FRQA 1D1NA 1JA1A 4IW3B 2X3UA 1QGAA 3WBJA 3VO2A 1Q82D 4B43A 3CC4B 3WBKA 1R5OA 4NBSA 3E1YE 1KK0A 3B78A 1JJ2B 4ZGQB 1EP2B 2QTZA 1H42A 3ZBTA 4PC6A 1G7RA 3W2GA 1QVGB 1ZM9A 3AVVA 3CD6B 3CMAB 3JQPA 5AN9A 1R5BA 4FN5A 4YALA 3VO1A 1YHQB 3QFCA 5TY0A 3CC2B 3W2FA 1B2RA 4FK8A 3OW2B 1W2BB 3AVTA 4RJLA 1EFUA 3CC7B 3P27A 2GPJA 1IJFA 4RCZA 4G5GA 2YWGA 5FA6A 3AVYA 1GO2A 3WYAA 3G6EB 2RC6A 3CMEB 3AGQA 1R5NA 4PC2A 1VQ4B 3QFSA 2BVNA 4ACAA 3U6BA 1FRNA 2E1RA 3ZC3A 1KQSB 4ACBA 2BSAA 1QFJA 1Q7YD 4B47A 4LBWA 3AVUA 3E20A 4YAUA 1VQ5B 4U9UA 4HE5A 1QGZA 1IB0A 4F7DA 4HE6A 3A1FA 4MYUA 1D8TA 1ELOA 2B7CA 3VMFA 3OJWA 1G7SA 4TMXA 3CW2A 4MYTA 4G1BA 1KRHA 1DDGA 5GV8A 4TN1A 3B82A 2CNDA 4RD1A 2VNHA 3I56B 4TMWA 2OTJB 1TTTA 2QMUA 3JQRA 3MHPA 1EFTA 2VNIA 2D74A 1M90D 1KD1D 4PC7A 3MMPA 5JBQA 4G1VA 1I7PA 4TMTA 1VQ9B 1QFYA 3ZZ0A 1SKQA 3JQQA 2BN4A 1B23P 4J0QA 2XNJA 1VQ7B 2C77A 3OZWA 3CCRB 3B8HA 4RD2A 4K1XA 4LBVA 2HMAA 4EH1A 4QFMA 5THXA 4B48A 1N8RD 1S0UA 3CPWB 1CNEA 2BPOA 4YAOA 4M1KA 5TV2A 1NDHA 5H59A 2YWHA 2ZITA 4TMVA 4DQLA 4AF7A 1M1KD 3FPKA 1S72B 1W35A 1N0UA 1VQNB 1OGIA 5KSWB 4FWTA 1HA3A 3CCQB 1EFCA 3W5UA 2XEXA 2YWEA 1OB2A 3MCAA 1QH0A 1SM4A 4LBZA 1NJID 3PENA 4BPRA 1DARA 3CCMB 2PLFA 2B5OA 3QFRA 4AC9A 3AGPA 2PIAA 1DDIA 1K8AD 3W2IA 4B44A 2BMWA 1KTVA 4YHBA 4Y9UA 5H5JA 4R71A 4Y9RA 1EP1B 4RD0A 1QGYA 1E64A 1QUEA 3WXMA 4ZCIA 1EWYA 4C0SA 5DSZA 4NCNA 4RCYA 3V76A 4P6VF 3CXCB 2OK8A 1QUFA 4M2LA 3W2HA 5HXBA 3LRXA 1KC8D 4ZGNB 3OZVA 4QHYA 5EMNA 1KK3A 1GAQA 1A8PA 1YIJB 1QVFB 2OK7A 4PC3A 1UMKA 1AMOA 3VNUA 2EIXA 4PGOA 1FDRA 2BGJA 2EFGA 3QSYA 2PMDA 2NPFA 1ZM2A 2FX3A 3WNDA 2XNCA 2OTLB 1OGJA 3G4SB 1VQMB 1YITB 3ZZTA 2BGIA 3ZZUA 1IJEA 4Y7CA 1TVCA 1JB9A 3AVWA 3WY9A 2BM0A 2YWFA 3CCSB 4H9GA 2J7KA 3J81k 2DEUA 3P26A 4DQKA 1H85A 4WQMA 4B3XA 4PC1A 4M0LA 2BF4A 1EXMA 1DG1G 3I1FA 1XE1A 1TLLA 1K9MD 2CRVA 1VQPB 1J9ZA 4M4SA 1VQ8B 3FJOA 1W34A 3CCEB 2RC5A
chains in the Genus database with same CATH superfamily
1VFPA 5JO9A 4E31A 4P81A 3U1VA 3T3PB 2HMVA 4HXEB 3CB4A 3O4HA 4LMBA 1YE8A 1EJBA 1T34A 4QYIB 2XB9A 1M0TA 2WEKA 4A8HA 2PU5A 2FN7A 3EWAA 8OHMA 1T2FA 1U2GA 5LBUA 5A3VA 4FLEA 1PD1A 4EKIA 5C7IO 3WAGA 3V7FA 2IU4A 4DQUA 1O6BA 2Q8PA 5BR4A 1I6KA 4DIBA 4ZA2A 3CX8A 1J2YA 4BO2A 4F9EA 3FETA 1T0IA 2P4HX 4B45A 1G2OA 2ONYA 3RIGA 1T3GA 4JXXA 4X1KA 2H65A 5TPWB 3W7VA 1MB0A 1V7ZA 4CEIB 3WC4A 1E6MA 4MUEA 2SKDA 4N3NA 3QKSA 4R51A 1Q1AA 1LPPA 4BQOA 1B4DA 3KL4A 1JJVA 4KXYA 5JAUA 1K7SN 2JF0A 3FXAA 1C8VB 1MGPA 3O47A 5FO0A 1NVBA 3QEJA 4NHEA 1ZN9A 1HYGA 4QLOA 5FD8A 5HIAA 5H83A 2M2IA 2XB2A 1ST2A 1YA8A 1IRXA 1UXJA 2EX0A 4WINA 2C9CA 1NY5A 4FUQA 3ZY5A 3RRBA 2XVXA 1Z15A 4PBRA 2VT6A 1D4ZA 1E3EA 1BS1A 1FCJA 2YYZA 2PE5A 1XD2A 2ORVA 1AOXA 1TO1E 1YBAA 4ENWA 4ZCSA 2P9HA 4CKEB 1VECA 2O2XA 5E8RA 1CJTC 3VVMA 3QNUA 5KVVA 3IKLA 3IJRA 1XF1A 1KK2A 1RWMA 3MT0A 3DMFA 2JFZA 2OLKA 3O8QA 4KO2S 5F52A 3V8EA 1L7AA 4CLDA 5ALUA 1PJ5A 3DV2A 2GCGA 2YIMA 3K09A 4CLHA 4Q66C 4OK6A 2YV3A 3WIUA 3BCSA 2FWIA 2XEDA 4Q18A 4PYLA 1IQRA 4EBBA 5I47A 4Z0HO 1VHDA 2JBWA 1W9XA 4D0GA 3E3OA 3U9LA 4JUDX 4MGIR 1ZM3A 1ZIYA 1CLEA 2DJ5A 2I6QA 3U2QA 5SZJA 3SE0A 4F4UA 2ZJZA 1RPTA 4ZZ0A 4OTZA 3G0GA 5A9RA 1ZZGA 1WDTA 2G9VA 1IB6A 5CFOA 1N0IA 1Q57A 4OJMX 4C3VA 3VJRA 1SVOA 4FCTA 3KV1A 2QG6A 3TVTA 2X15A 4F46A 1I18A 1F3OA 2EIHA 4RMNA 5KVSA 5G0VA 2GREA 1U2RA 3HN7A 1U7PA 1XE3A 2SKEA 1ZUNB 4YAFA 3H42B 5ERYA 5CDUA 2CNWD 2ZYUX 4YMHA 4DIFA 5C53B 1VZ3A 3B1KA 3SJZA 1NLFA 1X87A 3HY4A 5L7WA 2NZWA 1CRLA 1X14A 2B1JA 1DPFA 2C5GA 4XL9A 2PANA 3RC3A 1S6YA 2I6XA 3E9QA 1V2HE 2HSGA 2MHCA 4MXDA 4PZLA 4RQBA 3KHUA 5C46F 4RIGA 3TTWA 2VP5A 3OM8A 1UD6A 3W5HA 4KMSA 4R9UC 1XLUA 4L3VA 4LECA 4TT3A 3LDFA 1IWPB 2WE7A 2GB4A 3TLMA 4EL5A 3Q5EA 1ZOIA 3FMOB 2QP9X 3NRJA 2P65A 3OKPA 4ERNA 5ADWA 4OB7A 1AGRA 1WB4A 3AMVA 3JD1A 5HUHA 2WNIA 1MLDA 4UARA 2VJMA 5TNXA 4RA6A 2DBRA 1BG6A 5GONA 4LMRA 3T0IA 2YR0A 4B34A 2CSUA 5EPEA 3IEVA 3D31A 3FZNA 1VQOB 2UYYA 4R69A 2B21A 4HDOB 2G83A 2P7HA 4R2LA 7MDHA 3FF1A 3CZ4A 4TX1A 4DEYA 1AA9A 2E1PA 1UDAA 2HZBA 2G3YA 2PNFA 2QAJA 4NDAA 4XX1A 2VT3A 5IDQA 4I2NA 1QG0A 2XWPA 3TFOA 4ARUA 3JQFA 3HDVA 3UW3A 3DCYA 2LUOA 3BA6A 3GXOA 3H0KA 3Q3HA 1U0TA 4U39A 4BO7A 4MWDA 1Y8RA 3QW2A 4NCBA 3AF4A 3G5MA 1I3OA 1C9MA 3G5LA 4MUNA 1M6EX 3P9ZA 4F6RB 4OOSA 3JRNA 4GECA 1DV2A 1FFDA 1F0YA 1W59A 2GK7A 3RVLA 4O2BB 2IU6A 4ZP1A 1DTSA 4NE7A 2A35A 2ZXEA 4RZHA 4U5QA 2RI1A 3X2FA 1BWQA 4XI9A 2P9TA 1GHTA 2LZ0A 1J00A 2FRDC 3IURA 3AW9A 2QR3A 3PR3A 3B78A 2IE0A 2L18A 4CTKA 1M0EA 1DWOA 5HBRA 5AHKA 3HP7A 3ENNA 3AJDA 3CZ5A 4FHZA 2QTZA 4KGXA 4A26A 2W6NA 1RW4A 3NDIA 3O4RA 2FP4A 4X0EA 4CMGA 5GIPE 1YL6A 3HY6A 1TO6A 3OY7A 3ZXSA 3T95A 3T5GA 1QGUA 4PQEA 5AKXA 3TIVA 3SFTA 3E03A 4A2QA 2W22A 2O6HA 1X1TA 2JH9A 1WCWA 1M10A 5CVVA 2G5CA 1R5BA 2RCYA 1L8XA 2TECE 2R8OA 1OAOA 1OBVA 3CWCA 1DBWA 1Z36A 1I14A 1Q3KA 4GSKA 3A9RA 4NNPA 3VPGA 4UEKA 1IUPA 1ULSA 3BH7A 4MUYA 4S1OA 4N6OA 3T7DA 3ZCVA 1VJ5A 3EDRA 3WHLA 1MR3F 3OW2B 5IBRA 4GOOD 4FZVA 3AVTA 5D7BA 3OCVA 1IZ8A 3USES 3I5MA 3W4JA 2YNMD 3PWZA 1NXXA 3VR4A 2GZAA 4FIZA 4HFRA 1VXOA 2YVUA 3PA6A 1I2AA 1QGED 1U8YA 2YHBA 5F12A 4DBLC 1DINA 1WQ3A 3A4LA 3AHEA 1G5QA 1TA4A 3A3YA 3NBKA 4N5IX 1M7BA 2GVDC 3BWBA 4JVLA 2ROQA 3G1TA 3QELB 5E4JA 4U7PB 2CJWA 1O87A 2VAWA 4AY5A 2CLEB 1P3JA 3ZQJA 1EYZA 1V1MB 5DXJA 3T9AA 4S0ZA 1VQ4B 1EE1A 2Q9AA 1EGQA 3Q12A 3U6BA 3FGZA 4CUJA 2JBHA 3L1UA 3V4ZA 3WL8A 4ZOBA 3GLGE 3TEFA 4JI4B 3O8DA 4C3ZA 3HNRA 2X23A 1CFZA 1HORA 4NBVA 3U7EB 4YQZA 5ES3A 3WK9A 3ANXA 4OM8A 2NX2A 4X7PA 1UJ6A 4DREA 3TAHA 1EPUA 5DHQA 4BQQA 4HDMB 1RAEA 1WD7A 1TT5A 4PHFA 3DBRA 2EQBA 4K81B 4ZMSA 1IBLB 1N25A 3UC9A 1TKRA 2C1XA 1TE2A 1CW2B 3LNTA 4KH1A 3SYNA 4D1YA 2V1XA 5A1TA 3PGLA 3IQHX 3RJ5A 4LWZA 3COZA 3NOQA 3Q3VA 3H4TA 3W8RA 2C3OA 3HWRA 2X8AA 2ZB7A 5K2MA 3GVPA 3ZHZA 3NIBA 2GD1O 1NJSA 5K0SA 3PHHA 2QDKA 2ZIXA 4JQSA 3RD5A 4W5NA 3JWEA 4MVJH 3IXQA 3CH4B 4WN9B 2VP2A 3FCXA 1V11A 3T4XA 1HDIA 3VYVA 4WBNA 2GESA 1HOXA 2OBFA 2YC2C 3A58B 3CINA 3G2KA 3H9QA 3ORFA 1KRHA 2Y0EA 3JQ9A 1U2SA 1Z2OX 2P6OA 3GPDG 4YQEA 2JIMA 4ZZ1A 2X9GA 1X7ZB 1XN1A 3BDIA 3BJMA 1E9SA 1PGJA 3D4OA 4MAAA 2NP6A 4TLAA 3X1JA 2JAUA 2C61A 2QGZA 2C58A 1DEXA 2DPLA 3RIHA 2Y76A 3RUCA 2PX3A 3SYTA 3BFXA 2D7JA 3VI3B 3WLMA 1IZZA 1Z88A 4KSCA 2PPVA 3JYPA 1KYIA 3HCOA 4Z4GA 1JAXA 3OCYA 1DTEA 3Q3EA 3Q6QA 1UWVA 1BLIA 2J4CA 1ABFA 3FBTA 4JOSA 4LXYA 4Y8VA 5DBEX 4WA7A 3ZHUA 2CL6X 4AX4A 2RGDA 5F33A 5HQTA 1JQ5A 2VTKA 3AY7A 4FSHA 3BWDD 4HGYA 1MABB 4DR6B 2OGSA 2VG8A 2FU5C 3ZZ0A 3FNFA 3DCIA 4ARZA 1KC1A 1QBKC 4IHJF 4X7MA 2HCBA 3H1GA 2Y1OA 5TS3A 4XLAA 5IZ4A 3EEBA 1SXJB 2VHYA 3NT2A 4Q39A 1YUBA 2B5WA 2QQFA 3W3AH 2Q2OA 2QRJA 1K6EA 5AK6A 2WAYA 3WGKA 4PN3A 4ZICA 5JDIA 1M2WA 3G88A 3GG2A 1SZPA 4KUEA 3WADA 4PNZA 2QYSA 3BQ9A 3EC7A 2RHMA 2HK9A 3N2GA 4Z1OA 1ID1A 5KYUB 3KQKA 2F48A 1B0ZA 4M0PA 4DV1B 3H97A 3T56B 4B8YA 1UBFA 1W2WB 3ORSA 1CDEA 3FTDA 4YJ3B 1Y1RA 5AVRA 3E4CA 2HIAA 3F67A 2GKGA 4HYYA 4IIVA 4WCFA 4D9CA 4IF4A 4FHEA 2A1IA 1WXFA 2D62A 5JD4A 2FEMA 3ZWXA 1T8TA 5J2UF 3KT8A 3PUYA 5EHQA 3KAQA 3X2SA 4N5NA 1W36C 4MUJA 1VIMA 4YJ3F 4CE6A 4BGEA 5J4VA 1U7DA 1R6BX 3G49A 5TV2A 5T4BA 3T3IA 3VPFA 1NDHA 1KS2A 2TRSB 2YWJA 1HRKA 3NPAA 2JGDA 2G9NA 4HZUB 4CLOB 4YCCA 1GZHB 3LUFA 3G2NA 4D9BA 3B9PA 1Z0SA 2IZOA 5J5CA 3RSZA 3ZI0A 4M9QA 5J1TB 1Y1KE 2AL7A 5B1YA 3MGAA 3SQMA 1DBIA 3C1UA 3AOGA 1KWKA 3DXXA 3KB8A 4GEKA 2UYOA 1T6YA 1X7XA 1NBIA 1M2OB 2ISSD 3B1JA 1IG0A 2LXNA 4XTRA 2E4YA 2HA5A 1CNMA 1JHXA 2RARA 3O9ZA 4LJ7A 1MC1A 4RFSB 5JZOA 3THXB 3PTZA 1PP4A 2Z1NA 2V7PA 3GROA 1YTUA 2R85A 4Q4JA 2LP4Y 3C6ZA 5AH0A 2OHXA 5CDGA 2B20A 1T3SA 1EFCA 3GAFA 4KKVA 4OQPA 5L45A 3MTIA 3OTWA 2WF9A 3PNQA 3FMIA 2FRVA 4K9SA 2QKYA 3BS4A 5JXHA 3NUQA 5AJHA 4NMLA 5HGXA 1E32A 4LBZA 4IIHA 4EGSA 4HGRA 4ND5A 2OV1A 4B80A 1FJGB 1YQUA 2O19A 5EPOA 2J07A 2ZSFA 5D3MA 3FNIA 1ZNYA 3TZ6A 1I01A 1KQGA 3DP9A 2PIAA 5CRIA 2EG5A 3K30A 5K51A 1DAKA 1JEAA 3B13B 2BMWA 1IIBA 1AS0A 3LC2O 4RH0A 2BGWA 3IX7A 1NTRA 3H05A 2OQIA 4ON9A 4GM0A 5GJWC 1JLMA 1YDMA 2QPLA 3RBXA 2VS1A 4YCSA 4UXJA 3PIIA 4B82A 3U3ZA 5BWBA 1P4HA 3MJSA 3NU1A 1EG7A 3CCFA 1W44A 5TX7A 3DDOA 4N8SA 1N8KA 2X2FA 5T7BA 4J29A 5AUQA 2I1WA 4MCJA 1S89A 1PJTA 1Z06A 3DAPA 3EW9A 4HATA 4LK2A 2AMFA 2XCSB 3LT5A 2OLEA 3DLCA 2QD5A 1UKYA 2IELA 3ZBPA 3ENQA 1N2JA 1Y80A 3DMHA 4EPRA 1RKUA 2GAOA 4M0EA 3ROZA 4LWPA 2Q5CA 3F7OA 1LBIA 3H8WA 4EI9A 2RB4A 2QN3A 1GN9A 3SC6A 3W2HA 2QVGA 1KVTA 5JMTA 1P4AA 3FJ1A 4YCNA 2L2QA 1HLDA 3GUVA 1ZCFA 2PIDA 4NOLA 3ZLBA 1EP9A 4V0MA 3BG5A 2WVAA 1GQOA 1KFKB 1QG2A 4KN6A 2F4VB 3LC0A 1SD1A 2YXLA 3NT4A 4ZOQI 2NTVA 4M21A 2F7SA 1CRZA 2AR9A 3GJTA 3NHBA 3KE8A 2PQ0A 4MLDA 3VTKA 1RWPA 4KZPA 1Z8NA 1VB3A 5K8IA 1FMLA 3A1DA 3KAKA 5UKDA 1Y89A 4EO9A 1JFSA 4FSDA 4M9XA 4M0DA 4G7WA 1RBQA 5LPNA 5FL7A 1USVA 3G8BA 5C1BA 3R8XA 5JHHB 2HA7A 3UA3A 4BMPB 1PWZA 4N65A 5C34B 3I2GA 3DCJA 2NWQA 2FPGA 1E7WA 1VM6A 4HX2A 4BX2A 2Z1MA 4HFMA 1IEWA 1HTBA 3H5VA 5TPZA 5E4YA 3BMOB 3WB0A 2ZQ5A 2OTLB 4NBNA 5EZQA 2HWKA 4KUHA 3EXFA 3DR3A 3VMMA 5K4GA 2WSSD 3FHJA 3HR8A 3V32A 4Z1MD 3SS7X 5ECYA 1II8B 1FFXA 2PYDA 2OBRA 2X0KA 5IVIA 2Z3ZA 1KORA 2OILA 2QRZA 2AX4A 1TM2A 1VRVA 1FUKA 1ZEMA 3S29A 2R6JA 2A9FA 4H7EA 5JEEA 2HYIC 3GGSA 4F56A 9LDTA 1YKFA 3B12A 1HNWB 1LRKA 4YQYA 1YX2A 1YR9A 2II6A 5I9IA 1QH8B 4X1YB 3RT1A 1WORA 1QWSA 3VZPA 4L4SA 3LLMA 4CT5A 4KWCA 1BWSA 3R0ZA 3D6HA 3LQRA 5TE9A 1Z4KA 4PC1A 2FG5A 3PXGA 4M0LA 2B4AA 3NXSA 4BX0A 5JMOA 1K5DA 5JSHA 3TQHA 3GFBA 2HSDA 5ERGB 3FF4A 1OLXA 3NIFB 2EERA 4MR8B 5ARCA 4HJRA 4KX5A 4OATA 4I81A 2NU9B 3C6BA 2NO4A 4ZVQA 2NSYA 3ELUA 3ZV6A 1I5RA 2LBPA 2R86A 2R8ZA 3LY8A 3L6CA 3PCTA 3JAMA 3HFSA 1U81A 3NVMB 1YZLA 1F9EA 3VX3A 4E30A 1IATA 3MW8A 3HDYA 2Z2IA 5H7XA 4IG9A 5HQ3B 3B51X 2FUEA 2GEUA 4D6XA 5E1BA 5LR6A 2GPAA 5KQGA 1L5VA 3ORQA 3MAJA 1R7RA 4A10A 1CUDA 2O7SA 3TTTA 3SBEA 1C3VA 2JFBA 7AT1A 2BF7A 4NBLA 1YOVA 1BDHA 4QPDA 2XQKA 1IMOA 1BFKA 1VG1A 2JHCA 4G9GA 4YJGB 5L8VA 1T5TA 3SFVA 1RC1A 1YJWB 2OV6A 2Q5OA 1OC2A 1UAYA 4KWHA 2Z2ZA 4IIJB 4LF9B 4LN1A 1SBZA 2HHAA 2X5KO 2XR1A 4O02B 2I54A 1I1OA 3ZR4B 4FKBA 4ADSG 3CNNA 4IIJF 5L3SA 1U99A 1ESCA 3F6BX 4EGQA 1OJLA 1HG0A 1L7MA 3OLQA 3KPYA 1JJ7A 1CS0B 5GVRA 1HLPA 3PDHA 4FFNA 4DDHA 1GDDA 1PL7A 2RHWA 2XGGA 3S1AA 5AIAA 5EERA 3VDQA 2ATIA 5CIYA 4G26A 4TTSA 1CIJA 2CWWA 1I36A 4DJ5X 1G4UR 4XRGA 2TYSB 2CXHA 3LO8A 3VR6H 4OSOA 3K4QA 1NI4B 4IKPA 2D6FA 4HX9A 3AM3A 4QJIA 1WF3A 2JJ1D 1SG0A 3WGJA 3SEZA 4A1FA 1SHLA 1D5CA 1VJ1A 2IEDA 5DO9A 1I94B 4TLLB 4D9FA 5F64A 2EGUA 4HYTA 4XGRA 3U4CA 2P8SA 5K0BA 2EW2A 3X1XA 1QE0A 2OR3A 2GCEA 4KN8A 2P77A 2EF1A 3GQBB 1GRCA 4HWOA 1IAVA 4H4DA 4TQ9A 4ER3A 2CUZA 2R8BA 4KGZA 3ZDEA 4NG5A 3B5JA 5JANA 1ZDMA 2PUGA 2Y68A 1ZJJA 1FNBA 1V35A 4G0YA 1WHSA 5ITZB 3HG7A 1GM5A 1EFRD 1YZHA 2VT2A 4DA6A 1SWVA 2V6GA 1LY1A 2WU3A 2XYRA 3ANNA 4U9IS 3ADDA 1BCRB 3LBAA 5GQSA 2NZJA 1SO8A 5LDGA 3VNVA 3ZCXA 4BX3A 2QA4B 1HQKA 5DCLA 4FFDA 3LPNA 4II2A 3IB3A 4INPA 4QVKA 1E9FA 1G64A 1U1DA 4U8GA 4WY8A 4ZYUA 3DB1A 3UMSA 4EUKA 1YR1A 4N3BA 3IO5A 2BV3A 3QYJA 3OQVA 3HV0A 1CQWA 1GCIA 1JQAA 4M6WA 2WAOA 2ZVDA 1I2DA 3PFKA 4A8TA 2HXGA 4WERA 4DUGD 5CG1A 1H3EA 3GRVA 4TUYB 1QTRA 4DYDA 5A88A 1PW5A 1U5BB 4K87A 4F91B 4CUZA 2HNBA 4ZYVA 1XTPA 1WUHS 5DBOA 2W0MA 4XGIA 4O8ZA 4BLTA 2BGUA 4PCAA 3TFQA 1B6SA 2VUHB 4TUYF 1RMQA 1R0RE 1OROA 1ESMA 5CTAA 5JJBA 2AR0A 2ZM6B 4M1EA 1HLFA 2AWNA 1LGYA 3A9VA 4MRNA 4A36A 1OTYA 4QLAA 3TJZA 3STHA 1P0QA 3V8BA 4E1AA 4F2HA 2ADFA 3RANA 1NBMA 1ZHHA 3A26A 3H04A 3HJTA 4J9UE 1QU2A 4DQVA 2JFGA 1Z4MA 2ZSAA 1V39A 5GY7A 5A4AA 3IHLA 1K7XB 3RW9A 3UWOA 5C7LO 5KB3A 3W5CA 2FEWB 2H5IA 1SCUA 1NASA 2PD3A 2DHDA 4J49A 1EMDA 1OXBB 2QRPA 5BVHA 3DF9A 1RWOA 5EIEA 3WWZA 1IBMB 1C1XA 1PV1A 3ES9A 2PKXA 4CIAA 3H8JA 5EMMA 1ZJYA 1BJKA 3WLTA 3HCPA 1GP2A 3GT7A 2C84A 2Q3CA 1HFEL 3JYNA 4HYQA 5DBHX 2QNRA 4OF4A 5DOVA 4WGGA 3E3AA 5JU6A 2YRXA 4D0NA 4HEA1 4N0PA 5T8KC 3TKLA 2NYAA 1AQIA 4ENUA 3PHBE 1GAJA 4JC5A 2VA8A 2YBEA 1NSTA 1IY1A 1SXQA 1XP8A 2CXPA 1L5SA 4WNCA 2C4VA 2GA9A 1QQAA 1FUYB 1GA1A 4FNMA 4HMOA 3C3BA 3SIWA 2GTIA 4RGYA 4ZAWA 4OHWA 4MLPA 4QRDA 3BXEA 2CLDX 6ABPA 3KOWA 1U90A 1B15A 4A6EA 3AFOA 1VJDA 1AUVA 1X74A 2GJKA 1JYFA 1PQYA 2FPIB 2UUBB 4JL8A 1PS0A 2WZDA 3FJYA 1Y5IA 3Q3GE 2XE4A 1J1ZA 1U2QA 4IUDS 5H16A 1CF2O 1N3IA 2P67A 1Z47A 3BORA 4W8OA 5KHOC 1Z68A 3JALB 5I48A 1PG0A 3VZSA 1X3LA 1TA0A 2ODEA 3HA5A 3OG9A 4R8RA 4QUGA 4ETNA 1AZTA 4YVFA 4CF5A 4RSMA 5F23A 3KHKA 2D1RA 2HJRA 3TECE 2Z6QA 2OECA 3DHWC 1EDOA 4WOJA 4F04A 1O0SA 5FADA 4RBNA 2XZLA 2HWWA 3BC1A 2HEGA 2WOJA 3RFCA 1YS9A 1V3TA 3L5KA 5FOTA 2GO1A 2W7TA 1PKVA 1J2JA 2FPOA 5HW0A 1JMVA 3K35A 4LF7B 3SIPA 1NMSA 1ZD9A 1VIAA 3EIHA 1U8EA 2A30A 4HLUC 2C5AA 3I6BA 2VRBA 4A0RA 4RPKA 1M6VA 4P22A 3VDXA 3R9XA 3X1WA 4E09A 3HU5A 4NBTA 2VF4X 1EWKA 5AVVA 2XY4A 1OTXA 2QB5A 3IKVA 3LNCA 4GM1A 3CZQA 1BIFA 3MFQA 4MQEA 3ONWA 4H3HB 5EFZA 5KSPA 1OX5A 3K0AB 5CJPA 1FMJA 1NURA 4QDUA 1SUBA 1HUQA 3NIDB 2IIQA 2ZATA 3ILHA 5IASA 5TC4A 2ONCA 3OY2A 3HL4A 1E3WA 4MQFB 2H2IA 5EGNA 3I4LA 5EQJB 3OZEA 4H15A 4BIIA 1AN9A 5IULC 3CMEB 3DZHA 5I9BA 2E89A 3IC5A 4S0XA 1LJ8A 3OQJA 3A14A 4KXQA 4Z99A 3V46A 3WKEA 1C9NA 3GFTA 4AB1A 4NZYA 1HYQA 4FZ3A 3VR6D 1TZKA 2WV7A 4NY1A 4B3FX 3PQ4A 4ZAGA 3ABIA 1P1HA 2B8WA 4XH9B 5DEOA 5LMCA 2QRQA 2O8NA 1QFJA 5HZMA 1XVLA 2PRYA 2V03A 3VNQA 4F6LA 2CUTA 2BZSA 3RVRA 5BNIA 1N3YA 2PMFA 3E48A 2WHRA 4Y6LA 1XFDA 4GFDA 1NBOA 1NG1A 3TGWA 2VOJA 2AK3A 2QMOA 3D6NB 4ZRNA 3A6DA 5I4IA 1HX7A 2HRZA 3OAAA 3C1OA 3G9ZA 3EGEA 3TZLA 3CPHA 2ZRBA 1MAVA 3T53B 1NPTO 1YK0A 2BCGY 2AN3A 4ALNA 1T3TA 4KHZA 1F2DA 3NVDA 4XYEA 4D42A 2DFLA 4CIWA 3GR6A 2MMCA 3B9BA 4QBKA 5CU7A 3QLVC 2X53S 2GRJA 4IDEA 4FFRA 1T9DA 2A0KA 1CJKC 2X8LA 4FFPA 1OASA 2AT1A 4QU9A 2IZ7A 4FI3C 3ZQ4A 5AW7A 4C2TA 4GVLA 4QDXA 3JQDA 3WK7A 1CQIA 4BE9A 1DWPA 1VSQA 5F4BA 4FMBB 1YOBA 4DJFC 1U02A 1VIDA 5BXQC 2J4FA 4RGBA 1GLVA 1RU3A 2YZGA 5DHSA 1SC6A 1DAOA 1Z34A 4D4MA 4QT4A 3EFBA 1QK5A 1DBRA 3IAM1 3V4PB 3WRVA 4IO0A 2BJWA 4OGGA 4QTYA 1E2IA 4PXYA 4B74A 2VBUA 2HBZA 3R41A 3GIRA 1OZGA 2BHTA 5C18A 1W96A 5I4KA 3ZLUA 3QLUA 5T3UA 1ORIA 4JKOA 4PO3X 2OORA 5KREA 4P35A 1TMKA 4TXJA 1ZFNA 1X1RA 5F9FA 2C7QA 4TMTA 3FMFA 1VGVA 2D5CA 4KN5A 2H1VA 3MS2A 3D7MA 3IMGA 3MMSA 1XNRB 2JGKA 4KIJA 2NSJA 3ROMA 2VRCA 4NS4A 2DWCA 3D4BA 2H1FA 1NUAA 3I23A 1C4XA 5CHYA 1JN0A 1L7EA 3WAJA 2IUFA 3Q72A 1AKRA 4UNSA 3CCRB 4KIWA 1ZICA 2HU7A 3P5BA 4M49A 4XR6A 1E7RA 4DNRB 2QL5A 4K1XA 3CS3A 4BRSA 1AKYA 3QTBA 4IWYA 4LCBA 3HN6A 4BP3A 2HMAA 3I52A 4L4ZA 4CG0A 4ZGBA 4B4OA 3M4XA 3HI6A 1P2GA 1D1QA 1TU4A 2RK3A 5DU2A 4BRWA 2O8BB 2M1XA 5LB4A 4D3DA 3UO8B 5HCUA 4B3TB 5B4VA 1S0UA 4B5LA 1TKAA 4QUHA 5K3AA 1NB9A 1ZESA 4DWJA 1F1JA 2HB6A 4P25A 3HLKA 1DEAA 2YVKA 4YAOA 1Y6RA 3E7FA 5LC1A 4J0FA 4YGXB 3CKLA 4E88A 1C0KA 2PZJA 3LPDA 2KLBA 2ZE6A 4PLCA 2YWHA 3ROPA 2G4LA 1J24A 3VDRA 1Z8FA 2I66A 4TMVA 1K8ZB 3LCVB 1AGYA 1EVLA 1J2UA 3MINB 5DMXA 1GGVA 4YP1A 3GLIA 3ZYCA 4TYQA 2DYKA 1PQWA 3UB3A 4JVNA 5HGJA 2WR8A 3L7YA 4KFRA 4W5HA 2X9LA 2VTBA 4M87A 1YU6A 2E37A 2F1RA 4IDNA 4NZPA 2JI9A 3QV1A 2AXQA 2Q4OA 5EE0A 4ICIA 4QNNA 4C0XA 4CM8A 3F3KA 4FCCA 4XCVA 3V8QA 1S72B 2IX3A 1OI2A 1UJ5A 1V5GA 5FPPA 3LWDA 1CUHA 2XQJA 5L53A 1EVZA 1RQLA 5TDHA 2VBCA 1ZJWA 1UDBA 3NGMA 2QPOA 1T1SA 1B41A 5TQ2B 3WL7A 2C2GA 3SY8A 5DM4A 3NM4A 3FOWA 2XQIA 3R77A 4Z4WA 1YVDA 2CL0X 3BXXA 3GIWA 3CGGA 2ZS7A 3CUSA 2DGDA 1A7JA 1GTL1 1GTVA 4D9GA 4ZI2A 4DR4B 1ZKMA 2NUBA 2V0NA 3DFKA 3JASA 4QULA 3MSXA 1WZEA 2B9VA 3L82B 4GI2A 1E3JA 2DQZA 2VTEA 2Y99A 2NTEA 1E3SA 1FYDA 2C3PA 4ZOLB 5F73A 3DO8A 1A5SB 1HMPA 3ESDA 3D8BA 1NX9A 3BE8A 3KQWA 3MWDA 3R3HA 4FYPA 4W7IA 3USZA 5AW1A 3MTEA 2GPSA 3TNDA 1ONOA 2H2AA 4ZOLF 1IPEA 4BLQA 4GPD1 4Y6SA 3T5AA 3L4BC 2DX7A 4I9GA 4JBLA 2F59A 4EJ6A 3HCEA 3C14C 1VLQA 3ZPNA 1RTKA 2QT9A 3DHYA 1BQ4A 3EQZA 3RV4A 5DXFA 5JCOC 4I55B 2CXQA 4PSCA 4CM4A 2Q6LA 4AJNA 4IJWA 2JZCA 2EP7A 1LQUA 1Y9ZA 1WETA 2RHOA 2IP2A 4NONA 2Z0MA 1HYHA 4PYMA 5DGHA 3JYOA 4I55F 4WLVA 4L02A 1Z28A 2WTBA 3IVMA 1SOMA 2QOEA 4N49A 3WLFA 1JR3A 3KJGA 4LNUB 4Y18A 3RYIB 1CZUA 3GCDA 3F98A 4GX5A 4DXHA 2WM9B 1IBSA 1O95A 2O7NA 3UUFA 2BFEA 3EXHA 3LYHA 4LOLA 3NGLA 4WEOA 2ID4A 2XYVA 4EA7A 4HX5A 3PVSA 4WXHA 3WXBA 1WUJS 3KPUA 2P9JA 2A84A 3LQ2A 3PXEA 4YJ2B 5HTOA 3C3DA 1NW5A 2HCTA 2VDWB 4M7OA 5LZ5A 3DTVA 4W5JA 5TIIA 2CT8A 3ZGOA 1ZGHA 2AJTA 3MLAA 3I9NA 1X15A 4RUKA 5K0LA 5BN3B 2FFBA 2GZ1A 5KWJA 2VXOA 4BPBA 5F4OA 4YJ2F 1Y4AE 2B83A 2BMJA 2QJFA 3FKJA 3PL1A 2Q6IA 1MFZA 4R3WA 1KEKA 1QIJA 1NOIA 2BGLA 4S1WA 2ZWIA 1IFXA 3KQTA 3LP5A 4I7EA 1IOZA 4DV6B 4V0KA 2GXSA 4GDFA 4CGYA 3DVAA 3T7IA 3WLJA 3CRW1 3TDMA 2OPBA 3NNDA 1IU9A 4KUGA 1GGJA 3B52X 3GJ3A 4BX8A 2GR9A 1AURA 3L7KA 5CDTA 4R16A 1YFJA 2C82A 4J7UA 2I2BA 2FR8C 3ABOB 3JARA 3BWVA 4OUKX 2GBIA 3HU3A 4JXZA 5L51A 3MWEA 4IUBS 4K6KA 2I99A 1K06A 3GCXA 3M3DA 3AF5A 16PKA 1H66A 3CXRA 2J6HA 1H9AA 4TTAA 4CKBB 4CQMB 3WQZA 1E2KA 5LXTF 2CNNA 2GF2A 3NUZA 2FZ4A 4QXQA 3GL9A 5A1JA 5FTKA 2H07A 3I6IA 1JG7A 4WD3A 1ID8A 2H7VA 3DFIA 4EZEA 2QE6A 3HKEB 4ENRA 3AM5A 2Q3JA 1U28C 3JX9A 4E4YA 4ZAXA 1KDZA 4D0RA 1I5EA 3GA7A 2BGRA 4FOTA 1EKXA 3CR7A 4PZCA 2HF2A 2F9MA 4QPCA 2OZKA 3P2IA 3L40A 2EF0A 4URVR 1W29A 1BH2A 4MA4A 4KYUA 1YGPA 3M0EA 3EFOA 1KE1A 1E9RA 4X07A 1C81A 2R11A 2C7RA 4NV3A 2W90A 4KWTA 2QL9A 3CCEB 4MOWA 4AUMA 1QZXA 2ZBVA 1L3CA 4DSAA 2B1GA 1FEZA 4WZTA 4UVGA 1U8UA 2Y0DA 4MPRA 4Y9SA 4C0KA 5HRUA 1YS4A 3RLIA 3KSBC 4ED9A 5L3ZA 3LLSA 4IOJA 3R5JA 1J2EA 8ADHA 4F2PA 3QG5A 1TQ8A 4OYLA 4WXEA 2NVUA 3PKZA 5DPMA 5EXPA 4BQPA 4F2DA 2H52A 4AYXA 5JWHA 4ZMRA 1ZXXA 4GX0A 4XGNA 4OG2A 1S1CA 4RDXA 4V0RA 2XUDA 4Q9KA 4EUNA 1NQOA 2Y1GA 3PG5A 3PXAA 1YFLA 2XXAA 2IK8A 2A94A 1ISFA 4YJFB 1ZXBA 4F60A 4TTTS 4YRGA 4HB3A 3SOPA 1KNXA 2YVQA 1VHWA 1SQFA 2HLHA 1VHEA 5EJ8A 3R5KA 2GJ9A 4IWXA 1NVXQ 5FWXB 4KLAA 1S8AA 3QJ5A 2VXCA 4FHDA 3UGJA 1U0EA 4QU5A 4OHYA 2F1LA 2PY6A 2YS7A 4CMIA 3IHWA 5JJ5A 1CRQA 4N5MA 2GXUA 3QXJA 4AF6A 2X4LA 1BN6A 3WS7A 2SKCA 2V0CA 2KVOA 3CRZA 1KJJA 2WYIA 4QFCA 5KHAA 5KYKA 1XTJA 2PD6A 4DB4A 3H2IA 1Z2DA 4X20A 5F7ZA 5BSGA 2V1UA 4M1QA 1T2UA 3M6IA 3K9HA 5DCUA 3O4FA 3DEFA 3VDMA 1S8NA 5BW5A 4ZKEA 2A5JA 4HO1X 2PH7A 3ICWA 1XCBA 3VH4A 1ULTA 3AJ8A 3DV9A 3MAGA 2GN6A 3O7WA 3ZKAA 5KX5A 2IHVA 1FYFA 4OQFA 3G8YA 3KJZA 3PFBA 3VHQA 4BNKA 5DNAA 5A3QA 4NCAA 3PX3A 2VHTA 4RZ2A 1EEXB 2BTOA 3QWHA 3E1GA 4RH3A 4PRZA 5CIQA 4I2VA 4BB6A 1C3EA 4WLEA 2PBLA 4CI9A 4WZAA 4EYQA 1KP3A 4NDZA 4Q4LA 1GNLA 3OH8A 4YRAA 4RU1A 1SHUX 4G1EB 5KYGA 4OFZA 3QWBA 2VDJA 4IINA 4UEOA 6REQB 2Z4RA 3WYGA 3KYIB 4L5AA 2PCJA 1LCIA 3D6TB 3S0JA 2COKA 1GAWA 4MVJI 3KEGA 4BMVA 1J5PA 1LK0A 4LYGA 1QVRA 4N5HX 3TTYA 2ZSJA 4LHEA 2O54A 3D7SA 3T7JA 2RONA 5AW9A 1XXHA 3A3BA 2YBDA 4BNWA 4X7CA 4YJHB 3IOCA 3P0HA 2HRRA 3KL9A 1TEHA 2P2YA 3TRJA 4BQRA 3GT3A 4F3CA 1OXSC 3D7KA 3FYUB 4RELA 2AS0A 3CVUA 1K8YB 4BC1A 1IIRA 3KTOA 3OOJA 4RPLA 5AVKA 2IDZA 5GIOE 5AI4A 3TMYA 1JLHA 2OYCA 5ICEA 2Q4DA 3ZUGA 2B2CA 2I2DA 5IF3A 4TMFA 3N5KA 1X3SA 4N54A 5BSXA 1TLTA 2CEAA 4XEUA 5EKDA 4Q9AA 4PRKA 1WCXA 5E4TA 4ZDWA 8ABPA 3WL3A 4XWWA 4IAOA 3WBFA 3RAPR 5CA1B 1VE6A 3LQFA 2QMHA 4G1FA 3TZKA 1UADA 3O26A 3DH0A 1I0ZA 4AYWA 1QMPA 4MW1A 2V4DA 1XZFA 2IDJA 5LWHA 4XEHA 5CA1F 1W48A 1W581 3C8DA 4QGFA 2J7PD 4E51A 4LHYA 1IXSB 1EZZA 4CHTA 4JP3A 4JENA 4RKQA 1H8ED 4NZ9A 1FIUA 2O8EA 1GSOA 4G4SP 3CCCA 4YRQA 2O0KA 2VZLA 2WJ4A 4ZC1A 3WRXA 3UMBA 2O2DA 2OMKA 2Q3HA 3SP1A 3CCLB 4EEZA 1PZEA 4HPWA 4MWSA 1W73A 4DBZA 2JLYA 4XB1A 1DDOA 1GNTA 2B98A 2Z57A 1YHYA 4P8RA 4DT1B 1I6MA 3CN9A 3OT1A 4PVDA 3EGDB 2P41A 2EJCA 3N9IA 1WXWA 2X42A 3NBYC 3VQTA 5DP2A 1PEAA 3CLKA 5JJIA 4R2IA 1GEEA 3IPYA 4UEJA 2OBBA 3D26A 2VYVD 2CXUA 1GNSA 1Q0UA 3K0BA 1T6XA 5ALSA 1C30B 2ALJA 2C0PA 3FVQA 3EXEA 2NTYC 4MVJP 5ITSA 2C7GA 4B43A 2PS1A 3IJEB 1GKUB 5EZYB 2OXFA 2ES4A 1JIXA 4QHTA 5FXMA 3RF6A 2O8FA 3AV0B 3SNKA 4BQEA 4D8YA 5TRDA 1MQAA 1EA7A 1OMOA 1JJ2B 2FW9A 3NNSA 4IG4A 3ZHVA 4MIKA 4DSUA 5EZYF 1EP2B 3MWJA 4C6TA 4CMAA 1M54A 1E1CB 2RGXA 4P2BA 2BFDA 3KX2A 4DCTA 1JHZA 2HJWA 5HJ2A 3ZBTA 5IAOA 3QUSA 1KL7A 2Y1DA 3GFGA 4D46A 1ZD4A 3KJEA 4MR9B 1ZHFA 4P26A 1FU4A 4NENB 2J0EA 3F90A 5IZCC 3CVJA 2IYOA 3E2IA 1OVGA 2G67A 3CJRA 3ZUPA 1SEPA 2XUHA 3PPVA 2VJDA 3SXUB 3HXKA 3M7IA 1X1BA 2G8LA 3ZHRA 4ASUA 1FOEB 5B30A 1OIVA 1I5OA 4GEGA 1E99A 1JEQB 2XJ4A 2CZCA 1AK1A 1WW3A 2W6OA 3W2FA 5F2OA 5B37A 3A37A 3UTCA 1ZNQO 3ITNA 1G9SA 1PK7A 2V45A 3AQ4A 4MWGA 3MC1A 4PO9A 2O20A 2RG1A 1XRPA 2W6ID 4DMMA 2G4VA 2ECKA 1XMIA 2FZEA 4F21A 2ZWOA 5H9WA 1O2DA 2JVJA 4XLFA 1A9QA 2I03A 3H5IA 1AUOA 1XRQA 3MWLA 3LUDA 1YJAA 2BR3A 4UDOA 2WHPB 3SS9X 4G5GA 4GXNA 1WOYA 2H1RA 3TXAA 1S3SA 1QZ3A 1LPOA 2H48A 3TQRA 1J06A 1N2EA 2QTWB 4IM7A 1BXGB 1E3LA 3HVKA 4AROA 3RTGA 4JVOA 3EJ6A 1NLUA 4OHBA 4REQB 3K0FB 4LZNA 2FMUA 1RJEA 1YDFA 3AUKA 1PZFA 2N1BA 2FP3A 1DQNA 3C3AA 3GZ4A 4G4JA 4U63A 2E5WA 3KAJA 3RUIA 4LOHA 1NSYA 1EK1A 4Q16A 1LSUA 5CXSA 4KRFA 3A11A 5EINA 4Y6OA 3PNBA 2JJ8A 2GX6A 2GF9A 5ECWA 1VSTA 4HE5A 2XHEA 4KK3A 2QM3A 4TKUB 2PKCA 4C3UA 1RAFA 1P81A 1OBFO 3JAWA 4I9NA 4I4IA 3EEOA 5KTRA 2BCEA 3BIWA 3BXGA 5B2ZA 3NOOA 2C8VA 1CUWA 1XRNA 1M8FA 2CXSA 3RIMA 3U09A 2Q0SA 3EF1A 3BSSA 5DBFA 3ZK9A 2ZJ2A 3Q0EA 1TQ4A 3MJHA 1D03A 2BEUA 4NAHA 4KDEA 3GDHA 4Q6BA 4IIXA 5K0GA 5D3KA 2NSLA 4D7AA 4M46A 4WASA 1WJGA 1UANA 4NBWA 3FHTA 2IYSA 3KOUA 4DV3B 4LKOA 3AR3A 1QE3A 2IEGA 1RWNA 4XWTA 5H02A 1P4RA 1L4UA 3PR1A 4E6EA 2F8SA 1L5WA 2NO1A 5AOVA 2GPTA 2A6PA 1R0SA 4KMOA 4EFKA 1H4VB 4NAVA 3QHQA 4DCVA 4NJMA 2AG1A 4BLVA 3TUZC 4INJA 3VHXB 4FHFA 3I56B 2C4TA 1Q92A 1WE2A 3Q8XB 3VFDA 1JDBB 4NV0A 5DNYB 5B53A 1V4VA 3RYTC 1T8RA 4ZO8A 3SR4A 3QPVA 2OD7A 3V4VB 1GWNA 4PYQA 3C70A 4BNYA 3UMVA 2NXJA 3CRMA 1AGPA 2AYXA 2I9PA 2IODA 1FRVA 5JAPA 3TLZA 4G1VA 3T7KA 2AG8A 2R8PA 2XADA 3L8FA 2VZ8A 2WPNA 4ND4A 1SUIA 1JR3E 5DSXA 2Q1YA 4TZKA 1SPXA 1C7QA 3HJBA 4HS9A 1W6UA 3B2EA 2CZQA 1TMOA 1IOLA 4OHMA 2ASEA 4Y2RA 5AM5A 1HETA 3KKPA 1WB9A 2BKVA 4TTJA 5DTEA 2PXXA 3EGCA 4XLLA 3TIGA 3L77A 4WPGA 3IAFA 3VJMA 3LQ4A 3PYXA 2FVGA 1DC5A 2X19A 5BN4B 1U1FA 3DKIA 4L6CA 4LGYA 4UREA 5HP4A 2EWVA 1JKJB 4HB2A 1SXJD 1RHKA 2C96A 1OLUB 3FWHA 4ZEOA 4YYEA 3C6KA 4NJEA 2L17A 4D6PA 4E4TA 4PLGA 1J4AA 4PICA 4TZ6A 5EIOA 4M76B 1EUCA 3C8ZA 1SQ6A 1E7MA 4C7VA 1LI4A 1N7GA 2YHSA 5HIIA 3L41A 1HFKA 2BD0A 1UK7A 3A70A 2P90A 3ZVNA 1CNEA 1H2FA 1U8AA 1E4VA 3K0CA 4UHKA 4H1TA 5CFMA 3AR5A 1BOFA 1WCV1 1JFFA 1Z16A 3FFTA 2AJCA 3OE4A 5CGQB 5DSTA 2RI6A 2AMJA 1AZSC 1MCZA 1W7AA 2CVFA 4Y0VA 5BSTA 3KB6A 2X6TA 4W9NC 1LNQA 4E5NA 5LYJB 2O7RA 4I50A 3MQFA 4ZALA 5K3FA 4G0NA 1PFGA 4DQLA 2P62A 4FD2A 2JGJA 4RJIA 3MA0A 5ALWA 1B1AA 3LPLA 4QJ4A 1ZSVA 1H6CA 2JK0A 1TJ3A 4KPEC 1E8NA 4BNUA 2FZKA 1R0CA 1N9GA 3FE2A 1B6RA 3BREA 3GELA 3U3OA 4HQ6A 4JEUA 5AM2A 1ZN2A 3AC0A 1FLDA 4Z49A 4ZQFA 2WKRA 3Q7QA 3DE1X 3JZIA 1OE0A 4RJ2A 5SYNA 1LWNA 1CP2A 3ZDQA 2HLDD 7REQA 5HJ7A 1G8MA 2NMVA 3CE9A 5H0IA 4RV4A 3EVTA 1QYIA 3RHTA 2Y71A 3VHLB 1W1UA 2HJVA 1GT6A 1GUZA 5FTNA 4C21A 5K6AC 1Y33E 1V1RA 4KH0A 4RTMA 2CFOA 4FYMA 4J75A 5G2OA 5HF9A 4YASA 1OFUX 2MYUA 3QQPA 5MFZA 2SNIE 4RL4A 2K7FA 2UUAB 1YKSA 2E21A 2VHUA 1LZLA 4IRXA 3N2KA 4J7AA 1H94A 3MGBA 3B89A 1H2EA 2DE0X 5F21A 2YRFA 4JVSB 2KB0A 2P1ZA 4IVPA 4NIMA 1N2HA 4XPIB 2QSYA 4GQBA 1B73A 4CM1A 3U61B 4I66A 5IAEA 5AM4A 4D45A 1PJQA 2FDXA 1K8AD 3BD8A 8AT1A 2W2OA 1L6IA 4FE3A 1RKQA 4YJKA 5GP1A 3CB2A 3VAAA 3CJTA 3CW8X 5ALVA 4Y9UA 1KO7A 4FGZA 4NZMA 2QW1A 4Y2HA 5DK4A 1G55A 4Y9RA 1C1DB 3R75A 1ZJ4A 1S2MA 3VNSA 5A7FA 1F17A 4GI1A 5LU9A 2WHEA 3MWGA 4C0BA 2FF7A 3I2HA 1YV9A 4IH1A 4YY3B 1NMXA 1ZVKA 2QM7A 5IT5A 3R9WA 3ZS9A 3KZXA 1HNNA 4EMTA 1GPDG 1YJCA 3HYNA 3BHIA 5DNWA 3E81A 5IT9A 3SKYA 5TGZA 2C1EA 4ZODA 5PNTA 4BVKA 1V41E 4IDDA 5JY6A 4U6SA 4CR8A 3AWDA 4KI7A 5CJJA 1ZA2A 4E08A 3A31A 2OCXA 4P3PA 3FFWA 2Q8QA 2J45A 4OHKA 3AJEA 1V16B 3K1AA 1C9JA 3UM9A 5A03A 3QA9A 1URPA 5JROA 3SZGA 4XORA 4LQCA 4QJ3A 4PAWA 4TSFA 1A7UA 4XXHA 1XQWA 2Q50A 1GPNA 2PXAA 4QHYA 4FKMA 3S5UA 3NBAA 1NWHA 4JUCA 4OKSA 5LQAA 3CU5A 5IJ0B 5KOJB 3MSCA 4RIHA 4G0MA 4PXSA 1NW8A 2XMQA 2Q3BA 3KYCA 4R5HA 1QVFB 1O6ZA 4WKPA 3WKCA 2B4RO 2O3QA 1ESEA 4NTZA 1HZJA 3R6WA 2C8JA 3JQFC 5TF0A 4UQPA 4JC8A 3JQ7B 4BCDA 5KQSA 4R1TA 3L6EA 3UFXA 4EI2A 5K8UA 5TMDA 1J8MF 2LRHA 3L7LA 4JYPA 2DPXA 4G5HA 2BGJA 1N2IA 1N4DA 5B1DA 2YW2A 5IKMA 4HH4A 3T8YA 2LCIA 4RYDA 3QEKA 1HSZA 3DE7X 2IC5A 4K9LA 4LZPA 1XHEA 2O6LA 4LKRA 3A9WA 2WM3A 3N28A 3BDAA 2FMHA 2J9YB 3B70A 1JS1X 2C3YA 3F7MA 4GUDA 2V6JA 3E9ZA 2CLMB 3MYRA 2JFYA 4U2GA 1ZNZA 3EQ2A 4YROA 4ZCQA 2ISQA 1FQOA 2D06A 1OGJA 2E4VA 3D8UA 1QDEA 1X13A 3EG5A 4EPXA 2PSFA 4WZAE 3H0EA 2WJZB 5CYPA 4X7RA 1Z74A 5DZSA 2AEFA 2CHFA 4RY8A 1TVCA 2EL7A 5K0CA 1ZKDA 2B1IA 2GBLC 4FGLA 2WWFA 3OZ7A 4PX3A 2EKLA 3WY9A 1BC5A 4I46A 3BMNB 2FY8A 1S7GA 4DRZA 1F38A 3ZV3A 4R1QA 1TM3E 1XR3A 4Q9NA 1OAOC 3RBVA 2PKWA 3OF5A 1RE0A 1EK5A 3JW8A 4A8JA 5D6OA 1C1YA 1XXHE 1Z6GA 1VLOA 1O77A 2GCOB 2G5PA 3RS0A 2Z8YA 2HWYA 4V39A 1KAOA 3T35A 3AO0B 4G41A 1JEOA 1UXOA 1G20E 3PA8A 1OREA 2Q6KA 1ODKA 4DEVA 1JB1A 1AXEA 4Z4SA 2I7VA 1QGDA 2XWBF 3A7DA 1KMMA 1UMDB 1VCMA 2XRFA 5NULA 4BASA 3ZWWA 5E1OA 4QICA 5FAKA 4CUKA 2IP4A 1EFPA 1NVVQ 2F62A 1IHYA 2XECA 2AQHA 3B6KA 3MWYW 1HT0A 3D2AA 6NULA 4R7ZA 3H6HA 3RYHB 1F2VA 5CT4A 2CWDA 2GKSA 2I9KA 2QN1A 1YB5A 2ZRLA 4ES6A 2X6XA 2F1IA 2W0SA 3TM4A 4RZIA 2VHJA 4BNDA 5M5BA 2JA2A 5AQ1A 2J3KA 2QN7A 2I3BA 3K70B 1BE0A 2I3ZA 4MRSA 2PQ6A 1RHMA 3I72A 2VNKA 3EVDA 2CK3D 5TVKA 4ZO6A 5AT1A 1QHFA 3RADC 4QO7A 1ZK1A 3JYLA 3VR4H 5F5LA 3D0KA 5ESDA 4LPSA 4CM9A 4B8ZA 3H7IA 1WHTA 3Q8MA 3O2NA 1E3DA 4XPZA 3DEYX 2V7VA 1A8QA 1FYWA 4RSGA 3VOAA 4OIFA 3SC2A 5BP7A 5MN6A 4C0LA 1N0VC 5EIWA 4JI1B 4L9RA 4GR4A 5BSWA 4RVSA 5LL6P 1AX9A 3PUXA 4Q1CA 2V8OA 1IVSA 3BPSA 3PC6A 1NQVA 3O03A 4G1CA 4S35A 2QX9A 5JNLA 2QQGA 1XKTA 3IA2A 1ESNA 1G4AE 3ECSA 2UZAA 2O7QA 3L8CA 5GOZA 2RMKA 3RREA 2WF7A 5CFPA 2H63A 2H3HA 5K3OA 2XYPA 1U98A 4X7FA 2ZCUA 1T2EA 4O1IA 4OSEA 5K09A 2VQFB 3E5RA 5KTTA 4Q3CA 4UMVA 2HOQA 2HK6A 1R9JA 1OB0A 3ASVA 1MVOA 3HO8A 2QQ0A 2H4JA 2DXIA 1IM2A 4HLQB 1QU3A 5EP4A 1I1QB 2CY0A 3DQPA 3SLKA 1KC3A 2P69A 1K4MA 2X40A 2XCOA 3BB3A 4FWBA 4DE5A 1Q14A 4U5XA 4OHVA 3TTXA 2ZTHA 1HDYA 1H69A 2WKPA 2I6SA 2PL1A 2EEZA 2IVFA 4E5PA 1EHIA 1JIIA 2QX6A 3H18A 3L8EA 4FBGA 5BYJA 3U49A 3URMA 5B36A 5CM8B 1LV8A 4FE7A 4JJEA 2YDXA 4PQYA 2CLLB 3W05A 4RPBA 3FRHA 5FBRB 1EXNA 3WL4A 3JQAB 2B78A 4OKIA 3RJ9A 2AJ8A 3GGCA 1HT1E 3WWPA 3N0TA 1GQQA 1MDFA 2ZI4A 4FXPA 5D86A 3Q4GA 3RO7A 1B76A 3A1VA 3VNBA 2J30A 2PLWA 2X41A 3QVUA 1I1NA 2KWIA 3HXTA 4R40A 3LUKA 1E62A 1DEOA 4RDHA 2AD1A 1NJ6A 2QGNA 1B00A 1KMCA 4B0PA 5J4KA 3R3UA 1Q19A 1WKVA 1S2NA 1Y7PA 5HS4A 1E58A 5JDIC 2JN9A 3I9JA 2GJRA 2AFIE 1CUCA 1UPBA 4LDQA 1FNMA 3HEMA 3VZCA 1UBKS 3AETB 1WLYA 2I91A 4S2UA 5DBIA 3MERA 2CF5A 1K4KA 3OKCA 4I1RA 3NP7A 3CESA 4EHJA 4UMEA 1OX4A 5E7JA 5EIAA 4DLTA 1OA0A 5EA2A 1CV2A 4Z0PA 4JJAA 4QGHA 1RI3A 2AN4A 2VYFA 3O3CA 4Y2SA 3V7NA 4DHWA 1EVKA 2WM8A 1T5LA 2YXPX 5TB5A 1CE8B 3I5YA 2VBTA 1V5WA 3NTOA 1IY2A 3NHUA 3PNSA 2FLWA 1D9XA 2YX1A 4P53A 3BAZA 3A28A 1I4TD 1GPYA 1KZ7B 1QRRA 1SOVA 1T1GA 2WFAA 2X5JO 3QJGA 1F12A 4L8LA 3NEJA 3NETA 2BEWA 2A9KA 1U6IA 4FT2A 1Z0UA 4M0MA 4A23A 4P12A 1XJ0A 4MKFA 3R7NA 1HBJA 2OHVA 2VVTA 3NDRA 5ED0A 3U3JA 1RHRA 5DTJA 3UZUA 4WIAA 1WW8A 1AMUA 2X3FA 3P0FA 2QXTA 1Y0BA 1M1XB 5FORA 4BO4A 4PWYA 2WTNA 4WVLA 3GLGB 4XN3A 2DTEA 4JBYA 4PAAA 2FPPA 3DMTA 1D2HA 5H68A 1AUQA 1JVNA 1JQKA 5F3WB 3COYA 1NDQA 5E9QA 3TOZA 3AYZB 1ECLA 4RAOA 2YJNA 1FMTA 5LZ2A 5AM1A 1N4AA 5B6JA 1MAUA 3DMRA 4Z0NA 3ZEAA 2JBAA 4V02A 2W48A 3DL0A 2B82A 5I5GA 1E2DA 1F0KA 4HWPA 4L22A 2REXB 2XDWA 3FYDA 3HCRA 1Y9EA 1D2GA 2DZDA 4KIUA 2Z5LA 2MJLA 4L51A 2ST1A 3VNAA 2RAFA 1X86B 3FKSA 3IUPA 3OLYA 4RA9A 3J80A 4PHTA 1ZSYA 1QKIA 2FN9A 1NLMA 1P9WA 1Q82D 1INLA 5L3QA 5CAEB 1ZK3A 5HKKA 2HGZA 4NBSA 5JIBA 2M5SA 3ASRA 1U9YA 1P7CA 2TMGA 4H31A 3WMWA 3RWBA 721PA 3TRDA 3T9CA 5KEIA 4JI8B 2BY4A 1N2SA 4GMGA 3ZJUA 3PNLA 5LMNB 1I33A 2D1FA 3ZJYA 3DZGA 3ICQB 2J31A 4BLPA 1DAFA 2E85A 4QOIA 3V3TA 3KKZA 3G9UA 4YCLA 2H08A 5IDXA 3W2GA 2AQ8A 1KU0A 4WK4B 4BKOA 1L8OA 4J0CA 5K8VA 4LW8A 1I30A 4ND8B 2WDZA 3PT5A 3RI3A 1DNPA 4QM7A 2EJUA 3AG5A 4G36A 4IHAA 4M8IA 1G3RA 3HCCA 3GHYA 2JFWA 2R5FA 4Z7JA 3I83A 4YRTA 4EJ0A 2JZNA 3TXYA 2WIJA 3PDIA 1DKPA 2C00A 2B6NA 3Q5DA 4FYKA 4G5FA 1AQ6A 4O4JB 3T1QA 2ZL6A 1BGXT 1UFOA 3ON5A 4HAYA 4UNQA 4WNYA 2HQSA 5ECGC 3NHSA 5ILQA 5LLDA 4OP2A 2HMWA 3QKIA 4O4JF 1O8CA 5D7NA 5JATA 1XNGA 2Y6UA 3VOBA 1OH6A 1ORTA 4ZYTA 4F1KA 2IPOA 4K6HA 1P73A 3BXOA 3ER6A 2WSMA 3WYAA 4C87A 4ZEVA 2JLUA 1YZTA 4HGNA 2PKQO 1TTPB 2FB9A 5HRCA 3CLTC 4FX5A 4UQLA 4F86A 3O3MB 1WQ4A 5AOBA 1ZVJA 3MD9A 2WB2A 2D3TA 1MA0A 2X1LA 1N7HA 5JMWA 1CZRA 3CUUA 5LBIA 2BFAA 4LZOA 3NEPX 3RSQA 1SOWA 3GJQA 4R9RA 3DAFA 3TR6A 1Q1GA 1FVOA 4B47A 5HA5A 1DJPA 1GNPA 3C97A 3I3OA 3F8SA 4LYAA 4LBWA 3AR8A 1SG6A 1T9BA 3NBMA 3PNMA 1QS0A 1Z6ZA 1B0UA 3GLHA 2UVDA 3L0ZA 3KTAB 3JY6A 5HF5A 3I30X 3UWSA 4TOIA 4BQFA 5T67A 2J0UB 1Q7RA 3C87A 3ZNOA 1KJNA 2FSFA 3CG0A 1C1HA 1X2BA 1Y4DE 2FMFA 1P0IA 3N87A 2GHRA 4PBTA 4RLQA 3T4UA 3BKWA 4JB3A 3T9DA 3V4SA 1E69A 1T2NA 2GJ8A 4TVBA 1BHO1 3DE3X 2WBLC 5IW8A 4QDJA 2XTNA 1COZA 3KS9A 3PEVA 4H1VA 4CG1A 4TTIA 3RS8A 5D8DA 2OWDA 1NU6A 2IQIA 1I8DA 2QLBA 2PQMA 4W9MC 4JIGA 4LCJA 1NDUA 4G1BA 2OHIA 3BJRA 1YU9A 3EOAI 2W98A 3GEEA 3KKMA 4X91A 1F8GA 5EHNA 4C4PA 4W5TA 1CCWA 4PX9A 1KBZA 3B82A 3BY2A 2HRCA 1NZFA 2VPPA 1WULS 2YOHA 3AQIA 2PH3A 3BCRA 1DT5A 2YQZA 3R6DA 5JCOA 4CWAA 1MQ8B 3NYWA 1CJMA 1WKBA 3K0EA 3F47A 4G2NA 1DTWB 1JPJA 1C50A 4MHOA 1PFKA 3PQ7A 1DCTA 1PJ2A 4FYIA 2YFKA 4G63A 4ENTA 4KR2A 1RMYA 2CDNA 1DCFA 1TRHA 3QVSA 1EFTA 5IBPA 3OICA 3N2EA 3VR2D 3Q7TA 3PXBA 4HGZA 1R6DA 2W11A 3OKFA 2X8BA 4EA6A 4X0CA 3FPGA 1K3FA 3H1AA 4REMA 3P9CA 5JBQA 1CUVA 2IY8A 1YE3A 3QVOA 5DM60 3IESA 4UOZA 2QVCA 1NF3A 3C7DB 3O1LA 4I5FA 3E05A 1W0KA 1A72A 1D1PA 1REQB 4I4TB 3ZIUA 4H16A 5KYXB 1VBKA 2DHQA 3T5CA 3LC7O 3WNZA 5AJZA 1WEKA 1C4WA 4PV7A 1TOAA 4UUMA 1OKKD 2ZJ5A 3TEJA 3OT4A 3H2ZA 4DPKA 3IOMA 5CDSA 3IEKA 3ZEIA 4UJ5A 3PQ3A 2A88A 1NKTA 1NYRA 3BGWA 3QUQA 1L5HA 1E6LA 3RB8A 1XKQA 1P5HA 2MSDB 1UR5A 3LBFA 3QWIA 1SQSA 4JC0A 1XIVA 4CEHA 4MHTA 2OPHA 4MR7A 3LT2A 3RK4A 2RHBA 1NM5A 1Y1TA 1Z6AA 4OIMA 2MCFA 3GLFA 3FLBA 4QPZA 4Y30A 5CNIA 4AO6A 4YAIA 2GZMA 4KFTA 3T5TA 1TADA 1U3CA 3CNLA 2ERYA 5THXA 1BWPA 1RI4A 4L78A 5CR9A 3U26A 5KNCD 3GBSA 1TK3A 1WZUA 5BN5A 3MTAA 2QUKA 5H82A 1Z07A 2HSWA 1T4MA 4BVBA 5MGBA 4BQNA 2XXJA 4RF4A 1KMNA 3QKSB 1J8DA 4FYWA 4K6MA 4MV1A 3RS2A 4BFYA 3D0QA 3MK31 1QGOA 1XALA 1QIGA 4GICA 1A0OA 2AOUA 4CXMA 4NK4A 1FVFA 2BFBA 3WK8A 3LAWA 1AUPA 4GLLA 1WRBA 1K5GA 2AOTA 3NLLA 5FRDA 4AS2A 1P91A 4BNJA 4B3DA 4RF5A 3WX0A 1V5IA 1QAOA 2G5GX 1O4VA 1XD2B 2C2KA 3FPKA 3IV7A 1T24A 3NBFA 5JTUA 3GD5A 3EZ9A 4K3VA 1P17A 2H7YA 1U9ZA 3LECA 2QRHA 1A8IA 3MQ4A 1A97A 1YIDA 2E4ZA 3Q7PA 2IYWA 5G1PA 4CDGA 4B3SB 1LBHA 4CL8A 3I6ZA 2Q5JA 2EX4A 1Z2NX 3WIBA 3QIVA 4AAYA 1CJVC 4ND2A 1TU0A 1ONPA 4Y98A 3KQUA 4K6GA 2O1EA 1Q0ZA 2XKAA 2XTMA 4OYYA 1QF6A 1DL5A 4KDFA 4UKDA 1E5TA 1UQTA 5EC8A 3LXMA 3TLBA 4GNRA 2V74B 4S12A 5DYTA 3VH1A 4DLXA 1MZPA 5IXYA 1EVJA 1P2TA 1JQLB 3DWFA 2FG6C 3AT1A 2ZYRA 5SY6A 3JYQA 4EG5A 3IBTA 1LF5A 1XVUA 3GMDA 3OU7A 4OXQA 1RLIA 1YQDA 1PD0A 1GCGA 2CHUA 1M8KA 3G5AA 3UFBA 2WHXA 1RYEA 3QFRA 1U3UA 4OAQA 2OXRA 5D51S 3W2IA 2KW5A 1CD5A 4CMEA 3PX7A 1L8QA 5B1SA 1WBJB 4TUYA 3E3NA 1VGQA 7ADHA 1LNZA 1E1QD 4Q02A 4RD0A 1SA0B 3GVKA 1YB6A 2IPAB 3EVCA 3K5PA 3QX9A 4HXFB 5F3RA 4BFLA 3MLEA 4RE5A 1FUEA 3BFKA 3QM1A 4CL0A 4YRFA 1NFFA 1OIXA 3T12A 2NUTA 1XRJA 4FEYA 3V2HA 3ENVA 1GV0A 1XJWA 3L4EA 1WKCA 3P2KA 2UUPA 1R16A 1E2EA 2F90A 3P9QA 4MEJA 4RHFA 4RMIA 4C0AC 5C35A 1J8QA 2ON6A 4RY2A 4NPHA 1VMIA 2UVQA 5FJJA 4RCYA 5BR7A 3CO5A 4BXOB 3I3SR 1MOQA 3A2NA 3L02A 4UBOA 5JCXA 1ILEA 1NRWA 4M2LA 2G9QA 4GPZA 4LSMA 4JELA 5LD2C 1UZLA 2ZEJA 2Y9MB 5GONB 4AVZA 1TK9A 3EXIB 4LSZA 5DULA 3HB5X 3ZE1B 2QAGB 2ZR0A 5HRAA 3AZPA 3LNNA 2WSBA 4D25A 1O6FA 4BU0A 1GUAA 2HKIA 3PFHA 5GONF 3M6UA 1IOVA 1K7CA 1SCIA 4YELA 3IQIX 1NY6A 2JFUA 2QX4A 2J5XA 2ZR7A 1YSCA 2K5UA 3PF8A 4P34A 1IONA 3NRBA 3DDWA 2A5YB 3GPLA 3CPXA 1X42A 2E82A 4AQYB 3SSMA 1IXYA 2CNWA 2QTFA 3IOYA 1Y8RB 2IDKA 3HAGA 3W8DA 1C8KA 4L74A 3WISA 2FKAA 3DLPX 2C7PA 1YZKA 2P2GA 4V0QA 2V59A 4HDNA 1ZC4A 3V1KA 3G0CA 3PWKA 2EJVA 5HILA 3WG9A 4BYGA 1IVYA 4GUAA 3IULA 3G4SB 2FGKA 2H2GA 2NUAA 3B1YA 3IAS6 3OX4A 4IX9A 4O2AA 3OE7D 1BKYA 3ZZUA 1WDMA 4UE6A 4EEKA 2E4XA 4B3GA 3DFFA 1AB5A 3QF7A 5KJFA 2JIDA 3K5HA 4A2WA 4R54A 3WLLA 3CC8A 2FETA 2WG2A 5KOIA 3K9NA 1X77A 3BCHA 3LMKA 1NXQA 4I14A 3I45A 5BMOA 1NBHA 4UNIA 1PR2A 3AF3A 5EL0A 3KYDB 2WNHA 4FDUA 3AVPA 1PN3A 4NU5A 1RRPA 4IMPA 2WG1A 1G21A 1MU0A 3LKBA 4C6HA 2AFHA 5P21A 3LBHA 1Z6TA 2FCAA 4ZGWA 3JU3A 4IMJB 4QXPA 4AMVA 1XTRA 4L7QA 1LW6E 4XQFA 2ZYHA 3I9LA 3RFUA 1VIVA 1RM5A 2XZPA 3P2YA 4LTDA 2JLRA 5DYYA 4BIMA 2PWPA 2FHPA 3GZJA 3KDSE 3PDWA 1KFCB 3EARA 3IP1A 2IYRA 1ZMTA 4OP3A 4GXTA 2X85A 2RGNC 1BRMA 1ADGA 4FSXA 3X0DA 1V0FA 3LFHA 3KWMA 3OPXA 1W30A 5AXCA 4YRJA 4U7DA 3E82A 4PYKA 1E79D 5BY2A 1RBZA 4BLWA 3KQHA 1TUBA 1E1LA 3STXA 1GN8A 2CJWB 2X5NA 3ONVA 3IRUA 5A8AA 1G7CA 4GLJA 5DHFA 3AFMA 5I7SA 2DBYA 4ZGGA 2FWMX 1TYDE 5JI3E 4MA0A 2DAPA 3GH3A 3ASSA 3IAUA 5LQKA 3VC7A 2XVAA 3G7UA 3IAEA 1AKQA 1GLGA 4CG2A 3TLKA 2Q7XA 5FOSA 2C98A 1KMIY 1KI4A 3ZWDA 2QI9F 2FI1A 4LE0A 3LPAA 3BA1A 1HVXA 3WQHA 2I33A 2ZIUB 1A9SA 5CLJA 3DBRB 1K28D 1A77A 2A7QA 4HFJA 4KV7A 2QDXA 2O5VA 3VPAA 4HVLA 1KDPA 2O8DA 1E2MA 5G40A 1E4EA 2EQ5A 3C3PA 2PGNA 3PCRB 3SQDA 4NH0A 4ZEWA 1NJ2A 1MO3A 1XD9A 3VKVA 3VJLA 4O63O 2ZIXB 1Y3HA 4IQ0A 2OQRA 3L0SA 4ZREA 4ZI5A 2YNMA 2JVIA 5K0FA 5T5QA 2V0GA 1YJNB 1Q44A 1V11B 4LHWA 4W1RA 4BFUA 1ZK2A 4WBNB 3KSAC 3H8SA 3LHIA 5EXEA 3I9FA 1SVKA 2I2AA 1GFWA 2ZT7A 3WA6A 3ORRA 1N07A 3PQFA 2ILVA 4HDCA 3W9UA 4WBNF 4G0WA 1GA4A 3I01A 4KLZA 3PGMA 4B6GA 4A91A 5IMBA 4INZA 4YUAA 4JWTA 4BJ3A 4BTLA 3ADPA 3EQ9A 3A7EA 3ZV7A 4FFSA 5IWAB 4FKZA 5AI9A 1PIWA 2IPLA 3WIOA 1A71A 2VNJA 1KJ8A 1ODFA 1OPRA 2FEXA 2I1QA 3EMDA 1VL5A 4DLUA 4FIDA 1ZU4A 4Z4ZA 3GUZA 4ZZ2A 3SSNA 5I7WA 1RABA 2KX7A 2BMEA 3QEMA 4OHCA 3TNJA 2AJBA 1TPZA 4OQDA 4GP6A 4B6JA 2O2JA 1JNXX 4HHEA 5I7FA 2C7VA 1R9GA 4CTMA 3KR9A 4RCVA 4EPVA 1JDBC 1VQLB 1GTJ1 5GADl 4XIIA 1XFAA 1R0ZA 1W4RA 3KTFA 3LDHA 2QGGA 4M9ZA 1C0EA 2BZ1A 1KJQA 4GBJA 4Y6GB 4R7GA 5AI5A 5JZMA 3UXEA 1IDN1 2RI0A 3BUSA 1Q86D 1RPZA 2BP7A 5IM5A 3ZHQA 3GBVA 2DECA 4JB0A 3FDJA 4DIMA 4OI0A 2HJHA 1ORDA 1IHMA 4NE9A 2Z8XA 3U4MA 2J32A 3MTBA 3I9OA 1PSZA 1Z4QA 3HDHA 4JJKA 4PM4A 3L9XA 3IALA 1B74A 1UJ4A 4W9RA 3B2QA 4XQ0A 1GZ3A 4CV3A 3THWA 3N2GB 1WM1A 2ZWMA 5LZ4A 2WJVA 3QBEA 3L46A 2IUEA 4JXKA 1NW3A 4UAUA 5KDDA 2Z9CA 3CSSA 2EKQA 2R6R1 1CUIA 3C6YA 4JKYA 1R12A 1UEJA 1PR5A 1D8AA 4GC5A 4LRQA 4WCFB 3RKRA 2J6BA 1G5TA 1W1WA 4UUOA 3FDFA 4CPDA 3GX1A 1SUWA 4NVRA 4RMHA 4GDMA 3FWNA 5CA0A 2DMRA 3ORYA 4CF3A 3FPCA 1LVGA 2P3QA 4JP1A 5LQUA 5CURA 4LDNA 3M2TA 5AW6A 3IQXA 5HUQA 1NW7A 3CWZA 2J3QA 5BW8A 5ICGA 4IJ6A 1TF5A 1UDXA 4TYPA 3W5BA 4QGGA 1JEYB 2P4UA 2WFLA 3L7CA 1XROA 4JOQA 5F9HA 2O8CA 2ODWA 2IEZA 5AKYA 1C0PA 1U0FA 2ZYTX 1NONA 5AW0A 1KWGA 1SMKA 1DIGA 2ZIAA 3NAGA 4L6AA 4D57A 1W0JD 2HF9A 3A1UA 3EXG2 2QRLA 3CT6A 2C94A 1NR5A 1ZCZA 4L0CA 4IR7A 3CZAA 1U2ZA 1BEZA 2L42A 1E2QA 4HBGA 1KKLA 2UVPB 3P7MA 1H2XA 1X7XB 2ZSHA 5CX1A 5AHWA 4M0UA 5ECDA 1JA0A 5A3SA 3UH0A 5JNTA 2VTDA 1X38A 2XE8A 3MGGA 1H1TA 4LOIA 3OPQA 3QPCA 5JS2A 1V5FA 4IW3B 5D2CA 3LDGA 3L0BA 4Q4JB 1KI6A 2ATEA 2H5EA 3OOHA 4NU6A 5BOSA 3PF9A 5ER6A 1G16A 4Z4IA 4GMFA 3C5EA 2VYND 1U11A 4HYEA 1N57A 1O89A 1TZMA 3DNMA 3QE3A 3WKDA 3JQ8A 3WRWA 2M6RA 2RHDA 2GRAA 1SRRA 5THQA 3RC9A 2IH5A 1YZVA 3T3GA 1AHIA 5LDDC 4UD6A 1FDUA 4LS3A 3PT9A 4MVCA 1KZYC 2I6GA 1U7XA 2X4IA 4KKXB 4XWYA 4YP0A 1E60A 1LXCA 1QVGB 2C2OA 5AK4A 5KWSA 1YF3A 3P20A 5L4SA 1RWKA 1Z9BA 3UHFA 3Q2IA 5FFMA 3KQPA 3AHDA 2I4NA 4H7PA 1N5MA 2GI4A 4YXWA 2RGEA 3ZTWA 4X65B 1NT4A 1PF7E 3LKVA 1G3IA 1R10A 1WQ1R 3CBQA 1LU9A 4FFVA 4L4XA 3L8DA 2O0LA 3BHNA 4TVSA 1Q0TA 3RVBA 1L7PA 1M6NA 1ZH0A 3PQDA 4LYDA 3WLHA 1S3IA 4KLNA 4RADA 1HF3A 1MC8A 4FZ5A 3TQTA 1L4GA 5JWRA 3NC4A 3VTZA 2XKBA 1XOIA 3C5CA 4GE3A 5KC9A 4C7OB 1A9TA 4P9NA 3FN4A 1ORVA 1UBMS 3P0EA 2HBQA 1RD4A 1M72A 2W8ZA 1JG2A 1W5FA 2VJOA 4LE1A 2XF2A 3IIMA 3IO3A 5K01A 1FQKA 4LX0A 1KJWA 1Z4LA 1EDBA 4G6IA 2X58A 4CCYB 2LNDA 3DD1A 1YRYE 2NU7A 1G1AA 4ACAA 2C95A 3PUKA 4U2DA 1P4GA 1G6HA 4RDJA 1PLKA 2HJGA 3UGQA 3UW1A 1QOPB 1HL3A 3ONUA 1GXSB 2WU4A 1GQFA 4FYYA 2Q2VA 3VU9A 3W1VA 4F84A 2G17A 2Y0PA 3F96A 2B9EA 1SU7A 2VUIB 4M98A 2OUIA 3UT5B 1S02A 1EX7A 1QIHA 2PA3A 3KEMA 1TO2E 1VLVA 4BWVA 2Z6BD 4O5AA 3EVBA 1FFYA 3QMVA 2NIPA 5DHTA 1IHOA 2H18A 4LTMA 4RVDA 1VCOA 4A2PA 3RK0A 3ZVKA 1NN3A 1NW6A 2IOQA 3K4HA 3ZY2A 1RLJA 4ECAA 2FPGB 1FTSA 3UANA 2AB0A 4UTVA 1JZQA 4L8JA 3RRNA 1K6MA 1NOJA 1JIJA 3QF4A 4YA6A 3VV3A 4H08A 1DQYA 1OFHA 3IKMB 2RE8A 3LHDA 1YS1X 2XF8A 2XDYA 4GW3A 3RVOA 1YQGA 2VKQA 3ODGA 1B93A 2HDOA 5ALKA 4AG3A 3EF3A 3TSZA 5C4IA 5GV8A 2BC9A 3E2PA 3DE6X 3ONYA 2A3NA 3ZLVA 1GKKA 3BIFA 3VSAA 5BT9A 3BFPA 1PJZA 3DOFA 4HN2A 2X9QA 1L1FA 2OCGA 1DC8A 2GLTA 3SK0A 3UV7A 1QQ5A 4Z9BA 1E8DA 1WXIA 1P5FA 3IP7A 1PVVA 2IHZA 3MM4A 2DLDA 3HB1A 5KO2A 4PWZA 1XCLA 4TL9A 3S2FA 1UOQA 1IUNA 2IUSA 3NHPA 4XJXA 5IDYA 4AZTA 1ZGCA 2BIFA 2P5YA 1VBNA 2C83A 3IELA 4MVJA 4QXMA 1RIFA 4MV6A 2Y3IA 1QPGA 2EEPA 1PQ4A 2HU8A 2ZRGA 3K9CA 3E5MA 1CK4A 3ELWA 3OOEA 5ICFA 1W4LA 3MB5A 1IEVA 4IDHA 4B33A 5JSFA 2BH2A 1OI7A 3OI7A 5CUQA 4HDRA 4CKWB 1SIWA 3L8GA 1KY5A 2CNBA 2QM0A 3CTMA 3WB2A 3CZCA 1KHTA 5DTIA 4DSTA 621PA 1PGQA 3ANMA 2GZSA 1GU7A 4BNIA 4ZHQA 4RC9A 5C5EA 4EG6A 2C88A 2YZMA 1V0EA 1L5MA 4OLHA 3B8HA 3ZYZA 2DR2A 2FUNB 5T6MA 1W4BA 1YOVB 4QBFA 3V8NA 2WSSA 3DOHA 1CUFA 5HYVA 3P19A 1SRQA 4Z1MA 2B61A 2C03A 3NIGB 5C31A 1F4VA 4B46A 1O54A 1KI8A 2EVWX 1NUHA 4AJ4A 4EELA 4MSUA 1NVDA 1WR8A 3LA6A 4LV6A 1KI1A 4WY2A 4BUJA 1P1JA 2QORA 4CW7A 4RORA 1PFQA 2OYNA 4HGPA 2WINI 2YVLA 4TWAA 1Q7GA 3CP8A 1P3DA 4EG3A 1DQSA 1XCGB 4PO8A 3OOSA 4YLEA 2ARKA 3U5ZB 4IF6A 1PJBA 1PU2A 4QFBA 4XYGA 4V1CI 3PHJA 4TM7A 1HDRA 1LS6A 4KAJA 4BO6A 3S1AB 4WKBA 4ESHA 3FMPB 5C52B 5G0SA 3X1MA 1I3KA 2IF2A 1CUYA 3E3MA 2YHIA 2G9RA 3HA7A 3ILVA 4HQKA 3TYXA 4CKXA 4F5WA 5GAJA 3BYZA 3FYHA 2HWUA 2O5EA 3RYFB 2H2WA 3E70C 4KRGA 4PSKA 1J21A 2WKQA 3E4DA 1DHRA 1FK8A 3H5WA 1F9AA 1FDTA 1B6TA 4QVAA 4DUZB 3DWIA 4OU4A 4NG4A 2V9CA 1XZEA 1HDOA 1PW7A 2OXTA 4JB2A 4NYJR 5IUKC 3JXEA 3ZPXA 5C1OA 2FW8A 3AR7A 4HAOA 1PK9A 3P4YA 3OCWA 4C78A 4DLVA 3U44A 3VGJA 4JJFA 2ORWA 3C7TA 4EJSC 3OP4A 1Y6FA 4CF6A 5JR3A 4AU1A 1MF7A 6LDHA 1G8FA 2HT1A 3VPBA 2ZT5A 4FTWA 1B8VA 4MI1A 3EIUA 1XK6A 3AJ9A 5SY4A 3H2SA 1MG5A 4Q03A 3H6KA 1UDCA 3IJPA 5K03A 3QMPA 1FFBA 1DARA 3LCUA 4OBWA 4BV2A 1AO3A 3A1SA 3H19A 3WJAA 3PK0A 1QVZA 3OWHA 3PE4A 4RK1A 4XWOA 2ASVA 3OPOA 2GSDA 5LZ8A 4BO3A 4B44A 1N9ZA 2C29D 2JI6A 1ZI6A 4D3XA 3G2QA 3KQMA 1Q6YA 4R71A 1TT7A 3KJFA 2F6RA 4MYDA 1UEIA 4Q6WA 4DR3B 3MRVA 5IWCA 1Y1SA 3SWWA 2OBMA 2EKDA 2W2LD 2BSQA 1CY7A 5I7AA 2JJ1A 2P75A 3WXMA 2W8BA 2WJIA 4JBGA 4Y2JA 2PJZA 2I29A 3ASQA 1KFBB 2OCIA 4IOLA 1Z3CA 1WOMA 2Z2XA 1IUOA 3F5FA 1YO6A 2VF5X 3K20A 4HZGA 3FNBA 1KRWA 3RVDA 4PNEA 4CQLB 4EG0A 3CXCB 2E2WA 4CM7A 5J3JA 4XOPA 3F97A 4C88A 4PYIA 3LRXA 1EFRA 2XTJA 3S8YA 3DLTA 3THYB 4DG9A 3ZGVA 2I4TA 1ITZA 3WYNA 2I3GA 5FPSA 1GAQA 1C1XB 2WWYA 2ZBEA 1E6WA 3DBHA 2IYYA 2P9ZA 1TGVA 4URZR 3W9YA 1YIJB 4GMXA 3AY0A 4ZAYA 2OK7A 5CD9A 3EIFA 1UMKA 3FNGA 4MEAA 1U0JA 4ZK6A 5D1HA 2O0JA 1G4HA 1JQDA 3NVAA 3OJFA 4G4IA 5E6RB 5IT4A 1QCCA 2CBZA 5DGIA 1Z4IA 2ZCJA 4DIOA 2OC9A 1CB0A 1F2UA 1SQGA 4DUGA 3BB1A 1E0SA 3LGSA 1NBEA 4MJLA 2MSLA 1DBSA 3ZHTA 2W83A 1E8MA 2WP0A 4B4WA 4Q93A 1GADO 5KOHB 3I6QA 2HSEA 4FU0A 2D00A 4YLGA 3L7DA 3S3TA 1XEAA 4KRYA 1XJCA 3WGOA 1DC6A 3T7SA 2YY6A 4AKGA 1U8ZA 3OCXA 2VKTA 3FYCA 4LGVA 2JCGA 1KI3A 1MV8A 3D2CA 1FFCA 1ULUA 3HBNA 3WI7A 4BEJA 1OLSA 2HQBA 1IDOA 3CRNA 4ILKA 4LZZA 3GOQA