1B2RA

Ferredoxin-nadp+ reductase (mutation: e 301 a)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVATY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN-NADP+ REDUCTASE)
publication title Structural basis of the catalytic role of Glu301 in Anabaena PCC 7119 ferredoxin-NADP+ reductase revealed by x-ray crystallography.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 92
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1b2rA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1b2rA02
5HXBA 1JA0A 1VQMB 4RD3A 3CCQB 1KC8D 1GR1A 3ES9A 1S0UA 2FX3A 2PLFA 3CC7B 1FRQA 3QE2A 1H42A 4P6VF 4ACAA 3CW2A 3LRXA 1FNMA 5TV2A 1EWYA 1KK0A 1GO2A 1YJWB 1D8TA 3JQRA 3AVYA 4G1VA 2RC6A 1ZM9A 1G7CA 4P3YA 5JBQA 4EH1A 1OB2A 4YAOA 1AIPA 1TTTA 3AGQA 1JA1A 4R71A 1K73D 2C78A 1QFZA 1ZM2A 2X3UA 3AGPA 3WBKA 4PC1A 4M1KA 3W5VA 4RJLA 4LBVA 4NCNA 1EXMA 3CXCB 3I55B 2BM0A 4TMTA 3VNUA 2BVNA 1KK1A 2YWGA 2VNKA 3CCRB 4FK8A 1Q81D 1IB0A 3AVWA 4B44A 1HA3A 3AVTA 3CCMB 2QTZA 1YJNB 5H5JA 4ACBA 2QEXB 2PMDA 1OGIA 1GAQA 4FWTA 4F7DA 3JQPA 3CB4A 4B43A 4RD2A 1B2RA 1VQPB 4PC6A 1DDIA 4TMWA 1AMOA 2GQFA 2DETA 4RCZA 4YAWA 3J81k 2XNJA 3WXMA 5KSWB 4C43A 3E1YE 3G6EB 3A1FA 2CNDA 1JJ2B 1KRHA 1FNBA 1ZM4A 3CCVB 1VQ4B 3OZUA 1F60A 4RD6A 4AC9A 2AHOA 4TMVA 1SM4A 3CMAB 1S72B 1Q82D 1F20A 4BPRA 3W5HA 2RC5A 3CCUB 1M90D 4TN1A 4B48A 1YIJB 1OGJA 3QFTA 1SKQA 3CC4B 4DQKA 1QGAA 4J0QA 5GV7A 4PGOA 4PC2A 3AVXA 4M0LA 4G5GA 3CRZA 1BX0A 4Q7JB 1DARA 1DDGA 2OK7A 3LYUA 4TMZA 3QFRA 1D1NA 5FA6A 4Y9RA 3U6KA 3W2HA 1R5NA 4UAJA 1NDHA 5DSZA 2HMAA 3AVVA 2BV3A 1KD1D 1R5OA 4MYUA 3U2QA 1FNDA 1XE1A 1TLLA 4LBYA 3PENA 4QHYA 1OB5A 1GJRA 3FPKA 3VNVA 2YWEA 2VNJA 1CNEA 1U2RA 1EFCA 3QSYA 4ZGNB 2QA4B 5THXA 4YHBA 2VNIA 5AN9A 1GAWA 1DG1G 1EFUA 4Y7CA 1H85A 3WNCA 3P26A 4YALA 2NPFA 1VQNB 3OW2B 2BF4A 4RD1A 2OK8A 3WBJA 1Q7YD 2OTLB 2HCJB 4PC3A 4YAUA 3I56B 2BMWA 2VYQA 3E20A 3W2GA 1FNCA 1EP3B 4PC7A 4LC0A 2QDXA 1KTVA 2DERA 2B5OA 4G1BA 1VQ9B 2B7CA 1YI2B 4FN5A 3ZZTA 1UMKA 1N0VC 2XEXA 4TMXA 1QGZA 3OZWA 3WNDA 1BJKA 2BSAA 1G7SA 4N3NA 3ZZUA 1EFTA 1K8AD 1E64A 1ZM3A 3FJOA 3MHPA 4Y9UA 3CCLB 1VQLB 1QX4A 4IW3B 1WDTA 3ZBTA 4DQLA 4WQMA 3WNBA 4NBSA 3MMPA 4AF6A 3JQQA 4ZV4A 4M53A 4U9UA 2BGIA 3CPWB 1TVCA 3CD6B 3G4SB 3QFSA 3B78A 2YWHA 3W2EA 1VQ7B 2DY1A 1BQEA 2DCUA 3V76A 1E63A 2B7BA 4RD0A 3CCJB 1YHQB 1EP2B 1KQSB 1QVFB 4N3GA 1W87A 4H9GA 1YITB 3OJWA 3LVBA 3VMFA 3WYAA 1E62A 2HDNB 1CNFA 4ZCLA 2ZITA 1J9ZA 4RCYA 4LBWA 3I1FA 2E1RA 1VQ5B 2DEUA 3W2FA 4B3XA 1JNYA 4C0SA 1G7RA 2VNHA 2PIAA 1G7TA 3B82A 3CC2B 1QUEA 4ZGQB 3OZVA 1FRNA 3ZC3A 3CCSB 1QFJA 1KK2A 1TUIA 2D74A 3ZBUA 3CCEB 1IJFA 1QVGB 2QN6A 1QFYA 1QH0A 3CMEB 1VQOB 1VQ6B 4AF7A 1KJZA 1IJEA 5EMNA 4ZCIA 2BM1A 3G71B 1YJ9B 4HE5A 1XB2A 2BPOA 1EP1B 1K9MD 3MCAA 1Q86D 3W5UA 2C77A 2QTLA 3U6BA 3ZZ0A 4ZCMA 2CRVA 2GPJA 2VZLA 2QMUA 3P27A 1FDRA 3AVUA 2XNCA 2BGJA 1A8PA 2YWFA 1QUFA 1GVHA 4M4SA 4M2LA 5H59A 1N0UA 4MYTA 1CQXA 5TR9A 1ELOA 2EFGA 1W35A 1JB9A 1QG0A 4RD4A 1BX1A 4QFMA 3LO8A 2R6HA 1M1KD 1VQKB 3WY9A 2J7KA 4LBZA 4B4DA 4B47A 1NJID 5GV8A 3B8HA 2EIXA 1W34A 2BN4A 3VO2A 1N8RD 3QFCA 1QGYA 1KK3A 1D2EA 4YAFA 1ZUNB 4K1XA 2OTJB 3W2IA 1I7PA 1B23P 5TY0A 1W2BB 3OJXA 4HE6A 1VQ8B 1R5BA 3SJZA 3VO1A
chains in the Genus database with same CATH superfamily
4DRXB 3GPLA 4OG2A 1IFXA 3PD7A 2OKGA 3SJ7A 1XRQA 2G0AA 3QJ5A 3RIMA 1QHXA 5I47A 1REQA 4TKOB 2J32A 3NDPA 3CP8A 3D4NA 3ZWOA 4P7BA 2J85A 2PEYA 1T9KA 1JWAB 1USKA 2XYVA 1RP7A 2OGTA 3HJUA 4IIUA 4MMXB 3TPZA 4KTVE 1XRLA 3L7YA 1ZKMA 2X7XA 3WQZA 5FBLB 3ZY2A 4XVUA 1OLOA 1UJ6A 2XKJE 3GL9A 3OPYA 3SQWA 4A8JB 1ATZA 1R5JA 2P5YA 4JCOA 4LI3X 5FNVA 5KWEA 3DYIA 4ACAA 4NE9A 4D45A 2VPPA 5MHTA 4HB4A 4M9ZA 1ZK0A 2DTEA 1E3EA 3BIXA 3FUTA 4AZ3B 1M34E 1DTSA 3R6GA 3JWEA 2JA2A 1U7OA 5DW0A 4YBZA 4GI3A 3LW7A 4Q15A 4DBZA 1SQGA 5CYFA 4ZCRA 1QZUA 3BXGA 1M8FA 2XYPA 2AL7A 2OLKA 3VR1A 4UPDA 3Q5GA 1XGKA 4QDZA 4A2QA 2EWVA 3D1VA 1ZIYA 2SNIE 3ABZA 2ZIGA 1O0BA 2CHQA 2Z2XA 2B6HA 5SZHB 4BMCA 3PEEA 3KB1A 4CCSA 4Q66C 1E1NA 1ZWLA 4D57A 2YWDA 5GP1A 2F67A 2PEZA 1DADA 2QAJA 3ASVA 3S7TA 1PI3A 3TVTA 2ZB3A 3THXB 3CKMA 2O3JA 1P0CA 2VJMA 1ZM2A 4GM4A 4MUBA 2D13A 2I2XB 1EKXA 3BEOA 4EG0A 4RZIA 1YS7A 4BZZA 5BN1A 4Q9NA 1WS6A 1T1SA 2Z5VA 4TTSA 3W9YA 2AK3A 4TWAA 1IUOA 1V6SA 5F76A 3U49A 4BO3A 3R5HA 3QOWA 3VR2D 4JB0A 2HRZA 1M8GA 2HSJA 1FSZA 2ZWVA 1FFGA 1MX5A 4J6FA 4YMLA 4LZJA 3I34X 1PQ4A 4IIYA 1PNRA 3QVXA 2QOEA 1M6VA 3C4JA 3FTEA 4URYR 2QX7A 2CNKA 3VISA 2IYVA 3IAEA 4R6WA 5ALOA 2CMHA 1HBJA 1NHWA 3VR5H 1FF9A 2ZAGA 1ZICA 5KDLA 1LDMA 1U0LA 1LXCA 1T3HA 1T9BA 4LJ9A 4ZOLA 4ME6A 4DQUA 3A4NA 1CZOA 2BVNA 2XOEA 1TM7E 3LGXA 4OQLA 2J9XB 4F1KA 4K9RA 4N7BA 4NG5A 3G0BA 3DMRA 3LNNA 2X0IA 2G5PA 1N8NA 4M8NE 1Z2NX 1SU8A 1TTQB 3ZD8A 3AVTA 3ZQ4A 4RZQA 1LV7A 1KSJA 1YCFA 5IF3A 4HWGA 3KUXA 2REXB 2PCJA 1RI5A 3R0VA 2A33A 3EEFA 1Y4DE 1N6OA 1X7GA 2XMZA 1NBMA 1FFEA 2I2CA 4OJYA 2ZR0A 3LQKA 5E2BA 5KVVA 2OZVA 2Y1DA 3MBKA 1FP6A 1JJAA 2IX9A 1E0SA 4LVUA 3RODA 2ZS9A 1L3CA 1CX9B 3PPYA 1XMVA 3JZDA 4AS2A 1WZUA 4A0FA 3W5CA 1OXSC 1RYBA 3BF7A 1FJGB 2FXIA 3R6TA 2AFIB 1UWLA 3W79A 3WGNA 3S0JA 5EJ5A 2AMYA 1SXQA 1M1YB 2WF8A 3FBTA 1VPEA 2VYND 4IQ0A 1QZTA 1ZUIA 3G8BA 1DWUA 3NATA 3WAJA 4RKQA 4L4UA 5AW5A 4TMWA 1LLDA 1JLSA 1H66A 2GQFA 2LCFA 4D0SA 4O3MA 2QBYA 3KPVA 3W6UA 1K6EA 1UBRS 1IBSA 1FSSA 1NRWA 1TQ2A 1DEOA 2FWMX 2HHLA 2HRDA 2XQVA 3P9YA 3JVIA 1XK6A 4KQ1A 4NYJQ 4A6PA 3KBOA 5BP7A 3IAXA 1LDYA 3N0VA 3PGA1 3R23A 2J3MA 4KXLA 2GJRA 2UVPB 1U6KA 1T5IA 1W30A 2C88A 3VUEA 1N77A 4YYEA 2YL2A 1TECE 5AVQA 1MP0A 1EVJA 1VE3A 3BORA 3LQRA 3MA0A 4QQNA 1ZM4A 3B6ZA 1WZ2A 2VC2B 3LIIA 5HQ3A 5AT1A 1OHHD 1H4TA 4PYLA 5CM2Z 5TPWB 5KQSA 3S68A 3OHPA 4U7PB 3QMVA 4NS4A 1OFIA 1OT3A 2GK3A 3ICVA 1RR6A 3DZDA 1V1RA 4UBJA 4A91A 4YRJA 1E43A 4MV4A 3S2FA 1WA5A 3TAUA 1DAEA 5GM2A 4GPBA 2PUDA 4CR7A 4YP9A 4BPRA 2RGAA 4JR2A 4KX3A 1KBOA 2EARA 1WCWA 5B37A 2QN8A 4QG3A 1P8JA 4HAVA 4GX0A 4MEJA 4XOUA 1U7XA 4WNYA 2WICA 3FDZB 4BNWA 2BONA 2P9QA 5EPOA 2KX7A 4P9SA 3HG7A 5EE9A 5K0GA 2QV0A 4D3DA 3I64A 1QDLB 1JNXX 1K5HA 2HMYB 2Q8PA 5JAPA 4RM0A 2B78A 1WX1A 2ZT6A 2NP6A 4EHKA 2P3LA 1UKEA 1RWQA 2HRQA 3I4LA 1MJ5A 2V59A 3UYLA 2YIVX 1O96B 2ZE7A 4DCVA 4FTWA 3O91A 3QHAA 3HN2A 2LDBA 4LSWA 1Y3IA 4DR4B 5A5GA 3O0TA 4REQA 4TWIA 2JK1A 4GYJA 4Y9RA 3F71A 3ZD7A 5JANA 5EKUA 3HB7A 3BK2A 1T36B 3AI2A 1V3UA 3Q6IA 3RUHA 4NBLA 4EYGA 4EMSA 3FLEA 2GBPA 3RSHA 4KWHA 1JAYA 4HLDA 3AT1A 1HQCA 1Z8NA 3L8MA 4LKRA 1VCIA 2H1OA 4UCXA 2G4CA 3KZKA 4I50F 3UMSA 1WZCA 4HY3A 3T15A 2RG1A 4MRMA 4AY2A 4A23A 1VBKA 3KSBC 3TXYA 4MRNA 3B9QA 3PENA 1L8XA 1GCAA 4KMRA 3OQOA 1XD2A 3KJGA 3W3AD 3LOQA 2ZDQA 2GJ9A 3QWAA 4MB0A 3GGPA 4PX9A 4HQOA 2IV7A 4AP6A 4F4DA 5BWLA 4YUAA 4WBNA 1Z6TA 1K8RA 2VNJA 5KNBA 5EKXA 1GWNA 1IPEA 2J5RA 3OZFA 1YDFA 1B8VA 1EEXB 3D64A 4E03A 1HE2A 1K0UA 1NI5A 1YAHA 3TRJA 1C2TA 1Y1QA 2PM8A 4HOYA 4CNBA 3TW0A 2CBGA 5IXSA 1B1AA 3KC2A 4MI6A 1A5ZA 3WMFA 4AYXA 3HLKA 3L7IA 1XN4A 4MQEA 2QUBA 4UHFA 1DXYA 3P4YA 2CV1A 1NVTA 4PCVA 3VVLA 3FRHA 4FWBA 3E9EA 3ELUA 2ZUDA 1QHSA 2WB2A 3OW7A 1L7VC 3HBMA 3QOYA 1NW8A 3IJPA 4LJAA 4GFDA 2NLOA 1GZ7A 4NENA 5HX7A 3ZWMA 1XCPA 4DIDA 1DJNA 1VZ2A 1PWHA 1WY5A 1NR7A 1RCFA 2C2GA 3RABA 1M2VB 3SJUA 3ZVRA 4EMUA 5LU9A 2ZXIA 1Y33E 2A67A 1RC8A 1H9CA 3C3PA 2BFBA 1PR5A 3G6KA 3T5GA 3UB3A 1PJBA 2O0KA 1W85A 3MMNA 4RNDB 4XLLA 1ZOSA 3RSCA 5DBIA 3C6ZA 2OTLB 5JISA 5KU1A 1D2MA 3KR0A 1A4IA 2P5UA 4PC3A 1GNQA 2WU4A 2Z4TA 4TKLA 5C80A 1DC4A 4MS3A 2XXAA 4F85A 2DU8A 5LB2A 1JJFA 5K45A 1H4QA 3MWYW 3E9MA 5F52A 5KMGB 1WVMA 2JIMA 3REQB 3HVRA 5BMVA 3OFNA 3IURA 4OQDA 2A30A 4EGSA 1SBHA 3BE4A 3TE7A 2HH9A 1EP3B 3OJOA 4PC7A 1NTRA 3ZNPA 4S12A 3ZV4A 4DWVA 3MEQA 2JATA 3MFQA 1Y7PA 3GQBB 1P2GA 3L0IB 3O2SB 3QLUA 4NI5A 4EA8A 1TQ6A 3M6XA 3AZPA 2R25B 2ZT8A 3A37A 5ALNA 4RPLA 1QIDA 4B74A 1O6ZA 5IWAB 3WK6A 1XWIA 1JHYA 3OE1A 2DBZA 2WD7A 1AV7A 4O4HF 4R8VA 3LWNA 3O26A 4HZUB 4MK4A 3ANTA 5M5BA 4NXMB 1JHDA 4AZSA 2VCEA 4R98A 3JRWA 4PXSA 3IAHA 5I7OA 4MUFA 2QTCA 1N9KA 2A1UB 4MW7A 2GFIA 3CRW1 1N6HA 5CXXA 3JASB 4DHEA 4KMSA 3PKIA 2IS2A 1U8AA 3BBLA 3CVVA 4OXNA 3H3XA 3ROXA 4I5EA 4DR6B 5D2CA 2Q9UA 5K0JA 1U11A 1OI2A 2X0FA 3CRQA 1P3JA 4LFBB 2H9YA 4LHYA 1E2DA 3KSRA 1F4VA 1X80B 4ZEVA 2X7HA 1LS6A 2PL1A 4S3MA 5HJ7A 2F8TA 2PUCA 4YFYA 3H99A 2ZTHA 3HZHA 3JU3A 1RAIA 4OH1A 1NQ5A 1YDMA 1Z4KA 4QU9A 3F5SA 3UQYS 4CF5A 1WDTA 3DM9B 3SSMA 4OXQA 3EULA 2VJPA 4D96A 5FJIA 3WNBA 1OVMA 4K8RB 1VE7A 3U4HA 2WG0A 1RXEA 2JL1A 3JQQA 4WGFA 2I3ZA 3Q7EA 3ONFA 4ZVVA 1E79D 1JHVA 2R96A 3GJXC 4X91A 5TB5A 2REOA 3BJRA 4F71A 2IXGA 3F90A 3P0JA 2FSPA 1C3VA 2PJUA 3EE6A 4R8MA 1A8HA 2NN3C 4B3BA 2Q1TA 4CHTA 4C6SA 2OMEA 2FPKA 1TO6A 3A28A 5DTMA 1K8QA 1FS6A 3PPXA 5A2QA 4UPEA 4V24A 4XM2A 4BBPA 3L07A 2EX0A 4AKTA 2Z8ZA 1BQEA 2ZBUA 1V0EA 3KXDA 2J0EA 4KOEC 4HGQA 4LN1A 4QJIA 5DGTA 1N36B 2H9IA 4G25A 1U94A 5CBPB 2H1WA 1LI5A 3A6ZA 3EASA 3KQVA 3NHZA 1KQSB 3VZBA 2FFQA 3HSSA 5JH7B 4IOMA 2KE5A 1B8UA 1EBFA 4WZ6A 4FEEA 1FTGA 1KERA 3LPAA 3IIJA 4RS3A 1Q16A 5CG2A 1W87A 4RPBA 1VLVA 1M73E 2P77A 4GC9A 4Y98A 3QPCA 1YJAA 4F84A 1YITB 2Q3FA 3E61A 1I1NA 2UZ4A 4DK1A 1P61B 2UVQA 5LDDC 4G4JA 1W5SA 2H2GA 5KJFA 2VLIA 1CD5A 3EXHB 1RLUA 1CNFA 5ICFA 2F8LA 1GU1A 2H51A 4H31A 3IODA 3WHLA 1AC5A 1GRVA 1KI2A 1XYGA 2WTEA 4DUGD 4FHGA 3KELA 3LDUA 2E1RA 3WKEA 1TMGE 2FPSA 4D82A 4HS4A 1L7MA 3ST7A 1C1DB 1EH5A 1ZYUA 2ZRLA 4C0SA 4EHJA 4YY3B 3MJTA 3B82A 2D7JA 3DZFA 1MAUA 1QPGA 4WX2B 3ZV6A 5CCBA 4MR7B 4BUJA 1IZZA 1OKKD 2VRNA 5ALKA 3AXSA 1NJ5A 1ZW6A 2J0VA 3IIEA 5FOTA 4D7AA 1WJGA 1U81A 3H5VA 1K7YA 3PWZA 4RYDA 2EAUA 3RYIA 3TNDA 5KYKA 3SZGA 2XSZA 4DEYA 3MT9A 4FR0A 4LNAA 1XCGB 2CDNA 3S2EA 4G5RA 1KMQA 4HGNA 3PJDA 4OYRA 3RIYA 5JXHA 4NCXA 2ANCA 2I65A 3OCCA 4JMQA 3D7LA 5FOWA 4CCWA 4Z99A 4GXNA 3VJMA 1KVQA 3M0EA 4OFZA 1XZAA 2Z56A 1EI9A 2OCDA 1ZM7A 3STTA 3N70A 4UVIA 3WKCA 2ATEA 4IG4A 5ICCA 2XA9A 3A2MA 4P38A 5EC8A 2CHFA 1QO7A 4IV0A 2B8EA 5BN5B 3IEPA 5JWHA 1GG8A 2DUWA 3BXZA 5J2TF 4XWTA 3UUFA 1EX1A 1NVBA 3DHVA 5DNAA 4EPWA 1WE2A 3ICEA 1U1DA 3GVPA 1XQBA 3CLRD 5A04A 1WZEA 4EG7A 2C77A 2IA5A 3H8VA 2QTLA 3PTZA 2IUFA 3BZWA 5D5HA 1V6AA 1V5EA 1ENPA 3GWZA 2WTXA 3AEQA 4UHHA 3O4GA 3SYTA 2PWAA 2QW8A 4UNPA 1YQEA 3KR2A 3TSZA 2IHVA 2OXFA 4GMGA 1L9XA 3IXQA 4L51A 4NIMA 3SQNA 5HF9A 1HURA 3I73A 5TPZA 1ENYA 2OCKA 2WZQA 3D7SA 5JCOC 1FU4A 1BWQA 5JLAA 2L17A 1YQDA 3NBFA 2FSVC 3C6QA 2FQXA 2G1PA 1U4SA 1U99A 3SQDA 3THOA 1H8HD 2IF0A 2ZUEA 1ELOA 4ZODA 1PW5A 1GNTA 2W58A 4M46A 1X7WA 3SF0A 5IWCA 1DB3A 3D6NB 1S7GA 3LCUA 1COZA 4M0EA 1JDBB 1TVKB 3UMFA 2O6LA 4J2HA 1NBEA 4J94A 4U7HA 4P93A 3RW9A 4MWZA 5FAKA 1UKVY 4R2KA 1A0OA 3GIRA 2HDOA 1AUQA 2FMFA 2WPNA 3P2KA 3UKOA 4KQ6A 1AKNA 5AHWA 4JJIA 1YBFA 4PGMA 2O14A 1WLSA 4M7RA 4QVKA 2WEKA 2ZJFA 5K6AA 3LKVA 1J0XO 2PANA 3X0DA 3I9JA 4DIEA 1WOPA 2ZUSA 3DTYA 3LT4A 3QMPA 1R15A 2PXHA 2J3QA 1AZTA 4TTRA 3Q8KA 3WKDA 4AY3A 1IHOA 2ES4A 2CWWA 1YA4A 3RUIA 2YFHA 4K1XA 1AGXA 3E5RA 3NETA 5I7UA 4O4IF 1MHPA 3A1CA 3O8LA 4BTVA 4JI7B 4FHDA 4IDFA 1GILA 4J7UA 4WBXC 5CP8A 4Z3DA 4NNOA 5T3UA 4D8TA 5BV1A 3EH2A 4R1PA 1JA0A 3ISTA 4QOSA 2HT6A 2EWMA 2P65A 2X9NA 3F9RA 1S1MA 1PYOA 2XADA 1QPZA 2YNMA 1J4AA 5DLPA 5TNXA 5ESWA 4QUAA 2I4TA 4H7PA 5D87A 3V00A 1NYQA 1RLMA 4EUEA 2ONZA 5CK4A 1U8CB 3IP9A 1QVVA 4MDYA 4HEA6 4ABTA 1E3SA 4FBMA 1HORA 1V5GA 3L4SO 2FGJA 4DL9A 3SZRA 1CF2O 3L4EA 3DE7X 1N57A 1JI3A 2ZG6A 2X6XA 2HHJA 3TTTA 5HUQA 5JHHB 3DBRB 3DE1X 3GDOA 3PNQA 2EBFX 4YQZA 3NT2A 3NALA 2D1RA 5FI1B 5FTJA 1KORA 4YWJA 1K7EB 5T8KA 2H0RA 2D5BA 2HZBA 4JUDX 4RHTA 3ORYA 3TM5A 2YUTA 2QTBA 3TZQA 3BVPA 4X1IA 2WFZA 2G04A 3VNAA 3IHWA 1X7XA 4GGPA 3AVYA 1U0FA 2JLSA 2Q2OA 5BQOA 1TZKA 4HAYA 2PR2A 1GTJ1 1EAYA 2PUVA 2VCYA 3O2NA 4ZVUA 1Y6FA 1R66A 2Y27A 3MTIA 1C3OA 2Z83A 4KFUA 3E0QA 4CLRB 2QIOA 4MHOA 1HLPA 1XLWA 4CL3A 4EG8A 3H9GA 3AI1A 1ML3A 3QX9A 4BB9A 4PN7A 1YL7A 3EXG2 3I92A 4DAEA 1WETA 1Y7HA 4B75A 1CVIA 3VX3A 4DV4B 1IEWA 2QUKA 5FX2A 3F3MA 3FZEA 4R31A 3FHCB 4LYYA 5HVNA 4GR9A 2J6HA 4BQSA 1L7QA 1M6WA 1RE0A 3RANA 4ZT2A 3ILVA 1SXJB 1TQ8A 4YRIA 4U7DA 3K1YA 1CEYA 4WWVA 1WRBA 2JKYA 2ZS8A 1XKQA 3AY0A 5AW3A 3TLKA 1UMCB 3WRVA 1A1VA 3UO8B 3KXLA 3GCWA 3LBHA 4X3OA 1PGJA 1A76A 1TF2A 2P3OA 2R8PA 4G63A 5ALSA 1RXCA 3UJ7A 4L5AA 3KHKA 1ZN7A 4XL9A 1CQIA 3FKJA 4CMCA 1KDYA 1FW6A 2ECOA 1UBTS 3BGWA 2Z5LA 3KXPA 1IM8A 5K99A 1RQLA 3IDQA 1UDCA 4LQ4A 2QM0A 4QIHA 5EEHA 4D9EA 2F1HA 4RIHA 1T4CB 4N5HX 3JR3A 1KU0A 4Z4ZA 1HH4A 3IAS1 2BGWA 4KYIB 1SZPA 4MULA 1ZH8A 2XHEA 4C7OA 1NY6A 4N6OA 2B0CA 4S1PA 3L7KA 3T95A 4B44A 3COVA 1QIJA 3B7PA 4M1WA 3QUQA 3FVTA 2VJJA 3SZLA 4ZYXA 1GGJA 3FYUC 4LE1A 3P8ZA 2Z3WA 1CUWA 3CH6A 1Q0HA 2FEPA 4GECA 4QO7A 4G0WA 1DOZA 1T91A 3NAGA 4WCFB 3SKBA 4WXYB 3IYLW 3UENA 2P2DA 4Q9AA 1MCZA 4PLPA 2Q3BA 1EGHA 4LUCA 4TS4A 5LPNA 3K6SA 1JFVA 1UMDA 1UT8A 3WMGA 2B8JA 1J7KA 3GW8A 4F7DA 1SB8A 3EWIA 5FEMA 3HJRA 3CB4A 1CY2A 1PFYA 3NWPA 4HVTA 1E2PA 4MO2A 2WUGA 5IS2A 4MV5A 1NQAO 4MB2A 3IVMA 3TGLA 1II8A 3A9RA 3BIOA 5LQNA 1AMOA 1YONA 3MD9A 3WDSA 4YROA 1PNTA 2QNRA 4HMPA 3KQUA 4EUNA 2EF1A 3TXXA 3KUUA 3UHAA 1KJYA 1ZISA 4TV9B 4B6SA 2YUIA 2A0XA 1CE8B 3HKEB 4WZAE 3WGUA 2VSOA 4KJZA 1NUUA 3ZCSA 2CFRA 4P6YA 3VC2A 3RAEC 2NM0A 2LE0A 4DHWA 4F97A 3I9V6 3EEYA 4PNHA 1NRJB 3EUEA 5FAXA 2V3VA 5DIZA 2OP1A 3FHLA 2W71A 4ZOCA 1KS2A 2PGIA 1LC0A 1RQNA 5I9IA 2EDCA 1UBFA 2PGNA 3QHPA 4FP9A 5DXJA 1QF9A 1OZ0A 2YMQA 1E3QA 3AEUB 4WUTA 1LFDB 3ABOB 3KRTA 3ACBA 4D3SA 1S3SA 3LF1A 5EE0A 1V1MB 1Q0TA 3RTCA 2GFHA 4LGMA 2IUYA 1JG6A 3UJ9A 5KHAA 5FIUA 1L5SA 3PGMA 4PGOA 2YVUA 4F5WA 2FPXA 2VDQB 3Q2IA 2GEVA 4KAXA 2WYOA 2B2NA 1N25A 4UUPA 4RA6A 1M0SA 4F9GA 5FWXB 1P2TA 2CJWA 2PMFA 2W2MA 2JCVA 3NAQA 4RVCA 1NNUA 3E05A 4P1ZA 1W5AA 4QXRA 4YXFA 1XMSA 1S8AA 5DBOA 4M0LA 2RAUA 2OCPA 3CUEF 4OXKA 5IBQA 5E7JA 3QA3E 4OTZA 1O4VA 3E2MA 1DKPA 3EA5A 4HMOA 1Y89A 5B3JC 1CS0B 4MJLA 1IDOA 4KVFA 3TTYA 4V02A 1W88A 3F6PA 3GDWA 4EJSA 2OBTA 1W46A 1NJ2A 1P7ZA 2GD6A 2P1RA 5ALTA 3TR5A 1KWKA 3W1WA 2QRPA 5G02A 3HWX1 4GHWA 5D7NA 1TYDE 2OD7A 3DZHA 4L8VA 1ACLA 2XYRA 3QPUA 4RMGA 4E6PA 5DP1A 2O8CA 1G3MA 2HNAA 4UCQA 4KO2S 4CCYA 3EPPA 4MKRA 2BC9A 4RYLA 4YFVA 1TX4B 2ZSHA 3L7MA 2FXVA 3NEJA 4G5QA 4GYWA 4RLFA 4UCWA 1SCBA 1YCHA 2NQ8A 4QTXA 1PK8A 5C2JB 5CA1B 1XVVA 2GLXA 2WUEA 2YS7A 4XDHA 4XX0B 3CC8A 2GZDA 3SOZA 1J9GA 1UZAA 2NOAA 3PNSA 2HWWA 5EZYF 3R9IA 3UAYA 4QPPA 1VPDA 3W2TA 4BLQA 3QXGA 4RF4A 1KSHA 2VEDA 5JVDB 3C70A 5A03A 4JEMA 1DCMA 5DNEA 5F9MA 621PA 4UNRA 4PO1A 3T51B 2LKDA 4IO0A 3PBKA 2WKSA 3GT3A 4K46A 4MS1B 4IIJF 4B2IA 3GJ7A 1NBHA 3VPDA 1E89A 3EUWA 2Q2NA 1A5SB 3HNOA 1MO5A 4NJMA 4BO4A 3W06A 1YKGA 1XTJA 5JNRA 1OXUA 4I4TA 2ZJ4A 4JQCA 2ZBGA 4HN2A 3H2HA 2ATVA 4MQFA 3ICOA 4O4JA 5BQ5A 5AW9A 3T1QA 5C8DA 7REQB 1UWKA 3N3AC 4NJEA 3FOBA 1GU0A 5ALMA 1KZ4A 2FWNA 2NNWB 2W4QA 4OOVA 1GGKA 6GPBA 2AJ8A 2VHWA 1I7DA 2ZYGA 2WD9A 1H2EA 2IYYA 3QKSA 4LIPD 5HBRA 4KIUA 4DCGA 3QIVA 1XTSA 1UIMA 1A2KC 4GXRA 4YJHB 4ZTBA 4AKHA 2XE6A 1SIUA 5GONB 1N7IA 1VHJA 2JRLA 1XELA 2O7NA 1VC2A 1AQ6A 3TZEA 4F2WA 3BSFA 1NJ8A 3OAAD 2XLBA 2V6MA 3SG0A 1O03A 3F8SA 4HRXA 2IP4A 5HZMA 2PWBA 3II6X 3FWKA 3WB1A 4FKMA 5CDYA 4O3FA 1NVDA 1OLXA 2IW1A 3KUDA 4JODA 3EDQA 4LC0A 4OA8A 1GG2A 3KQNA 1V1JA 2RHLA 5F64A 1YA6A 4G1BA 4IVQA 1Q1GA 1TGYA 1HKUA 3EC1A 3HSKA 3UFXA 3I9FA 1B43A 1VOTA 2CLFB 3M3HA 4BWFB 4HYEA 1O9GA 1RBQA 1T1GA 2YWCA 3D4PA 4E5SA 3OQIB 5JZVA 3FDFA 1Q14A 2A78A 3EGCA 4QPCA 5DKFA 4P2GA 1NVAA 1QGZA 3THSA 3O7MA 5KPDA 5E8JA 1BKDR 2WJ6A 4D8UA 2QUZA 3C4VA 1R12A 3DB1A 1FTNA 4XORA 2DPGA 4PAQA 2FCRA 4QEZA 4N8SA 5EXDA 3UCXA 2C5SA 3WHPA 2WFAA 4DLKA 4WY8A 1EUDA 4I1RA 2A3RA 1SD1A 3SFVA 2UYHA 4RY8A 1BCRB 4AP9A 1R1DA 5KYXB 1E5DA 1GKIA 1JQ5A 2PQ0A 4FKBA 5KNLA 3AIKA 4L9WA 4MKFA 1V5VA 3GJ6A 4FFRA 4PYRA 4YJFA 3VKWA 3WLAA 4AJLA 2AUTA 4FLMA 1Y8RB 3WE7A 2FN8A 3H5LA 3VR3A 1BSVA 2OV1A 3FJOA 3EIHA 4WGGA 3WKBA 4L4SA 2DM6A 3RHFA 4YUYA 2XT9A 3OOHA 4AF8A 2YZMA 4PICA 4BU1A 3X1JA 1ZD8A 1XDGA 2A5DA 1XDUA 2QE6A 3CF2A 1KPHA 2ZTVA 3CWZA 3OCVA 4GPD1 4TLMB 4AJPA 5AM5A 5HM6A 2Y1FA 3AQIA 4IH1A 1JR2A 3G59A 1A9OA 4XM1A 3FB1A 2XYGA 3R7SA 3MJFA 5KOJB 3ZBTA 2JVIA 1L2TA 1ZXLA 2DF8A 1NTOA 3GV0A 4RA9A 4UVGA 3ASQA 2H1SA 4BNUA 4MO9A 5CVCA 3PK0A 2Q1YA 3H1GA 5CT8A 4DRXA 5F77A 2DQKA 1GKKA 1O9HA 3HACA 3DOCA 3JD4A 4L4XA 4P53A 3PQ5A 3GGCA 1WM1A 3G7NA 5FULA 2XTNA 4V2IA 4AN0A 4J7AA 4WE3A 2ORVA 5ITVA 2GCNA 4TQAA 2Y9MB 3PP8A 2ZWPA 3MB5A 1KMHA 1UPXA 4A8JA 3IKLA 4KLRA 5JC1A 3ZHUA 4B6PA 1Q22A 2VJCA 1V8ZA 5FOUA 5C32A 1TIPA 3KT8A 4DJTA 4PAAA 1YQXA 2XB6A 3CT4A 2A9OA 2IP1A 4TWJA 3RAGA 3TQTA 4AZ3A 2AUNA 1C7IA 3CVYA 3UPUA 2P0AA 5CX4A 1N75A 1F0PA 2J6CA 4GXQA 1S3FA 4R3WA 5C5CA 2HFJA 2C9CA 1UXGA 5A5FA 3KQTA 1YZ3A 1H2FA 5D1HA 3VHXB 3CH5A 1KSGA 4K5QA 2Q45A 4QTUB 1ENZA 1IBMB 2RDMA 1Z25A 3TOZA 3F7MA 3NHJA 1KFKB 2QSZA 2OBFA 2X40A 4IFBA 1IVNA 4TL9A 1Z4NA 5CFMA 4YIHA 1P9RA 3RYFA 1K7FB 4G5FA 3U4IA 4NU6A 6ABPA 3QBTA 3THXA 2AJLI 1T2AA 1XZLA 4ZCLA 2XA1A 4HQ6A 3OEHA 2ZSDA 3QE9Y 3T3NA 1OH6A 1PS8A 2F1JA 2C92A 2J0QA 4K3VA 3OF3A 4QEKA 4LQCA 4DSZA 3LYAA 2ZAOA 2GBCA 4AJ4A 3T3HA 2IYOA 2VQ6A 1ZNQO 2OL4A 4Q1AA 1JIQA 3MB8A 3K30A 1TIKA 3PG5A 4L76A 4UM9B 1U7DA 2WIJA 2VQEB 5IANA 5T64A 3KZ1E 4HDMA 3ZUPA 2C5AA 4EM6A 2V4DA 2BTQB 4H3KB 5FV4A 5C5IA 5IPFA 3WK9A 2AX4A 1FK8A 1RYMA 2AN9A 2DOGA 1PZFA 1OB0A 1J2YA 4NRDA 2P2SA 2C4KA 2IV3A 4G4SO 4JKOA 2WIAA 3T4EA 2GXUA 1U0BB 1JDTA 3HCCA 1C0LA 4M22A 3TQCA 4CT5A 2H48A 3FKQA 3RB8A 2X9QA 1U3VA 1OWNA 3KJHA 2IH2A 4NDZA 3ZIAD 4AK9A 1P5ZB 4IDHA 4OAPA 1C1XB 2C5LA 4PZ0A 5AQEA 2O2YA 2G83A 4MGKR 2JJMA 5A62A 2YV1A 1KARA 2ZIZA 3A9CA 1J8FA 3T7DA 4AXBA 3VZSA 1L7PA 4Q1DA 3PR1A 1PJCA 1EFDN 2RGCA 4E31A 1V2GA 4M99A 3OZCA 5K6RA 2YY5A 4QLBA 1EESA 2FW6A 3DD5A 3E9YA 2QSYA 2UUCB 1D7OA 1YJ9B 1FLNA 4NYIR 5EIBC 5FBRB 2AFIA 3KK0A 4KXQA 1Q86D 2UU9B 1M1YA 1H65A 1SPBS 2W0SA 4IGKA 4YTEA 1JA9A 2J3HA 3ZDBA 5FL7A 3MILA 3EY9A 3TZHA 4QBGB 4UNQA 1QNFA 1YR8A 1G9TA 3HJHA 1EB9A 1IHXA 1R10A 5EL0A 2QI9C 3OIDA 4QRHA 2QMUA 4QJ3A 3G8AA 5AKYA 3DLCA 1FJXA 3EEQA 4I4LA 4DLVA 4JLDA 4Q7KA 5CX1A 3ROQA 3GNTA 3GXOA 3AESB 2OO7A 2UVPA 1Z07A 1I4DD 1VMDA 4BN0A 3A1DA 3GJRA 4AL4A 4D8YA 2RHCA 1VLYA 1KXZA 4GKJB 3HGQA 1XI2A 2VPWA 3LZ6A 4DJJA 1WSDA 3G5AA 1ABFA 3IHKA 3KKNA 4UTZA 3U13A 1Y6JA 3E9DA 1EAMA 5CJ2A 1EFHA 5TPWA 2EFGA 1CZRA 1CRPA 4P34A 4PCAA 5JDCA 2P40A 3KL2A 1Z5WA 1O94A 2Y6VA 3QYPA 5DPMA 1JJ7A 3HLTA 2X8WA 3WQHA 5IN4A 2VDVE 3FNRA 3DKKA 4Q3LA 1S7CA 2F9FA 4B4DA 1LK0A 4ZQFA 4OX9B 3R6JA 2FPOA 1SVKA 2JCSA 2H4XA 2OCGA 4E11A 2XUKA 5T5QA 4AG5A 2Q46A 1H8EA 3E23A 1P9WA 4MUGA 2JJQA 4BNDB 2DCMA 4BX9A 2OORC 4Q9HA 5BNWA 4GOND 5JMWA 3VO2A 3FDZA 3DAGA 1PD1A 5AKXA 3OLXA 3WK8A 4NFHA 4XNFA 1M5RA 2HU7A 2JHFA 2F00A 4UDNA 3UMRA 3NC0C 2OBNA 3T7TA 1AB5A 16PKA 3Q3AA 5B1SA 1M2EA 3IP7A 2GJPA 3OX4A 5E6RB 3T9CA 4B0PA 4TXMA 2WAAA 4EL5A 1M1UA 1ZUNB 1KP9A 1PV1A 1LTQA 4IXDA 4MSUA 1PHRA 5IARA 1UANA 2LD4A 3W2IA 3G5LA 4MWDA 5ANRB 5A3VA 3TTXA 2XODA 3CVUA 1IL0A 2NXJA 1Z2CA 1Z5VA 2Q3DA 2WUFA 3VYSB 4B3MB 4HE6A 2R6ZA 3Q4GA 4R1SA 3QYJA 4AP5A 3D0OA 4UUNA 1GEEA 4CWAA 4RD3A 1KGSA 1DQPA 1T36A 3BWEA 3SQOA 3EDMA 3INNA 5A0FA 1ZDMA 2NTNA 4NMHA 5SY6A 5ENZA 4QTYA 3FMVA 3FHTA 1V45E 3GRRA 3THRA 1QQAA 3MUOA 2A84A 4C4SA 4LNHA 2CLSA 3QMWA 1R4ZA 5GQSA 4D5GA 4J49A 3SLNA 1X86B 5T41A 3HJFA 1NU6A 1CUEA 3F4KA 4UJ3A 1QGED 2QY9A 2WHRA 4Y2TA 1HNWB 1S9DA 3R6KA 2UZ3A 5TV2A 4KODA 4RHFA 3QW4B 4HH0A 1YUMA 2YVLA 2IGBA 2YDXA 1ZONA 4A6EA 1E61A 5CM8B 2J3IA 2RMKA 5F3WB 2UXDB 1T9GS 2VZ0A 3H9UA 3GEIA 3GRFA 6REQA 4N54A 2GH1A 2QU7A 4Q19A 3REOA 1NR5A 1PO7A 4JBXA 3KXKA 3OPMA 2ZXFA 1AGPA 1JA1A 3LHDA 2XE4A 3GNSA 3JYQA 2NZXA 4ER5A 2E18A 3FTDA 5J1SB 2R97A 3KZXA 3OPXA 3RS5A 1YVEI 2X3UA 1SUBA 3AOEA 1M2VA 4FMCF 2JJ2D 4HWRA 3VNRA 4OA5A 2N1MA 1CRWG 4FFSA 4M8IA 4ML3A 2FFJA 3M1AA 4LJ7A 5K0NA 2R6R1 4BTEA 2BZ1A 2OAGA 2DFPA 4D4HA 4Q7QA 2I5PO 1J09A 1VDMA 3H86A 3DCYA 1MJFA 1OH8A 1U0HC 5JOQA 4MWOA 5CXSA 4KR9A 2ANBA 3CF0A 4I7EA 5IAOA 2JAUA 2RAFA 1IUNA 3T7IA 5C81A 2VNSA 2NO5A 2HD4A 2X5KO 1RVV1 1E99A 2C9DA 1YS4A 3FBWA 2QUAA 3Q9LA 3VNUA 2ASVA 4R0MA 4QDJA 1I13A 3EZNA 3TL3A 1ULBA 3GQBA 1BMDA 1NXPA 2R1ZA 3GU3A 1Z5GA 2GN1A 3NPAA 2PL3A 3R6WA 5JADA 3HCRA 2Z1NA 1UM9B 3NTLA 4MEAA 3P0FA 2OE2A 3KEQA 3PDCA 4D4KA 2QS9A 4RACA 3TSCA 3BIJA 4HATA 3W8DA 1PFUA 4A2PA 1J22A 1DU4A 3GARA 4HZUA 4I1UA 4ZVQA 4QLAA 4BFCA 5A5VA 1JG4A 1NC1A 2QRNA 5J4HA 4C03A 2AQ8A 2ID7A 4OQPA 4NCIA 4YRRA 2PMDA 1FTWA 3U3XA 1SHZA 4J0IA 2A1UA 4JIMA 3TPFA 2DHEA 4BB5A 4JP3A 5KYVA 3B6EA 1KI9A 3JD2A 4JT4A 2V0CA 4M7OA 2B9VA 2Q6IA 5K6TA 3HM2A 1E9AA 2RBKA 1J9EA 3N2NA 3PQFA 1MNAA 3O4RA 4I9HA 4M55A 4DV7B 1MG5A 2J59A 1E59A 1MH9A 1WMDA 3GJ0A 1W44A 2VL7A 1SCIA 1YASA 1XF1A 3OE7A 1X80A 2OHJA 4IFEA 4YAWA 2Z9CA 5KNDH 2EDAA 3T7JA 2VT2A 2XDQB 3MUNA 3Q3GE 2XRFA 3F98A 1MAWA 5G0SA 3H0EA 1RRKA 1S02A 3HKDB 1FLAA 2ZI4A 2JI9A 3FXAA 4JX8A 2XEDA 1Z7WA 1XMQB 3M5CA 2OG1A 4QU8A 2YQ5A 2PT6A 3PJEA 3GA7A 3G7SA 3S2ZA 2F8SA 4B3TB 3LOPA 1R88A 4NOMA 1PJTA 1LW6E 2PFSA 2WTMA 3EQ6A 4RD6A 4GMFA 4HNQA 3T3IA 4ATNA 5DWDA 2AG5A 3UJAA 3C8UA 4NBKA 3MYYA 5AESA 4B84A 2VDMB 1MQ9A 3CLKA 2JLRA 2WE7A 5F12A 4LRYA 3DW1X 3PITA 4JOSA 5ERGB 5CB4F 2PYZA 5FPHA 4X94A 1CUAA 3K9CA 2UYOA 4UZUA 4OMDA 3HAGA 1IEQA 5JXJA 3EIXA 1JR4A 3ER8A 5DFAA 5DW3A 1M0EA 3TINA 5HTOA 1VFNA 1QGUB 3HDVA 4IRXA 5F1OA 3KZCA 2OCAA 2GPBA 4RESA 2C2KA 2DECA 1GL6A 1RE1A 2X2PA 4HGPA 4K9NA 1AU9A 1RZ3A 4Q3CA 4RVUA 5CBPA 4TLEA 5LLDA 2J9YB 3L01A 4YQFA 1P3Y1 4KOAA 1C29B 1O8CA 5JH7A 2H4JA 2WVAA 3VR5D 3VR4D 1YBMA 2ZUWA 1N3LA 3D0QA 4E2FA 5B7PA 1JE1A 2JI7A 4OOEA 1QH1A 3Q6QA 3QFRA 2PGAA 4KWEA 4MARA 4RM2A 5CURA 1BG6A 2ZIXB 4IDBA 2E82A 3NGXA 5FOSA 3BY1A 3WA7A 4HDQB 5DT2A 1TQDA 3K0CA 1AN0A 1VXRA 3GT0A 1VJ1A 1HNNA 1LJUA 1PSDA 3EXHA 5DYIA 5TT0A 5DTJA 3KKQA 4TKMA 3VH1A 5HG0A 1B14A 4EO9A 1C3XA 2GPSA 4OATA 2YZ2A 3QBEA 1JQ3A 4TYMA 1R5OA 4MYUA 2OUIA 2ZAMA 2CJXA 2BYTA 2RIRA 2GGSA 3CCBA 4QXOA 4W6ZA 4B80A 5BNIA 3SXJA 5HHTA 1C1DA 4BVLA 4PO8A 2PN1A 2FUG1 3ESQA 4P32A 2GZ3A 2V0GA 4HP8A 1J56A 4M37A 2GEBA 4WKBA 4YB8A 3V4ZA 1QG6A 4CIBA 3DPUA 5IUKC 1B4DA 1K5GA 1N5IA 2BTOA 1VG0B 4DMCA 4XVCA 1C9MA 2B35A 1HFKA 3TK1A 1FYEA 1M1XB 3TLGB 3WL7A 1I6WA 4F9TA 4EKYA 5EE1A 1QQ6A 4DV1B 2W2KA 4K28A 2NXWA 1TCBA 1Z4JA 4HADA 4B3JA 5GAJA 1EFCA 5DGXA 3IGFA 5U4XA 4DLBA 4QECA 2HU2A 3MGBA 4DR1B 1CYDA 1T5EA 1KHTA 3AWDA 3AR5A 3F2IA 6CHYA 1U1CA 2XKBA 5CH5A 3V1UA 1QH9A 1PT8A 5C7YA 3V7AA 1PSWA 2R8BA 1V8OA 2JIQA 5AN9A 1T13A 1KY3A 2GAIA 3NOXA 3DMNA 4WESB 3UAGA 2BFOA 3Q2KA 5HPYB 3KM0A 2FZVA 2EJTA 3AU9A 2QD1A 1HETA 3BMNA 3FVQA 3OUZA 4GDMA 4YELA 4EK9A 3I9KA 2RHTA 1TUGA 3M6FA 4CNQA 5AHRA 1NZJA 1GN8A 2G5TA 1D07A 5BSFA 5K8VA 4IZHA 1WMFA 4GR4A 5JJCA 3T5DA 2IEYA 2QVLA 1GV0A 4YALA 3LX4A 4YMUA 3R9XB 3T9BA 4UFOA 4H7JA 2WU1A 2FMIA 1YR2A 3F6CA 3LT1A 4J6EA 4WXEA 3TLZA 2CLLB 2GVDC 2GO7A 2BF4A 2OZEA 4RMNA 4TRJA 4KRFA 4ND4A 1XU7A 1L7AA 3ZBQA 3PEYA 4LHSA 2FTKE 2NMVA 2BGTA 4XLFA 5KJEA 1YJBA 2SICE 5EWLB 4ZANA 5FTLA 3MHTA 1YTUA 2VDLB 3S1LA 2G82A 2IX3A 1NFRA 3Q3EA 1LC3A 3OUUA 3ODGA 1Z5UA 3W6ZA 3ONEA 2AZDA 4AQ7A 4IZ6A 1EG7A 1XD8A 2A9PA 3F5DA 5D3MB 3AR9A 1KL7A 1D4OA 3AR4A 5AI6A 1NVUQ 4FGLA 3ONVA 4RH1A 3LQ6A 1C7EA 3WQRA 4E22A 4E4YA 2XECA 2GWHA 1E5QA 2WG1A 1NT2A 2M5SA 2HBQA 3NGMA 4OJQA 4RH3A 5AMXA 1DV2A 3N0XA 5BT9A 4EENA 2QL5A 4AO8A 1QFMA 1WB9A 4QPDA 3OJCA 2XHZA 1AGNA 3BDVA 3RWOA 2ERYA 2X58A 1VYHA 1R8JA 2H06A 2VK1A 5AOVA 1MQSA 5EIBD 5FH9A 1ABBA 2ZRMA 3WNDA 4G0PA 1I3NA 4GI1A 4ODIA 1TVKA 4AJIA 2JH8A 2JDID 2WV7A 1I14A 4XFJA 1G8FA 1PR6A 5EIOA 1APBA 1F8GA 1G6Q1 2GNOA 1XVUA 2ZE5A 3A1WA 5DIFA 5B64A 2QQFA 1XNRB 4U0JA 2IE0A 4MQ4A 4U7TB 4NZZA 3ZDYB 1KAEA 3AG5A 1E64A 3ANYB 3I6BA 2QROA 3LQYA 4HTFB 4XD7D 3U3MA 1U3CA 4D74A 3SICE 2Q0HA 3I76A 3KNZA 5A0TA 1K6IA 5KQPA 1D1SA 5LYJF 2XMDA 5GY7A 4NPHA 5IM4A 3HYNA 1GPLA 3PGVA 5HK9A 1HMYA 3I62A 2Z5FA 3L43A 2O07A 4UC0A 1XX6A 5K3EA 4KO1S 1VGRA 1DFGA 4CKCB 2EGUA 3SC3A 2NVBA 3VRHA 1HGXA 4R8KA 5AJTA 5J2TB 3TMAA 4P4SA 1T9DA 3U60B 1QCZA 1SBQA 3CCFA 3MMPA 1V3QE 3FCSB 4JX9A 2AYZA 3BMXA 5JROA 5T6BA 1XQYA 1T9AA 2VFAA 5LQCA 1BE8A 1Q5PA 2EJCA 2NO0A 1HDYA 3RU9A 2O2DA 2X85A 2JEYA 4ZVTA 5KCMA 1ILWA 5B6PA 2ZTSA 1TVCA 3ECCA 3DF7A 4UAVA 2VF4X 1GPJA 4RPDA 1TK2A 1JMKC 2C1XA 2QZ4A 3L9WA 2BFMA 3USES 1H23A 2I7TA 1IXKA 4EIWA 1LK7A 4J0HA 2O59A 2BBOA 3TIXB 4EG3A 1ISJA 3OMLA 3IOCA 2YRFA 3DBRA 1LW7A 3QU7A 4H59A 5CDGA 1DKLA 2OOKA 5CPBA 1MO2A 4EI9A 1M67A 2BEKA 3V76A 2WFLB 2R9VA 1Q74A 1X13A 3M70A 2B7BA 2AE1A 4FWIB 5CMLA 3TS1A 3ZK9A 5B1DA 5JS7A 1ORRA 3DDCA 3EGXB 1W4AA 4IUDS 4ZVRA 5TT1A 1SG9A 4CDRA 1L8OA 2IVFA 2VAMA 3QSGA 1NSFA 1LRKA 3Q15C 3KTFA 6NULA 1UBOS 1FX0B 3A8IA 2NO4A 3CUWA 3LS2A 2IXFA 3V33A 2WP8J 1QTNA 1HG1A 4CMEA 4CLRA 4AKIA 3KKKA 1EFPA 2W8BA 3M9LA 3VKFA 5IHXA 5JIBA 3MFYA 2PD3A 1DKOA 4JL8A 2GYWA 2J7PA 3TEFA 5I9LA 1ZVVA 3G68A 1UXIA 1Z5OA 2Q5HA 3K09C 3QA9A 1EDOA 5ECYA 5FI0B 3M3DA 3KR9A 2CDRA 1U8FO 4KWTA 2FOXA 3D3NA 4Q4JB 3QBVA 4L8JA 1SXJA 2ZYDA 3AKCA 4LBWA 4X8MA 3K9BA 1XTQA 5FFNA 2L69A 2PRIA 1UMCA 1DIRA 5FO1A 2EKZA 4KI7A 5FFMA 4DEXA 2RHJA 3RH0A 1K08A 3CGGA 2E6UX 2PIAA 1ULUA 4NTZA 2OQ2A 4O4IB 4UAUA 1ULSA 3QPBA 3DXXA 3VVBA 5C9ZA 2B1QA 4ZGWA 5FLXA 3IUNA 3B1JA 4JB3A 3OEYA 3RVDA 1BMFD 2XJ9A 1FRNA 4QJ5A 2DYKA 5JS8A 1YVPA 3DVQX 3GLSA 4B1FA 1AS0A 3JATA 1T4CA 1DHRA 4M1QA 2ZYRA 4KYTA 1U2DC 2P6UA 2VT6A 1PEAA 2BSXA 3UT5B 4B7CA 3GEPA 3BH6A 3N3BC 1WUHS 4LRWA 3IO5A 2RHDA 1L5HB 3LWZA 4ITVA 2E37A 2XQIA 1PLJA 1SN7A 2XYHA 2H2AA 1UAYA 3EEBA 4WV3A 3TLAA 3ORSA 3Q11A 3NW9A 4K05A 3TQHA 1JIXA 1ABEA 3T7AA 1QH0A 3NVKI 4KLCA 2QPLA 1WDMA 3FSGD 3ZE9A 5GZ6A 2RHHA 2H4YA 4Q7MB 3WL6A 5CJPA 1ZIPA 5E3JA 5ALUA 4Y0VA 1BH6A 1YNOA 3TFWA 3PPIA 3CTPA 2F3RA 1G8PA 1RQGA 4JYPA 4QUDA 1RKBA 1NJ1A 3D6JA 3GP3A 4TVSA 3FN4A 1JWLA 1EP1B 4O2BF 2QMQA 3UC5A 1QVZA 3F1KA 5T57A 4D6XA 5JCJA 2IITA 2NO9A 3C87A 3ZZ0A 4YDHB 4Z1MD 5ADHA 1SHTX 1N2CB 5L53A 1FSFA 3LVQE 3P0IA 1IBKB 3WK7A 3HK2A 4HYYA 3H94A 1BEEA 2D2IA 3I2HA 4R1TA 1OJ7A 3FCUB 1P81A 1CFJA 1A2OA 1GRRA 2BHNA 3D02A 3LD9A 1Y82A 5FWDA 2WIGA 1TYZA 3H4MA 2QTTA 5C1IA 5J4VA 3GLIE 5GJWC 3WWOA 2ZRCA 2FEXA 4TV9A 3VH2A 1NG9A 4FFPA 2O8DB 1J49A 3I5MA 3WBBA 1CE8A 3HKEA 3ZGNA 1JKMA 1JG7A 3NLLA 1Q95A 2VSNA 3ESDA 5EYPB 4BO0A 2ZRGA 3LBAA 3IUMA 3LY7A 3FSRA 3PUZA 4OK5A 4WXRA 3A6PC 1BXGB 4JGGA 4CLXA 5BSRA 5GIPE 5L9AA 1XAIA 4RHXA 5FTKA 3UUEA 4ESOA 5KOYA 1Y5NA 4QO8A 2BJVA 1CJVC 2YVKA 3V8EA 5AVWA 3JR7A 1GZDA 3WY9A 1ZOOA 2EFYA 4LXQA 4CMAA 2G1KA 5E6UB 2Q0XA 2G88A 1KJIA 3KJFA 1K68A 4FW8A 3SN6A 2HU8A 1TU0A 1A7JA 3LWBA 3AEUA 1U2PA 3SBEA 1AKMA 1XEWX 4KAFA 2KWIA 1V1MA 3M4XA 5KSOA 1L7OA 1TO2E 3ESCA 1XZQA 4PV7A 5K2MA 1F2UB 4QYIB 5DULA 3D3WB 3O8DA 4BO1A 5HXAA 4ZXPA 3E8MA 1JTEA 1IM5A 2ZBPA 3VZRA 5FWXA 3CA8A 4DLRA 5TDHA 1G38A 1OTXA 1E1YA 1M0WA 2GKOA 3CXRA 3U7EB 5CB0A 5IZCC 3Q85A 4XUGB 2R44A 3C48A 2H1RA 1K8XB 1I7PA 2QA5A 4NEGA 2CFSA 4G5HA 5GZ3A 3F96A 3T3DA 1ESEA 3QZUA 3B2EA 4Y3UA 5DCWA 3ZZ1A 2F55A 1RXWA 5FWYB 2HC9A 2IYEA 3NWEA 4LVNA 4OLJA 3RUAA 3AL0C 1Q1EA 2WMOB 3LX8A 3VVCA 1Z0KA 2BKXA 4WK4B 1DJOA 1NJSA 1GR1A 1MC4A 3FYTA 3PEWA 3OLYA 2ID4A 3E1SA 2FU5C 3T5AA 3NS7A 3GMTA 1H0HA 4PFJA 4Z9XA 1DIOB 1Q15A 2LIPA 4WZLA 2PGLA 2FWAA 3DA8A 1WVIA 3WISA 5H80A 5J5VA 4YP7A 4RTOA 2EYUA 5CA1A 2HWKA 1LB1B 3N75A 2P9FA 2HK6A 1OZFA 3EUFA 1L4MA 2Q49A 3NDJA 1YZHA 4XX0A 4AICA 4AJEA 4BFUA 5K0TA 3K6JA 5GADl 2WWRA 1KAQA 3Q6NA 1YDEA 3IT0A 4OGWA 1OLUB 2QN3A 5A4KA 5JVDA 3K0AB 1D8TA 3L06A 2FDCA 3AHCA 1WOSA 1Q44A 2XZDA 2IYNA 3G5UA 4KH0A 4XQEA 1HTWA 1H5UA 1WOOA 2F3QA 1QTRA 3KDSE 1KE2A 2DPXA 1JSLA 4AVZA 3DEFA 3FCXA 1UC5B 2E5LB 5HR5A 4HUTA 3ESYA 1Z0ZA 1CUJA 1XU4A 1W29A 1K73D 2D1TA 5ALYA 1ZZEA 1HNXB 3RIHA 2SECE 2H1HA 4Z4RA 5EJ6A 4BNFA 1HNZB 3KJZA 2G1AA 3H1BA 3P52A 3F5QA 4QEDA 4JB8A 7REQA 5IUJC 3BH7A 3MCTA 4V0ME 3UWPA 3WLTA 4R8RA 3BFPA 2H57A 1O95C 3F4BA 4ZAZA 1SGWA 4HGYA 3NBZC 1Z0DA 3UF0A 4RJ2A 4BNVA 3KO8A 1U3WA 2XGOA 3A6GA 3ZHBA 1ZCJA 3CX8A 3EZFA 3KB8A 4K9KA 4XONA 2OFWA 4Q24A 4WFKA 3SHVA 3TR6A 1VKHA 1OBFO 4QUIA 5HDQA 3ILSA 4FX5A 1QDEA 3WP0A 4BFWA 4D1YA 1BIFA 4HN9A 5GONA 4BO5A 4D92A 3ADCA 4HWPA 5IVDA 3B9RA 1YHZA 3O8CA 1RACA 4S2EA 4XWAA 1P80A 3H9CA 5ETJA 3EJ6A 1IH8A 1MA3A 1PUJA 4P35A 1SUEA 4WK6A 2YINC 2WAYA 1T35A 2B2CA 2ACWA 1DXOA 2XNHA 3I9OA 4NLLA 1RI4A 1XV5A 2PTHA 2Q4BA 4MQLA 2IXBA 1UODA 2J5BA 2A2ZA 4MQBA 3AHDA 2PNJA 3DQZA 1E2KA 1HMPA 2VBIA 1JLHA 2I3AA 2IXTA 4NMMA 4DQVA 2ADMA 1VG9B 2R47A 5A1TA 4OP1A 4DIOA 1LPNA 1R0RE 2DUJA 4Z8YA 3OX2A 2NPOA 4Q12A 3HM9A 5LXTF 5HKKD 2ATXA 1NURA 1NBME 3OQIA 4LYAA 4BJ1A 1U2TA 3VR0A 2I4OA 2F7SA 1A9YA 3ZU6A 5EZYB 3WMEA 1L5OA 2INGX 5L51A 4MV9A 2X6WA 3IAM1 3H2YA 1FQKA 1Q1AA 1WHTB 2G5CA 3G0DA 3B7GA 1ZRHA 2GK4A 2JFQA 3DHEA 1SBCA 2UZ1A 4ZIRB 3PEVA 4C4TA 1BCRA 4DQ0A 5JSHA 3DG9A 4K9DA 4M9RA 1U3UA 1NP6A 4IIJB 4UM5A 5KYXA 1H4VB 1VBMA 1XZFA 1N6RA 4Y2UA 5J3JA 2D8AA 3L0BA 1Y8RA 3KTDA 3E84A 4JLWA 2JD2A 3RBAA 1WNTA 4RGQA 3SDSA 3SY8A 4CMIB 2JLWA 1HKHA 1WQ4A 3OU2A 2HHCA 3OQJA 4FFMA 3DAOA 4XR9A 3DVLA 3V8BA 2O54A 2Q4EA 3OZ7A 3GF4A 2I1LA 4QLOA 4HUQB 3HN6A 3IBCA 4ZO6A 1GPDG 2FPIB 2H5IA 4P3PA 4DV2B 4JUIA 3GUZA 5E1DA 4RS4A 2I91A 1YXMA 1JJ2B 4B82A 3BQ9A 3K9LA 3U40A 5KOJA 2PD6A 1Z13A 1C41A 3QXSA 5KNBH 4FONA 4PF1A 1L1EA 3M3PA 5A2GA 1K7XB 2G71A 3SLKA 4R40A 4CKWB 2H4WA 2WPDD 3EZ6A 2X9LA 3OQ1A 1LI4A 3HQ4O 3MM4A 4R1QA 4OHZA 1RWOA 4XAQA 1IHMA 1S72B 1Q82D 1NBIA 2ZI9A 4RQBA 1T5BA 1PZXA 3W5HA 4KQWA 3SCZA 1DWQA 2HDHA 2AGVA 3BHIA 3MWFA 4JC8A 1AQUA 2EW2A 1TK9A 1P5RA 2NO1A 3KYDB 1U04A 1IATA 3P4UA 5E2AA 1GD1O 2ZEJA 1JFFB 1M1NB 3FVVA 1QIKA 3MJCA 2AK2A 4FFNA 5CLFA 4AXXA 1HDCA 3PLNA 2J1LA 3GGGA 2F17A 4EYKA 1NNEA 3KQYA 3UK0A 1E1LA 1RLTA 5KNCA 4EQ6B 4ASUD 1KKLA 1N0HA 4K6MA 5JLJA 4UQLA 3VHXA 1ZH0A 4LS3A 3ASSA 1UD4A 2DWQA 1CUCA 3DWGA 3U31A 4PX2A 2J6BA 4IO1A 4H6WA 3VNBA 3ZWYA 4ZZ3A 4V0QA 1A3CA 1L4LA 1WP4A 5CITA 3CPEA 4CETA 1JHPA 3U9SA 1P7VA 1LF5A 3G0HA 3E7PA 4C0AC 1KPGA 2IUUA 2JZOA 1GCIA 3ZCTA 3JU4A 3IE0A 2WBLC 3NHAA 3W6PA 1NDHA 3CCCA 4KVZA 2EU8A 1T8RA 4MV1A 5DNYB 1SWVA 2C59A 2G06A 5EESA 5FPSA 4OI1A 1CZNA 4ND7A 3NBXX 4PR0A 4BC0A 2ZFUA 1F2DA 2AS0A 2O5RA 1XJWA 1N6IA 1W0JD 3DDOA 2YCLA 2X0EA 2LCIA 4PLWA 1AZLA 4MICA 4LBYA 3AONB 4QHYA 4BDSA 4RVDA 3NANA 2OBLA 3Q3CA 1VJ5A 4F72A 3H13A 4XOPA 2AEFA 4JMLA 4BMYA 2H31A 3HXTA 2O57A 2BFEB 3VNVA 3BSSA 4GQIA 4I2NA 4OY3A 8LDHA 3W04A 5JTUA 3VYRB 1TEVA 3PC2A 4BQOA 4BMOB 4YO8A 2RBGA 4L5CA 3U0VA 5CLLA 2H0AA 3QSYA 4PWZA 1UCFA 3TLEA 3ZGYA 3TSAA 1JFSA 2V7XA 1QRUA 2AX3A 5ICEA 3RPEA 2I8AA 3OBBA 3VV3A 5NLLA 3WLLA 3ZOKA 2KBEA 2HLHA 5MN5A 2CYBA 1VJTA 2D3WA 4YHHB 2ZJ7A 1C1XA 4QUZA 2OAP1 2PBFA 3HCFA 4ZYUA 5IYWA 3DNMA 3U56A 3PRJA 3SVZA 3VX4A 1LX7A 3Q6MA 3EG9B 1FFSA 1KO4A 1NMQA 4F2HA 1OU4A 1TE2A 2NYAA 2POCA 4H3HB 2Z2IA 4US2R 3IKVA 1D9XA 4RVGA 2HOQA 2ZVPX 3CN9A 3LUGA 4IEEA 1L4NA 4HF7A 4PG7A 3IOEA 4D44A 2J0SA 4GKKB 1DOAA 4KDFA 5C7IO 2C0CA 2XQFA 3A1VA 3IAAA 5D5QA 4RD1A 5AP9A 5T6MA 1ZAYA 3WZMA 2QL7A 3K8QA 3KB2A 3GDGA 4G37A 1T6ZA 3T1YB 1DP4A 5JAIA 2QGFA 1ADCA 2PLNA 4B45A 5F4BA 1SG6A 5F73A 5FJJA 3I56B 4X7MA 5EP2A 1ODLA 5LP1A 4MR8B 1ZD1A 4MMZB 5A3SA 3N53A 2DSNA 4E30A 4DCJA 2KSQA 4KNYA 1OLSB 1TKCA 4PPYA 5CM9C 4NHOA 2IOHA 2NSLA 3MJEA 3AESA 2P4SA 3INRA 2JIZA 2ASEA 2QDXA 2M6RA 4J2TA 1ZGHA 1MD9A 4Q1CA 1XTZA 4YGXB 1PD0A 3TOVA 1V95A 3BWVA 2OA0A 5JO0A 1UF9A 1T9GR 2WJJA 1QAMA 4ICIA 4R54A 3L7JA 3VJLA 1LZKA 5AKEA 3CNBA 5CYOA 4DLPA 3D6MA 1PTJA 1F7UA 4OEHA 4OBWA 5CPFA 2VBGA 5ERYA 3TNJA 4YLYA 2BAGA 2J67A 5B6JA 2QYOA 3MMZA 2RG7A 3OPNA 3L5KA 5G2OA 1BJKA 1E3DA 2O8BA 1G7SA 3QTLA 4LYFA 3JYPA 2RI0A 1Q12A 2RJOA 3AEYA 1DUIA 4MUHA 5EY5B 5F33A 3GRVA 1KYVA 1RM4A 3H16A 4YT8A 3PS9A 5JXGA 4AJJA 2IW3A 4HDKA 3G05A 1V0FA 1OAOC 1AXRA 1YI8A 2QSUA 1RMQA 3A11A 3A58B 1CRQA 1ID1A 4K2AA 4UNIA 1QM5A 2A8YA 3SX4A 1XSEA 1B00A 4W99A 2NPIA 2ONCA 2BZSA 5EHGA 4TSFA 2WU8A 4JEUA 3UMGA 2WQ7A 3BMOA 3KPJA 4FGUA 4KN8A 5ES3A 1XXHB 1XTKA 3CUSA 3GEDA 1R0CA 4IS2A 1Y6QA 2OHXA 4LC9A 5E6RA 2GF2A 4ZVNA 5KSPA 3BRCA 1ZUNA 2RD2A 4LWOA 4PCUA 2QEQA 2PU5A 4O1MA 1IONA 1PFQA 3OT5A 1OYWA 4P5DA 1N8TA 4V0OA 1J0DA 4X71A 4XZ3A 3Q72A 4TVBA 2V8OA 1TCUA 3ONNA 4TM8A 4X60A 5HZHA 4WQMA 3ROTA 3JSAA 1NXSA 3ADOA 1XTPA 3UMVA 1EBUA 3ACCA 3SMVA 2EKDA 3BN3A 4LHZA 1GNRA 1MH1A 5CB8A 3MCZA 2V03A 1IK4A 3ESZA 4BN4A 5HP4A 3PC8A 3NBMA 4X7RA 3I9MA 4KJXA 5ECWA 3FNHA 3IDOA 2DFNA 3ED1A 3H2BA 2VJBA 4G36A 2AJBA 2DR3A 4DDMA 1Z12A 3DEHA 4Y0AA 4D8VA 4Q4HB 1QO9A 5BR4A 4C0JA 1CW2B 2W43A 5I7RA 3TDMA 3UBMA 3HYLA 2BE9A 4DNOA 4WBNF 3FW1A 4FB4A 5B3LA 2CYAA 1EJ0A 4B40A 3H83A 2PS9A 3OKCA 2VHZA 1SCDA 3Q0TA 4AQYB 1KBQA 1DKQA 4BXOA 2EJWA 5IAGA 4IHAA 5CR9A 4ZDIA 1W93A 3O1JC 4JASB 3IKJA 2EHJA 3IERA 1OZGA 4FQ5A 4RC9A 4GSYA 1PZHA 1XP5A 5LYYA 2IZ0A 1YAJA 3PPWA 4MEBA 4KDEA 3V7NA 1GSHA 1S4QA 3EPKA 1Q3KA 3S5UA 4BNHA 1ECCA 3R4CA 3ZI0A 1X42A 3C39A 1AHPA 3KUCA 4OFXA 4ENQA 2FB9A 1GUFA 1XOIA 10MHA 2O06A 1FDWA 1P0FA 3BF8A 3ZVLA 4U2DA 3HDJA 4IF6A 1ETUA 4QOJA 4BY9E 1PR2A 5NULA 2DEUA 1HT0A 2ZWIA 3M6AA 3AHIA 4N9QA 2HZ7A 4B3XA 2YBEA 3B6KA 1D0IA 1THTA 3C5HA 1KYXA 2R7KA 2YYSA 1T4BA 4AAYA 1TF5A 1KNXA 1Z7YA 1P2SA 4QSMA 4XVRA 1K4KA 1TMKA 2PSJA 1QVAA 3O8OA 5EE5B 3B7WA 4BAZA 1CJCA 2DGDA 4RIGA 2XRZA 4P31A 4EHDA 1JHQA 1PR9A 1JYSA 3HEMA 4C7VA 5CH3A 2VAVA 4TZTA 3GI1A 3ZC3A 4CT4B 1PQYA 1EG2A 2TMDA 1WB6A 4RQTA 4A73A 1DMSA 2IU3A 2FRVA 5ALEA 1L5KA 4K0RA 3BH4A 4BQFA 2ZBRA 3W4IA 3T53B 5LZ5A 1YB4A 2XCTB 1K6JA 2CNWD 4LJYA 1OH5A 3N0TA 4DYDA 1MB2A 3CLSC 3CQ9A 1YZFA 3W5DA 1O95D 1V5IA 2F1OA 2MSNA 3E9ZA 2QN6A 1UM9A 4PHCA 3ITNA 5J58A 5AJWA 2MINB 2P5TB 1P45A 4LJ4A 4UPVA 4HAWA 1NXVA 4FJ1A 2K87A 3FY4A 3CPHA 1GG5A 3MC1A 3RU2A 2WUDA 4CFSA 2Z04A 3CNHA 1G60A 4XGNA 3G9UA 3P5SA 3C1AA 3VHRA 1GQQA 3EQ8A 3TCKA 2VBVA 3D2LA 5EMNA 2RHWA 3OEEA 3ND7A 4WLUA 3DT8A 4JSYA 4F5EA 1ZH4A 1O6GA 2FVYA 3FMOB 4K9OA 4P5EA 4MJ3A 4UHCA 3ZD9A 5EXEA 3TFQA 1SVLA 2GBIA 2AQIA 1B1CA 1KZ9A 1KU6A 5UKDA 4Y6PA 3U7FB 4R83A 2B5VA 3OX1A 4ROSA 5TQ0B 5KHLB 4D4IA 3R4VA 2P3SA 4KKTA 1SVIA 2H6EA 2BH9A 2BE7A 2OEPA 2EKLA 4LXIA 4MA4A 3T0IA 5JNWA 1YS6A 2JF0A 3TCXB 2C83A 4NCKA 5DNDA 3RI3A 3UK6A 3AEXA 2OP0A 1Y3FE 3QY0A 3HSYA 4AB1A 4Z54A 1JH9A 1XKTA 2XDQA 2X2EA 1K28D 4D0GA 4FT2A 4PR3A 2V7EA 2JIBA 4FMCB 1D8AA 3HKDA 1HFWA 3L49A 3ZI7A 3KOUA 4BAUA 3AVPA 2QRGA 4ECEA 1P60A 3J7TA 1C9EA 3SJCA 1IQPA 1N0UA 1VLMA 1XL1A 3TQSA 1MW8X 3P2EA 5FBZA 1RHKA 1PZEA 2D6FA 4KTTE 3W5IA 3OFKA 1BOFA 4QBFA 5FADA 5U4QA 4UDOA 4C30A 5CDSA 2CDBA 2W2NA 1G2OA 5IJ9A 1QCYA 1K3TA 2IHNA 4HDRB 4XLZA 5F7OA 5I45A 5JAUA 4C1NA 3S1AB 4UDYX 3HPQA 1NOIA 1ZNWA 3N76A 3S2SA 3UJHA 2W00A 2BN4A 1PR1A 3V46A 5M34A 3ADDA 4EHIA 3WP1B 3I04A 3K9QO 2WTBA 3A1EA 3GLVA 2ABWA 1QGUA 3ZXXA 2JI4A 3ECSA 4AN1A 2OMKA 1W49A 3KJIA 3VU1A 1XJCA 3UOGA 2O3SA 3FFTA 4D98A 4UQOA 2YOFA 4YRGA 4QVIA 1ESNA 5KPJA 2AG6A 1VBFA 4AKGA 2XUQA 4G8DA 1I3LA 4GSLA 3ICWA 1Z63A 4MUYA 2VOJA 2P3MA 3MT7A 4H16A 1QHFA 3VBCA 4QUBA 1KZ1A 1B23P 3ZE6A 4LFAB 1XPOA 1CIJA 1W2BB 5AIBA 3KDPA 4HEA1 3ISXA 1J90A 4OKSA 1E1QD 2ZI6A 2CUNA 2JH9A 4JBHA 2PXAA 4WZBB 5D01A 3VI4B 3ZU3A 1VQMB 1TMOA 1R0ZA 1ZGBA 2EHDA 4B4WA 3GFQA 4F91B 4UXJA 3IJ5A 1HSOA 4KMMA 2BDTA 3F6BX 2WWVD 1WP9A 4PNEA 5BV7A 1CDZA 2A1TS 5IC5A 2PX3A 2FSIA 4KWCA 2FWJA 1JDNA 1F8YA 5DP2A 3REFA 3S40A 1PL7A 1SXPA 3PSAA 4OJNA 3MTEA 2OO5C 2L19A 2RIPA 3A31A 3AUFA 4CUZA 1FRQA 1CCWA 3V9PA 3DKIA 4QXAA 3DDZX 3EIFA 1YR3A 2EZ8A 3QVTA 5D1NA 3WGYA 1QGDA 4MCIA 1Z4LA 3N2GB 3NZEA 4CUKA 4IVPA 4KGDA 1RBZA 3QXCA 3JQRA 4G67A 3LO5A 4RMHA 3IVRA 4V2UA 4R68A 1FDVA 4FJ2A 4ZREA 4BNXA 1NKVA 1UBHS 4W5HA 1ECLA 2HIHA 2ZRKA 4UULA 1FVHA 1TC2A 3NH6A 2TSYB 4OJTA 4X1KB 4P3YA 4IDDA 1IWPB 1AMNA 3ENZA 2CXQA 5KQLA 1AIPA 1VHLA 2WWHA 3OI7A 4PQFA 2XD4A 4WESA 5CB4B 4R71A 9GPBA 1VQ1A 3QU9A 1ZH2A 5C8YB 4G85A 5AW0A 2GK7A 3V4LA 3R3ZA 4FXUA 2QGZA 1BS2A 3W7AA 4OHPA 3M6MD 1PJZA 3GT7A 3JQBC 4U9IS 3O4HA 3LSTA 3CESA 1W36B 3AGPA 2ATCA 3DNPA 3LGAA 1NQXA 3P5BA 4M36A 4CLHA 4N47A 2NU9B 1UDXA 3LVRE 2LCQA 4DUYB 3LPCA 3S2UA 2O52A 4JCCA 2R84A 3C7TA 5JZSA 1U0RA 4PC1A 3PC6A 3M6UA 1U2GA 3ZKAA 3VSBA 5LQRA 4DC1A 3H19A 1WQ3A 1G5QA 2HA2A 4O02B 1YOVB 4QPJC 3RO7A 4M3NA 1OPXA 2LZJA 4A0GA 3D3JA 3FOCA 2JFGA 3H9EO 1MZPA 5I3CA 5D3MA 1WVGA 2JLBA 3EWSA 4CV2A 1DAFA 1KH3A 1MQ8B 2X1HA 2YWBA 3FMPB 4IAOA 2IYTA 3A4LA 3KOZA 1G63A 4RLHA 5A71A 4XEUA 2R00A 1T2EA 3HP4A 2IGTA 3GLQA 5ELMA 4J1SA 3NHUA 4MAMA 3UGQA 2GEUA 3S7ZA 1PT9A 4HV4A 1KOFA 4BKOA 2ONJA 1AURA 5L4LA 3WFJA 5B7GA 3R8CA 1VE5A 3G2QA 3PPVA 4IGFA 1B76A 3ELYA 3H6HA 4LZWA 2DC1A 1F5NA 4CI0B 3EFHA 5AM0A 1KF0A 4EB3A 2HJWA 4HC4A 5B36A 2W98A 1E0KA 1IZ9A 1NAHA 4U1RA 1AT1A 3B5IA 4DIUA 4DXDA 5A9SB 5BNZA 1MX1A 3S2GA 2XRYA 3K32A 3SHQA 1OGIA 1QKKA 2HA6A 4BYGA 4CI9A 5LN1A 5BV2P 1W52X 3FCCA 5EHQA 1AO0A 4TLBA 1G2QA 1WKVA 1T2DA 4PSDA 3ZJ5A 1WMBA 2B9EA 2NZ8A 2CHUA 2VJDA 4HTFA 2W70A 2C96A 1E18A 4YQEA 5IYZB 4GZ3A 3IQFA 3OZGA 4ZGBA 3WYFA 1LKZA 2WWWA 1KAGA 3I9V1 4FUTA 5JSYA 3SGLA 4MPJA 3RS0A 1C80A 3TLXA 3S8EA 1EGAA 2VRBA 5KWIA 1LY1A 2HU5A 1H6DA 2I29A 2PV0A 2IYWA 4NBRA 4CN9A 2ZI3A 2XGJA 5KOHB 1UUFA 2ZXHA 4H0FA 3IRUA 1U8ZA 2VDKB 1YMUA 5J2TA 1KJQA 5IVKA 1PG0A 4RDIA 2D1FA 3ETJA 4XTRA 5DH9A 2JD0A 3G0OA 4HH1A 2NW6A 3O93A 1TDJA 3KD3A 3PQDA 1B41A 4Z4SA 5CLGA 5IBPA 4CFZA 5FYDA 4CLDA 2MSLA 1F20A 5JATA 1MA0A 2HADA 4JUAA 2GXSA 3IMKA 3ZHYA 4ZOQI 1RQRA 4KX5A 3HJGA 2YZ7A 4IV8A 4MHSA 1SEVA 5E7IA 5HGJA 4CZ2A 3W1EA 4WI1A 2MMCA 5K0FA 5C8ZA 3Q8MA 3TX6A 2UUBB 1FFYA 2PWZA 1P4HA 4H6XA 4EZBA 2XUPA 4Z4UA 4CKXA 3FA2A 4M0MA 5D3ZA 5EZQA 4OK3A 4QGFA 521PA 3UAXA 5ES4B 1GZ4A 2N46A 1HR0B 3LCCA 1A04A 1JFLA 5H4HA 3QEJA 3EGXA 1YNSA 5LP6C 4H1WA 4RIEA 1A8SA 2J3KA 3FCEA 3HEBA 1SURA 4H6PA 5TS2A 2FRDC 1CHNA 4DMHA 5KTOA 3HXOA 2ZZNA 1AQNA 3W3ZB 3KYCB 4RV5A 5B1IA 4DJDC 3HHPA 1BLIA 1RHQA 4Q82A 3RRBA 4EX7A 3N2KB 2FUNB 2C9ZA 4L74A 1KR5A 2G3YA 2RGYA 3ZGOA 3DQPA 4CM3A 4KHPB 4QYSA 1G21B 1NP3A 2P2YA 1ZHHA 3N5KA 4ON9A 4EKGA 4ALMA 2QZZA 1NQTA 2VIIA 4Q4JA 3H8SA 3WX0A 3AUXA 3PFFA 1ADBA 5LYJB 1RJ9B 3X1ZA 4EKNB 2JNWA 3UBTA 4DM3A 1Y7TA 4R2HA 2QUJA 4Y0NA 4RFSB 1YE3A 5BW4A 3K16A 1N9ZA 1ZJ4A 4IWYA 2GARA 1MB9A 1CF9A 1Z6QA 4O4IA 2YFQA 3QU4A 4X07A 2GAFA 3I6QA 3VR2A 3JAMA 1GJRA 3CU5A 4G4IA 1RS0A 1KZ6A 1UBUS 3FGZA 2FSGA 1WHSB 2QRMA 1CDOA 4HDOB 5B7NA 2WAXA 1UJ2A 1DOHA 1LPSA 1UJCA 3DBOB 3VPAA 4LZAA 1IEVA 1GUAA 3HB5X 3F6SA 5JBIA 3AKZA 3GFPA 3OM9A 5KNDD 1KO1A 3HBLA 5HBGA 3T61A 1JHRA 3NOQA 1R16A 1FTSA 3UT5A 4F93B 1OIVA 3ADKA 5K8UA 4X3PA 2NV0A 3FWNA 3V2UA 1OC2A 2H29A 1OX6A 1L5HA 4EOGA 1V37A 2FR1A 4BLOA 2AD5A 3CS3A 3LX5A 3P2IA 4PANA 4YAKA 1GTSA 3GPCA 3U4AA 1EFRD 3DGEC 4NFYA 4Y6GB 2D7CA 2PY6A 1YVDA 4ADSG 5EJEA 2WU0A 3IR7A 5BW8A 1AKTA 2PX8A 4RFVA 5K0ZA 5KYYA 3SEQA 2IHKA 5CCXA 1CQJB 4MLDA 4NZOA 4Q4LA 3SS9X 3WAKA 2B37A 4JKIA 4Q4DA 4DANA 3A0RB 3RD5A 1P1JA 2YJGA 1N3YA 2MT9A 1DQZA 4DG5A 1O4WA 1OTHA 1TT5A 1E9BA 2CXUA 3H5AA 1UJMA 2VYNA 2XWBF 1N2CA 2VJIA 4TMFA 5G4LA 3T6KA 4D6PA 2C5EA 3GFGA 3Q9UA 3UHJA 4PQRA 3MPOA 3CLSD 1JKJB 4OB7A 5C4GB 1TFRA 4AYTA 4GPZA 4MUMA 3E20A 3W2GA 4II7A 4YMHA 1OC4A 5HILA 2CUKA 2GCOB 3FYUB 3PVZA 1VF7A 1G16A 2CE7A 4UBIA 3ZDRA 1EX9A 1YWGO 3V8MA 4Z86A 4DR3B 2G1JA 4NMLA 4YCBA 2IYFA 3PGXA 4ZPXA 3C3CA 3J81A 4C2TA 2XWPA 1BXGA 2OGUA 1UMKA 5DBFA 3OMXA 4L02A 1N0VC 1NFFA 4JWKA 3ZE2B 5EWJB 1ZITA 3KKMA 2O0JA 3D6VA 2C4MA 4JVNA 4WN9B 3FSEA 3DXYA 4GBGA 5E6UA 1GPBA 1TJ4A 3UK1A 3HWWA 4YXWD 3SVLA 4P25A 1AUPA 2JI8A 1LRJA 2GCGA 3F2VA 5AXCA 3L1IA 1FSPA 3LYHA 4D41A 3CUUA 3ETDA 1D2CA 3NJ8A 3ZZUA 4G0XA 3KD2A 5JJIA 5KVSA 4E7PA 2DQ4A 3QTTA 2VDWB 2E1PA 3OA0A 2O9JA 1F2UA 1NM5A 3I01A 4QYIA 5CLJA 2QW1A 4BZQA 4Y9UA 2CXRA 4UXHA 1E2BA 5C51B 4IJQA 1KY5A 1HC7A 2N3ZA 3PXDA 3ONWA 2Z2ZA 4C04A 2JRCA 4FNOA 2JGNA 1J8MF 1AE1A 3I83A 1RJEA 3DD1A 1MB0A 5ECDA 1E9DA 1SU7A 3K6KA 2R68A 1P77A 1G20B 2X22A 4TS1A 2IDJA 1TTHA 2PBZA 4BO8A 4EPVA 4DQLA 4RTNA 4O2BB 4IHQA 1E3TA 3DVAB 1XUOA 3RLIA 4NAUA 5FWYA 1Z7BA 1URPA 1ZCZA 2WHQA 2YYZA 4FUQA 1H6BA 4LOJA 4NU8X 4OLHA 3F0TA 4W5QA 3KBBA 4B2PA 1SMKA 4ZAWA 2OGWA 2ZANA 4BNYA 4OIFA 5KC8A 4N7MA 3RUEA 3V7UA 3I3OA 5SICE 3TUIC 2BHRA 3QVJA 1HT2E 3KV1A 1Q92A 1B8OA 5LZ2A 1I4WA 2X2OA 1DEXA 5HIJA 2VP3A 2NT4A 3WGLA 1Z62A 4DWWA 4BNMA 1ZS9A 2GPWA 1W5FA 3NKFA 4ZALA 3W2EA 3A26A 3K0KA 1U1IA 5JALA 3F3SA 1XA0A 2YJTD 3PT5A 3OT1B 1XTTA 2ETXA 1VKNA 2XB8A 4N0DA 5AW4A 2CXXA 1ONPA 4CMBA 1E63A 3QXJA 4F8EA 1OLUA 1VBNA 3EIUA 1G8KA 4HJRA 4CG1A 1L9KA 1P3DA 4BWVA 3EVZA 5TMBA 3RNOA 3PHIA 2XBUA 4NXNB 5ALJA 1P9LA 5ULLA 4EY4A 5DNUA 3OQ6A 4G8CA 4AJ2A 1QIGA 5FUMA 1P9NA 1Z82A 1YL6A 2DUNA 5TQJA 4RVHA 2VHXA 3NP9A 3AV0B 4LEIA 3EB9A 4J1NA 4GSKA 1JBQA 3SFZA 3DCJA 1DX6A 3DLHA 2I4IA 4I4TF 4ETIA 1DC8A 3BA1A 3HI4A 4O4JF 3L6CA 1EXNA 3LV8A 3OJWA 1EZ4A 2HYDA 3GA0A 1NT4A 3PFWO 4LECA 4XI9A 4CGYA 1AOXA 3CUKA 5K8JB 4I5GA 1I5EA 1E62A 2FN7A 2DPMA 5IFKA 2ONYA 2QSJA 1CJKC 3GX1A 4WXPA 1ESCA 1T1JA 2C57A 4G6ZA 2XVZA 1ISIA 3A3OA 5I5EA 1E1CB 5MGBA 3R7NA 4P84A 3B5JA 4LHEA 5CA0F 2ZL5A 1MVOA 4WOCA 4NNPA 5CXQA 5JZBA 3ZWXA 3H4IA 4ZKEA 3PNMA 1C3JA 3RROA 4IJ5A 4QPNA 4KPUB 5COAA 4DK0A 2I7XA 2MTBA 3JVUA 4FYIA 2NZ2A 3LFHA 2M6KA 4KAJA 4A2WA 3NMUF 4YA6A 1FFCA 1Y48E 4YREA 2HEGA 4RJJA 1GPNA 4FGWA 3D8BA 4DLSA 1GL3A 4CG2A 1XDSA 4IIFA 2O05A 4OHOA 4WLVA 5BWBA 1CDEA 3NT4A 3UPTA 2CW5A 4PBSA 4HFRA