1B2WH

Comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLVQSGGGVVQPGRSLKLSCLASGYIFTSSWINWVKQRPGRGLEWIGRIDPSDGEVHYNQDFKDRFTISRDKSKNTLYLQMNSLRPEDTAVYYCARGFLPWFADWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ANTIBODY (LIGHT CHAIN))
publication title Comparison of the three-dimensional structures of a humanized and a chimeric Fab of an anti-gamma-interferon antibody.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1998-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b2wH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b2wH02
4RSVA 1X5YA 2P5ED 4L3AA 5EIIB 4POUB 1EEQA 5D7SH 1K8IB 5DF0A 1CFSA 5FEBA 5ACZA 1MRFL 2A9NH 5I18H 1JBJA 2OK0L 1WZKA 4XMPL 4IOFC 4YDLB 3HPJA 5IQ9A 1KJVA 4BFGA 4KHXL 1SJEB 2LTQB 1A7QL 1BFOA 3W2DH 1J8HA 1NBQA 1NMCB 3ARFD 5FYKE 1OPGL 4H1LG 2AKRA 1WZ1H 3BOVA 1XCQB 1QVOA 2BHZA 1XGPA 4NQEB 5LAXA 3KLDA 4OUUA 3HAEH 4GS7C 2VUOA 2DF3A 2AQ2A 3TZVD 3STLA 3T0AA 5ICZB 1XF3A 1X4ZA 2V5SA 3E3QC 1WT5A 1SJXA 2MPAL 4AZ8A 4YZFF 1FC1A 3BUYB 5L7XH 1IGTA 5LKNA 3LS5L 4LQFH 3S6CA 1VEPA 1WISA 4K7PH 5GZND 4KJQD 2DJ4A 4WDIB 2V9RA 2Y7QA 3DGGA 3SO3B 4PJ5A 1IC4H 2ITCB 4P9MH 1M05B 3LH2L 3BPCB 3DVGA 4M48L 1IBGH 1T0MA 5FV1L 3TVMD 3LEVH 1L7IH 5KBNC 1H8NA 3TIDA 1BQHA 4H88L 3VWJC 1H3WM 2DTSA 4U1SA 1RVFL 1JPST 1PKQE 4XBEH 4LU5L 1TITA 2D7TH 3UXFA 4R0LA 1MAML 5DJCB 3QA3B 5I19H 1JUFA 4L4VA 2PO6B 5SX5K 5EC1A 4S0TD 4ZPTB 2XWBA 5MENA 3GI8L 5ANMB 4AM0B 2IANB 1WEJL 1R0AH 1KSRA 4U49A 2DM3A 5JXED 5H37G 2W0PA 3AS2A 1KF9B 2H6PB 4PG2A 4XCEA 4ZO9A 1LILA 5EOQL 2FGWH 4D0CB 2IPUK 3WL9B 3PWLB 2EICA 3BKCH 5C0AB 4Q2ZB 3T4AB 3SJVA 4X6EA 4PY7A 5KAQG 4N0CD 3EO9L 1QFUH 2VR5A 1D5ZA 1NLDL 2ADJA 3QULB 2G75B 2ZUXA 3ARZA 3BH8A 3KJ4C 1KTLA 3UX9B 3QFDA 5IW1A 2EIDA 2XZAL 1RK1B 3C5SB 3MRIB 3GSVA 2Y06H 5F1IA 1OP3K 1NGQL 1BAFL 4IHOA 2BERA 1Z3GH 3ULUD 2J5LB 3MCLH 3NFNA 4PJIF 4U6XA 1P4IH 1BLNB 4U1GC 1UXSB 1HXYA 5C70A 4EN3D 4LPWA 1QRND 1ZTXL 3QWQB 1I1YB 1BZ9A 1DCLA 1RZKL 2X4QA 1JNNH 2VDNH 3G6JE 3C8DA 3CVHH 3Q6FB 4P4KC 1S5IH 2LU7A 1YC8A 1FPTH 2QQNL 5D7JC 1RZGA 3NAAH 4FQIL 5D2LB 3UP1A 1P9MC 3RVXC 4Y4HA 2FEDD 4IBLT 5D71H 1MFEL 2R0WL 4OZHF 3RAJL 3CSBA 5HYSA 4L8SB 1QUNA 5JHDA 4NQCD 3KGRA 2X40A 3QFJB 4PUBH 2GJ6A 3V79C 4XP9H 2C1OB 4JKLA 1F4XH 3ZKXB 3BSZH 3LZFH 5JORB 3VXRD 3SGKC 4XRCA 4I0PD 3VGBA 4DKDC 5H2BA 3DMMD 5K9OA 5HGAA 3VFNB 1FYTE 2R2HA 4JRXB 4XHJD 3TO4D 4XCNB 4F8TA 2ZNWA 3FQUB 6FABH 3BWAB 1T6VN 3L7FA 1G7HB 3QNXB 3T77B 4D9LL 1MFDH 5FUCE 4HMDA 2FHCA 3MYJA 3W11C 1QBMH 2BMKB 4YBHA 4KVCL 1JHKL 4EBQH 2NR6D 2VXQH 1NFDE 1EUUA 4N1CA 4OFYA 4YH6A 2R1XA 4NM8H 3BD3A 1JV5B 1YEGL 5D7KD 3VFTA 4YIQB 5ESVB 1XF2B 3AS0A 4YQXH 3IXTB 3LB6C 3V6ZA 4YDKH 1U8PB 2VDOH 2BP3A 4NJAL 3TJEL 3DPBA 4AEHL 2EDXA 4QWWC 3TBSA 3R1GL 1DEEB 4AEEA 4WUKH 5DJ0B 1HOCA 3CXHK 1Z9SA 4M1GH 3RZCB 2NX5B 3ARFB 4KMTL 4GRLC 4X80L 2AP2A 1OVZA 3D2UD 1MPAH 3Q3GA 3D0LB 4L3EE 2YZ8A 3HZVA 4O00A 3OZ9L 4CDHA 4XCFH 3ZDYE 1TTUA 2PXYD 3EHBD 5I8EB 1G0DA 5DYOA 3WJJC 4ZO6A 1EJOH 2BC4A 1H3PL 3UYRH 3L3GB 5KOVC 4IJ3C 3CJJA 5IHZB 1U36A 1J05B 4QT5B 2C1PA 2VDPL 2H2PC 1PKOA 1EXUB 4PRAA 3U48A 4KKBC 3O4OC 4WHDA 1OLZA 2NY2D 3ARWA 4GBXC 4LHJB 2GCYA 3VFRB 3S4SG 1RK0A 3OJ2C 1NJ9A 3MRBB 3EOAA 4AMKL 5A2IH 3HG1B 1T89C 2PW2A 4RFNB 5DS8A 2MQ0A 4PRIE 2Q6WA 43C9A 5D70L 4PS4L 3ET9F 1I3RB 4YBQC 4PG9A 3MRKB 3MV8D 2H2SC 4ZFFA 1AP2A 1DBMH 2NXZC 3EAKA 4JY6A 4X7SL 1FORH 3T65B 2CLZB 2ICEB 2DM2A 1DN2A 2BSRB 1T4KA 4M7LL 2B2XL 4JRWA 3VXTB 5GISL 1QPPA 2YPKA 2FDBP 3BZ4A 1MJ7L 2EDLA 4QY8B 1K4CB 3RVVC 4I3SL 3SGJC 3WXVL 4A6YA 4NNXA 4FXKB 2YC1B 4PJBA 4Y16A 4QCIA 2F8OA 3KYNA 1FNGB 1GGIH 4NOBA 4X4YA 2BNRA 1GYAA 2XTJD 5HGDA 1QZ1A 1B0RA 3GO1H 1WFNA 2BOCA 4X0KB 5F3HA 1BQLL 3UC0L 4LDLB 1XGQA 1CFQB 3EYSL 4HULB 3BKJL 1E28B 5CHNB 3GMQA 4Z0BL 2GFBA 1ZWIA 4HDIA 1QRNB 4P2RE 3WO4B 4R26H 1XZ0B 3RA7H 5FFLA 5IB2A 3BZFB 4OLYH 5HI3C 1U8HA 2I9LB 2ED7A 4O2FA 4XNZB 1E4WL 4WGVB 2VKXA 3GSOA 1A4KA 1OAXL 1QSEA 1CDHA 1UWXK 4KUZL 2FJGB 1GZPA 2CR6A 3RNKA 2BVTA 4KTEH 5HXMA 1C08A 4P3DB 1A7NH 4DKAA 1QNZL 4P2OC 3HMXL 5CJQL 4CVUA 1IGCH 2XYCA 3GMMB 4LLDB 3FMGL 4HC1A 3L3DB 4NFBA 1JNLH 4HUUA 5JO5A 4FQJL 4ZUTA 5J12C 3ZDZE 2BNQE 5HI5D 2ZCHH 3VXRB 4AL8H 4I0PB 4M1DL 3IFLL 2R0ZH 3SDXB 5CZVH 3MJ6A 1J5OH 1QLFA 4HJ0C 2WBJC 4W6YB 3T3ME 3TO4B 1ETZB 1FGVL 4M8VA 5FYKD 4Y7MA 5AYQA 4F2MA 3RWJB 2E9BA 4DW2L 5I8CA 2H3NA 4QXGL 3HI6H 3QIBA 2CKBL 3CFBB 5JUEH 1F3DH 1OAYH 4JM4H 5T3XL 1UZ8B 3MOBH 3EYVA 4UNVA 1T1ZB 5C0BA 4TUJB 4LFHD 2PR4H 2VZTA 4PJFE 2QQKH 2VDKL 3EO0A 1KYOK 4ZPVA 1EVUA 5IB1A 4HHAB 4JGJA 5DZOA 2F53B 4GW5B 3OSKA 4G8GE 3MNZA 3NPZB 5MEQB 1K5NA 4Z95H 1JTPA 4TPRL 1RQ5A 2X09A 4KV5F 3WFBL 3EFDL 3RDTC 1C16B 1L7TL 3HAEG 4M5ZL 4BELD 1HWGB 4LEOA 3LEYH 2XY2A 1OF2B 4PRHE 3QRFM 5BJTB 1I1FB 1QR4A 4JO4L 5C0DA 2PXYB 3L3OA 4JREB 4NHUA 3MJ8A 1N4XH 3U7WH 3LQAH 1KCUH 3MRRA 2CIIB 5SV3A 3OKOB 1IAOA 3ULVH 2VO5A 2AV7A 4ZS7H 3V4UL 4PJCF 1T0PB 3HC4L 3FOLA 4ODVH 3GIVB 3WLWC 3C60B 1D5MA 3QUXD 5HVHC 5DVNA 3EO1A 4LLUB 4OZIF 2HKHH 2B0SL 1AKJD 4ZMAT 1S5HB 4HS3A 2C3VA 3HLAA 5A3IC 2DKMA 3QEQE 4OB5L 1KJ2B 3IDNA 5KSVA 5IMLB 2JJWA 4Z5RB 1LO3H 2GSGB 1DQDL 2H8PB 4M6NH 5HGHB 4LCCA 3BE1L 1A14H 5T5NG 1GZQA 5EOTB 3CH8A 1DEDA 3R0NA 4YHML 5EO0A 3MFGB 1EEYA 1GSMA 1RHHA 4FQQA 4UV4L 2VB5A 3AREC 3CU1A 2XTLA 4OZHA 1NC2A 7CGTA 2Q8BH 3AU1B 4NO3B 4XPHH 2FO4A 1VGKA 4MQ7A 3BN9D 3QJFA 5E8NA 5I1HH 5IB5A 4M3KB 3D18B 4WV1C 1HHGB 1HKFA 4NO5B 5GIRB 3OJVC 4CRPA 1S7WB 4HC1H 2XTJB 1JGEB 3RWHA 3V0WL 1LEKA 4HXBH 4R90L 4ZXBC 1OOAA 3REWA 1WCBA 5E99L 1F4WL 5HHQA 4C4KT 2QSCH 4OFDA 2JB5L 1JGDB 3QP3A 5J6GA 4X6BB 1G7JA 2O61A 4WNQB 5C6WH 1IT9H 1FYTD 1EIBA 1CGXA 1XR9B 4P5KB 3BKYL 5L2KA 2BCKB 1DBJH 4Q6IB 2X9YA 4MJ4A 4P48A 3RWDA 2HJLB 4LLQA 3QG7H 1UM5L 2VLJA 3HS0A 5DRZA 3T4YB 1MIMH 2QV2A 4LNVA 5IIEA 1MCBA 3CX5J 2W60A 3MTRA 5D5MB 4JHAH 2J3SA 1CE6B 3LHPL 4RISL 5F89A 3SOBH 3QDGA 5IG7A 3AXLB 3MLUL 5BS0A 4MHHI 4DN4L 5J11B 3QI9D 4R7NA 5IB4A 4DFIA 3EDKA 4PGZA 3FT2B 3CIQA 5ALCH 3A0OA 2ZUYA 5EU4B 4UDTA 4WEMB 1RSFA 3HPLA 5ALBL 1HHIA 5J13B 5CUSH 4PJAE 5CBEB 1CFNA 4WI8A 3GJEB 1UCBH 2AXHA 1DVFD 2COQA 3SDDA 2I60L 3QUKB 5I75B 1U91B 1NBZA 3QHTC 4L3ED 5IM7B 3DRQB 5DHYA 4BSVA 2PETA 4H26A 1ITBB 2CLRB 4QYOA 4WW2C 5CGMA 4Q9RH 2V5YA 4X7TA 4RGMB 2FB4H 5DLMH 2FYYB 5BZDA 1IEAB 3VH8A 3DX7B 1KEMH 2EDFA 1X5LA 2O26U 3ULSA 4QOKE 1IAII 3BQUB 4M61A 4TSCL 2XT1B 4U6VH 5L6YH 4N5ED 4QNPF 3EW3B 4F8QA 3BAEL 1P6FA 4GMTL 4UOW1 4NCC1 1FL3B 4PJGB 4YHOL 5BRZB 5KVMC 1IGMH 4PRID 4DGYL 4MNGE 4M1CD 3PP4L 3UTSB 4DFHA 1MFCL 1KXQE 4XCCH 2GAZB 1WWWX 1J1OL 1U3YA 4BH8A 5IW6A 2W9DH 4R3SA 1E6OL 4FS0A 4CL7A 2BVQA 5EUKB 4EQ2A 3HFML 3QUXB 5I76B 3S36H 5FO7A 4GAGH 5FOJA 4X6DE 4K3EH 4OGYL 1OCWH 4P5MA 1DUYB 1DANT 4KJYA 4LRNH 4YO0B 1T7YA 5C2BL 5E08L 1YPZE 1J0IA 3JZ7A 3QEUA 5DD5H 3VXUB 4HUWA 1KBGH 4XPTL 2OL3H 1BPVA 1EAPA 1VFAA 3RKDD 3QG6A 5KSBA 3INUL 3SDAD 4OGZA 3FQNB 4Z7UA 5JPNB 2WIIA 4LHQB 1MHCA 4QEGA 3HRPA 4FP8H 4KK9C 3ZT6A 2CJUL 1JVKA 3GJFA 4Q97A 4KU1A 5FKAB 5IFAL 3CLFL 3DTXB 2XIDA 1EBAA 4W81A 1A6VH 4P2RD 2AEPH 4X98A 4H0GA 4OCXH 4JG1L 2I25N 1QO3A 5INCA 1G84A 4U0RB 1WAAA 3WLBB 4KKCC 3T0XA 4WCYL 1RJYA 1PLGL 5EORH 5KZCD 4BUGA 2IAMA 1WLHA 2V7HA 2EDBA 1FNHA 4OM1L 5F7LB 2I9TB 4YDLC 3BFOA 4NYLB 1RV6X 3IFOA 4HIEB 3I50H 2LTQC 4NFCA 5EO9B 1R5VA 2DQGL 2XZCH 3CX2A 1G7QB 3PGCA 1FJ1A 2JIXA 5AZ2H 5E1HB 2A38A 4V1DD 4P23A 2R4SL 4JKKA 2BNQD 4CDGC 3P73A 5DC0A 4L5FH 5ETUA 1IM9A 1SEQH 4PGDA 2EE3A 1A4JB 1DANU 4MD0B 4PLKC 4JFOB 2AK1H 5JLZA 4NRXA 1E0OB 3KWWB 3U46B 1FVEA 2LFGA 3DIFB 5GGRA 5L88H 3HUJE 1IFHL 4YFLI 1K9TA 1AGFB 3ARGC 1MFAL 2AEQL 3QJHA 2Z92B 2DS4A 1TZIB 4APQD 1NUDA 1M7DA 4BQ6A 4PRPA 3P0VL 4F15B 2NY7L 3QWRD 1EHLL 1E4XH 1DN0A 4YPGA 5DTFB 1OTSD 4ZSOA 3TYGH 1LO2H 2FSEB 1ADQL 2XACC 3P40A 1DUZB 5C0CB 2ED8A 4FHBD 3WIHL 5C0ND 4J7RA 4ZFZB 1EEZB 4G8GD 5HYJD 1C12B 2R8SH 4PJHE 3P9WB 3NCBB 2XQYG 4UDUB 2YXMA 5E0QA 1OB1A 5FOBB 2BSSB 1PQZB 1UQSA 5F96H 1EFQA 3N9GH 3U1SH 1NAMB 4PJCA 4BFIA 1MHPL 3MV7B 1NGZB 4CNIA 3WCYA 1CGSH 1FV1A 3O6FA 3CVIL 4UIKH 3KLHD 4OZIA 2HT2C 4PRHD 2D4FA 2QR0A 2ITDA 4QRSB 1IL1A 1KC5H 1MWAA 3D3VB 1FO0A 4Z7WB 3QCVL 2I5YL 1GXEA 2EEBA 1KIRA 3DI3B 3IDGB 3IDMA 3S5LA 3CCHA 5TF1L 3QPQC 2EDRA 2P5WB 5CS7A 4JO2L 1BJMA 2NY5H 4M8QB 4P3WA 5DQDL 2Y5TB 5C0EB 1A7PL 5HSFA 1FFPB 1EO8H 2J5LC 5MEPB 4YZFE 2W59A 3QEQD 3KPPB 2XKSA 4MQXD 2NY6D 4MJ2A 3S8WA 5E8DL 4DKEH 5IMKB 1YEDA 1OAUL 4MDIB 3UPRB 4JQIH 4KZDH 3AUVA 1AHWA 3SCMC 4BH7B 3QDME 4LVHB 2W38A 4CKVX 1Q0XL 1JWSB 4YAQB 4XT1C 1NMBH 4O02H 2X1QA 5C8JA 4J8RB 5KSUB 2EZ0C 2F5BH 2VWEE 4WUUE 3W0WD 1P53A 3AY4A 1VGEL 1PG7H 1E4JA 3VXME 1W8NA 4R4FH 5F88B 3MLPA 4L8SC 1Z9MA 4XI5C 4U1HB 1PY4A 4HUXA 3PGDA 1LD9A 1RUKL 5EZIH 1U6AL 3ZKXC 3QUML 3MROB 1ZEAL 3PWPE 4I0CC 5IVZA 2UWEB 4GLRH 3WUWB 1UACH 3SDAB 4AYFA 1C8PA 3RFZC 1NGXB 3REVB 5DD0H 5EUOF 1QSVA 4L8CA 5HBBA 2OJEA 4OLWH 3SGDI 4LSVH 5E2WL 3KXFE 1MEXL 3GSUA 5LGKA 4U31A 2EH8H 5FYJU 3L9RA 5D1QD 1YY8A 5DRWB 3LV3A 3VFMB 25C8L 4OCMC 3QUZA 2VC2L 1U92A 1TTGA 4OF6A 1L4IA 3QXAA 1IZJA 1I8KB 5KVDL 4PJIE 1F11A 1A7QH 2DYPB 1Q94B 3C87A 3NABL 4GRMB 3FT3B 4NO0D 1XF1A 1YYLL 4HUKB 1EJ6A 2XFXB 2YD5A 4I0KA 3DARA 4IRJB 3KPMB 1HYRC 1NCBL 5FGRA 1R3HA 3ARFC 2OXHA 3TPUB 4ZUUB 1NEZB 1OTTD 2ZSVB 3RY5A 4V1DB 1RZFL 3N1FC 3LS5H 1P1ZA 3VWKA 2Y07L 5F97E 3V6FB 5I1KL 3TZVC 3WXWL 5JW4N 1MUJB 3MRLA 3HE7A 5IK3B 4EI5B 1UJ3C 5GRUH 5I1GL 3SKMA 2VZ3A 3BYYA 2CDFB 2BVYA 1U93B 4LNRA 4U1LB 4PP1D 3T1FA 3QDJE 2R2EA 2VZ1A 1LE9B 5GZNC 3U9UB 4KJQC 4ZNEE 5EBLA 5EN2B 2ZUTA 4OLVH 1KCVL 1RIVH 1MWAH 1FO0H 2KUTA 2WUBL 5HHVL 1RVFH 5CSBA 4X7FC 5MERA 3G5VB 3V0AC 5SWSB 4G43B 5LQBH 5FYJE 4K7PY 4QRRD 3L5XH 2ARJA 4MB5A 3TA3A 1JZ6A 3OKNA 2LVCA 3HNTH 2P24B 1HILB 2F58H 1WEJH 3BJ91 3NFSL 4JFQB 2MFNA 5C0FB 2OQJB 4QOKD 3WEXA 5HYJB 1AXSA 5EOQH 4LEXL 4Z7VF 3UPAA 1ZT1B 4IRZL 4X5WB 5C7XH 4CVWA 1TXKA 4N9GA 1DBBL 3Q48A 4HGWA 4LVOB 5JHLL 4QGYA 5JXEC 3VXSB 4JM2B 3KR3L 3EO9H 3BP5A 3UTTA 3KPRA 1MFBH 1DFBH 2ZOKA 4OZFB 4HH8A 3DO7B 3H3PL 1YNKH 5DI8A 2XZAH 1AR1D 2RHEA 4N0CC 1IARB 1SM3L 4HH9B 2ZCLL 3VCLA 2BY1A 4S1QH 4A2LA 1ZS8B 3FB6A 5GHWL 1GC1C 4IIQC 3HC3L 2NY3D 3RI5F 1XEDA 4FXLA 2FD6L 4R7DB 2MTPA 5IFJA 2OX5A 1W0WA 3BESR 2ZJSH 3O41A 5IT2H 4I3GA 1S7RB 1ZTXH 4EDWH 3ULUC 1WZMA 5ITFA 3RIAF 2DMCA 4O5LL 5J1AB 4XVTL 4LK4A 4EN3C 1YMHA 2NY6B 2V5RA 1CN4A 3KLAB 4P3CL 2DQDL 1YMME 2VSCA 1N3NA 4XPFH 4FQIH 5JMRA 4PTUB 2GTZA 4LCUA 4LHUG 2VISA 3MJ7B 4J3TA 1CWVA 5ICXB 5CSZB 1U8IB 3RAJH 4ZAKD 3VE0B 4XBGB 4XWOD 1BD2E 4CJ0A 1U41A 3FL7A 5BZWA 4JEGB 4NKQB 3HN3A 2YD9A 5GS1A 5FA4B 3W0WB 3BDBA 2M8XA 5BXFA 2FEDC 4Y8AA 5TPWL 3CPLA 5JW5B 4EDXA 2HKFH 4PJEB 4XP4L 1FE8L 1G7LA 1URLA 4Q0XL 2JB6A 4PV8A 3QEHA 4YX2H 3QO1B 4ZQKA 2GUOA 5C9JA 4I0PC 1U8QA 4HWEH 1BGXL 1U95A 4EEEA 5LCVL 3U0PB 5D1XB 4WY7L 4FQXA 3TO4C 4XHJC 4M7ZC 4NQUA 5CILL 3DXAD 1TQBB 2A73B 3GSQB 5FDYA 3E2HB 4HWZA 4QHMB 2KZ1B 4P57B 5D1QB 3HMXA 2NR6C 3VGHA 2B5IC 3WHE1 4NJAH 3TJEH 3PDGA 2C26A 4AEHH 4LSRL 3BXNB 2X4SB 3P9MB 2UVEA 2Y6SD 1ZGLA 3L5HA 3LKPB 5D8JH 2AJZA 4NUJA 2VLKB 3MCG1 3DVNA 4NO0B 5EBWB 2YN5A 3UZEA 4KMTH 2XKNA 2X1XR 2Z8VC 1BOGB 2YSSA 1T0NB 3FO9A 5T1MA 1ITCA 4LSQH 3OZ9H 2CGRH 2CKBA 4HEME 3OJMB 5GGVL 1H3PH 3O2DL 3RY6A 1MI5A 3ROOB 4M4PA 4L8BB 3H7BB 2ZOLB 2PXYC 3F65A 3TH3T 2VMFA 2ZPKH 1T5WB 4QHKJ 4AK1A 2OM5A 2R4RL 4C56A 4ZFGL 4QRTB 4OKDA 1HDMB 1IQDA 2W92A 1I7TA 2LU3A 2X1PA 4U6HA 4AMKH 4FFYH 3ZE0E 4JCMA 1XCTA 4NQDD 5CGYD 1IAMA 5HHNA 1FNSH 4N0UE 2NY2C 3KNBA 4MJIA 3ROLA 5I1CL 1UC6A 4QRRB 4X4ZA 1ES0A 3VWJA 2F8VA 2VTFA 3KS0J 4J3UA 3I6KA 3VRIB 4X7SH 4K71B 3K81A 3QZWA 2ZP0T 2EC9U 3FOMA 2BVUA 2VR9A 3JTTB 2IH1A 4P46D 5GISH 2X4UB 2BVPB 5KSAB 3QEGH 5F3BB 2ICCA 4ISVA 1G0YR 3H8NA 2O93L 1QFWI 2A83A 3NCEB 4L8DB 5D6CB 3E6FB 1I9JH 4RZCB 2E8YA 3MJ9L 2D0HA 3WXVH 4D8PA 3MV9B 2X4OA 3BVNB 3MNWA 4MZ2A 2HG5A 4MNHB 3TN0D 1X6LA 4XPAL 3QDMD 4PJ8D 5IF0A 4LPVA 1AQDB 3UBXI 1KUMA 1LEGB 1NDMA 3U0TB 1BQLH 3UC0H 1BWMA 4N0RA 1KN2L 4QHLA 2J8UF 4Y89A 2R1WB 2NY3B 4I13B 5DQJA 4WUUD 5SWQA 3NZHL 5DD1H 4FMFA 3BGFC 2XTJC 3VXMD 5GZOD 3KPQA 5BOZG 1U8MA 2B1HL 1XIWA 3G04B 3QCTH 4I9WE 5C09A 4NM4H 3TNMA 3IDIA 5FO9B 1XH3B 4ZUWB 2KQMA 4TVPL 5KVGH 3PV7A 5F1KC 3F12A 4X9BA 4LKXB 3PWPD 2B4CC 5BV7B 4PBWD 3DV6B 1E4WH 3GJFK 3P77B 1FZKB 2X7LB 2JJSC 5CD3A 2Z35A 5GSRA 3HMXH 5CJQH 4ZAKB 1A0QH 3FONA 3L3HB 3VGEA 1M6OB 3GMLA 4P4KA 4Q6IC 15C8L 5D7JA 3D25A 1P9MA 3FMGH 4ACPA 4MX7A 2K1MA 3CXDL 5IWLC 4GG6F 4QRQA 4FQJH 5EA0L 2EDTA 2JK5B 2AV1B 5C0GA 1XGUB 4F58L 2DLFH 5DJYA 3QSKB 2FZ3B 3MRNA 4XNMA 1YC7A 3IFLH 1VEOA 2EO9A 2C7UB 4PJXB 1OW0C 4HD9A 3GFUA 2EE9A 4W6XB 4C83A 3O4LA 2VZOA 1ZLSL 2GITA 5J11C 1FAIH 3GDBA 1L9MA 5AAMA 5HI5C 4P4RA 3NPSC 4LCWE 4KVNH 1HHHB 4OF0A 3SGKA 3L1OH 4DW2H 3DROB 4HFWA 4ZD3L 2PW1B 3VG9B 4QXGH 5JDSB 4C55A 3TH4T 3CH1A 2UZXB 3MZTA 1M71B 2VDQL 2G60H 3O11A 4W70A 3VFUA 3CMGA 1R5WA 3QH3B 5J89A 2EDHA 3VI4E 3DXAB 4ODWB 3F7QA 3Q0HA 3VJ6A 1DQJA 4YNYB 5CEYA 3MGTA 5AUMB 1KPRB 3PWJB 3FHQA 1U8JB 5I75C 5D2NE 3TWCL 2CD0A 2N7AA 2VDKH 3D5OF 3FRUB 4UOJA 1GIGL 3MACL 4HFUL 1BECA 4JANA 4G8IA 3F7VB 1IILE 2H9GB 3SQOH 4G7VL 4D3CL 3VGAC 4WU7B 4KZEL 3QDJD 4Y1AB 3O45A 3HE6A 3HA0A 3HUJB 2OSLB 3O3DB 1EFXD 3FB8A 3MLZL 4WWKA 4MA1C 4TPRH 3S88H 3WFBH 1AY1H 3EFDH 3FQRB 3WS6C 4MXQC 3V7MA 3LDBB 4C58B 1KLUA 3ZLQC 4PRDA 5C08E 5TQ0L 2DWDB 4DGVH 1HZHH 3FT4A 3BPNC 1J12A 4NN5B 4JPIB 2YXFA 5DHVA 1RUML 3TBVA 1UVQA 3V4UH 4FQLL 4RAVA 4LVNB 3WJJA 1X4YA 5DQ9B 4MA8H 3BKML 1HSAB 1WF5A 4OTXH 2APFA 2B0SH 1JL8A 1HYSD 1G7IB 3EOYG 5C07A 3RVWD 4OCRL 2ZG2A 5T1DL 3L95A 3T8XB 4OV6F 3DBXB 3QUXC 1G9NC 4NQDB 1R24A 1FDLL 3V9FA 4WW2F 1EMTL 4GBXA 4G7YL 5DK2A 5T33L 2DQEL 1W72B 3BPOB 4XZUB 4ZTPL 2KH2B 2HRPL 1UXWB 2Q8AH 4MDJB 1S7QA 1BP3B 2E7BA 2VXTH 3M17A 1MRDL 4GAFB 3LKRA 4JPKL 1GC1L 4PLJD 1ZHBA 4YHMH 4GMSL 1RMFH 4OCYH 3U2SA 4UV4H 4JFPA 1I7UA 4XAWH 3MRCA 2RFXA 4DZ8B 3GMOA 3ULUL 1O5DT 1NCAH 1S7TA 4EXPX 3UTPE 1A3LL 2FEEI 4FTVB 4JRYB 3B5TA 3V5KA 2BVOA 5I30L 3GKWL 1YMMD 4JDVA 3TN0B 3QDMB 5IR1B 1EV2E 4OKVB 3BN9C 3WE6B 4U0RC 4M02A 2Y72A 3C6LD 2P8LB 4ODTL 4KTDL 1BD2D 1FCCA 3O3AB 3V0WH 3GUTA 1EUTA 1ND0A 4QNPE 4NHCH 4HIIA 4R90H 1OHQA 1KPUB 4PJ7B 4C54A 2V2TA 4NN6B 3GEWB 3EFFA 5E99H 4PGBA 1F4WH 2EYRB 3MLYH 3RL1B 2X70A 3NN8A 1CQYA 4WU5B 4GRWF 1UEMA 4YDJA 1MIEH 3MBEB 5E4EB 5D1ZB 1OAQL 2ORBL 2JB5H 3BD4A 5CKAA 1H0DB 3AM8C 3WFDL 3MODH 2WLYA 5HHME 2MKLC 1G7PB 5F7EL 3KVQA 3DX8B 3BKYH 1U8LA 1EZVX 1U8OA 2APBA 3C5ZD 4P2QE 3LSOA 4X5XA 3GZKA 3CNKA 2LV4A 1HHJB 1JNHB 3TM6A 2SEBB 1N5YL 4UIMA 4ESKA 4K8RD 9CGTA 5FGCB 4F7PB 2G2RA 4MAYB 5FUCC 3V6OE 5I1AA 1T21B 5ISZE 3QDAA 1RZ8A 3FKUS 3MPCA 3LHPH 2A77H 4P2OA 3MLUH 4DN4H 4F15C 2HLFD 3DX9B 5ID1B 1AD9B 4JPWL 3L3KA 3I3BA 2IQAB 5FHBL 3NACL 3VDAA 3ABZA 3QI9C 1MJUL 1FRGH 1BBDL 3RUGB 2DQCL 2WBJA 5JTWA 4Y8DC 3T3PF 4XVSL 1MLBB 4OD1H 2PYEE 4NO2A 1TVDA 2NW3A 4Z9KB 2LABA 1OLLA 2VIRB 5FCUH 3GM8A 3I75B 1DVFC 3TPKA 2Q7YB 1DE4B 2CDEA 1U8KB 3SKOB 5IUSA 4G5ZL 1C7SA 3STZB 5JOPE 1T2XA 5EC2B 3GSXB 2UZYB 1A1NA 3KPSD 1A7OL 5SWZB 3ARDD 2ESVB 1ADQA 2BK8A 4I2XE 4TSCH 4HMCA 3WIHA 4MXVF 3B2VH 3IJHA 3BAEH 4JY4A 3IYLW 2J8HA 5I8OL 1K3ZA 1LQSR 3C08H 4K7PX 3VW3H 5IKCA 4P49A 4GMTH 5FKPA 3O3BA 4YHOH 4LMQI 2NY1B 4N5EC 4NNPH 2IPKB 1MHHB 2I27N 4QHUB 1KJ2L 1J1OH 1HINL 1FNAA 3EUUA 4X6CF 5B8CB 4FABL 3O9WB 4LVHC 1E6OH 4M1CC 1OP9A 4Y4FB 4Y19B 2YKLL 4R96B 1CG9B 4HW6A 2JELL 2VDRL 4OGYH 2VE6A 4ZFOB 2F54A 4L4TA 1HH9B 1I1AB 4BM7A 5C2BH 1BVZA 2YPLA 2J8UA 3IKKA 4XPTH 5ESAB 4L1HA 3TYFA 2Z8WC 1CXIA 3IVKB 1NKOA 3INUH 4HBCH 2VKWA 1VESA 3TO2B 1KXVC 1ULVA 4PJ9D 2KZWA 3FQTB 3NOIA 4GT7A 3MMEB 2CJUH 3RKDC 4F7TB 4YHLH 3CXHJ 2HLAA 3SDAC 5D96B 4F3FA 5T3XE 1DLHA 1NMAL 4IMLA 3X14B 1ONQB 4EUPA 1IQWH 4I9WD 5I9QC 3I6GA 3FRPG 4Z78B 2ENYA 1RULL 5C3TA 2E7MA 4GG8A 4RA0C 1MLCA 2HJKB 4H25B 1M4KA 3C2SA 3U4AA 4WCYH 5IMMB 2B4CL 3HTLX 1NKRA 1QFOA 2FX8H 1T04A 2ADIB 3MLSH 4G80A 5TDNB 3I3DA 4GAJL 4E0RA 4JZNA 1XF4A 4S1SL 5JQ6H 4PGEB 3C6LB 1CZ8H 3HMWL 4K3GA 4RFOH 5D2LF 2DQGH 4WV1A 4RGOH 2VLRA 1B2WH 1LO4H 1QSFE 2EIZB 3P0YH 5DRXB 5EU5B 2OP4L 4QXTA 2R56H 1IC5L 1IEBB 3RGVD 1JZ3A 4AH2A 5KS9F 1NBYA 4ZXBA 3EYUL 4CADB 1CXFA 5CEXB 4AT6B 3ZO0A 4CN1A 4F7EB 4IS6A 4BKLA 1KIPA 1P7QD 3QAZC 4ODHL 4LCWD 2NLJA 2CMRL 3WFEL 3C5ZB 3OTTA 1FIEA 5CP7A 5IVXE 2IALB 2XRAH 3HI1A 4H5SB 1MFAH 2O5YL 3QIWB 3VMNA 4J4PD 4M43L 5KJRH 1X5ZA 1DR9A 1YEKL 2HTKD 3HZMB 3WDIA 5FYKL 1EHLH 1LWRA 5IV2B 1D5BB 1D5XB 2Q3ZA 2MHAB 4APQC 4CJ1A 3S98A 1BMGA 3WIHH 1MJJA 2EDYA 4W68A 1A9BA 4GQ9H 4CVXB 3ARBA 5EUOE 4JY5L 3AAZB 4NPYA 2GSIA 1OTSC 4OCWH 4YE4L 4CAGA 4UQ2B 5J6HB 3OB0K 2OR9H 3FCTB 3DUUB 3B9KB 2OTWB 3QO0A 3B3IA 5CMAB 5C0NC 2Z31A 1K8DB 1HH6A 5AZEL 3MC0A 1XT5A 1MHPH 4JFXB 1UH2A 1ORQA 5C08D 5J06A 1DDHB 3MYZA 2HT4D 3QHZL 3VFSB 3H9YA 3O6LH 2GHWB 2XN9B 4K07A 1TJGL 3QCVH 4MCZA 3PJSB 4YEEA 2XNAB 4OF7A 2I5YH 2P42B 1CK0L 4RBPH 3L7EB 4AIZB 5ID0A 3C5JB 3KLHC 4JDZB 3ZSSA 1PX3A 4JG0L 3JVGA 4X4XA 4KKLD 3KPSB 4OT1L 4I4WB 5KVEH 1F58L 3HR6A 1NCWH 3GBMH 2GIYA 3KPNA 4YHKH 1VACA 1UB6A 4S1RL 5E8DH 1G9NL 1ORSA 1ZA6B 3K2UH 3AROA 2A9MH 1HNFA 5HD8D 4PR5A 2HFTA 5TDPB 3OHXA 1CXEA 4LLYB 4MQXC 2NY6C 3C9NB 5D93B 4GKSB 4HT1L 4EUPH 5FB8B 1NSNH 1TMCB 2YUXA 3QWOA 5HJ3B 4FQCL 1JNJA 5JIKA 1GGTA 2APVA 3FB7B 5HHPB 1VGEH 4U2ZA 1Z9OA 1DQML 3QT2A 4HKBB 3NBNA 3OXSB 1T03L 1QR1B 4FXGA 5GSVB 5HYQB 4QRUA 4GW4B 4O9HH 4JB9L 5EFIB 4HPOL 5E6ZA 4HLJA 3NZ8A 3UTPD 5DJAB 1RUKH 1A9EB 2NZIA 3LRSB 3T0EA 3KPOA 1KB5L 1ZEAH 1NL0L 3PV6A 1IE5A 2BOBA 1KYOJ 5K9QG 2CK0L 3KHQA 2WK2A 3CD4A 4OJFL 4B7IA 3LQMA 1E4KC 2ATPA 2ATKA 5D7IE 1AO7A 4Z7VE 5I17B 1K2DB 5LGHL 3JWDC 5EPMB 3RWGA 5EBGA 1ZHNA 3NIDF 4ZO8A 4X8JB 2JJTC 4UU9A 4RMQA 1C5DA 2E6JA 1MEXH 4U6TA 4WO4D 3MRFB 2DI8A 2A6DA 1TVHA 5D1XC 3OG6B 3S34L 1J0KA 5B3JE 3ULUF 1FVCA 1LE5A 25C8H 3LMJL 4OSUL 3WFHB 2VC2H 1JF1B 5HHMD 3E2HC 4O4YH 5I1IL 5C0RH 3E6HB 3MLWL 5D1QC 2CIKB 1U8NA 3H9SE 5I66B 4P2QD 2AGJH 4CU7A 1YEIL 1J7VR 3NABH 5ENWB 3X12A 4WHYH 1YYLH 2X4RA 4S2SB 1S9VB 3KPLA 4L9LA 4JPVL 4OZ4B 1K8IA 5DWUL 5ICYA 3BEWB 3LN9A 3MRHB 1I3GH 1LK2A 5ISZD 2A1WL 4J3WA 1AXIB 1YEHL 5GGRY 4HV8A 2VERN 4LLMA 1T1WB 4PD4J 4D9RE 5J1SC 4XNQA 1WWAX 1UA6H 2C4FT 4JFDB 4ORGA 4FNLH 4U1MB 4G42B 5J9PB 3JV4A 1OTTC 1UB5A 4URTB 4BFEA 4Z7OF 2C4XA 1B6UA 5I1DA 1CLYL 5GGTL 3PDOB 4P59L 1EPFA 1FBIH 1JPSL 1P4LA 3KYOB 4Y4KD 4MA3B 2FGZA 5D7LE 5IJVA 4PP1C 2HN7B 2PYED 3KYMA 1OTUD 4ZTOH 2EE2A 4I48B 5CCKL 1UKQA 5EOCH 3ARGA 1KB9J 3WFCL 3NFSH 2Z93B 5E8PB 2DLGA 5JOPD 3G5ZA 1I3VA 2A74B 5DJZB 5GGQL 3H0TB 1KCSH 4JKPL 2Z91A 2BRQA 1FN4B 3O2DA 1SEBB 4IRZH 4K71C 3MFFB 1DBBH 1TQCB 5GJSL 3NCFB 2PCPB 1FGNL 4JHWL 2DQTH 3KR3H 4RFEB 4X6CA 1NGWB 3DYOA 2BY3A 2XQYK 3ESUF 2E7LA 2VXSH 4IRSB 5F7WC 5D9SB 3BDXA 4X6FA 2IANA 4UINH 4Y5XB 3BHBB 3DYPA 3H3PH 3QRGH 3HI5L 3MX0A 3UTQB 5T3ZE 2C9AA 2ZCLH 4XVJL 4NBYB 2VQ1B 3BO8B 1NC4D 5BVPL 4ONOA 3U36A 3WL9A 3B5GA 3HC3H 1REIA 2BHYA 4AEIH 3RNQB 1JYVA 2HVJA 3RI5K 5JW3L 1AQKL 5IMOB 5L0QB 5B39B 1T1YB 4C57C 1GHFL 2QEJA 4Z0XB 4LAQH 4S11A 2NY3C 5CKGA 3D85A 1U3ZA 1CT8A 3RIAK 5DMYA 5GQBA 2RCSL 4ETQA 4KY1L 4P3CH 2DM7A 4KQ3L 1BJ1J 1S7XB 2DQDH 4G9FE 2XXCB 3MJ9A 5L2JA 3DGCR 4NZUH 1FG2B 4HPYH 3LKSB 4X4MA 4ZUVA 1KIUA 1G6VK 4ODSL 3RWEB 1R3IH 3SCMA 4LCYB 1C5CH 4DVBB 5F7KC 3SDCD 3RRQA 4ZNCD 2IPTH 4E41B 5TPWH 3GRWL 4ZAKC 8FABA 4XWOC 4IMKA 4ODXA 1FE8H 3TJHD 3QQ4B 4Q0XH 4KKNA 2ZG1A 4HIXL 1FFRA 2FBJH 3CFDA 5I8KH 3OAYK 2Q86B 5C1MB 3SPVB 1JGLH 2QBWA 1E6JL 4PJ5D 3IF1B 1TJIH 2F74B 5SV4A 2AK4A 4XP5L 5KS9A 1JZ4A 1BGXH 5F7FA 4JJ5A 5LCVH 2WQRA 5E2JA 4PV9B 3GK8L 5CILH 4FFZL 1Y6NR 1QSFD 2W91A 3LKNB 5E8EB 3A6BL 3O2VH 1QEWB 3AMLA 1DQLL 2CRMA 2BRRL 2X1WL 1FH5L 5TDOA 3QCUH 5FCSH 4JLRB 3HAEB 3PDDA 3IXAB 5JOFA 2G9HB 4LSRH 4XP6H 3ECBA 2BMKA 1WTGT 4UB0L 5BMFH 4NRYB 2EKSA 1BZ7A 1WBXA 3FHAA 4XGZB 4RWYL 5ESVA 2XZQH 2P5EA 2Y6SC 2FL5A 1ZVSB 4JKMA 3LPWA 4UV7L 5HYIA 1NUNB 3CX5K 4NIKB 1LDSA 1HSBB 5GGVH 4X9IA 5CIPA 4K94L 3O2DH 4U1NA 3IS1X 3FO0H 1FCGA 3K1KC 3H3KA 3W82A 5HGBA 1UYWL 3ARFA 1MHEA 1S8DB 3MRMA 2ADGA 1XF5B 1LNUB 3G6AA 4NN5C 4LQ1A 3TF7C 4FQ1H 3VD9A 2YD2A 1NBVL 3TZVA 2IQ9H 4JDTL 2R4RH 1MCDA 1UJ3A 3QPXL 4LRIA 5DZLA 2W0FB 4GG6E 3ZZ1A 3BIKA 2OI9C 1Q9KA 5GS2H 5ESQA 3VD3A 3P30H 5L9DH 4PJDE 1JGUL 1N59A 5F1OB 5I1CH 4WI5A 4UQ3B 3MUHL 2FX7L 1YNLL 4JFYA 4M93B 4QTHA 5CGYC 2D31A 4XNXH 3ZT7A 2LU4A 3TVMA 1T7WA 1RJLB 4Y4HD 3B83A 1G7MB 3MRBA 3TNNB 3KYKH 4LPYA 2AQ3A 1WQVT 1T7ZA 3PIQA 3B9EA 4O2EB 1D9KD 3K3QA 3I02A 3PQYB 1TZHA 5IQ7H 3MJ9H 4KDVA 4PRBB 5BV7H 1O7VA 3MO1B 1CVSC 2X10A 4QRPB 4P46C 4CMHC 6CGTA 4M5YL 4WWID 1LP9B 4IEFB 2R0KL 2ICEA 1T80A 4C59B 1IM3B 1RZJL 1TNMA 3DRTB 3V6BR 3DSFL 3W11D 1I7ZA 4R2GD 4P9HC 1Q38A 5IGXL 3OXRA 3TN0C 3BP6B 2EYSB 2X05A 3FJTA 3EDEA 4G6JH 4PJ8C 4U1IB 4BSWB 3NZHH 3O8XD 5E8OB 2H26B 2X4TB 4U3XA 2HFEB 2B1HH 4YK4B 5I1JH 4IIQA 3HC0A 4NN6C 4BZ1H 3MV11 5F6HJ 1J1PL 3BRFA 2YHGA 2UZIH 5GZOC 1WV7T 2FIKA 1CFSB 5ACZB 4X0KA 4WI6A 5CJXC 2JE8A 3MBEC 3WUWG 5D1ZC 2X42A 4OZGA 5H8DA 3HPJB 5E2UL 5IQ9B 1KJVB 3CFCH 3OGCA 4LDOB 5CZKA 1BFOB 4EN3A 4GRLD 1J8HB 1QRNA 3CZJA 3JWDL 5K9KA 2AKRB 3BGMA 1QVOB 4D2NA 1XGPB 5LAXB 4JO3L 4OUUB 5HHOE 3CXDH 3STLB 2VAAB 3MRJA 1XGRA 3SDCB 1XF3B 3DETC 5AWNH 2W0LA 1YEFL 2OBGA 1IGTB 4MAYC 2EXWC 3GMNA 1PY9A 1CL7I 1IEHA 4QLRA 3FFCE 4QHNA 3LN4A 3H9SD 5KTEL 3D39E 4FG6D 1VFMA 4X7DC 3RPIA 4QTIL 1ZLSH 4DZBB 2Y7QB 3DGGB 1C5BL 4PJ5B 4KKBD 4NQCA 1K6QL 3ZDXF 4ZD3H 3DVGB 1T0MB 5EH1A 5IROC 5DRNA 5EU6E 1FFOA 5CIPH 1UCTA 1CTOA 2VDQH 3TIDB 3SY0A 4F57H 1CF8L 3IU4H 3BN3B 3VXRA 1BQHB 4KAQH 4JFFE 3VD4A 1N6VA 4U1SB 5GJTH 4D9RD 2DD8L 3H42L 3IJYA 2QL1A 1BF2A 3IS0X 3DMMA 4N0FA 3FAWA 4R0LB 1MJ8L 2FJHA 1MCOL 1JCKA 1NFIA 1JUFB 4L4VB 2H2SD 2FLBT 5EC1B 2NXZD 3RWJA 4G7VH 2CQVA 2XWBB 3X11A 4D3CH 5MENB 3H2WA 2J12B 1NFKA 4KZEH 1OT2A 1SBSH 2EDKA 1EHXA 2N1KA 2CUHA 4OFIA 4HCRL 4XCEB 1OM3H 3LEXA 4K3HA 1FL6A 2AJXH 5D7LD 4Q58C 1IAKA 3LD8B 4GRWE 2Y5EA 5TGBA 4WHYG 1INDH 1W72H 3SJVB 4X6EB 4PGCA 4PY7B 1RUQL 1MNUL 5TQ0H 1D5ZB 2ADJB 4BUHA 3DECA 1NFDF 3BH8B 1KTLB 3BDYL 3QFDB 5DUPL 5IW1B 1RUMH 2BNRD 4CU6A 4LSDA 4CN4A 4KK5C 3KS0H 4JZOA 4DGIH 3GSVB 5F1IB 3G9VA 4IHOB 1I8LC 3U79A 4U6XB 3NFNB 2H1PL 1N6UA 4TOYL 3D2UA 1TJHL 1HXYB 2OJZL 5DVKA 2OZ4L 3GIZH 4JQVC 1EO7A 1J1XL 3P2TA 1FDLH 4JFZL 5F7MC 1QP1A 4OZFG 1BZ9B 4G7YH 5T33H 1I1AC 1HYSC 1T2QH 2X4QB 1QYGH 2HRPH 1OGAE 1CDJA 5T3ZD 3A6OA 3FTGA 3LS4H 4KROD 1CD1A 1CIDA 3DVIA 4LLUA 1RZGB 4FZ8L 3ZDYF 1MRDH 1L6XA 1C1EH 1RURH 4Y4HB 1S5HA 1T3FA 4Z7WF 5HYSB 1CLCA 5JHDB 2FJFA 3BEVA 4NQEE 1KJ2A 5DC4B 3QQ9D 2P49B 3IDXL 4RAHA 2YPVL 2GJ6B 3PL6D 5CBAA 5D96C 1D3CA 1RIHH 3WJLC 1YUHB 4NQVA 4M6OH 3HNSH 4XRCB 5GGSA 1RIUL 3MV8A 4G9FD 5H2BB 3M07A 2Y1VA 5FO8A 2D03L 4F33A 5K9OB 5HGAB 4LASL 2R2HB 3K1DA 2YD3A 4MJ6B 3L7FB 4D94A 4R2GB 3MYJB 2DLTA 1KNOA 5KN5A 4UUJA 3C6LC 2R1XB 4HS6A 5MI0C 5I2IA 1WSST 4OLUH 3VFTB 5DK0A 5IB3A 3BMVA 4Q7DA 3HZYA 5F7NC 3V6ZB 4YHZL 1RZ7H 3SO5A 1CGTA 2K3TA 3U0WL 2AJ3B 4MA7L 4JFEA 2YWZA 4MCYA 1RPQA 2Z9TA 5ANME 1I85C 2Y9RT 3P4NA 5DFVC 1HOCB 3IFNH 3JV6A 1JPTL 2UWEF 4BQCA 1BFVH 3CFEA 3RDTD 3C5ZC 3TT3L 5F1SA 4EI6A 1JGDA 5HY9A 2R2BA 2IADA 4KPHH 4KXZI 5E6YA 3EDFA 4AIOA 3Q3GB 5C0AE 3QIWC 1QBAA 5A43C 3HZVB 4OIAA 1IAIH 4RMTA 5B38G 3L6FA 1GCFA 5DYOB 4AG4L 1INQB 1CBVL 1FL5A 2BC4B 2CLVA 1BVKB 2X1OA 2GQHA 5C0IA 3NACH 43CAB 3HRZA 1F6AA 2HLFC 4RAUA 1WFOA 1HQ4A 2C1PB 4HKJA 4BK4A 3BT2L 3ZTNL 5A3ID 1OW0A 1EHNA 3RX5A 3E8UL 4KRNA 1A6AA 2GCYB 3DV4A 3RQ3A 1RK0B 2UV3A 1NJ9B 3EOAB 4NJ9H 3B9KC 4PB0L 2PW2B 2MQ3A 5IBTL 2VITB 1WUNT 5DS8B 2Q6WB 43C9B 5JW4M 4WEBH 4G5ZH 2F8XC 4JN1L 1A5FL 5DGRA 4PG9B 3LIZL 4ZFFB 1AP2B 4JY6B 4LHUD 3CUPA 5D2LE 3NA9H 4TUKH 2DTML 4TSBL 1T4KB 2G5RA 3ARED 3U6RA 2GW5A 5EO1A 2CLRA 3RIFF 2C3XA 2YPKB 3T3MF 1AIFA 1NC2D 4Z77A 5DUBA 3BZ4B 3QFJE 4TVPE 3ARDC 3T2PA 5ACLA 2DMKA 4HJGA 4UTBL 4A6YB 4NNXB 3DX7A 4PJBB 4Y16B 5E5UB 4QCIB 3KYNB 1SJVA 1BEYH 3WS6A 2QADB 1MOEA 4X4YB 1S9WA 2BNRB 4J3VA 4FRWA 5HGDB 1B0RB 4PJFF 1AFVL 4FABH 1NGPL 4JRXE 2BOCB 4XX1G 5F3HB 5GS3A 1Q9WA 1XGQB 1ZHKA 3I2CH 2JELH 1PKQA 3GMQB 2GFBB 1ZWIB 4HDIB 3RWIA 1GGUA 5DA4A 1EGJA 2FWOA 5HVWA 2GAZA 2WWMD 4HF5L 4MD4A 2DM4A 3DLQR 5IB2B 1G9ML 3ES6A 1PZUB 5I6XC 1INEH 1Q72H 2MMXA 1U8HB 3LKQA 1N64L 4O2FB 3K4DA 5L2KD 4GW1A 3QNYA 4P9HL 1A4KB 3SKNA 1QSEB 1AKJA 3MRPA 1G0XA 1GZPB 2APTA 2ZKHL 3RNKB 1C08B 2DRUA 5IHUL 1U2CA 1CLOH 1IC7H 2NX5E 3VFGL 5M95B 4PJ9C 4JQXC 1LDPL 5J3HD 4BZ2L 1VCAA 1RULH 5JO5B 4HUUB 2UUDK 3OR6A 4U7KA 1A3RL 4ZUTB 4BZYA 2HTLD 2ED9A 2ZCKH 4NQXA 1VPOH 4LCIH 4UT6L 5SX5H 1TTFA 2L7JA 4OM0H 1QLFB 3D69A 4A2MA 2KDGA 1OAKL 5E7BA 3FB5A 4NZRH 2W9LA 4J6RL 3HMWH 4MAUH 1KB5A 5F9AC 5EG6C 4F2MB 2NXYB 5I8CB 2H3NB 3CDGA 5DD3H 3QIBB 1A6TB 4HWBL 5HHOD 4WI3A 3G6JA 5DZNA 4DQOH 1IC5H 2YD4A 4Y5VA 5IJKC 3WD5L 3EYVB 1PZ5A 3HG1E 5C0BB 3EYUH 5ADOL 3PWVA 3FFCD 2XG5A 4U6YA 3EO0B 3D39D 5LWYL 3RGVC 4ZPVB 3PXJA 5IB1B 1UH3A 2WWKT 3CSGA 1OP3H 3VXOB 3MNZB 3AM8A 4RRPA 4RGNB 3RVTD 5EU6D 2O5YH 3ILPA 4M62L 4R8WH 4JFFD 1K5NB 1N26A 5FYKH 1G6RA 4WI7A 3NGBC 2AABL 1FYTA 1K3IA 3VI3E 2K9UA 4LEOB 2IJ0C 2DLEA 3MA9L 4XB8A 3QIUD 5JNYA 3L3OB 1E27A 4ONFL 4NHUB 3MJ8B 3MRRB 2O5XL 1RZIA 4YE4H 5D2NC 1IAOB 1NFDA 3UJJL 3PUCA 1D6VH 4O2CA 3NIDE 2AV7B 3FOLB 4X7CC 1D5MB 3EO1B 1ZK9A 4F7CA 5JPMA 5M7QA 5AZEH 5CP3A 5DA0B 3VFWA 1Y0LA 3MREA 2C3VB 1PGRB 2IFFH 3HLAB 3QI9A 1H3XA 4MJ5A 3QHZH 4NWUL 2L7UA 1TCRA 4LL9A 3IDNB 1TJGH 3TCXA 3MCKA 2NZ9D 1IGYA 5K9JH 1V3KA 1CK0H 5ELIA 5KSVB 2PN5A 3CMOL 3OQ3B 2HT4C 1U3HD 1EGJH 4LCCB 1DVFA 3D0VA 4RIRA 3IKCA 3S35L 5TE7L 4L3EA 1F58H 3LKOA 4H8WC 5EO0B 4S1DC 35C8L 1RHHB 4FQQB 4OZHB 1NC2B 2FBOJ 4KKLC 5LXGL 1KTDA 1PX4A 2LVEA 4OBSA 2FO4B 4ZFOL 4HK3N 4NSKA 2NTSP 1VGKB 4MQ7B 1IC1A 3QJFB 4R97B 4Y2DA 1OGAD 3P4OA 5E8NB 5B3NA 3SGDH 2CH8A 5IB5B 4M7KH 3ZYOA 5DMKA 3SDXE 5HD8C 2N7BA 4XNYH 2GJZA 1F90H 1FHGA 3RWHB 1LEKB 4XC1L 3K0WA 1UM6L 1D7FA 4JB9H 1WCBB 4RWHA 2JIXD 2CO7B 4HPOH 2X6MA 5E6ID 3REWB 1X5GA 2FECL 4PRIA 5CJOL 5JA8B 2AJUL 1FSKB 1T20A 5HHQB 1TIUA 1LK3H 1KB5H 2NQCA 3WDJA 1JI2A 3JWOH 1G7JB 2CK0H 2O61B 4OJFH 1N8ZA 4HWUA 5CSGA 1IZKA 5HPMA 3UJIL 5LGHH 1Q0YL 5L2KB 4DVRL 1B4JL 2F53E 2PTUA 3RWDB 4LLQB 3DWTA 3Q6GH 1HQRB 2VLJB 3HS0B 5DRZB 5D72L 5IIEB 4OCSH 1QD0A 2W60B 3O6KL 1EA9C 1FQ9C 5ILTH 4OSUH 5F89B 3QDGB 2V2WA 5IG7B 4X6DF 1F2QA 5BS0B 4WO4C 3RL2A 2PO6D 4R7NB 5IB4B 3GRWA 4B41A 1YPZF 1MVFA 3ILQC 4ZOEA 2AJYL 5GS0D 3VRJA 3SKJL 3Q1SH 4UDTB 1G6RH 3HPLB 1HHIB 1X44A 2VXVL 2EYTA 4P2RA 4JPVH 2XI9A 3RJQB 5TH2A 1CFNB 4NC1E 4LSSL 2A1WH 3SDDB 2CDGA 1MCLA 3KDMA 5C0AD 1NBZB 1B4RA 3U4BL 5DHYB 2BY0A 1I8KA 4BSVB 3OKEA 4H26B 2V6HA 5IBUB 1A1MA 5I73C 4QYOB 4KK8D 4K8RL 3V6OC 4X7TB 2MNUA 2J6EL 4J1UA 5CP3H 1GOHA 3K46A 3VH8B 2V7NA 3ULSB 5A2FA 4ELKA 1CXLA 4PJXF 3TT1L 1GGBL 4K55A 2IH3A 2WBKA 4FFVD 3JTSA 2BNQA 3F6LA 4JFFB 5E24E 5IEKA 3U9PL 3BWUC 1JYXA 4Y4KC 3ZHDA 3MLXH 5MHSE 1II4E 1U93A 2WANA 3RJDA 3C6SA 2WIMA 1OTUC 2X89A 2OMBA 3VA2C 1R3KA 3K8LA 1PEWA 3BZDA 3EJJX 5B22A 4APQA 1UWXH 4BH8B 5IW6B 4R3SB 3QWRA 5GJSH 2BVQB 1PW3A 5T1LA 4NNYA 5H35A 5DVMA 3UTZB 5FO7B 4PJFA 3QFJD 4ZS6D 4P5MB 1TPXB 4R6UA 3U30B 3WNMA 3HUJF 4FQHA 4KJYB 3N0PB 5EU3A 2Z8RA 3QEUB 1NPUA 1NUFA 4HUWB 3B4NA 4JR9L 1UWGH 3GMPB 3GSNL 4LLWA 4G8GA 1EAPB 1VFAB 3QG6B 4YPJA 5I16A 1QQDA 5KSBB 5BVPH 3UBXA 4LF3A 3J7HA 1I3UA 1JHLH 3UDWC 4F9PC 4Z7UB 2WIIB 1WFTA 1MHCB 4TNWK 4PTTA 3LCYA 3GJFB 4K7FA 2VSDA 3EBAA 4PJHF 4PRHA 1OAZL 4X98B 1ED3A 4WHCA 5BCAA 4G8FA 3T0DA 5D5ME 1CFVH 2RCSH 3IETA 1YEJH 4KI5C 4ONGL 1QO3B 4YK4C 1XGYL 5INCB 3OL2A 2YD8A 3Q2CA 4HK0A 1OGAB 1TETL 1RJYB 5IESH 1MCQA 2IAMB 3Q5TA 4U2YA 3PHSA 2V7HB 1JWUA 3HZKA 2AW2A 5I71C 2CUIA 3RZCD 3QEQA 2NX5D 3IFOB 3SHSA 5HHXL 3L5WB 2VR4A 3N1QC 1FJ1B 4U7MA 5E6IB 2JIXB 4H20L 3CSYA 2MSPA 4P23B 4PTUA 5E70A 3DHMA 4HIXH 3P73B 5ETUB 5ICXA 3SDCC 4PGDB 1U8IA 1SJHA 1VFUA 4LPCA 3VE0A 1E6JH 5JLZB 4NRXB 1I8IA 3TJHC 3FFDA 4HSQA 1AI1L 1TLKA 2NY4B 2OMNA 2X9XA 5GGRB 2HMIC 4I18B 3DX6A 5JW4R 2EDNA 1WTLA 2R69L 1Y6KR 3GHBL 2MJWA 4OBRA 2E6QA 3MR9A 3QJHB 1E4KA 4NKMA 3F5WA 4OLXH 1M7DB 3A6BH 3SGEI 4PRPB 1DQLH 3UO1L 1LO0H 2BRRH 1K4DA 1DN0B 4YPGB 3HG1D 4PJ7F 3C2AH 4KHTL 2YRPA 3OKLA 3JSSA 2ICWJ 2JJTA 4ZSOB 4PJGE 5BRZE 3A6CL 5MEOA 4UB0H 5DHXB 4NUGH 3UTSE 2NW2B 3GMRA 3NFPA 2F5AH 3OKDA 5HVFB 4JZJA 4M03A 1OB1B 2VZSA 3GSRA 1LEIA 2XPGA 4FA8A 1UQSB 7FABL 5D1QA 3IB4A 2N4IA 2ARWA 4PJCB 4BFIB 2XA8L 5F9JA 4CNIB 3LD8C 1FV1B 3O6FB 4D9QD 4EIZC 2E3VA 4OZIB 1YA5A 4DK3A 4K94H 2QR0B 2ITDB 1IL1B 3VXUE 1MWAB 4UI2A 2EEDA 1FO0B 4NO0A 5EBWA 1QFWH 2E9IA 2QHRL 5IVOA 2H45A 5INDA 3ARPA 1KIRB 2KKQA 1D5IH 4GKOA 4KMQA 1N6QL 1NAKL 1WK0A 3PE9A 3S5LB 3CCHB 1ZE3C 3ZKQD 4GAYA 4KJWD 2MOVA 4E42A 2DBLL 5HYFA 4OQ1A 4HCRA 3RUGF 5A16A 3SE8H 1AHWB 1MCCA 1P2CA 3NTCL 3ZDXE 4HUVA 4PJAA 1FZOA 2WINA 1WBZA 2BJML 2G5BA 1CE1L 5IEHA 1UG9A 2K7QA 5J7CC 2PNDA 5C8JB 2IBZX 3ZL4L 4YGVA 4H8WL 2ZUWA 4Y4HC 4DUVA 1ZLVK 1AR2A 4DAGH 4HUXB 4KQ4L 3PGDB 1LD9B 4M5YH 1NANI 1D9KC 2R0KH 3CK0L 2OZ4A 3S96A 1S9XA 1RZJH 4QOKA 4OI7A 1EERB 2DDQL 3R8BB 1V3MA 5IVZB 3JTTA 3DSFH 5HDBE 5EZOL 2R0LL 3GM0A 2VXUL 4HUNB 4YUEL 1B3JA 2X2YA 4MLSA 5HGGS 1AJ7H 2C3HA 4YHNA 4PLOB 1CL7L 1DBKL 4R2GC 5KW9L 3AC0A 2RB8A 2DKSA 2O5ZH 4G9DA 4MNGA 3GSUB 1A2YA 3L9RB 1YY8B 3LV3B 1J1PH 3O8XC 3PABB 4G6ML 1LEGA 3VFPA 3L3JA 1A64A 2DICA 3QUZB 3R4DA 3KPTA 4M6AA 4K3DL 2UVFA 3QXAB 2R1WA 1P5VA 4M4RA 5C0CE 1F11B 5EU7C 1MY7A 2F53D 5DSCA 3OJDA 4X6DA 3BZEA 3DUSA 1UWEL 2CO6B 1MRCL 1TVBA 4N8VA 3SBWC 3K74B 1YPZA 5CAYB 2VL5A 3D9AH 5D7SL 4ZUSA 2YUWA 3MZGB 4YC2B 1R3HB 5I18L 4NN7B 4J23A 3MV7E 3IFPA 1FZKA 2P8MA 1P1ZB 3JWNC 3VWKB 3MRLB 3W2DL 5I0ZA 3HE7B 4ZAKA 4QTIH 2GT9A 1WZ1L 3D3VE 1C5BH 4PYHA 4Z7WE 4YXHL 3SKMB 3BX7C 1IMHC 1K6QH 4LNRB 3DNKA 1M7IA 3T1FB 2R2EB 1ZXQA 2XWJA 5EBLB 1I1CA 4FG6C 3C60D 5JW4Q 1FLRH 2P5WE 1Y18A 2D0FA 3EYOA 5L7XL 3WS3A 3OAUL 3I85A 3H42H 5MERB 1I9RL 3HKFA 3IRPX 1MJ8H 4Y0GA 2E8ZA 1IC4L 2ARJB 4P0DA 4WI9A 3TA3B 4HS8H 3OKNB 4P9ML 2R1YA 3KJ6L 3FN9A 2ERJC 3G5XB 4XBPB 1JIBA 3T0BA 1L7IL 1WBYA 4XXDA 3ARQA 3TFKC 3WEXB 1AXSB 4N90E 2D7TL 4N9GB 4HGWB 4M9PA 5I19L 3AB0B 3BP5B 5MHSD 3UTTB 1YEEH 3KPRB 2ZOKB 5DUPH 2X4NA 5BVJA 1R0AL 2E7CA 5DI8B 3HUJA 1DP0A 1T22A 3VCLB 5A1AA 2FGWL 4Y16C 5KAQF 2UWEE 4L29A 3FB6B 4Z8FH 3GB7A 4KUCF 3BKCL 3DSNA 4TOYH 5IFJB 4S0SD 1QFUL 1W0WB 3O41B 4N8PA 1WZLA 2YA2A 2WBWB 1XIWD 5DD6A 5C09D 1WWBX 5ITFB 2R23A 4JFZH 2FX9L 2IGFL 4UOW0 1YMHB 5FM5M 2Y06L 4JO1H 3NCMA 4PJHA 3OKKB 4UT9L 3CDCA 4IOIA 4UTAL 1N3NB 4FZ8H 2EKJA 2GTZB 4LCUB 2VISB 1A8JH 1BQSA 5CJBA 1TZGH 1J0HA 4JGMA 4KROC 1BF8A 5BZWB 1H5BC 4M00A 5B39G 5GS1B 1FIGL 3SE4C 2CK2A 1FP5A 3CFIC 5BXFB 5ACMA 2VDNL 3CPLB 5DURB 4EDXB 3CVHL 4MDJA 3EGSA 3VFOA 1NCDH 1SMAA 3MRGA 1FPTL 1G7LB 4TULH 3NAAL 5C0JB 3QQ9C 4V1DE 2D03H 3ZE0F 3PL6C 4PV8B 4LASH 3QEHB 5C92A 3NA4A 3OKMA 3P9LA 1R6VA 4ZQKB 2GUOB 4P46A 5C9JB 1P4BL 1QA9A 1U8QB 4DZ8A 1U95B 3TV3H 4XP9L 1YQ2A 2XZZA 3QQ3A 3BSZL 3LZFL 3MLRH 5CEZE 4FQXB 4XC3H 3ZHKA 1GGCL 4U3CA 4PRNA 2APXA 3TN0A 4HWZB 1JFQL 3QIBC 3QDMA 4PJ8A 3VDCA 5CINL 5F9OL 3KHOA 5SWSE 1JWMB 1N5AA 3BPLC 6FABL 2P8LA 3MXVH 5DJXB 3U0WH 1FNEA 4UAOB 1MFDL 4DUWA 4OD3L 1QBML 2OXGA 4WUUA 4EBQL 1ZGLB 2VXQL 1AGBA 4YDVA 2AJZB 4NUJB 3VXMA 4OAWA 2X41A 3DVNB 1QFHA 4HQQH 3BQUD 5HYJE 4WWKD 3MRDA 2XKNB 4MXQD 1F4HA 2YSSB 3FO9B 5T1MB 5LGJA 1AXTH 5CJ5A 1ZAGA 2APWA 3STBA 4OD2A 3PWPA 3VXSE 4HJJH 4NBXB 4HWBA 2CKBB 2A6JA 5BRZD 1CBVH 4EQ3A 4GS7B 1JNHA 4WUKL 1MI5B 3UTSD 4M1GL 1F3DJ 3UAJC 3KXFA 3ZTNH 3CC5A 1MPAL 3QR2A 5C07D 4C56B 4A6YH 1BX2A 3ELAT 1IQDB 2XWTA 4XCFL 1I7TB 4U6HB 5ID1A 2XICA 3MOAH 1XCTB 3TIEA 1OP5K 5IROA 3KNBB 4MJIB 4PJIA 3UCRA 4NZDA 4PD4K 3VXUD 4HZLA 5A40E 1ES0B 3VWJB 4JN1H 4QHKI 3I6KB 1N2RA 3QZWB 1X5KA 1MCNA 2NY0D 4MSWA 3FOMB 1JPFA 2IH1B 4DEPB 3RIFK 4ISVB 2Q7YA 4PY8J 2A83B 1U8KA 2QSQA 5FM5O 3W0WE 4D8PB 2X4OB 3RTQD 4D0BA 3MNWB 2HG5B 1FLTX 4PJEE 1AD0A 2P45B 1DBML 1DQQA 3DYMA 1FORL 3QDJA 3VI4F 1KB9K 5IF0B 4ZNEA 4R97C 1AFVH 1EFXA 1NDMB 5CLTA 3LN5A 3WHXA 3KJ4B 2HA1A 4QHLB 5DQJB 1AGCA 5TE4L 4D0DA 3KPQB 5F1NA 2EDDA 4KK6D 1I8LA 1U8MB 1V7NH 1ZLWK 1XIWB 4Y5YA 1MREH 5C09B 1GGIL 3TNMB 3IDIB 1EBPA 5J1TC 4U1GB 4HF5H 4GXVL 1NLBH 1G9MH 3F12B 1FSKC 4JQVA 3K2MC 4P9HH 2WWMC 3IAGC 5CD3B 3BMWA 2ZKHH 2Z35B 4Z6AT 5F6IB 5GSRB 2VLKE 5GRJH 1BM3H 3FONB 3GMLB 4P4KB 5D7JB 1CICA 3EYFA 3D25B 1IVLA 1FZJA 3LVEA 4MX7B 1BBJA 4QRQB 2D3VA 3EOBA 1A3RH 2D7MA 4OLYL 2VYRE 3CLEH 5DJYB 3BD5A 1DBAH 3MRNB 5J3HC 1JF6A 4XNMB 2WQ8A 5C0CD 1A7NL 4C83B 4MNQE 4TN9A 1WC7A 2HTLC 4J6RH 1XR8A 1HHKA 2GITB 4H1LA 4P4RB 3C8HA 4NCDA 2BDNH 4HFWB 2VZVA 4ONHA 4HWBH 3S9DB 3CH1B 3W5MA 1LO5A 5EZJA 3O11B 3VFUB 4BJLA 1R5WB 4AL8L 3VJ6B 1DQJB 1MCFA 1QSZA 1YMMA 3MV7D 5CEYB 3VXQA 3MGTB 5CZVL 2EIEA 3X3FH 3B43A 5F9WB 4YEFA 4JANB 1BD2A 4G8IB 3D3VD 4QRRE 5TFSL 3TBWA 3L3IA 4WIQA 3HI6L 4QKXB 1YQVL 1OAYL 4JM4L 3O45B 3HE6B 5DRXA 4G6KH 1KJ3H 2MQCA 2P5WD 4XX1E 3FB8B 3MOBL 4WWKB 4NZTH 3WN5C 1BQHG 4XVUD 3V7AG 2PR4L 4AT6A 1I85A 2H32A 2AXFA 4MXWL 3RVTC 2AABH 2CR3A 3KYAA 4LBEA 4WJ5A 1W0VB 3MA7A 4BQ8A 5DDHA 3MV9E 4KJPD 4XMLH 3C8KA 3FT4B 4OLZL 3LRHA 2VLLA 5DUMH 1KT2A 1KJMA 5DHVB 4HIHA 3RPKA 4XMKH 3TBVB 4KTYA 1GAFH 1AGEA 5I74C 3UJJH 1UVQB 3JV5A 1VADB 5L8KB 3EZJB 4RAVB 4Z95L 3QIUC 4N90D 1RFDH 2J6EA 4DTGH 4IJ3B 2IG2H 2YRZA 5C07B 4XP1H 2YPLD 5JOEA 2Y25A 3L95B 1H3GA 1IRAY 1N4XL 3U7WL 4KKAC 1R24B 3O4OB 5DJ6A 3UZQA 2OTUA 4GBXB 1TPXC 3U30C 4ZS7L 5F71A 1I7RA 4NKIH 3DUUA 3CMOH 5FYJH 4OLEA 2NY5C 1S7QB 2J4WH 1KEGH 1RY7B 3M17B 1ZMYA 3LKRB 4LSTH 3S35H 5DJDA 4EKXA 2NZ9C 1ZHLA 1ZHBB 2NY0B 2DWEA 1ZGLM 5FXCH 1DDHA 3U2SB 1UENA 1U3HC 4JFPB 1I7UB 4UILH 3MRCB 2EH7H 2RFXB 1X7QA 5LXGH 3GMOB 5E94A 1DL7L 4AIXA 1S7TB 5T5NF 2DQUH 1LO3L 2BXYA 3RTQB 2BVOB 4M6NL 3FZUD 4JDVB 1A14L 4K23L 3ARDA 3DO3A 4K9EC 4PJXE 1Q8MA 3P0GB 4CN6A 2DYPD 2E27L 3GSNA 5FYLH 1X3DA 3ETBF 3GUTB 5HYSG 5T3ZL 4XC1H 2B20A 1ND0B 1WIOA 4HIIB 2Q8BL 4N0UA 2V2TB 3EFFB 4LIQH 3S7GA 3WIIL 1V3LA 4PGBB 2X70B 3NN8B 4IRJD 3OAZK 1NMCC 1YJDH 4WI2A 4YDJB 5ERWA 3DXAE 2YEZA 5MP6L 1SYSA 5E6IC 1WJ3A 4HC1L 4DJMA 1CU4L 1P7KA 3CDYA 4MZ3A 4EI5D 1U8LB 1CCZA 4HXBL 1Q0YH 1U8OB 3LRGA 4CVZA 1JTOA 3LSOB 4X5XB 5LBSL 4XCYA 4Y1AE 5CEZD 3EKCA 5E9DE 2QSCL 5D72H 3U4EA 4UIMB 4FQ2L 4I18C 4NOFA 3PG2A 3SO3C 1HIMH 2BFVL 3O6KH 2G2RB 3S3JA 5I1AB 1RZ8B 1GOGA 1S9YA 2HRLA 4OCLC 1WCQA 5GGUA 5SWSD 4TTGA 4P2OB 4KI5F 5I17A 1K2DA 4WHTA 3EOTH 1DBJL 4PJ9A 5EPMA 3V4VH 3ARBD 3L3KB 1A6ZA 3QG7L 2HJFA 2D2OA 3P4MB 3KG5A 2H32H 1PSKH 4ALAL 4NC0B 4N8VG 2AVGA 2V5TA 4U1JA 1Q9LA 2PO6C 4JHAL 3SQBA 4XNUH 3V52H 5GS0C 1JF1A 3VXSD 4JM2D 1H15A 4NO2B 5H37H 2NW3B 5JDJA 5FF6B 1R3JB 4H0HB 5L8LB 4K8RH 5FM4A 4NQDE 2CDEB 3WHE0 2J6EH 1V8HA 3O6FC 1J86A 5IJKA 3T09A 2P7TA 4R4BA 4KK8C 2ICES 1UCBL 4NWTH 2HT3D 3S4SA 1U2HA 1CD8A 3RGVA 4DCQA 4RNRA 3UTOA 2JCCE 2A2QT 3IJHB 1CLZH 4Q9RL 3TEUA 4OFKA 5IKCB 5DLML 3O3BB 4PFEA 3CSPA 4FFVC 5GRZA 1P7QA 4FTVE 1KEML 1JPGA 4LCWA 3HNVH 4JRYE 3I3EA 4LLVA 3G08A 1R3LA 2LAGB 4F7MB 3GJFH 4U6VL 4J4PA 5L6YL 3SEPA 3FN3A 2WWKO 3VG0L 4FN0A 2VE6B 2F54B 4L4TB 4PJ7E 1IGML 5D2NA 3RKPA 5IVXF 1HEZA 2J88H 4XPGH 2DQFA 2YPLB 5E8PA 1GJIA 1IKNC 4JR9H 4XCCL 3GSNH 2A74A 3VXNA 3TYFB 4ZS6C 4X99A 3IGAA 2W9DL 3F62A 5H94B 4I5BA 3S36L 3BP7A 4YDIL 4WTWA 1OCWL 3PWNA 4KRLB 5D9SA 4LRNL 3G5YB 2HLAB 1EZVY 5D1XD 4F3FB 5C08A 5IOPA 1DLHB 1V7MH 4JHZA 1KBGL 3ARTA 3HCVA 4IMLB 1JP5A 2PYFA 2OL3L 4EUPB 3W81A 5FGCE 1ZOXA 3I6GB 5C86A 2VQ1A 4HWNA 2GK0A 5F7HA 4ONGH 4GG8B 5C3LD 1MLCB 5DEGB 5TQ2L 3AFLA 1TETH 1MRFH 4MMZC 2OK0H 1MCSA 4XMPH 1T04B 5E4IA 4N68A 3RBSA 4G80B 4EVNA 4E0RB 1MAKA 1MCEA 4JZNB 5DC9B 1XF4B 4KHXH 2VLKD 4DWHA 1OPGH 5E00A 4WV1B 4TTDD 2ZNXA 3RUGE 5E03A 3IAQA 4QXTB 3MGOA 5DO2D 4AH2B 2J7LA 2MPAH 3RZCC 5EORL 1YY9D 1NBYB 4ZXBB 4LSPL 4BQ9A 4YC2C 4HKXA 3IDJA 2B8OT 3X13A 4MNQD 4LCYA 3VFVA 4IS6B 4BKLB 3SE3C 1AI1H 1KIPB 2NLJB 1L0YA 2HAZA 3HE7C 5CP7B 3N1PC 3F58L 2R69H 3LH2H 3HI1B 4M48H 1GRWA 5SWZE 2ESVE 2FCBA 3O3EA 2EDEA 4LGPB 3UO1H 1SEQL 4ENED 4H88H 3I6LD 4GQPH 2AK1L 4F9LC 4Q9CA 2NMSA 4KHTH 1HNGA 4LU5H 2W1NA 1MAMH 3ZKND 4XXCC 4U33A 5L88L 4GKNA 1MJJB 3HB3D 1A9BB 1HXMA 3ARBB 3WKNA 3GI8H 4W6WB 4NPYB 2GSIB 4Q6YA 4RFNC 2P8PA 5E8EA 4WO4A 2ICWA 5HI4D 3VRLF 1E4XL 3QO0B 3B3IB 2Z31B 4Y19E 5KSAD 5D7IF 1HH6B 4ODUA 2LQRA 4JE4B 3IXAA 5DJ8A 1ORQB 2CUMA 3MV9D 1AGDA 4P2QA 1NLDH 5FDWB 5F7DA 3AB0C 2R8SL 4POZC 4MCZB 2EDJA 3W9DA 5B3JF 3QUYA 2QHRH 5ID0B 3GNML 2DBJA 5F96L 2JLLA 3N9GL 1B0GA 1EK3A 1NAKH 1UJTA 2BY2A 4PREA 3TBYA 1NGQH 1BAFH 4X4XB 1U0QA 1BIIA 5ISZA 3RX8A 1KIQA 1FFNA 1CGSL 4UIKL 2QLVB 3KPNB 2GY7B 3D85D 1VACB 2R2CA 4KFZC 1KC5L 3MXWL 2P1YA 1UB6B 4KJWC 1ORSB 1FC2D 3WUZA 1XF5A 4PR5B 2MKWA 3OHXB 1RZKH 3BP4A 5EULV 1Z5LA 3NTCH 3OWEA 3V5DA 1ZLUK 3WO4C 2NY5L 4Y4KA 1CE1H 2QQNH 1KG0A 1EO8L 2A6KB 3QWOB 2PYEA 1A7RL 1MFEH 2R0WH 3B8YA 4H8WH 1N0LA 3NIFE 4NKDA 4FXGB 4XNZC 4QRUB 1J9CT 3NZ8B 4JQIL 4KZDL 1OT1A 3C09B 5GS1C 1F02I 1RJLA 3T0EB 5KG9A 3TCLA 3KPOB 2QKIA 1NMBL 2Y4SA 3QQNA 4O02L 1OGTA 3ULVF 2J8OA 3PV6B 2BOBB 4I2XA 2NNAA 4K9EL 2ATPB 3FAXA 2ATKB 2R0LH 1AO7B 1QLRA 1PG7L 4YUEH 4BK5A 4YHPA 3RWGB 2OTPA 4D9LH 1ZHNB 3BW9A 1CL7H 1DBKH 1CFTA 4LDEB 4KVCH 1JHKH 5E2VL 3UDWA 4TYUA 2A6DB 5EZIL 1TVHB 3RP1A 5JIIA 1YEGH 2A0LD 3DRTA 1FVCB 4FQXC 1QLEL 4G6MH 1NC4A 4K3DH 1UACL 2Q3AA 3CFJB 4U1IA 1ZV5A 5B38B 1U8NB 3CVHA 5DJ2A 2VLME 1CR9L 4OLWL 4LSVL 3X12B 3R1GH 4UAOC 3CFKA 2HFEA 2E5EA 4Y1AD 2X4RB 1JRHI 1MRCH 2EH8L 5E9DD 3KPLB 4L9LB 1RJZA 5ICYB 1TENA 1A6UL 1LK2B 4HV8B 4X80H 4LLMB 4XNQB 1HCFX 3PNWA 3MNVA 4ORGB 3QNZA 1S7UA 1QKZL 4ZOCA 3ALWA 2XN9E 3JV4B 1UB5B 2VH5L 4YXHH 2BXZA 5I1DB 4MNQB 3RY6C 2QQLL 2VAAA 3SDCA 5E5MA 1KULA 1P4LB 2VDPH 4JREC 2WAHA 3KPSE 3PHQA 3OAUH 5IJVB 2WUCL 5GS0L 2FIRT 3AS1A 3OV6A 1ZSDA 3KYMB 1I9RH 3OR7A 1YZZA 5IBUG 4AQ1B 3C60C 4NC1C 5GRUL 1NCNA 4DZBA 3RHWF 3ARGB 2Q20A 3KJ6H 3WV0A 5EWIL 3AGVA 5D70H 4PS4H 3I9GL 1Q1JL 2Z0BA 3UZVB 5T1KA 3VH8G 5K59F 3G5ZB 4OLVL 2OS7A 1GOFA 1RIVL 1MWAL 1FO0L 2Z91B 1F6FB 1QSFA 3V5HA 1QG3A 3IDUA 4WTZA 5AYUL 1CXHA 4M7LH 2B2XH 5LQBL 2X44D 4KH2A 3L5XL 4NRZA 4X6CB 3CZFA 5EBMA 5FIEA 2AEIT 3HNTL 4DOHE 1MJ7H 4DEPC 1PYWA 5F8RC 4X6FB 2F58L 4FTVD 4I3SH 1VA9A 4JRYD 5IVXA 3O6ML 3ZT5A 3U36B 5C7XL 2D9CA 2HVJB 1IJ9A 4HG4K 3EYSH 1ZA3A 3BKJH 4WW1A 2WP3T 3RWFB 1BIHA 1MFBL 1DFBL 1MH5A 2ARJQ 4Z0BH 4POYA 3D85B 2FX9H 1YNKL 3GBLA 3OF6D 2IGFH 1CT8B 4WFEE 2OR8A 3MBED 1EH9A 1PFCA 5EUOA 5D1ZD 3WIFA 2Q76A 4S1QL 4ETQB 1VKXA 3DOSA 3ZYJA 3EZ8A 4UT9H 4TUOB 1XIWC 4UTAH 1A1OA 5E95B 5I1LA 5L2JB 3W39A 3LY6A 3RY4A 4ZUVB 2ZJSL 2GTWA 5IT2L 1A6PA 1OAXH 1ZT7A 4EDWL 4KUZH 3SCMB 4NKOA 3DETD 2DI9A 1FIGH 3V0VA 1GVIA 1QNZH 1PAMA 4MMXC 5F6IC 2HFFA 4HAFA 1D6EA 4H0IA 4MAYD 8FABB 2EXWD 1RUPL 5JIHA 4ODXB 2HP4A 4XPFL 3JUYA 3NCCB 2VABB 3CFDB 1UM4L 2YN3A 4JFDE 2YD7A 4M1DH 4PJDF 1I4FA 4KXZH 1IGJA 1P4BH 2AK4B 5KS9B 4KI1A 1D9KA 4JJ5B 1CGVA 3OB0H 3OX8A 5GRVL 1FGVH 3LQZA 5KANI 1YUHA 2HKFL 1GGCH 2CKBH 4N8CL 4P5TD 1EAJA 1QOKA 1JFQH 5CINH 5F9OH 4YX2L 5T3XH 5J13C 1BZQK 3MOQA 5JZ7D 5TDOB 4MJ6A 4HWEL 4ELME 5JOFB 5CGTA 4OD3H 1O0VA 3ECBB 4R9HA 4G3YL 4U05A 5F9WC 4OF8A 3WDHA 3O8XA 4OGAC 3FQWA 2ADFL 5FK9A 1JTTA 2EKSB 4O51A 1BZ7B 5SWZD 1WBXB 2DKUA 2AXGA 2ESVD 2ZSWA 4RGMC 4X7EC 2FRGP 2B1AL 5E9DB 2P5EB 4CMMA 2FL5B 2H41A 4K2UL 3HE6C 3MSPA 3B5HA 4Y2OA 1Y6MR 2AJ3A 3BQUC 2WSKA 4WWKC 3RWCA 4TNVF 1L7TH 3SBWA 2WM0A 5D7IA 4KK5D 4M5ZH 2NY1D 2V2XA 5CIPB 4Z7VA 4XAKD 4YHIA 4U1NB 5D8JL 3D87B 5HGBB 4GRLA 4JO4H 2FR4A 1MHEB 4JKWA 3WO3B 2RIKA 5ITBL 4ZDHB 3MRMB 2ADGB 4NDMA 1S7VA 3G6AB 3JXAA 3TZVB 4LSQL 4Z76A 3O9WD 2AEWA 4RQQA 5C2UB 2BSED 3HC4H 2W65A 4Y19D 4Y4FD 1UJ3B 1SYVB 2CGRL 3BIKB 1MQ8A 2V5MA 3M8OL 1INQA 1Q9KB 1I1AD 1MAJA 5EZLA 5ESQB 5M94B 1BVKA 3H9SA 1N59B 43CAA 3HR5A 3V8CA 4JFYB 4OB5H 4QTHB 1J0ZA 4AEFA 1FFQA 2D31B 3IDYB 2ZPKL 3TVMB 2R9HD 4NT6A 1HKLL 3O0RL 3S5LG 3FO2A 1DQDH 1T89A 4FFYL 3FQXA 1CXKA 3BE1H 3KAAA 4P2YA 3S97C 1FNSL 2VITA 3PIQB 3I02B 2JCCB 1TZHB 2I07A 2NY0C 1XMWA 1ROWA 4E41E 4B53A 2P48B 4O58L 5F7YC 2RAMA 1FZMA 1ACYL 1OSZA 5CWSA 3MUGA 2RGSA 4HKZA 3RTQC 2YZ1A 1JHTB 1I7ZB 5D7LA 1R5IA 3QEGL 3LPGA 5DK3A 3OXRB 1SHMA 3SGJA 3ARRA 1NUGA 1I9JL 5TE4H 5FGSA 1CDUA 4M6ML 1OARL 1NCCL 3U7AA 2XQBL 3QBTB 3IU3A 2ENSA 2GYSA 4IIQB 3HC0B 1S7SB 1VERA 4GXVH 4YR6A 3LPFA 2FIKB 1CIUA 4V2BA 4KK6C 5EDXA 2D4DA 5E5RB 4JFED 1T1XA 3L5IA 1Z9LA 4OZGB 5DFVD 3I84A 3OGCB 5DD1L 4OV5B 4EN3B 4UNTA 5K9KB 4U1KA 5KSBF 3BGMB 2ZUSA 1LMKA 3IJSA 5AD0A 2L4OA 3QCTL 3MRQA 4NM4L 5F6HI 4LKCA 5FHAL 1UM5H 3QIWD 4Z7UF 5KVGL 3MRJB 1XGRB 1H5BA 3NVQA 4OFPA 3GMNB 3SE4A 4RISH 1SVZA 5A2JH 1RHFA 1FVDA 4QHNB 3LN4B 4KUCD 1JMZA 2Z8SA 3RPIB 1A0QL 2VLMD 4NQCB 5DR5L 1WAAF 3ARVA 5SX4I 5ALBH 3PL6A 5DRNB 2CRZA 1FFOB 3B9KD 4G8EA 5LG1A 3F7YA 2DLFL 3SY0B 1X5HA 3W5NA 2I60H 4G9FA 1I8MA 3IJYB 4NCC2 4P5TB 4YJZL 5DHVH 3DMMB 4N0FB 2FJHB 3RZWA 2PTTA 2A6IA 4CW1B 1MVUA 5JMOC 1NFIB 4M7ZB 1FAIL 5TFSH 2XN9D 4HX1A 2Q1EA 4KVNL 2YA1A 4ORZC 1NDGA 3L1OL 4UMGA 3X11B 2VDLL 5AG8A 1A6TA 4WFFE 1YQVH 3H9HA 4M9OA 2B5IB 2G60L 2VNCA 3LEXB 4G6AD 4KMLB 1FL6B 1KN4L 1IAKB 1W0YT 4Q9BA 5TGBB 3GGWA 4MXWH 4PGCB 3PQYE 3RBGA 1AC6A 2P46B 4LPTA 2N56A 3SQOL 4OLZH 4XVUC 4QRPE 3VXOA 4NQSA 4DGYH 1WGOA 3S37L 1LP9E 1IGIL 3PP4H 4WEUD 4JZOB 1MFCH 4JHBA 4RA3A 1UKTA