1B2WH

Comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLVQSGGGVVQPGRSLKLSCLASGYIFTSSWINWVKQRPGRGLEWIGRIDPSDGEVHYNQDFKDRFTISRDKSKNTLYLQMNSLRPEDTAVYYCARGFLPWFADWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ANTIBODY (LIGHT CHAIN))
publication title Comparison of the three-dimensional structures of a humanized and a chimeric Fab of an anti-gamma-interferon antibody.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1998-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b2wH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b2wH02
4NWTL 4I77L 3O6MH 4UTBL 4BQCA 1DE4B 5ICYA 1K8DB 2OSLA 4MJID 2A77H 5FYJE 1W8NA 1WSST 4WO4C 2P24B 2V2TA 1T22A 1MRFL 3SGDI 2ADGA 1IGTA 5I1LB 1FSKB 4YBQC 5ADPL 5I0DA 4U1GB 2D2OA 4IDLA 3HCVB 2RR3A 2D7NA 4IJ3B 1X5GA 3OJMB 4FQHB 2P5EE 3BDYL 4MDIA 4XH2A 5D7JC 4NZRH 1BBDH 3DV6B 2QQNH 1MAJA 1DVFC 2BC4B 1NAMH 1U8MB 1A6TB 3UYPA 2GJ6B 3RNKB 1CXFA 1ZVHA 4PS4L 3HA0A 2OLDA 2FATH 3QISA 1NL0H 4MQXD 1CXEA 1YMME 2JB6B 1S8DA 1CDGA 3OAZH 4G7YH 4FFWD 4DN4H 1AHWA 4LHUB 4QOKA 1QSFB 5C0DB 4YIQA 3ALPA 3TT1H 3V7AG 5FYLL 4WU5A 3U0PB 4J1UA 3WIHL 3FOMA 4X80L 5T3XH 1RUML 2P42B 4XCCH 1FNGA 1P4IH 3MRLB 5D1XC 4X7TA 5GGVL 1AGEB 4LARH 4TOYH 3TF7C 4EUPH 3VFOB 2VQ1B 2NNAA 1E27A 1QEWA 2UVFA 4HCRH 3VH8A 3MOBH 4L29A 4OQTA 3VI4F 1I8KA 1HYRC 4P57A 2R0ZL 3RA7H 2EEAA 3MUHL 3RVWC 4IIQA 5FK9B 3HLAA 1TMCB 4WW1A 1HNGA 5K9QG 3SKJH 2FSEA 2CGRL 4JDZA 4OZFG 3WO4C 1P4BL 2WZPD 4J7RA 5FM8A 1KFAL 3DX8A 2ESVD 2DMKA 3K2UL 2CRZA 5JW5A 3BP4B 2F8XC 1TZGH 3FQUB 4D8PB 3DV4B 3VGFA 2VXVH 2BHUA 1S78D 3FO9A 3P9MA 1KEGH 1MCEA 4S1DD 1W0VA 2X4NA 5EIQA 1T7ZA 1BREA 4XBPA 1FO0A 3SE3C 3AFLA 3SGJC 3R8BB 4RAVA 1MVFA 1QSEA 1G9NC 4HLJA 4WWKB 5J1TC 5D2NE 3SKUD 5GS2D 3WNMA 1HQ4B 5IHUH 1YQVL 3MRRA 1A7RH 5IKCB 3TA3C 2J8UE 3TBTA 2R0WH 1N8ZA 3MLUL 2JCCE 3CFKA 3IU4H 1OB1A 3G6JF 2VLKD 1KJ2H 5E1HB 1CTOA 1R0AL 3PHSA 2NR6C 3QNXB 4NRXA 1B3JA 3TC9A 3QUXA 4L8CA 3W82A 1HINH 3WUWB 5C0IB 5DK2B 2HFTA 3RGVC 3UYRL 1TJGH 4LF3B 3HI1B 1E4XI 2I60L 2R2BB 3F8UB 1WFNA 5AAWA 5AWNL 3N1GC 3QPQC 4Y2DC 5GRVL 2F5BL 1ACZA 3LMJH 1FNEA 3HE6A 4KKLD 3FB5B 5F7WC 3TO4C 1B4RA 1FO0L 4NFCA 3VWKA 2FHFA 3VXNB 5DMGC 4XCYB 4HIJB 3AY4A 4MD0A 3E8UH 3PP3K 5ANMB 4QYOB 1MNUH 2Y23A 5IB5B 5L8LB 3CSYA 4M62H 4OLWL 4PTTA 1ES0A 5HSFA 2XG5A 1EGJL 2CIKB 4QHLB 3MCKA 2K9UA 5EBGA 4XPBH 2DWEB 5HHPB 1TCRB 3VFSA 2E6QA 1RZJH 1P7QB 2XZAL 4YO0A 4U1KB 2EDRA 2P5WA 3T0XA 2WIIA 3EKCA 4NFBA 1MFAH 5GSRB 5KS9A 4PJXF 1UKSA 2BSRA 2KL6A 2P47B 3H0TA 4BUGA 2GK0B 5BVJB 1AFVL 5F9OL 2RJMA 2WK2A 5BQ7A 1JHTA 1FCCA 5C0CA 4O58H 3ZYZA 5IBUG 3S4SA 1DLFH 2NW2A 3EDJA 2C1PA 1YEHL 4PJBA 2IPTH 1SY6A 1CFSB 5HTSA 4XB7A 3HFML 4NFDA 2FZ3A 2ADIA 1IBGL 3MLXL 5DLML 5EZOL 4GJTB 5I8CB 4JG0H 1V7ML 1MFBH 4N9GB 5LKNA 4X6DE 2FLBT 1B88A 4YGVA 2NY4C 4K3JL 5LBSL 3LEYL 1XCQA 1DLHB 4WUKL 4L4VA 4RFEA 1U8NB 4X6EA 5F7LB 5CKAA 2NQCA 1JHKH 1R3JA 3OKYA 5MHSE 3JV6A 4PJHF 3UTSD 5IV2A 1FRGH 1OP9A 4AT6A 1Q94B 5FM5M 1GH7A 5JDSB 4DJMA 3Q1SH 3I9GL 4M5ZL 3PGFH 5TDOA 4ZNEE 1J0HA 1NJ9B 1EEQA 4UIMA 3B2VH 1X9QA 4R97C 5KVDL 2B5IC 4ZTPH 3STZB 5DQDH 3EO1B 3ETBF 4L4TA 1Y18A 1S9VB 4U1HA 4NN5B 2R39A 5F1SA 1A6AB 2F19L 4MXWL 5KZCB 1RJLA 2F54B 4I3RL 4HPOL 1CGSH 2OQJB 5IOPA 3O11B 2NXYB 4JJ5B 3NFNA 4EOWL 3SE4C 3P0GB 1VFAA 4GRMB 5CD5D 3WJLC 1B9ZA 3EDEA 1H3PH 3V4PH 5DO2D 3OF6D 4LRNL 3MRBA 2VISA 5DTFA 1JTTA 4OGXH 1KTRL 4RGNE 5I66B 1C16A 2G2RA 4JKWA 3ULVE 5HJ3B 1VA9A 4DFHA 2X70A 5L2KE 1TCMA 1GOGA 1U3JA 3V4VH 4KROD 2WNGA 4XNMA 4UINH 4EI5C 2EDEA 4ZOEA 3ULSB 2XZZA 3GKWH 2XXCB 4JQVC 3SEPA 2A6JB 4C83A 4HBQA 1DBJH 3P0VH 3IXAB 2BSSA 3QHFL 5FOJA 4AQ1B 1X5FA 3PNWA 4F80A 4CW1A 4D0CA 1CD8A 4DK6A 3D85B 1BFOA 3BZFA 3HNSH 4OFPA 4PJGE 4WO4B 3KPMA 4HUKB 4X99B 4JPIA 2Y06H 4H1LG 2X7LA 2XQBL 3REVB 4K8RH 2EDNA 3DROA 3BXNB 3DI3B 5I0ZA 1F6FB 5EOCL 4HMCA 3WEXA 1BIIB 3HUJA 4PJ5A 1A7QL 3QUKB 4ZQKB 5BXFA 3RI5K 2BNQB 1HHKB 3QO0A 5GJTL 3I50L 5ISZE 4ZUUB 5KW9L 1F58H 4XPFL 1F4XH 1R24B 4LCCC 2A6DB 2VDPL 4TPRH 2YBRB 5D7JB 1EVUA 5C3LD 3C9NB 4PLJD 3RY6C 1DVFB 5AD0B 1PKQE 4HS6A 3AXLB 4JZOB 1GHFH 2O5YH 1TDQA 2R4SL 4FQXC 1I8MA 3V5KB 2YSSA 4S1RL 4FABL 3O81A 1J8HE 5AAMA 3NCMA 2E7BA 3PL6D 4G8IB 4DUWA 4FFVD 1KPUB 1F4YL 4BFIB 3QHZL 3QJFB 3TVMD 4OI7A 1TQCC 1XT5A 5KSUA 4W70A 3F5WB 2FX8H 3MV9A 3Q5YA 5GIRA 3TFKD 3C5SB 3B5GA 5I1HH 1K2DB 3CX5K 1JGDB 5D1XB 3HS0A 5EBWB 5E8OB 5IT2H 4P48A 3MROA 2FIRT 3MODH 1UWEH 2GFBB 3MBXH 1WBYB 4N8PA 4X5XB 2RCSH 3CH1A 1ZHNA 4FTVB 4MNGA 4OIIH 2VLME 3LH2L 1Y6MR 3T65B 3VDCA 3QEQA 1U91B 5FKAA 3BPOC 3WO4B 1U8IA 5TF1L 4WY7L 1JF5A 3C2AL 3ZDYF 1I7UA 4NQVA 2R2EA 3SCMD 2BOBB 3IFLL 2GY7B 5FF6B 5E4EC 1JYWA 1I9RH 1FDLH 1X6LA 2FEEI 1DUZA 2ZUXA 1RK0A 2GY5A 4QF1B 5JPMA 1U9KA 2GITA 4OD3L 1IGIH 1L9MA 4P46C 3MBEB 2HJLB 2WUBH 4KJWC 3WNOA 3FT4B 5EORH 3DXAE 2NXZD 5HYQA 3TA3B 3P9LB 1T1YB 2YS4A 1J0JA 5DS8A 4GG6A 3QUZB 4KK5C 4CUCA 4NKMA 3IXTA 1JWUA 4PJDE 4MAYD 4HK0B 5C0AA 2X05A 4U0QB 3MLSH 1FFRA 4PG2A 5D2LE 1Q9OA 2SEBA 3GNMH 3RGVB 4L8BA 5GRUH 5KSAB 3CFJA 4IMLB 5SWSA 1AD9A 2JIXD 1WV7T 3UYOD 2DBJA 1OQXA 4QTIH 5BVPL 4Y2DB 5C09E 3UO1H 1H0DB 5TPWH 4F7PB 1D6EB 3TO4B 3UTTB 5KVFL 5C08D 5DJZB 4OLVH 5C07B 4OCWL 5HHMB 3TBWB 1D5XB 1QA9A 4Y2OA 3O3DB 2CJUL 5D7LD 2H8PA 1SM3H 2O5XL 1EUTA 2W65A 3VFUB 1OAQL 1CFQB 1XGYL 3Q0HA 2EECA 2HKFH 4QKXB 3T2NH 3ZE2F 4CNIB 4YUEL 1G7PB 3U6RA 1ZT1A 1AJ7L 4KDWA 1EZVY 2VLLA 4YXKL 3WBDA 1AQDB 4LMQE 4U1NB 4E41D 5A3ID 2B1AH 2VXUL 4N8VB 1I9IH 3GDBA 3Q3GB 5DJ0A 1R3HA 5FHBL 1YEGH 3GIZL 4R2GD 5KSBE 4P23D 5IF0B 2AABH 5DR5L 2BMKB 3IDIA 2XTJE 1KF9B 3HG1A 4JFFD 2L0DA 4GKSB 1NFIA 3QSKB 3QQ4A 1EO8L 3QDJD 3S7GA 1UKTA 3VFWB 4ETYA 3QUML 1MCFA 2W9DL 3X13B 1BPVA 1B2WH 5I1AB 5CAYB 1AE6L 2NY5H 5AZ2H 1HCFX 1ZK9A 4WDIA 3BWUC 1EEZA 2XPGA 4GXUM 1IAKA 2NY4B 2KBGA 3BGAA 1OGAB 3NZHL 3O4LA 1T04A 3T0EE 5E5UB 4WEMB 2UV3A 1J88A 4HIEB 3T2QA 3V7MA 4LPUA 4JFYB 4MJ2A 3DNKA 4I18A 5HHOA 3U46B 2VITA 1IC1A 1I8IB 2FO1A 3T3MF 4YK4C 3PF2A 1UH2A 3CVIH 2NY7H 3UJTL 2ZUTA 4MHHI 4U05A 3RNQA 3GO1L 1Z9LA 3SE8L 4XXCC 4PG9B 1KEML 4U1SB 3QXUA 3GSWA 2DMBA 5C6WH 4HQQL 1GCFA 4X6BB 4ONFH 4R97B 1RUQH 3ILQC 4KV5E 2B5IB 3TN0A 5GZNC 4LSSL 1KIPA 3X3FH 1U92B 5TE6H 1Q0XH 3WKML 4N90D 3TNNA 2ATKA 1IFHH 2Q7NA 3Q48A 4XAKD 5HI4D 4Q9QL 1VPOL 1KLGB 1AKJD 4HUVB 4JQXA 3KPRA 3MRKB 5D7SL 5EN2A 4YXHH 3K4AA 4OTXH 3KPQB 4LLVA 4P5TA 2AJXL 3GSNL 1SJXA 4JRXD 1B90A 3JSSA 3WKNA 5J6HA 3F6IA 3LVEA 4BK4A 4G8GB 4Q58C 3L95B 4P3WA 4M3KB 1RZGB 4R4BA 1N2RA 4X9GA 4G8FB 1BD2E 1MI5B 4XP5H 1JIBA 3CLFH 4R26H 3P4NB 3TEUA 1YUHA 4MWFB 3GI8L 4EI5B 4DKAA 1JN6B 1VKXA 4OZFH 3HNTL 1YN7B 4QHNB 4Q6IC 3V6OC 5I75C 4QGTA 1PZ5B 1NCWL 3KGRA 1JUFA 1DQLH 1K4CA 2VXSH 5CHNB 2JB5H 4NO5B 2W0LA 4MQXC 3S5LA 2GJ6E 2V5RA 2GIYA 2CLZA 2WMPA 2DTML 1A0QH 2BNRE 3OZ9H 4FFWC 4PD4K 1EIBA 4I9WE 5C6PB 4PD4J 3WHE0 5I1GL 4LSTL 1MRCL 5F7EH 3MUJA 1RUPH 4P2QB 1AGBB 4XAWH 2GTZB 2XY1A 1D5ZA 3TYFB 3WN5A 2FJFA 1A47A 1QFWM 3QYCA 1QSFE 3QG6B 4OFDA 4NPYA 3QQ9D 1X5JA 1XGQB 2IC2A 3P73B 2UWEF 4EDXA 5CCKH 4QCIB 4LCCB 5L88H 1NGQL 4P3DB 3ME0A 4ODSH 3QIBB 2EE3A 5FCUH 1JGVH 1P7KB 5C0RL 3GRWH 3VXMA 2VL4A 5EU6A 3WNLA 5CEZD 3AREA 4POZC 4K7FB 4LLUB 5F3BB 3LQAH 4FQXB 4G8EB 2YPLA 4JE4B 4KKAD 4L8DB 2QBWA 4X7FC 2OTPA 5D71H 3JTTA 4NWUH 1IQWL 1A6PA 2C7UB 2WWKO 1G1CA 4O51A 4DGYH 4JN2B 4U6YA 3BEWB 2ZPKL 3DSFL 3CSGA 35C8H 1SJVA 2DQDH 3QA3A 3S3JA 2Q76A 2BNUA 2HFEA 1MVUA 4WW2C 3RL1A 1S78C 1FZMB 3M8OH 1Z5LB 1JF1A 1TQCB 5I1DA 4LLDA 5DD1H 4XHQA 4X83A 1UVQB 2F53A 4YC2C 4S1DC 2GKIA 4Z7UA 1I3RB 2EZ0D 5K9OA 2K1MA 5L7XL 2B39A 4M7ZC 5GHWH 3F58L 1PQZB 3WFDL 4LHUG 4JRYD 4W81A 5F7DA 1D5IL 1FNLA 5DD5L 3VGHA 3PE9A 3MUZ1 4GMSL 1KIQB 1BWMA 3U0WH 2XZQL 1FIGL 1LEGA 3SDAD 1F4WH 2A6IA 4R7DA 4KHTH 4PIRF 3VCLB 4CU6A 1NFDB 2MHAB 4FFZL 1CK0H 1NANH 3OJ2C 3PQYB 4G3YL 2IWGA 5BS0B 3BPOB 4E0RA 2X4TA 4OUUB 4GUPA 5ETUA 4PV9B 1QQDA 1S7UB 1JNHB 4JKPL 5AYUL 2Z35B 2DRUA 1Y0LA 5E4EB 1IAMA 4KKLC 2YN3A 3VGDA 3MV8A 1MH5B 3C6LA 3VD7A 1B0RA 5F7NC 1Q8MA 4QHKJ 1LO5A 4P46B 3DVIA 3VRLE 2AJZA 3S36H 2UY6A 1ZSDB 3OJDB 1T89A 5ANME 4NNPL 3C5ZA 5ESVA 1HEZB 1MFNA 1RJYA 1A2YB 5F1IB 5F21B 3DVFA 1X5KA 5EOTB 4OLXL 2ZCKL 4J3XA 1HXYA 2XWTB 3KJ4C 1KB5H 1JGUL 1CR9L 4AMKH 1W0WB 4HUWB 5C8JA 2P8PB 4TSCL 1N5AB 1CL7L 3CDFA 4XB8A 3WUWG 1ZS8A 3DVGA 4HZAA 1LEKB 3LEVL 3MMEA 4UV4L 2BJMH 3D39D 4PJIB 2X09A 2R69L 4ODVH 1UB6B 2YXFA 4WFHD 2VSDA 1GXEA 1KN4L 2OR9H 3D0LB 2EE6A 3M1BA 1ZHKA 4NC1E 3G08A 2EYTA 3FHQA 1H3GA 2R0KL 5ECJE 2VB5A 4PJ9D 1KOAA 4NDMA 3QAZB 5JQ6L 4UNUA 5TFSL 1IGCL 2PXYD 1XIWA 4TTDD 4JM2F 1EEUA 4MD5A 4O2CB 4FXGB 5D96C 4TVPE 4XBGA 3NABH 3CDGA 4M7KH 4OCNC 1UEMA 1UM6H 2F15A 1AI1H 4LBEA 4OKVB 5T5FL 2VE6B 5JDJA 3ET9F 3F7YB 3QCTL 1CZ8H 5E8DH 1F02I 3LRSA 4Z0BL 4UOW1 4YHPB 4MNQE 3OPZH 3N1PC 3DSNA 4H1LH 5FUZL 2I07A 3FT3B 4RRPG 2DD8H 3RTQA 4JPVL 4FQLH 4JZJA 5J12C 3T0AA 3BPCB 4OFIA 2ADJB 3SGEH 5CD5C 5FA4B 4PJEB 4RNRB 2GI7A 2PYEA 1MCKA 5DO2C 3W39A 4QRPD 3O2WH 4YK4B 4G6MH 5H35A 1T0MB 3FO1A 4ZD3L 4ODXA 2B7DT 2X4OA 3WIFA 2I5YH 3F65A 2A74A 2NX5B 3MGTB 1HCVA 5E95B 2VUOA 5ESAA 1QTYT 3NCBB 4KROC 5JHDA 3F6LA 3V0WH 1BQUA 4GSDL 1NUFA 5CEXB 1JWMB 4LFHG 1ZHLB 3INUL 1EBAA 5FV1L 3TCXA 3UC0L 2CK2A 3QDMD 4YWGH 4U6XA 1UXSA 1OW0C 1I1AD 3MRPA 3UAJD 5KANI 1C08A 2AEQL 5C70A 4MJIB 1G7MA 1CDHA 1EEYA 4QT5A 5DK3A 5BMFH 4JM4L 4AL8L 5I9QB 1G6RA 3QWOB 3SKMB 5DURD 1EHNA 4K3DH 5E2WL 1NEUA 4ZTOL 3MUY1 2PR4L 3AB0C 2HFFB 2NLJA 2BVOA 3MGAA 4TUOA 3WS6C 2X89A 2ZSVB 3WFBH 1RZ7H 1T20B 1ZKAA 3B3IA 3WJJA 1A3LH 4LL9A 3R0NA 1IAIM 4PLJC 1A1NA 3KYOB 4F3FB 4M6NH 1N64L 1IMHC 2X4SB 4PJXA 2WLYA 1SBSH 2DDQL 3MOAL 4GAYB 4NQED 4NC0B 4Q6IB 5I75B 2Z31A 3IFNL 2KQNA 4Y4FA 6FABH 1EHXA 1WICA 3PL6C 3IF1B 1G6RL 1IC5H 2NY6D 4LGRB 4FFVC 3T3PE 5GS0D 4P3CL 5MERA 1CFNA 3TVMC 2ENYA 3VXSA 1OQOA 1U6AL 3RP1A 2AXJA 2P5WD 1OTTD 3TFKC 2J4WH 5E5MB 4HWNA 4YNYA 1GL4B 1L7TH 3PHQA 4UBDD 1KCRH 4AEIL 1M71B 2VDOH 1TVBA 2CIIA 5L2JB 3B9KA 4P2RA 1A8JH 1UC6A 3TIEB 1RZFL 5C0CD 1FCGA 1ODAA 1SYSB 2F5AL 3T8XB 4D2NA 1JK8A 3ABZA 1T5XB 3HPJA 4CVUA 1HOCB 3ZE1E 3NH7L 1FZKB 3B6SB 2DLFL 5C0FB 2ESVB 5DQJA 4Y88A 1EFQA 5IFAL 5ACZB 3SDXE 1PG7L 5EO9A 3SCMC 1J1XH 1TTUA 4WW2B 3ZYIA 3HI5H 4G6JL 4EDWL 4L4VD 5D72L 4OZGA 1EK3A 1YECH 4M7ZB 5GGTA 4XNUL 3PIQA 3HZMB 2J8UF 3BOVA 5DJ8B 5HGDB 4UT9H 2JCCF 2MPAL 2W0FA 2VO5A 3UDWA 1FGNH 1Q9KA 3W2DH 2CKNA 2NXZC 1WZKA 3VW3H 1AXTL 2VLKB 1ZANH 5CEZL 2QR0A 2YK1H 4MAYC 5H2BA 4DVBA 1MJJA 4YDIH 4LSRH 2W91A 1QFWH 2CKBH 3DHJA 1YEFH 5I30H 4O02H 4X4MA 4ZS7H 3PP4L 2C9AA 4ODTL 5JR1H 1VGEH 4PGDA 3S88H 2PTVA 3WFZA 1FYTD 3MRIA 5CIPB 1MJ8L 3LZFH 5DWUH 4M43L 1F8TH 3IDXL 5KTEH 1KJVA 2YWYA 1O7VA 4WU7A 5F6HJ 3UTTE 4WI6A 2A6KA 1T0PB 4BSVB 1FAIL 2IGFH 3DIFB 3QT2A 4K23L 2EIBA 3QCUL 2UYLA 1RJZB 1GJIA 4FQ1H 4NQDD 1Y6NR 4Z8FL 1TZIA 2GCYB 4LAQH 5A3IC 4PGCA 1NAMA 3K8KA 5A2JH 3KJ4B 3BQUC 5FGRA 1J86A 3O6ML 2XTLA 4MA8H 4P4KA 4UDTB 3EDFA 3GMRB 1IGYA 2A77L 1NDGA 4R2GC 2AAVA 2E7LC 1LMKA 4GKZA 4P23C 4WFFE 1I1FB 5HYSA 3UTZB 4YZFE 4YAQA 3C60A 1ZAGA 3IDJB 1T21B 1S3KH 5L8KB 4U7KA 3L1OH 1D6VH 1MPAH 3V8CA 1SVCP 3QFDB 5D9SA 5B8CA 4OFKA 3RKDD 1W2KT 2NY2D 3JV4A 4PJFB 4EVNB 5CMAB 1XF1A 4NZRL 1BBDL 3DLQR 5IW1A 3D2UA 4EUPA 4LAJH 2W1NA 5E1AA 4HCRA 4DEPC 5IMLA 2CRYA 1UA6H 3FOLA 4Q74A 5D1ZA 2YZ8A 1RSFA 2YPVH 2FATL 5D96B 1FZJA 1NL0L 2I27N 2QLVB 4TUJB 5IIEB 1UXWB 1HQRA 4JFQA 1NLDH 4JLRB 4G7YL 5FECA 2OZ4H 3FAWA 3CLEH 1XF2A 4H25A 4LVEA 3TT1L 2HVJA 1A22B 1IM3A 4NP4H 1NC4A 3VE0A 5T3XL 1WWAX 4XCCL 5D1QD 3VFGH 5F8RC 4D0DB 3NN8B 4IOIB 1OAYH 3IS1X 1TTFA 2B2XH 2IALA 4LARL 4TOYL 3ECBB 5GGQH 2X1OA 4HCRL 2L4OA 4EXPX 1CE1H 1BQHA 5J12B 5HI4C 3RA7L 4D3CH 1N5YH 5IROA 3O3AA 1NCUA 4HUXB 3RU8H 1KJ2A 4N0UA 3SKJL 3H6JA 4XX1E 4M61A 3ULVF 1KUMA 3MRMA 3QEQD 4MS8D 2HT4D 3KPSA 1UZ6E 4APQA 3P3YA 5FYLE 5GJSH 5EC1B 1RZIB 1TZGL 2PW1B 4KMLB 3O9WD 4PJ8D 2VXVL 1I3GH 4AENA 2A83A 1RUAH 2DQHL 3WS3A 3BSZH 1KEGL 5EFIB 4KROB 3REWB 3S34H 3OGCA 5EB9A 2F74B 4R6UA 2D7PA 2FO4B 1MI5E 4HK3N 2NYYD 1NBZB 4Z77A 1X4XA 1A7RL 1HH9A 3LSOA 3A67H 3IU4L 1FVCB 2JE8A 1FL5B 1HWGB 3VG0L 1KJ2L 3QFJD 1X4ZA 1AGDA 2J1KA 3ESUF 1FLRH 4F15C 5DVNA 5ADOH 1SBBA 3WCYA 5C0AD 3CFBA 1HINL 3CVHA 1AO7A 4BQ9A 2BY3A 3NBNA 3LN9A 4CKVX 4KVCH 5M95B 1PW3A 3U79A 3O3EB 1TJGL 3VRJB 3OXRA 3QQ9C 4WTZG 1T5WB 3O3BB 3GMOB 3LMJL 2NZIA 5K9JL 4IMKC 3ARZA 4O00A 4QHKI 1WCQA 3RWJA 3V8OA 4KJYA 5FA3A 2DOCA 4I48B 4J2XA 1L0QA 3E8UL 3MLWH 3ARPA 4Q9RL 5JNYB 4EQ2A 1MNUL 1XR8A 3BKJH 2ZSWB 4KKAC 8FABB 5H94B 5ICZB 1M6OA 5I1KH 3I6LE 4HGKC 3PL6B 4XPBL 3MLZH 3F12A 2XQYG 3H42H 1IZJA 4MZ2A 3AU1A 3LPFA 5JOFA 4LLMA 3TVMB 1YDPB 3TO2B 5F6IC 5CJQL 1C5CH 2DTSA 3OX8A 1GC1C 4JB9H 2EZ0C 4ZYKA 1PX3A 1J5OH 2CSPA 2DAVA 4Z7VA 2NPLX 3ARFA 4ONHB 2HMID 2I9LB 4NQTA 1JF6A 3BFOA 1QLFA 4HKBA 1F90L 3KHOA 1NMCC 1KV3A 2FL5A 5LAXA 5FDYA 4O58L 3EFDH 5DVMA 1DLFL 3SDAC 4YDVA 1MF2H 1VGKB 3QQ3B 3HG1D 4ZPTB 3MX0A 3NCFB 1FHGA 1NGYB 1F13A 1SEQH 2EO1A 4PRHA 4M02A 1SHMA 2VMFA 1MFBL 4HC1H 2RB8A 1BOGB 1T1ZB 3L3HA 4B41A 3KXFA 3QNYB 3SCMB 1IKFH 5CBEB 4PRID 1IAIH 1TNNA 3LQZB 1DBML 4J3OC 2AXFB 1QR1B 1H3XA 4QY8B 1BZQK 1MHCB 2ITCA 1JTPA 1MCRA 1ZXQA 4Y5XC 3MC0A 1VEOA 1HHHA 2DWDB 4NO0A 1LO4H 3PWNB 3GBNL 5DVKA 2NXZB 3OG4B 3V52L 3Q1SL 1DZBA 3PGFL 3PABA 4HS8H 3B2VL 3QIUD 4HXAH 1MWAB 4MAYB 4ZTPL 5T3ZH 3BH8B 3GBMH 2ARWA 2R2HB 5DQDL 4LCWD 3BIKB 1JPTH 4ELMF 4XXDB 4JVWA 1ZA3B 4NUJA 5KSVB 1CGSL 2OL3B 32C2B 1OSZB 2JIXB 5SWZA 2E6PA 2NZ9D 3OKNA 1G7LB 3BJLA 1NDMA 2HKHH 3QWRA 2VDQL 1H3PL 4UQ2B 3V4PL 5C08B 1I7RA 3HR5B 3KPRD 5CGTA 1Q9WA 4JO1H 2VC2H 2VLJE 4OGXL 5DFTA 3RBSA 1WBZB 5HGBB 5D7LB 4PJBE 4G5ZL 5E6IA 1FFNB 1I4FB 2DJUA 4E5XA 2IPKA 3I2CH 1IGMH 4UINL 5DA0B 3LKPB 5IW3A 1JV5B 3GKWL 4NSKB 4E41B 4PJ9C 1T6VN 1DBJL 4YBHA 3P0VL 2PXYC 2YRPA 4TTDC 3HC3H 3O6KL 4Z7WA 2ZUSA 4HKZB 2BCKA 4R2GB 4G43B 4PRPD 4HFWA 3ZSTA 3H3BC 4P23B 3H9SD 2Y06L 4K8RL 1BVKB 3MRQB 2ICWA 2AK4D 4L9LC 5B22A 2E7MA 3W0WA 4H8WH 4JFFB 5IVXA 3ZYJA 3QDJB 4P0DA 1S7RB 5F44A 1QFUL 3KPPA 2KUTA 3X11A 3JTSA 4TPRL 3MLRL 4KKCD 1T03H 4AM0A 4RA3A 2MKLC 3IDUA 3QDGA 4DEPB 4M6OH 1GHFL 1A7PH 2O5YL 3ARED 1IAOB 2E27H 2D0HA 5DK0B 3KG5A 5HVWA 5J06A 4L3ED 2AV7B 2BVUA 3BN9D 4P59H 1PDKA 2AJ3A 5B39B 1JZ4A 3J7HA 1C5BH 3PDOB 4NCC2 4BZ2H 4PJEE 4KV5F 2B4CH 4M9PA 3NFSH 1YEDB 4KI5D 5D5MA 2IFFH 3VXRD 4X4YA 3EYOA 3MA9H 2Y1VA 5I17B 4BSWB 2NX5E 4CADA 4HFUH 5I1HL 5DJ6A 3FB7A 3L3KB 4OFYA 1ZT4B 1M05A 3WXVH 3O8XD 5IT2L 1EMTL 2OYPA 5J7CC 1I1AC 4QRTA 3MODL 3UAJC 1UWEL 2NY3D 3MBXL 2Z9TA 1DTUA 2RCSL 4BELD 4E9LA 2VOTA 1BFVH 4RMRA 4PGJA 3L7EA 5H8DA 1AKJB 2NW3B 4OIIL 4OZHB 4AY0A 3ARBD 1V8HA 1K3ZA 5C0JA 4LGPB 1SEBB 3KLHD 4JRXB 5CGYD 3RL2A 3LN5A 5F88A 4BH7A 5LXGH 1BX2B 3C8DA 2M8XA 1KPVA 1INDH 2H1PH 4JN1H 4NT6B 1VERA 1IL1B 1I9RL 4FQQA 1UWXK 1FDLL 3MRFA 4YBLC 4Y19D 5IB3A 3ZE0E 3RWEB 2CLRA 3GJFA 1FQ9C 3AY4C 3BH9A 4Y5VA 2WUBL 3V79C 4U2ZA 2BVPB 2Q86B 4X8JA 4YHLH 4N0YH 1RY7B 3LKNA 4CMHC 2X4RA 3RUGB 3V6OE 2NY6C 4N1HB 1OF2A 4F15B 5GS0C 2IANE 2Z8SA 3MLSL 5AYQA 1ORQA 3KWWB 2CDEB 4IRSA 1X44A 2IQAB 4YPJA 1OTTC 4C56D 4I2XA 2QTEA 3MV9E 5GRUL 3FTGB 4EI6B 3C5JB 3MRGA 3IETB 5I76A 1PBYA 3QULA 3DGGB 2APTA 3UO1L 1B0WA 4UBDC 2LV4A 5TPWL 4CMMB 3PV6A 4WTXA 5I74B 3NOIA 1U3ZA 2PUQT 4OLVL 4Y5YC 3CK0H 3GIVB 1S7XA 4HIHB 4KK9D 2OBGA 1QLRA 1SM3L 4GRLD 5M7QA 3MFFA 4BZ1H 1W72B 2PETA 3RJQB 2HKFL 3T2NL 2DM3A 2PW2B 5INDA 1EERB 2CDFB 4PJCB 4Y8AA 4XCEA 3DBXA 1B6DA 2BXZA 2FYYA 3SJVA 4GW4B 3EHBD 3EYSH 5F6IB 2B1AL 5D6DC 4NQCA 1KCSH 5JIIA 2ESVE 5DHXB 1I9IL 1MIMH 4OM1H 5IVOA 2A73B 4JFZH 5EUOA 1YEGL 1Q0YH 4JRYB 1OP5H 1CICA 3VMOA 3NIGE 1NGZB 2DQJL 1NMCB 2AABL 1QBMH 4NIKB 1WTGT 3WUZA 5IQ9A 4RFOH 3SDAB 1ADQH 4GG6E 1QZ1A 3MRJA 3STBA 1EDQA 1A7NL 2ADFH 4MD4A 3CGTA 1B2WL 3QPXH 2VLKE 3PDGA 5AZ2L 1D7FA 2R15A 1MCWW 2FWOB 3H3KA 1HXMA 1UB5B 5KG9A 2H3NB 2JF1A 2O5ZH 4OZIB 4PJAE 3HZKB 3RIAF 1KN2L 4Y5XB 1X3DA 3CVIL 1QBAA 1LEIB 1E0OB 3HMXH 2NY7L 3QEUA 3IJSB 1QLEH 5TDPA 3BHBB 4EBQL 4XHJD 3TZVA 4FQIH 4HEPG 3MR9B 5EWIH 1U8QA 5HI3D 2ZG3A 1DBAH 3L3IB 1Z9SA 1GIGH 2P5EA 4NJAH 3VXPB 4ONFL 1UQSA 4MNHB 1RUQL 5CJXA 2EE2A 5E99H 3T0VA 4L3CB 5J4MA 5IWLA 2DJSA 3X3FL 2DM7A 3P77B 4OZFA 2LE9A 1FVDB 3BD4A 4LLQA 1OAKH 43C9A 5TE6L 4QLRA 1Q0XL 2CPCA 3VD4A 1CQYA 5IQ7L 1YMMA 2OSLB 4L8SC 3HB3D 1M7IB 1U2CA 1A14L 4YXHL 1QRKA 2HFGL 3RY4A 3D39B 3RKDC 2GW5A 2NY2C 1C5DB 3VGBA 2KKQA 3FMGH 1RK1B 4XP5L 4AYFA 2JKXA 1J0ZA 4I77H 3DX9A 4X4XA 4XH2B 4UTBH 5HHQB 4GQ9H 5KJRH 3IKCB 4G42A 4PJFE 1B0GB 3GRWA 2ZUQC 3U2SA 2PXYB 1DQLL 4JJHA 2JB5L 3RWGA 4JO4L 4YHMH 5HHOE 2HTLD 4UU9A 1J18A 4WJ5A 2YRZA 2ZWLT 4JFOA 4JFPA 5F97E 3VDAA 5KVGH 1YEKH 3OZ9L 5EBMA 1A1MA 3ZDXF 1S8DB 2FIKB 3ARXA 5F7EL 4QOKB 4CVXA 1RUPL 3UTSE 4XAWL 3SPVA 4L9LB 3DUSB 4XCNA 1GYAA 1N4XH 2X9WA 4WU5B 4N0FB 4CDGC 3AVEA 5D1QC 4J1UB 2CDGB 1XGTB 3SGKC 4NZDA 1OPGL 2ZG2A 4JG1H 1FNGB 5CCKL 5I8KH 5L88L 1J7VR 1FGVH 5D2NA 3S37X 3JZ7A 3IDNA 4ODSL 4PS4H 1MAKA 1JGVL 2J8UA 2G5BB 2JK5A 5FCUL 1E27B 1QEWB 4F7EA 1CWVA 4B50A 2R29H 3LQAL 1QG3A 1U3HA 3H9YA 4OUOA 5D71L 2CLVB 4NWUL 4QRPB 4WW1B 4DGYL 2DQFB 4ZO8A 3H7BA 4MS8C 2HT4C 5FYLH 4RMQA 2DQDL 5TE7H 1CE6A 3BVNA 3SQOH 1XF3B 1WGOA 3DX8B 1DN0A 3EJYD 5JXAH 3O9WC 3CUPA 4PJ8C 3VFMB 3TBVB 2I26N 3M8OL 5GGVH 5DD1L 1GOHA 3VXTB 3PHOA 4RBPH 3LKSA 3QNZA 1ETZA 1ONQA 1W0VB 3FB8B 4LNRA 1DSFL 3X14A 2G9HB 2NYYC 2J3SA 2H32A 3QDMB 4M48H 3DECA 4ZO6A 1I1AB 4DW2H 1FFPB 5I2IA 4NQSB 4RAUB 3W9EA 3EOAA 1CG9B 4I5BA 3U0WL 1I1CA 1G7QA 1F4WL 4KHTL 2YD6A 4KDTA 4OGYH 3K2UH 1C12A 1CK0L 3IJYB 5DURB 5CINH 4IRJA 1G7HA 5MEOB 2VTFA 3QI9A 3QUYA 3KYNA 1KB5A 3D48R 3T4YB 5MI0C 4ZFOA 3GJFK 3IFPB 4BK5A 3AS3A 5IMOA 5J57B 2OXGA 1PYWA 4YBLB 1G0YR 1TLKA 4RDQG 1YQVH 3CU7A 1QD0A 2C4XA 3B9DA 3SKOA 5IR1B 1KSRA 4NQEB 4JZNB 3S36L 4PRNB 2YPLE 1R3IL 5CEYA 2DM2A 3T3PF 3CFDB 5I71C 2IF7A 4PTUB 5J1AB 3T0WA 2X4QB 4H5SB 4ZAKC 3QZWB 4UDUA 2NY6B 4X6DA 5DQ9B 4U1IA 2I60H 1AXSB 4N1CA 3ROLB 4Y7MA 1L0YA 1KB5L 2P5WB 4WEBH 2P49B 2WIIB 4ZFOL 3HE7D 4ORGA 4FG6D 1KJMA 3OKLA 4C58B 4P9HC 2HMIC 3ARSA 1WAAF 4JFDA 3QIWC 1EGJH 4Y5YB 2RHEA 2FECI 4ZNEA 5C0CB 5BQ7B 5JPNA 3CC5B 4H0GA 4ODVL 3MV7D 5JW4M 3SDXF 4D9QE 5JORB 1CGTA 2OR9L 3NFPB 4KTDH 2Y25A 1RZ8A 4WI2A 4OLEA 1C7TA 4H1LA 1I3VA 5F93C 4OF5A 5EU3A 4L4VB 4TSAH 1KCVH 4G9FD 4HAFA 2N7AA 4PP1D 4LKCA 1A6WL 1R3JB 3VJ6B 1LE9A 1EBPA 1JPSL 3AUVA 4ZG1A 2VAAA 3NABL 3ALXA 1GGCH 1T83C 3MRHA 4PJ7B 4OD1H 1D5MA 1UM6L 1A6UL 1AI1L 3MLXH 3P4MB 5C9JA 5L2KA 3QIUC 5LBSH 5I8EA 1CZ8L 1H3TA 1KTLB 5E8DL 2FX7H 1FG9C 5F9DC 1I7ZA 5HDLA 4L4TB 1Y18B 3KPNA 3OPZL 5D7IB 5ERWA 1JJUA 3VFTA 3LQMA 2DD8L 1F11B 4L1DA 4FQLL 3MOQA 4XPHH 2ED7A 5D8JH 4R0LC 4ZPVA 4PJGA 4CJ1A 4JAMA 1FYTB 2EKSA 3T2OA 4AH2A 5EDXA 3NACH 4F9PC 4M5ZH 4L4JA 3O2WL 2DKSA 3L3OB 4LASH 2VDMH 4ETQA 1OD7A 5IB2A 2WBJD 1WQVT 5C08E 4LEOA 5ISZA 1F97A 5HYIA 1XCTB 1S7SA 2BXYA 4MCYB 3ES6B 4FMKA 3T2PA 4HEME 5J6GA 2F19H 2VKXA 2ICEB 2A1WH 4NQDB 3V0WL 3LQAC 2EXWD 4KY1H 1PKQA 1AIFB 5F89A 3OB0H 4U1LB 4NC2B 3UJJH 1A4KA 2YZ1A 4H26B 4UIKH 4YWGL 3LHPH 4XRCB 2AI0L 4YZFF 1UJTA 4G7VH 1OP3H 1J8HA 1UKQA 5C0GA 5GRXG 3G6AB 4S1QL 4E41E 2EYRA 4JQIH 3MLTB 4J3WA 1OD9A 2YUWA 1F00I 4RIRA 4AG4L 4K3DL 2YEZA 3U36B 3G5VA 3KLDA 3S98A 3CZFB 2RAMA 3DX6A 4MXVE 5INCB 2AJVL 3WFBL 1CFBA 1RZ7L 2C3VB 2NY2B 2VZ1A 5CWSB 3V9FA 3ARTA 1A3LL 4JFFE 4X6FA 1H5BC 2YPKA 3WXWH 4KJQD 3NGBC 5ABDE 4HKXA 3QDJE 4WWKD 2Q7YA 4G9DA 4DVRH 2FGWL 5TF0A 1J12A 4OZIF 2H45A 4M6NL 4GXUN 4U1JA 4N1EA 4RGOH 2IPUK 1SBSL 5E2UH 4LRIC 4OV5A 2IH1A 1IJ9A 2ZUQB 3DOSA 2O61A 3BN9C 2PYEE 3G5ZB 2AW2A 1JI1A 2J8OA 4GH7B 2XN9D 3CCHA 5EOCH 1IC5L 2AS5M 2IQ9H 2H9GA 4Y16D 4BFEA 1ZGLP 1G7IA 1JBJA 4KI5C 2BVTA 3KLAA 3BPNC 1TETH 2VDPH 3BO8B 3VI3E 2J4WL 3M07A 1CCZA 2HN7B 4LK4A 3SGDH 4RMUA 3O8XC 1L7TL 3HS0B 4DTGH 1EAPA 2VDOL 2XIDA 3DXAA 2NY3C 1V7NH 5FOBB 4M1DH 1T7WA 2W9LA 4PBVC 1ZGLM 3NIFE 4PJDA 1QSVA 3CH1B 1S7QA 2MQ3A 3EYFA 4L3AA 4OF8A 3ARBC 4DKEL 4N90E 3TYGH 4MHHG 5TQ0L 1P7HL 4GW5A 3KLHC 4WFED 4IEFB 4Q2ZA 1FV1A 3QEQB 4XAKE 5CGYC 5ID1A 1G6VK 5D2LA 2EDTA 1N59A 2CKBA 3CX2A 5LQBL 4ZFZB 5DVLA 4NQVB 3IAGC 3O9WB 1WWWX 3H3PH 4PJ8B 1J1XL 1WF5A 3T1WA 4JRXE 4NO3A 1HIMH 1NMBH 5CGMA 5B39G 4NM8H 3HC0B 5GGSY 1LO0H 4UT9L 4HIXH 1KIRA 3B9EA 1FGNL 3W2DL 3BESR 3QO1A 5A40E 1U2HA 2OJEA 2HRPH 2MCG1 3LH2H 3VW3L 2PO6D 3MCLH 5GSVA 3K80A 1FL3A 4QHMB 2Z93B 1OGTA 1ZANL 2DB8A 3BZ4A 1F3JB 1S7WA 3N85H 4Y4KA 2E8ZA 3OR7A 2YN5A 2R23B 1CLZH 2B8OT 2HLAA 4YDIL 1QRND 5C0AB 4LSRL 2FH6A 3OKEA 2AEPH 1QFWL 2CKBL 4TSBH 1BBJA 3VXSE 4QXTA 5I30L 4O02L 1ZLUK 4ZS7L 3L5HA 4JO2H 2SEBB 2X44D 5DEFA 4L8BB 5MI0B 5SWSB 1WBXA 5D6CA 1VGEL 5KSBA 4LFHD 3LZFL 2Z0BA 4GLRH 5DWUL 1F8TL 5KTEL 5DDHA 2UVEA 3AS0A 2LU7A 1MY5A 2V5TA 4WUUD 5MP6H 2EC8A 2G60L 4ZUVA 2V7HB 3S96B 1VB9A 1VFUA 4GRLC 5CEZE 1RMFH 1LILA 4JY4B 5JIKA 5I71B 2W65B 1H3UA 3D3VD 1JFQL 5E6ID 5IMKB 2APWA 5KZCD 1T2QH 2F54D 4FQ1L 4KUZH 1GZQA 3FB6B 3EHBC 4LAQL 4ZXBA 1ZT1B 5DJDB 4HX1A 3T0EA 2NXYD 2H6PA 2W92A 4V2BA 4DK3A 1ZOXA 4PJCE 5L8JB 1P84K 4MA8L 4Z7QE 1CD9B 1P84J 4WV1A 2YA2A 4OCWH 1N6QL 1YPZA 4HBCL 5HY9A 1LP9A 4MCZB 2BSED 4PP2B 1S3KL 3O41A 1WT5A 3HZYA 1DQJA 2OZ4A 3H9HB 1OAQH 5GS2H 3L1OL 1D6VL 4O2EB 5EU4A 1MPAL 4JHAH 2HVKA 3HG1B 1FG2A 4FQ2L 1TJIH 2FX9L 3WHXA 2LAAA 4U0RC 5KOMC 3BWAB 5T1KA 4P5MA 1U0QA 2R1XB 1IAKB 5CZVH 4PRIB 3W9DB 1T04B 1UA6L 1OTSD 4OAWB 1ZLVH 4Q0XH 1DE4A 2YPVL 1WFTA 4IOFD 5FUOH 1LDPH 1K8DA 3D5OF 5CIPH 1YN6A 2FDBP 2P24A 1CFTA 5DJAB 2OZ4L 3CLEL 1M4KA 1PAMA 3QH3B 4XHJC 3RX5A 5HI3C 5I1LA 1UJ3C 5I8OL 3RZCD 4QXWA 1BD2A 3BGMA 3QIUB 4NP4L 4QRSB 3HCVA 4OV6F 3VFGL 5T33L 3SKNB 4JVUA 1PJ9A 2JJVA 1RV6X 4LCWB 3HI6L 3DJ9A 5KS9F 2B2XL 1UGNA 3VWJD 1WWBX 5GGQL 3C09C 4LLYA 3DV6A 1WC7B 2BC4A 1U8MA 3CXDH 1CE1L 2NY1B 2GJ6A 4R0LB 2ATKB 3RNKA 1N5YL 3HB3C 3UJTH 1XF5A 4NKOB 4X6CB 1S9XB 3RU8L 4PJBF 4Y4HA 5HVHC 5EO0A 3KPRB 4QRRE 2JB6A 1DQDL 2VQTA 4LHUA 5A16B 1QSFA 5C0DA 3BUTA 1MLBB 1HH6A 5T3XE 1GGIL 1I3GL 3U0PA 2Q8BL 1RUAL 3BSZL 4UOW0 4MJ6A 1N2RB 3S34L 3VXUD 3MRLA 3K2MC 3JV5A 1PLGH 2IBGA 5B3JE 4MZ3A 3HRZB 3DTXB 1RIUH 3VFOA 3LKOB 2VQ1A 4NNXB 3GSVA 4JPKL 4NHUB 3GZKA 5A2FA 1S5IH 4FXKB 2HTLC 4CDHA 4KZDH 3A67L 2LU3A 5FK9A 3U7AA 4PRPB 3D0VA 3S5LB 2CLZB 3IDMB 5IW6A 5CBAA 2VKWA 1CVRA 1FLRL 2MJWA 2VZSA 5ADOL 1U8HB 2AK4B 3BP6A 4C4KT 3MYJB 4XI5D 4QHUB 3FO2B 4KVCL 3BP4A 2FJFB 2ZCHH 1MCPH 1YY8A 3FQUA 3DV4A 3PJSB 3I75B 1A1OB 4FHBD 3L7FA 1H5BB 4EDXB 1AP2B 3NGBB 3VFPB 3MGOB 3V5HA 4JM2D 3SDCA 1K8IA 4YE4H 3MLWL 3TWCH 1CS6A 5EU6B 2DQGL 3AREB 2XZCH 1TITA 1N6UA 2IFGA 3P40A 3QUZD 1HQ4A 4L3EB 5IKCA 4AIXA 4LSTH 1MRCH 3KAAA 4OBRA 4N0UE 3JTTB 3D18B 1S7VA 4XVTL 3H42L 4F33A 3KYMA 1JGLL 3QNXA 4HC1A 3EJYC 4QRPE 5KSAD 1WEJH 4LDLB 2HFEB 4NKQB 3U4EB 3WUWA 3VXRB 1C5CL 5C0IA 5DK2A 3BPNB 1UT9A 5DRWB 2AGJH 4YH6A 4JB9L 4LF3A 3HI1A 3MRNB 4NQCD 3FQRB 5TQ2H 4AK1A 1J5OL 2R2BA 4Z7UB 2X10A 4HXBL 5HHMD 4K55A 1JMXA 3O8XB 4J4PA 1HN1A 3FB5A 2IMMA 2ZUWA 1DUYB 1G9EA 3NZ8B 3VXNA 4XCYA 1CICD 1R5WB 1VDGA 2NY3B 4HIJA 5ANMA 3ARWA 3EFDL 3DSFH 5IB5A 1MF2L 5EIIB 1KULA 1LEGB 2DLTA 3EYVA 4R7DB 3HR6A 3ARBB 1SEQL 1OL0A 3HUJF 2FHCA 4QHLA 5JUEH 2DWEA 1TQBC 5HHPA 2X4TB 4E0RB 3IVKB 1TCRA 3NCEB 2AERT 5DJYA 5CJ8A 5IEKB 5L7XH 3W81A 1P7QA 4JANA 1IKFL 4OF6A 4U1KA 1IAIL 5FYJD 4XBEH 4Y19B 3ZHDA 5JQHC 5GSRA 1FE8H 4YR6B 5KANG 5SX5H 2GK0A 2DLEA 1LO5B 1LO4L 3JWDH 3BW9B 4LSDA 3EBAA 4G3YH 4RSVA 4F8TA 1QR4A 4RRPA 3RWDB 3B4NA 3RVUD 3RWCA 3F7QA 1OWWA 4W6WB 4HXAL 5ESVB 2P5ED 5T3ZL 3GBML 4I0PD 2P8MB 2A9MH 3GMNB 1OGAD 2WUCL 4GBXD 4BA8A 4K2UH 4F57H 5I8CA 4N9GA 2NTSP 1HXYB 1JRHL 3NTCH 3HE7C 1BLNB 1DLHA 3FQWB 4QNPE 4FG6C 3SE9H 4Z7VE 1U8NA 3NCJH 3EYQD 2HKHL 1WIPA 1MHPH 1PFCA 4Z0XB 1NFKA 3GMPB 5DSCB 4JO1L 2VC2L 4GS7C 4L9DA 1Q94A 4ZO9A 1BIHA 4P2OA 5JDSA 2XFXB 4GRLB 3CDYA 3UTPD 3BKCH 1GVIA 5EH1A 3BEVB 1MELA 3I2CL 3FRUB 4PRDB 1JGUH 1IGML 1WVZA 1XGUB 3EO1A 2IADB 3LS5H 4LU5L 1S9VA 43CAB 2V17H 1A6AA 4GRWF 1X5YA 2OQJA 3HC3L 3O11A 4PP1C 1MCOH 3BZEA 2OP4L 3QZWG 4JJ5A 3ZKMD 3VFNB 4MVBD 4GRMA 4GG6F 1T2XA 1WTLA 4UV4H 5JXEA 3ARYA 5E9DD 1E4KC 3U82B 1K5NA 5I66A 4OLZH 1KN4H 4ESKA 4PJ7E 1FJ1B 5EZLB 4G80B 1JPGA 5E94B 5HBBA 1P4LB 5HJ3A 1A7OH 5FGCE 2QV2A 4JCMA 4XTRD 1MWAH 3LRSB 1T03L 4ZFGH 1HKLH 3KDMB 1BVLB 4ZUTB 3RX8A 3ULSA 1JTOA 2I07B 4MJ5A 5ICXA 4M6OL 1A7PL 1XH3A 2OL3H 2E27L 3IXAA 5D7IE 3GGWB 2HTKD 5E8EA 1HYSD 4NRZB 1U3HD 4P59L 2AQ1A 3W39B 3D85A 3LN4B 4M7JH 2XNAB 3TBSB 4FN0A 4WO4A 4W4OC 3ZKXC 1C5BL 4R90H 4X99A 3RDTD 4BZ2L 1IEAB 2WBJC 3AC0A 3REVA 4FA8A 2B4CL 3BXNA 3RAJL 3O3UN 4WFGD 3NFSL 5HGAB 1UJ3B 4WI5A 5F70A 1X5ZA 3MA9L 4Z0BH 4O5LH 3WFHB 4Q7DA 2BNQA 1HHKA 2ZOLA 4HFUL 1RPQA 4M03A 2EXWC 4XMLL 4ZUUA 5JHDB 3PXHA 4ZMAT 1R24A 4NOBA 3WXVL 2BX5A 1XGRB 1HKFA 2A6DA 4N5UA 1K6QH 2YBRA 3C09B 5D7JA 3TJHC 1ZVYA 4KU1A 4I0KA 1DVFA 4U6XB 1UXSB 5AD0A 1U8KA 1CBVH 3MRPB 4JZOA 1KELL 5F7HA 4YGAB 4CN4A 4EEEA 1BFVL 2DLGA 1G7MB 1Q72H 3V5KA 5HVHB 4K9EC 3GMMA 4IRJD 4JFED 2IAMD 4G8IA 4PV8B 4RMVA 4Y1AE 4LKXB 1IEHA 3W0WE 2BVOB 1KPUA 5LXGL 3BRFA 4BFIA 4KAQH 3QJFA 4A6YL 2WM0A 2D4FA 1INDL 1ZT7B 3L3GB 5TJWK 3B3IB 4JN1L 2ORBH 5HYFA 3F5WA 3ISWA 1NCBH 4KJQC 4WWKC 3L3DA 3C5SA 3W11D 1K2DA 3QRFM 4Z9KB 3LRGA 2GUOB 1JGDA 5D1XA 4EN3D 3ZHLA 4Z78B 5F9JA 3D1MC 3CMGA 3QDGE 5EBWA 5FGBC 2CXGA 5E8OA 4HSQA 4PJXB 2GFBA 1WBYA 5J89A 2Z31B 4X5XA 5E2WH 2ZKHH 3TM6A 2D3VA 4XC1L 5ESQB 4Y16C 4FTVA 2EDDA 2Y7QB 1QPXA 1U91A 3SDXA 5JMOC 1FC1A 1IILE 3CXHJ 2CUIA 3ROOB 4J23A 4DKFH 2BOBA 1N64H 1CDBA 5FF6A 5L9DH 3MOAH 2ITDB 5DHYB 2YA1A 3PHQB 4QF1A 1TVBB 3SE3A 2CIIB 3E6FB 3SGJA 3A6BH 3B9KB 2HJLA 4PJHB 5ILTH 5DEZA 1JGEA 1I9JH 3I6GB 2V6HA 3TA3A 3P9LA 1T1YA 3CAFA 3VGEA 4P3CH 3WLWD 4BZ1L 2ERJB 1AGCB 2P8LA 5HDBE 3WFEH 2ZOKB 4WCYH 1U95A 4HK0A 3P4OB 4MAUH 2ID5A 4V1DE 1U8PB 5BV7C 2HP4A 3RGVA 1KCSL 5FB8A 1MIML 4IMLA 3RIAK 3EYUH 3S36X 4JFZL 4Y2DA 1Q0YL 1H0DA 4NKDB 4F7PA 1D6EA 4RGND 3TO4A 2FGZA 3UTTA 2PO6C 3HMXA 2HLFD 3NH7H 2ICES 3ULVD 3TBWA 1D5XA 5I16B 1ADQL 4HT1H 5L2KD 3UJIH 1QPPA 2E8YA 2ADFL 2VH5H 2WBWB 4U6HB 1PG7H 1ZWIB 1CFQA 2VR4A 3PP3H 4POUB 4LLWB 1KG0B 3SBWA 4MGXA 1TQBB 2GHWB 3QFJE 3SGEI 4CNIA 1F3DJ 1G7PA 5D72H 5J1SC 2VERN 3IYLW 4Z7NE 1T3FB 4XNUH 1AQDA 4KVNH 4N8VA 3PWVA 3MRIB 2ZG1A 2O5ZL 2X4UA 1FAKT 1CD0A 3DX7A 3V6BR 2GYSA 4P5KB 3SOBH 2RIKA 5HD8D 4YHNA 1OCWL 5CEZH 4WU7B 3L3JA 2BMKA 3V4UH 3EO0B 2A6KB 5EWIL 1O5DT 3MJ9L 5ISZD 2J5LC 5AG8A 1DBAL 4GKSA 1GIGL 4NJAL 1OSPL 1W72H 3QRGL 4R7NB 3VFWA 3X13A 3PP4H 3SJVE 5I1AA 2ZJSH 2NXYC 3LEXB 3LCYA 3MO1A 2VLRD 2VZOA 4OT1H 3WMSA 1MJ8H 5JOPD 1OAKL 3HE7B 3MRDB 3IDXH 1GC1H 5TGBB 4P4KB 4HIEA 1C7SA 1IGYB 4QTHB 4BYHA 4JFYA 2MTPA 1I8IA 1RHHB 4YAQB 1T6WA 4GS7B 4JPWL 4OCYL 3MV7B 4PG9A 4DOHE 4U1SA 4WTWA 1N0LA 2BY1A 4HH9B 3R8QA 1ZA6A 4X6BA 3FMGL 4K94C 4MSWB 1UACL 3BYTA 4YHKH 4F58H 2APVA 4HHAB 3GSUB 5E6YA 3SQBA 4GQ9L 5KJRL 5IW1B 1U92A 5E1AB 5IBTL 5IMLB 1OTSC 4J6RH 2FB4H 2P48B 3V7AE 2V5MA 5TH2B 4G9FB 4IOFC 3CJJA 4YHML 4RX4D 1U36A 4M93C 4PRIE 3SE4A 1XGPB 5KVGL 1KLGA 1YEKL 4EIZC 4WTZA 4HUVA 3WJLA 4JRWA 2CO7B 3IDGB 4OF0A 5FECB 3WIHA 1BMGA 4H25B 1VACA 4BSJA 3QDHA 4Q6YA 5BZDB 1A64A 3RZCC 2HVJB 1N4XL 2MOVA 1Z3GL 4G8GA 5AUMB 3C8HA 1RZGA 4JG1L 5BJTB 1IC4H 4G8FA 1MI5A 5I8KL 2N1KA 3VWJC 3MNZB 1FGVL 3P4NA 2MWCA 2DL2A 4MWFA 4S2SB 2VDRH 4EI5A 1JN6A 1EH9A 1YN7A 4QHNA 1PZ5A 2BVQA 4Y89A 2R29L 1BQHB 2ED8A 5CHNA 5E5RB 4JDVB 4K07A 4TUKH 4NO5A 2PF6A 4OCSH 2HJFB 4M61B 3ZKXB 2W0KA 5TE7L 4XPTH 2WBJB 2PCPA 2XG4A 5T1MA 4KZEH 3I3EA 3SQOL 1T4KB 5JXAL 4P2QA 1AGBA 1GGBH 4DCQB 2GTZA 1CLYH 1BOYA 3TYFA 2IH3B 4AENB 2IBZX 3WS3B 3QG6A 4M9OA 5GGUB 5C09D 3CMOH 4F7MA 3EOYG 4X9IA 4KMTH 3P73A 2UUDK 4QCIA 4LCCA 4M48L 1IGJB 4N5ED 1P7KA 3RY6A 4DW2L 3OKDB 4K7FA 5BRZD 2X6MA 5MEND 4LLUA 4UUJB 3E2HC 4FQXA 4G8EA 4NYLB 4JEGB 4OGYL 5F72S 4MXVF 3OAYK 3EJZD 2C7UA 5CINL 3PWUB 4JN2A 1EFXA 5EZJB 3BEWA 2HJKB 5FO9A 1KACB 4XI5C 1TVHB 4RFNB 4PRPE 2DQHH 2MFNA 4ZUWB 3CVHB 3H9SE 3AAZB 2XXMB 3D9AH 1FZMA 1M7DB 1UVQA 3M45A 3MBEC 3WV0A 1I3RA 5ID0A 1DFBH 4GKOA 4JM2C 4OI9A 1ZHBA 3BISA 2XTJD 1EGJA 1XZ0B 1TENA 3QUZC 3VG0H 3DUUB 4WI9A 1XR8B 4LMQI 4OQTH 1KIQA 4DZBB 2XN9B 2ICCA 4HS3B 4Y16B 3UPCA 5GPRA 2V2XA 3VCLA 2M26A 2HT2D 3MZTA 1NFDA 3VDBA 3ORJA 3PQYA 5KSAC 3NA9H 4RQQA 4OUUA 1J05B 4NNYB 4PV9A 5K9JH 1J0YA 1S7UA 4WEBL 3CFEB 5D7KE 1JNHA 5DGRA 1B4JH 2YD7A 3LS4H 1KJ3H 3S5LG 4KI5E 2Z35A 3BJ91 4Q9RH 1BGXL 4GAJH 1HE7A 2IBBA 5CILH 3PUCA 2X1XR 4P46A 5LAXB 1U8LA 1ZSDA 3OJDA 2JELH 4KRPD 3DYOA 4LHQB 3ZKND 3UZEA 4PRAB 4O4YL 2A9NH 5DEGB 1MFCL 1HEZA 3IAQA 5CJQH 2E6JA 1KGCE 4KTDL 1CU4H 5T1KD 3E6HB 5F1IA 2QQKH 4IS6B 1T7VA 5EOTA 4K7PX 1UENA 3NPSC 3L3HB 5BV7B 4TSAL 1KCVL 1D9KD 1A9EB 1F90H 2O93L 3HZVB 2VLJA 1W0WA 4HUWA 1GGCL 4UI2A 2P8PA 4XP9H 1N5AA 5HVGB 4W6XB 4OD1L 2PO6B 4YDJA 1LEKA 1RVFL 4XCFH 4S0TD 3RVUC 1TTGA 1I85C 2N4IA 3NCCB 4E42B 1S9YB 1UB6A 4I0PC 4F7TA 1FH5H 4PFEA 2FX7L 1YEEH 1QRNB 4M1CC 4AIZB 1LNUB 4GBXC 3D0LA 5F1NB 5K93A 5GS0H 1DBMH 1PZUB 2FEDD 3ULUF 5IVNA 4XPHL 3JWOH 3ZL4H 5D8JL 3T77B 3EYQC 2OI9B 4C56E 1MHEB 1BJMA 2OK0L 2BNRD 3GBNH 3NACL 4JFDE 3V52H 4O2CA 4I9WD 4FXGA 4Y4HD 2MCPH 3K46A 4WUUB 2R4RH 4LASL 2VDML 2EDWA 3IGAB 3X12B 1ITCA 3NPZB 3HPLB 1NC2D 4OKVA 2VE6A 3PGDA 4YX2L 2J5LB 3D3VB 4LPWA 3BAEH 2XV6B 5E6IB 5DHVB 4O2FB 1SY6H 2PYFB 3ARVA 1X6NA 3F7YA 3PWLB 5DMKB 2A1WL 4OZGF 5E8NB 1JZ3A 4KY1L 5C0BD 3UJJL 2UWEB 4YHPA 1E6OH 3EZJB 4C59B 4UIKL 3LHPL 2VDQH 1T66D 4G7VL 5DUBB 5FKPA 2VR9A 3BPCA 4KK6D 4OCRH 4MVBC 2ADJA 3UMTA 4MQ7B 2BCKB 4JQIL 4PJEA 4RNRA 4M8QB 4WENB 5B21A 3PWPD 2YD2A 4G5ZH 2WQ8A 5K9KB 4UQ3B 4X9HA 5GXBB 5JIPA 1T0MA 1DR9A 4BQ6A 3G5YA 2NX5A 4XXCA 4MMZC 3MGTA 2FBOJ 4GMTH 5DI8B 4XTRC 5SWQB 1RHFA 2YC1B 3WXWL 4DVRL 2HYMA 3VFRB 3FFCD 5CEXA 1JWMA 3V0AC 3O6KH 1ZHLA 2Y4SA 4AM0B 1NBVL 4RGOL 4P4RA 3QBTB 5E2UL 2DYPD 3IFOA 1A3RH 1ND0B 2HTKC 4YHYC 1HYSC 3KR3H 2R1WA 3MXWH 4MJIA 4M93B 2FHBA 1S5HB 3RDTC 4A6YB 2IQ9L 3TIDA 3BKMH 3QWOA 4XNQA 4OJFH 1QFUH 6CGTA 3G6JE 2HFFA 3RZCB 2W9EL 2BK8A 2C5DC 1TETL 5E2JA 2ZSVA 3EYOB 3IKKA 3MLRH 5E4IA 3QIBC 1UWGL 3PWJB 4D9LL 4LVHC 3GB7B 5DJ6B 1MFDL 3VWJB 4KPHH 1M05B 5DT1H 1YA5A 1OARH 4DTGL 3KYOA 4F3FA 1V7NL 4M1DL 3N1FC 2MQCA 4OM0H 2X4SA 3R4DA 3IRPX 4JKKA 3V6OA 4Q6IA 3T4AA 2IANA 1UEYA 5CZKA 3TYGL 1YJDC 3LKQB 4U3XA 4IRJC 2DLHA 2FNBA 2IAMC 3IF1A 3OXSB 3KS0J 1QP1A 4M4PA 1A02N 5EUKA 1DEDA 4S0SD 2QQLL 1D5BA 3KNBB 1SYVA 4ZS6D 4BH7B 3H3PL 1CDUA 3CX5J 1SMOA 2OMNA 1KPVB 2DQUL 4CAGA 1G84A 1I3UA 2HAZA 4G6KH 1MOEA 4DN3H 3JVGC 1HIML 3W11C 1EMTH 2X1QA 3VXUB 3O6FD 5KBNC 1NMBL 4NM8L 4EN3C 1LO0L 5IB3B 4HIXL 1QFOA 1ZLWK 4I13B 3GJFB 2F58L 1HI6A 1M71A 2HRPL 1WISA 5L2JA 3MCLL 3ZSSA 1MCSA 3TIEA 1SYSA 4X8JB 5E08H 3FQTA 3E2HB 4ELKA 2ENSA 5GRVK 1T5XA 3N85L 1HOCA 4K3GA 1CLZL 3K4DA 1FZKA 1CDCA 1NBQA 2Z8RA 2AEPL 4GXVH 2YUXA 4TSBL 3B6SA 4ONGH 2ESVA 4IRSB 3MNWA 5C0FA 4BH8B 3DRTB 4JO2L 5AEAA 2B1HL 5ACZA 4JR9H 5K59E 4WW2A 1AC0A 1JCKA 1OWRM 1R5IA 1IQDB 2QKIA 4TVPD 3QULB 5I1IH 2GJZB 3ESVF 3T1FB 3RIFK 2PTUA 1BVZA 3KHQA 2VIRB 3HZMA 4JM2B 5DJ8A 5HGDA 5HYJD 1DCLA 5MP6L 5DMJB 3MJGX 1RMFL 4P2OD 3WLWC 3VU2A 2VLKA 3RWHB 4PJHE 3GUTA 1F42A 2XA8H 4HZLB 2B0SH 1T2QL 2Q20A 4MNQD 2HH0H 4KUZL 4PREA 2DI9A 2C4FT 2OTWB 1J0IA 1JHLH 1IKNC 3Q6FB 5IB4B 4NQXB 1F6AB 3UTOA 4NQCB 1L7IH 4POYA 4PJAA 5KN5B 1FPTL 4RCAA 1A6VH 4AQOA 2HG5A 1CICB 3ARRA 2HLFC 4GRWH 1E4XL 4HKJB 4IHOA 3U9PH 3ULVC 5DZNA 1FIEA 3QUMA 3U7YL 4WNQB 1MCDA 4C55A 4JHAL 5IQ9B 2D7TH 3LKRB 5CJOL 3BD3A 4TNWF 1LVEA 4OIBA 4Z95H 1TJIL 3VD5A 3DIFA 4ODUB 1VADB 4R8WH 1MLCA 3B83A 3FQXB 3QAZC 4M5YH 5FEBA 2GCYA 4B7IA 3NPSB 5CZVL 3MTRA 4G6FD 4X4ZA 3CZJA 2R2CA 4Q0XL 3K7UA 4BFGA 1BWWA 4UDTA 4LP4A 2DQJH 5FUOL 1LDPL 4KDVA 5KG9B 3GMRA 4PB9H 1ED3B 3DURB 5HD8C 5DYOA 4WHTA 1CFVH 4HGMA 4PGEB 1LQSR 3UTZA 2HWZH 3TCLB 3IDJA 1NCDL 1A7NH 1QHOA 3P4LA 1T21A 1BQLH 3QEUB 4PR5A 2BRQA 1FFOA 1RU9H 1U8QB 2AEWA 2QL1A 1JWSB 3LOWA 3QFDA 2P5EB 1A6ZB 2EXYD 1K85A 3RVVD 4I0PB 3LB6D 1FZOB 4S10A 4FNLH 4PJFA 3FQNB 1NQBA 2Z8WC 4GBXB 5ENWB 4EVNA 4Z7VF 2HRLA 5DC9B 3U83A 4DGVH 4C57C 5GZOD 43C9B 3CXDL 1FL6B 1PY9A 5GQBA 1KN2H 1YPZE 3L5WB 2GTWB 3GSQB 1LP9E 3VGGA 3ZTNH 1X7QB 3GSNA 1HSBB 4P9HH 5F7KC 4EBQH 1J9CT 1VSCA 3UTSA 4TUJA 1UXWA 1BFSA 4X9FA 1UFUA 3U30C 4HW6A 4ODHL 1PVHA 4FQPA 3DO7B 1OT1A 4GG8B 1HDMB 3MJ8B 5JW4N 1YNTB 3ZT6A 5HGHB 5DRZB 4D0DA 1BEYH 3MV7E 3NN8A 2Q3AA 5EU5B 5E24E 1PLGL 4CU7A 2M1KA 3ECBA 5IQ7H 1RIUL 3DMMD 5I9QC 2GSIB 5GRWA 2I9TB 1S5IL 1A14H 3RWGB 4KZDL 4JFHD 4CN1A 4ACPA 3DUHA 4P2CG 4HUXA 2HFGH 4U7MA 1LK2B 1INQA 2P44B 3OF6A 5E9DB 1R3KA 3STLB 4M8VA 4XCNB 1Z0NA 4DZ8B 1I1RA 2CK0H 2ZCHL 5EG6C 5EC1A 1MCPL 5EFIA 2VABB 1H8OA 12E8H 2I25N 2MKWA 3REWA 3ZZ1A 2Y72A 3IDNB 4JO4H 2F74A 4YE4L 2FO4A 2J8UB 2JK5B 3TWCL 2JCCB 2XZCL 1NBZA 3UX9B 4PGZA 3WFCL 4YHYB 4X7DC 1U3HB 5EC2B 4W4NA 5HHNA 1FVCA 2IG2L 1FL5A 5GGRY 3H7BB 4XP4L 2VDLH 2Q1EA 3RDTB 5T1LD 4RWYH 3H8NA 4Q9BA 4HWEH 4HGWA 1MHHB 1CE6B 3BVNB 4XPAH 1WEJL 5EZIH 1OPGH 3G5XB 5DJCB 1JNNL 3CUPB 1BZ9A 2QHRH 3U0TB 3G04B 5LCVH 2AGJL 3O3EA 3VRJA 5TQ2L 1XEDA 1EJOH 1PD6A 4LVHB 1ONQB 4A2LA 3BI9X 4Z7WF 1PG7W 3O3BA 3GMOA 3UBXB 1DEEB 4LNRB 1K4DB 3GSXB 2P4AB 3X14B 1EAJA 4N5EC 2H32B 3OKOA 5IM7B 4I48A 4UOJA 4MDJB 4XGZB 5JNYA 3O2DL 5IG7A 2ZSWA 2EDXA 8FABA 1UADC 1H8NA 5H94A 5IVXF 3EJZC 2DKUA 2FD6H 1F4AA 3D87B 1C12B 1S7TA 4IRJB 4JFEB 2IAMB 3PL6A 4PYGA 5DRXA 5F8QC 5JUEL 4F7CB 5J9PB 1HK6A 2WINA 2J2ZA 5LVEA 1IC7H 1K3IA 3QUYB 4PRBB 4UILL 4JGJA 1YEJH 3TVMA 1I75A 1YDPA 3TO2A 2E9BA 1BQHG 2K7PA 1DSFH 1AD0B 5F3HA 3ZE2E 4XBEL 5EULV 4WFFD 4FXLA 1Q1JH 1FE8L 4WGVB 4EN3B 2XTJC 4ONHA 5DJ2B 4YQXH 1YC8A 2I9LA 1XR9B 3RPIB 3SKOB 3JWDL 3C6SB 3Q5TA 4HJGA 3S35X 2BOCB 4UMGA 1FBIH 4N68A 3GHEL 3NCYP 5D5MF 1VGKA 3QQ3A 2HT2C 4ZPTA 1NGYA 3MNVB 2V9RA 3R0MA 2A9ML 2XN9E 1A4JB 3LAFA 2CO6B 4OFVA 4K2UL 1CDJA 4F57L 4OCXH 4N9OB 5D70H 1BOGA 1T1ZA 3TT3H 3NTCL 3D25A 1H3VA 1IM9D 3QNYA 3SCMA 5CBEA 4ZO7A 3SE9L 3JUYA 4NZJA 3LQZA 2EO9A 4ORGB 4J8RA 5SV3A 2AXFA 1QR1A 1L4IA 3IDYC 3NCJL 3U1SH 3EO9H 1MHPL 4TRPH 1R3IH 4QY8A 1MJ7H 1MHCA 1KB9K 4IDJH 3EGSB 2DWDA 3ARGD 5HDBF 4X0KB 2PTTB 2VZTA 3PWNA 3GSRB 2YWZA 4KRPC 3ARDD 4U1MA 3ZKNC 5DRNB 2FEEL 3WDJA 3BKCL 4WWID 4NHCH 5T3ZE 2H26A 4DUXA 2Q6WB 5FO8B 1MWAA 4MAYA 3BH8A 4JY6B 3F7VB 2R2HA 1RZ8B 3LS5L 4WFEE 5IJVA 3BIKA 5KAQF 1T1XB 2V17L 2Z4QB 5TDNB 1ZV5A 4XXDA 5EU3B 1ZA3A 1D9KC 5KSVA 4XT1C 2OL3A 5GS1C 1OSZA 2JIXA 1MCOL 4PBWD 4LKCB 5CP7A 4RGNB 4UQ2A 2DBLH 5C08A 2AVGA 1EO7A 4OLZL 1M7XA 2DKMA 1WBZA 2UZYB 3MRCB 5LGHH 5L2KB 1T80A 2J6EH 2W0PA 1A7OL 1FFNA 2R1YB 1I4FA 2AJUH 1MWAL 4OI8A 3IU3B 3KPNB 3MQIA 1HZHH 4D9RE 5DVOA 3LKPA 4ZFGL 1HKLL 3JBG7 1JV5A 5ERWB 2GSGA 2DIAA 1A6WH 3VFTB 1G7JA 1EJ6A 4E41A 1JPSH 1URLA 3BQUA 3WE6A 2OL3L 2UY7A 4JAMB 3C8KB 4LOUD 3ZLQC 3ZYOA 4QOKD 1A6UH 1A21A 4HKZA 2E7LA 4M7JL 4G43A 3RGHA 4P23A 4R90L 4ZUSB 1VEPA 4XVJL 1BVKA 2X41A 5BW7C 4WUUE 5ISZB 4JFFA 4O5LL 3QDJA 4YPGB 5J6GB 3O4OC 1S7RA 2XKNB 1UM5H 3CH8A 3D3VE 3TPUB 5EUOF 1PKQB 1P1ZA 2VLRB 1K6QL 2F54E 4R96B 1T66C 1P6AB 1CBVL 5IMMA 4KK6C 1CXLA 1J8HB 3QXVA 1BJ1H 1IAOA 2UWEE 3R06B 5C0GB 5DK0A 1Q72L 4F9LC 2YD9A 2D03L 4RIRB 3L9RB 1EFXD 1FORH 3PDOA 2ED9A 1HILA 2B20A 3U30B 3HMWH 1X5HA 4LPTA 4J3VA 1P69B 5IVZB 4YHIB 4KAQL 3C2SA 2DI7A 2ORBL 1CGXA 2FJGB 1NCBL 4BSWA 4PGBB 1QSED 2KZ1B 1KBGH 2N56A 2AI0H 3CPLA 2Q7YB 3L3KA 1T7YA 1ZT4A 3BP7A 3BP5A 4S1QH 3MUGB 4GKNB 4LSVH 4XZUB 4OV5B 1FC2D 2W60B 4AG4H 1FVEA 4NGHH 2O61B 2ZKHL 2ZZUT 3S37H 4AEFA 1G0DA 4NO2B 5IFHH 1MSPA 3QUXD 1AKJA 3FN3A 4LPCA 4K71C 2NW3A 1EHAA 2AJVH 2JJTC 4OZHA 3FT2B 1MEXL 2EYSB 1NGPH 4XVSH 1SEBA 2Y5EA 3GSOB 5IP4A 4JRXA 1VFBA 1WITA 1BX2A 2VUYA 3MLVH 3HE6D 2FGWH 4R3SB 5FM4A 4DKFL 2HT3D 2BNQE 3JWDC 3VWKD 4NT6A 4XNYH 3VMPA 5L9DL 1IL1A 1NUGA 1DDHB 1TIUA 4M1GH 4U33A 3GMQB 1EAPB 3GK8L 5KVMC 3A6BL 1HSAB 3W5MA 2EDFA 2IEPA 3EJJX 3HN3A 5ILTL 5E00B 1MFEL 1I9JL 1WZ1H 2Q86A 4LSUH 5FYKH 5A2LH 1NSNH 2K3TA 5FCSH 3RUGA 1JPST 5J11B 1MRDH 3BE1H 1P2CB 4HV8B 3WFEL 4DFIA 4WCYL 1N59B 4ZS6C 2DI8A 2OM5A 1CVSC 3KWWA 4MAUL 2CDEA 2OS7A 3C87A 1QNZL 2IQAA 1R5VB 5C09B 4CU8A 4ELMB 3H2WA 3O6FC 3FTGA 4MLIA 4D0BB 4EI6A 3C5JA 3IETA 2A2QT 3EYUL 3DGGA 4LQ1A 4NZTL 4CMMA 4IMKA 1SJEB 5CD3B 1V3KA 3VXUE 1U8JB 4DKEH 3K81A 3I02A 5BRZB 5TQ0H 4HIHA 5MENB 1I1YB 3N50A 1OGTB 4FTVE 5LQBH 4HT1L 3BZ4B 3UJIL 2VH5L 1X5LA 2VYRE 2HLAB 2PW2A 3LD8C 2CDFA 1BBJB 4PJCA 5IFJB 1LK3L 9CGTA 1OLZA 4LPVA 4X9BA 4KVNL 3KLSA 1RJCA 3I6KB 1E28B 2R56H 2ATPB 2DQTH 1ORSB 4RZCB 2BERA 2A73A 1FN4A 1J11A 5JHLH 1UCTA 4JRYA 2EICA 2COQA 2XTJB 3SOBL 3DGCR 3J8F7 4HPYH 1NGZA 3ULUH 4FQCH 4P2OC 3V4UL 2XOTA 3O45B 2X4PB 3SDAA 3V6FA 3FONA 4HIIB 4L4TD 1W72L 1V05A 2Y9RT 2ZJSL 5EO1B 1GZQB 5I18H 4HX1B 3T0EB 3BGFB 4OT1L 4YHOL 3OKMB 2BP3A 3IS0X 5IJKC 3BYYA 1CXIA 1CLOH 2FWOA 4JREC 4D94A 1GC1L 4IM8A 5C0EB 2WANA 2LAGB 2G60H 1UB5A 3IDYB 5HY9B 3QJHA 5GGTH 3MA7B 4HWBH 4U49A 3HZKA 4OD2B 5C07E 4LSPH 5HHME 2CUMA 1QBBA 1KXTB 4Y5XA 1S9WB 3HZYB 1LEIA 1JFQH 3QXDB 3IJSA 3BHBA 2AV1B 3Q2CA 1EXUB 4KRPB 4PB0L 1G0XA 5FDWB 1P9MC 3OAUH 3L3IA 3VXPA 1IRAY 2L7UA 4MNHA 4O9HH 4YHKL 5T1KB 4P5MB 4F58L 4WI8A 2BSTB 4R4ND 1DQTA 2H2SD 1CD1B 1JI2A 4BM7A 3DHMA 1N6QH 4HBCH 1FVDA 4J6RL 2FB4L 1XF4A 1D9KB 5GS1B 1KNOA 1C1EH 5GRZA 3EOBB 4KC3B 4B0MM 4QRRA 4MXQD 2X2YA 1YN6B 2PNDA 1DQQB 1M7IA 4X6DF 1CFTB 1Q38A 2YD4A 4PJ5D 4FQ2H 2FX9H 1BQSA 3OHXA 5A2KH 3D39A 1BJ1J 4ZDHA 1BD2B 2EXYC 3BGMB 3RVVC 2GAZA 3LB6C 1C5DA 1IC4L 1RK1A 4LVNC 4XP1H 2Y5TA 4FFYL 4LLYB 5GZOC 5C1MB 5HHQA 2VDRL 3IKCA 1OGAE 1B0GA 1MUJB 3UTQB 3SDYH 4XWGH 4PJ9A 3L5JA 2PXYA 3AM8C 2BNRB 1AXIB 1AY1H 2FRGP 2D7OA 1XF5B 4TUKL 1LE5B 3N1MC 3TBYA 1DJSA 3MJ7B 2IAND 4OCSL 4Y4HB 5EO0B 3LDBC 5I8OH 1H3WM 3GM8A 2FIKA 4XPTL 2Q8AL 4QXUH 4KZEL 3GMLB 2WWKT 5T33H 1NC2B 3MV9D 4GAGL 1GGBL 4L9LA 1CLYL 1HH6B 3DUSA 3HI6H 4ODWB 1BM3H 4N0FA 4MJ6B 2CDGA 3CMOL 1XGTA 3O4OB 3EOTH 5HPMA 5JMRA 4KMTL 3UTPE 3V6ZB 5C0BB 3SY0B 1X5IA 5L6YH 5LWYH 3ILPB 3DMMC 2VL5A 3LPGA 5MEPB 2VZVA 2G5BA 3EDKA 3GSVB 2VDKH 2J12B 4HWUA 1I8LC 1QYGH 5A43C 4POZD 1A9BB 1DQDH 3WNKA 3D0VB 4KK8D 3RRQA 3PWPB 3S8WA 5IW6B 2CLVA 4QRPA 5CBAB 1T1WB 2DQFA 3IB4A 1NAKH 1GGIH 2ARJQ 3OR6B 4NKIH 2Q8BH 3BP6B 3F7RA 1DANU 4EXKA 4GLRI 1U8OA 1XF3A 4G8GE 1SJHA 1K9TA 3D9AL 5E9DE 3L6FA 3VFMA 3TBVA 1YY8B 4NRYB 1Q9LB 5CZXD 3VXTA 3CU1A 1IARB 4PJGF 3L7FB 4HMEA 1N0XH 3DRQB 4JPKH 3FFCB 4RMWA 1DFBL 4GW1B 3RWFA 3FB8A 3V5HB 5BZWB 3ZDZE 3FRPA 3SDCB 1K8IB 2G9HA 1U3YA 3QDMA 1VFOA 1DBBH 2DYPB 2ARJA 5EA0H 1I1AA 2Y07H 1FFPA 4ZSOB 4OQTL 4NQSA 4RAUA 1CG9A 1S7VB 4K71B 2D31B 1FYHB 3IJYA 1BZ7B 4PY8I 3NA9L 4KJPD 3KYMB 4Y0GA 4F33B 5I1JL 4XWOD 5MEOA 4P2QE 1PSKH 4OZ4B 5SWSD 2V7NB 4P49A 2EIZB 4X5WB 1NBYB 4YHZH 4L1HA 5I74C 3T4YA 4WFGE 1B4JL 3IFPA 3BUYB 1KJ3L 3LS4L 1I7TB 2IPUG 2DQGH 4GAJL 2F8OA 4WHCA 5EPMB 3TNMB 5CILL 5JO5A 5E7BA 4MX7B 1QVOB 3V5DB 5IR1A 4NQEA 4JZNA 4PRNA 1UWXH 4WRLA 4XVTH 3WDIA 1JGLH 2JELL 3NAAH 3CFDA 4OGAD 3EYVB 4HUMB 3NIDE 2A9NL 4PTUA 5J1AA 2X4QA 1KC5L 4H5SA 1YMHB 3QZWA 5GRJL 3UPRB 2I24N 3SBWC 1CU4L 5DQ9A 4K9EH 2QQKL 1AXSA 5DJYB 3CVHH 1MQKH 4JFEE 4HXBH 3ROLA 4ENED 4JANB 1U58B 3Q5OA 1ZGLB 4U2YA 5CUSH 3QG7H 3O6FB 4LCUA 5IUSA 4OLUL 3HAEB 3VA2C 4TNVF 5CLTA 2BFVH 1CGYA 4BUHA 2V2WB 4KXZI 8CGTA 5B38B 4XP9L 1UM4L 4Y5YA 3T04D 4LLAA 3M17B 4XCFL 2XWJA 1OAZL 3CC5A 2AXHA 4LCYB 3RWCB 1NFDE 5C0ND 2FLRT 3UBXG 3PQYE 4EJ1C 1ZEAH 1FH5L 5BS0E 5K59F 1YEEL 2JJSC 5GGRB 5JORA 3NFPA 3LD8B 3O4LD 5GS0L 1EVTC 3E0GA 5J56B 1W0YT 2X5PA 4I4WB 1GRWA 1QHPA 5HHOD 3ZL4L 3JWOL 3MCG1 5D6DA 3DYMA 1KLUA 4PJDF 3GI9L 1F3RB 3VJ6A 5HYJB 2MCPL 1JPFB 3ARGC 2R4RL 3DWTA 4PJ7A 1AGFA 2DN7A 5D2LF 3ARDC 5HHXH 4F2MB 3QXTA 2APFA 4HF5H 4P2OB 3P4MA 2WUCH 3TN0D 2APXA 3BAEL 1CYGA 1SY6L 4J3TA 1JRHH 4MNQB 1KTLA 3BDBA 1SVZA 2BRRH 2NY1D 1E6OL 5D7IA 3B2UD 1NH6A 5HHVH 4ZOAA 5BV7H 4JREB 1F11A 3O2VL 4M4RA 3BT2L 3BDXA 3BZEB 4OCRL 1FYTA 1GSMA 4P5TD 1KCUH 1OLLA 2DJ4A 5F71A 3VFVB 3QWQB 4HDIB 2VQUA 5CFHA 3L3OA 4U6VL 4DUVA 1K5NB 5FM5O 1LO2H 5DMIH 3KJ6L 4PJIE 3B8SA 4DAGH 3EFFB 1JPGB 4LU5H 4R4FH 4UAOC 4GMTL 1XCTA 4MCYA 3ES6A 3MJ6A 2AJYH 2ICEA 4PY7B 4XPGH 5KSBF 3RWIB 3OAZK 4NQDA 1MJUH 1UYWH 2OP4H 1AIFA 3N9GL 4U1LA 3VRIB 4MJ5B 3S9DB 4JFXB 4G6FB 1HHIB 5ICXB 4H26A 3VXOB 1XH3B 4XRCA 4LOUC 1A3RL 3KR3L 1AHWC 3MXWL 5LG1A 1IEBB 3G6AA 5E8EB 1HHGB 4Y1AA 1J87A 4L8SA 3D69A 3BKML 3MLTA 2EIEA 3QXAA 3GHBH 3KPOB 4ZOBA 5E03A 3U36A 4OJFL 2Z92B 3CZFA 1NEZA 2E7CA 5INCA 5E70A 2DMCA 1NGXB 2C3VA 4K3EH 5CWSA 5DHVH 1M1SA 2ZOLB 1NGWA 2RFXB 3VXMD 5EU6D 1YPZF 4KPHL 4LVNB 5DT1L 2Z91B 2G75A 1LP9F 1OARL 2DQIH 25C8H 2NTFB 4LCIL 4IIQC 4HWZA 1BAFH 2YPLD 4OM0L 1JVKA 3K4ZA 2ZNWA 4I1NB 1U8KB 4JGUA 2VLRE 5JOPE 3G5ZA 3B9AA 3RAJH 4ERSH 2APBA 4QRQB 1ZE3C 4HK3J 3X3GH 3LDBB 3LV3B 3GMMB 1ZVSA 3FCTB 5GISH 1N7ML 5MEQB 2F53D 4XMLH 1MCNA 5CKGA 3R1GH 1J1PH 4Z76B 1RFDL 4G6KL 4DN3L 5D1QA 3BO8A 3L3DB 3SGKA 2HN7A 4K94H 5IHZA 4LIQH 1KELH 1JZ2A 5F9JB 1ZLSH 1EZVX 3DMMB 1J8KA 5FOBA 5AG9A 4OSUL 1DP0A 4Y8DC 2FJHB 3QEGH 4MJIE 2WIMA 5E08L 2D0GA 5DJXB 4D9QD 3QUXC 1XAUA 5F96H 5GS3A 3VXQA 3PGCB 1CGVA 5FO7B 4YDLC 4A6YH 4V1DA 4AJ0A 3SDXB 4GXVL 2EDLA 3IJHA 3THML 4BFBD 4ONGL 4ZFZA 3HE6C 1MQ8A 2HT3C 3O9WA 4JR9L 4PJ8A 2AK1H 3MV8D 3VWKC 3C6LD 1IGFL 1KTDA 5I1IL 1NPUA 2QSVA 5IEHB 3HC0A 2VDNH 3U9UA 4QRUB 4S1SL 5LGJB 4XC1H 3HRPA 4S11A 4TNWK 3WNNA 3RHWK 3C5ZD