1B32A

Oligo-peptide binding protein (oppa) complexed with kmk
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 190
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b32A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b32A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b32A02
3OO9A 1A8EA 2O6AA 2B3BA 4H8JA 2I4BA 3B7DA 3MPLA 2Q2CA 2X7PA 1AH5A 5I57A 1QKAA 1R9QA 1MY4A 3IO6A 4QRZA 4YMBA 1B5HA 4MLQA 5I2KB 4K3FA 1FQAA 1D9VA 5ITOA 4AB5A 1MQDA 1EZ9A 2Q88A 4QSDA 1Y4CA 4KHZE 4YB5A 3LUYA 2RKMA 1MDP1 1B1HA 1IEJA 4GRKA 3MW0A 1MXVA 1R6ZA 3FV2A 4YKKA 3WAEA 5KZTA 1LFIA 2X7QA 1HSEA 1SW2A 1I6BA 4NE4A 5KCJB 4POWA 2DOJA 4FEDA 2Q9TA 3D4GA 3B6QA 2R71A 3ZSFA 2Q89A 2UYFA 2O84X 4JSOA 4BDLA 5I2NB 4U4XA 4DDDA 1OMPA 1IXHA 3V89B 4DLDA 2BJJX 1B51A 1GVCA 3R26A 4NF8B 3RT6B 4IO3A 3KJ7A 2GFEA 4ELRA 4PQJA 1SW5A 1DTZA 4ZECA 4BDMA 3JYRA 2H99A 2I3WA 2REJA 4XTCQ 5LOMA 3KGCA 4DIGA 5I84A 1FW0A 4NF6B 4OENA 4DCXA 1B46A 1M5FA 2B4MA 1ZTYA 3PGFA 4F22A 2DVCA 3WAFA 5DEXB 2Y7PA 2RCBA 5I58A 4JDFA 2NWJA 5HBCA 3C32A 1BIYA 5AA1A 3TCHA 1YCJA 1MPBA 1T0KA 1Y3PA 1B5JA 1H43A 4C1TA 1OVTA 1IQ7A 5A5XA 1OLCA 1MY3A 2XXYA 4GL8A 3D4CA 3MP1A 1B05A 1FTOA 3T96B 1TXFA 1FQCA 2V84A 4QHQA 3VLVA 3S9LC 3OXNA 5TPAA 4H67A 2I58A 3I6VA 3QUFA 1DSNA 1FQBA 1MY2A 4ELQA 4OFJA 5ELVA 2H25A 4KYEA 1OLAA 2V3UA 4QFNA 4U21A 3FUZA 2VP1A 1MY1A 4F3PA 4KCCA 2RC7A 3H6VA 3TTKA 3GXAA 3FVKA 2QJEA 3SETA 2DYXA 2QL3A 4EXLA 5L9MA 2ZNUA 1PEBA 3PUZE 3BFTA 3IOUA 1TT1A 2B4LA 1LLSA 2DE2A 1LB8A 4MF3A 3T9XB 4RNSA 1S7YA 3PAMA 3IK6B 3VV5A 1AL3A 1MQIA 4F39A 1Q1KA 1BP5A 1B2HA 4KR5A 3FZVA 1MQHA 4PP0A 2XX7A 1MH4A 2DP8A 1LBBA 3G3HA 3U1OA 5KDTA 4XKQA 3LSWA 3KOTA 1XVYA 2HXWA 4GWOA 3T22A 3K01A 4YB7A 2NXOA 3ZKLA 3CI8A 1R1NA 1N84A 1IXGA 1POY1 2F97A 4R6KA 1SQYA 1P99A 3C36A 2IEEA 4R2FA 1P1QA 2DWHA 1NNTA 3ZS6A 2Y7WA 2GHAA 4LATA 4F1YA 3OO7A 4HTGA 3KEIA 1LAHE 3VLWA 1LCTA 3FXRA 2D3IA 2UVIA 3PU5A 1GV8A 2A5TB 1FQFA 2Y7IA 2RINA 2R9JA 1A8FA 1MXXA 2ZYMA 1SYHA 1BKAA 4GLIA 4KQPA 5H8NA 3K00A 3HCQA 4AQ4A 5CM6A 3N6UA 4EUOA 3MVWA 3C34A 3FVOA 3DRJA 3DRIA 2Y7KA 2ONRA 1I6AA 4DXCA 3VLUA 3TYHA 3A3CA 1H45A 1N7XA 2F78A 1JEUA 4OQOA 4R6HA 1Y3QA 1A55A 3VE1B 3O6GA 3RUMA 1IXCA 1I6QA 2ALUA 3ECRA 3FV1A 4WEPA 2XXIA 3U93A 3MJNA 4OYVA 4ESXA 1OVBA 4G8HA 2FA7A 1P1WA 1CB6A 4I1DA 3RTWB 1NFTA 1JW5A 2NVUB 2I49A 5L8DA 1LFGA 1LGBC 3O2AA 2I4CA 4YB6A 2O51A 3SEWA 1M5DA 4DCYA 3CIJA 1VFEA 2AIXA 3U92A 2OCUA 1SYIA 1R9LA 4KI0E 1RYXA 5I59A 4KCDA 4U2RA 2YPNA 3TELA 4NMYA 1IZ1A 3RLFE 4BDOA 3FJGA 3G3KA 3E13X 4EQ9A 3RY3A 4ND9A 4QFKA 4JWXA 1F9BA 4YICA 4U23A 4TLLB 3JZJA 4BDRA 1SI0A 3RN8A 3UGWA 5CMKA 1ZLQA 3CSGA 3E9XA 4MFIA 4BDNA 2PVUA 5H8FB 3FVNA 3RTFB 4YKPA 5TU0A 4G8MA 2H98A 1MS7A 3CG1A 4NF4B 5FHNA 2F7AA 3FGSA 4TQUQ 2LAOA 3EHUA 2YJPA 2E0SA 4X48A 2UYEA 2RF1A 2WOKA 1UTBA 4HS7A 4F2QA 1PB9A 1B0HA 4H5FA 2REGA 3H7MA 3R6UA 4ZE9A 1FTKA 2UVGA 3ONMA 5BWJA 1QVSA 5EYFA 2VD3A 5I59B 2UVJA 2O69A 2ZXTA 2F7BA 5FHMA 4R72A 3ILUB 3IB0A 1USYH 4F2OA 1MXUA 3RT8A 3G3IA 4GL0A 3EHTA 2VHAA 4F1UA 1NMUA 1ZJLA 2RC9A 4Q5TA 1FCKA 4IGRA 4P0IA 1O63A 3MP8A 3DRFA 2DWAA 2XXXA 3BKIB 5CMMA 1I69A 1OIBA 1XVXA 3QAXA 5DVIA 1LSTA 1AIVA 4GVOA 2ONSA 1B7ZA 4POXA 4ECFA 3K1MA 3KJTA 3KSXA 3FATA 2ZYKA 4IY6A 2QS3A 3PUWE 3I3VA 3DLNA 1D3KA 3SESA 2AL4A 3EF7A 4E0XA 1II5A 4KYDA 4RPOA 5I56A 4GF8A 4YKIA 1P1UA 2CMOA 1UTBB 4Q30B 2DWJA 4QFOA 5H8HB 1O64A 2ZYNA 3CFLA 4H8IA 1Y4TA 3S9NC 1LCFA 3PD8A 1EZPA 3VVDA 5AE4A 2I0CA 4UA8A 2NUVA 1S50A 4LP2B 5EHMA 1MXYA 1MPDA 5I57B 3O97A 2A5SA 1N3WA 4P0GA 1PDAA 3N5LA 3RYAA 3RNNA 1TFDA 3DELB 3FASA 4OVJA 3V8XB 2Z8FA 4IO5A 4FJPA 4YAHX 2HZLA 3S2VA 5AA4A 3QUJA 1URSA 4QSCA 2VD2A 1D4NA 3HPIA 3T9UA 3RYBA 3KZGA 1WDNA 2HEUA 2GH9A 1H44A 5AA2A 4KPTA 1HSLA 4RK9A 3KG2A 3TKDA 1QUIA 2DXRA 4U22A 4X1BA 3T9VA 4ONYA 2ABHA 3HN0A 1HSJA 3LSLA 4MBPA 4U1OA 3UA8A 5I56B 3IAZA 3CHGA 4IB2A 3TQLA 1VR5A 3FXQA 1MXZA 2YLNA 4HCYA 3RQTA 4F29A 2XXUA 4QFLA 1WODA 1SW1A 3O6PA 1QKBA 2W7YA 2GHBA 2AL5A 4LVQA 4NF5A 5TP9A 2DXYA 3CG3A 3IJXB 3BBRA 5CRYA 5DT6A 4RY1A 1ANFA 3K1NA 4JB7A 2O1MA 3L6GA 4ZEKA 2I6EA 3IO4A 3KN8A 3O6HA 1ATGA 2DQVA 3O6IA 3TCFA 3FIRA 1NNKA 3TAJA 1Z7NE 3OMBA 4Z7EA 5I58B 3G3FA 3VVFA 1JEVA 4PFYA 5EHSA 3IX1A 3VDFA 4F31B 1Y1ZA 3OD7A 1URDA 4HW8A 1B40A 5AA4B 4OZ9A 3N26A 4FORA 4GFRA 3IORA 3S4UA 4FE8A 1B0LA 4FECA 3K0VA 2XXTA 3AXFA 5A5XB 1FTJA 2F8DA 1N76A 4H0WA 4EXKA 1NH7A 3T66A 4MLVA 2RCAA 2V25A 2F35A 1Y20A 5DVFA 1MPCA 1SD3A 5H8QA 5TPAB 1KWHA 2D5WA 2PBWA 2ZMBA 4XKNA 2OBGA 1NNFA 2VOZA 1IXIA 3HV1A 1POTA 2Q2AA 3UORA 3LSFB 2H4IA 3H6TA 2PX1A 2F6PA 4O3CA 2QRYA 2O7UA 4OEUA 4TLMB 5HPQA 2UXAA 2RC8A 3U94A 2G93A 2I3VA 4LONB 3M8UA 4F19A 4RA1A 3SEYA 3B6TA 2DVZA 1P1NA 3FD3A 4FATA 3EHSA 4OESA 3C35A 1B3HA 3K1PA 3KN3A 3UIFA 5CMBA 4QSEA 4GIZA 1NKXA 3PPRA 1M5EA 1JW1A 2HCAA 1MM6A 1PB7A 1DPPA 1B58A 4GXAA 4OXVA 3G3JA 3V5AA 4UACA 5KDTB 2ANJA 5HM4B 1AMFA 2QSXA 4RK2A 4ESWA 2Z8EA 3H6UA 4U1ZA 3ODBA 3E4RA 4LZ7A 1LAGE 2H9BA 4PFUA 2Z23A 3CRBA 2QS1A 4XKRA 5ISUA 2V3QA 1Y3NA 3Q29A 4JBZA 2GRVA 3M3FA 5JK4A 4IGTA 3DP4A 1O7TA 2P0SA 3N6TA 4GXSB 3DM0A 3K2DA 2HFBA 1SDXA 1D9YA 3TMGA 3DP8A 3SEVA 4DXUA 3V83A 4Z0IA 3KN7A 1US4A 5H8NB 4BDQA 4LQ5A 4XIGQ 1B4HA 4GD5A 3I5OA 3H3GA 4N07A 1XS5A 5CC2A 1ZIUA 1H76A 1FQEA 4R75A 3O9PA 3G3GA 2E1SA 3EN3A 5B70A 3K6WA 4PFTA 4X1DA 2CZLA 3U72A 5I2KA 1RKMA 1B9JA 4Q8RA 2QMWA 4H5GA 4ELOA 4HCWA 3PPPA 3CFXA 1JVYA 4G68C 3Q25A 3TZAA 3USDA 4H65A 3O66A 3CSBA 3M3KA 1SW4A 3DRGA 5ICQA 5JTYA 3H03A 2DS9A 3QSLA 3CVGA 1Q35A 4OEVA 4FAJA 3B6WA 1L5TA 5KCJA 1NL5A 3GBAA 3K02A 3MQ9A 3DP6A 1MY0A 4XXUA 4ZEBA 4ZZAA 1A7LA 3W9WA 3MZ1A 5I2NA 3MVYA 1DOTA 1QJMA 2XX9A 1GTKA 4IO4A 2F5XA 2R6GE 4TOZA 3QYTA 1UIUA 2PYYA 3TDJA 2XXHA 2XXRA 2F7CA 1VSOA 3SERA 1S9TA 2P1SA 2PT1A 1YPNA 4F18A 2Z8DA 4NF6A 4P11A 4M1VA 4ISUA 4DE8A 1MRPA 4G2ZA 4I8CA 2DE3A 3DRKA 3T9HB 3M3LA 4ZEFA 2XHDA 1LBCA 3LVUA 4G4PA 1YAEA 4C1UA 4EF2A 5DEXA 4H6DA 3MBPA 1ELJA 3FVGA 2O1LA 3K6VA 4R2BA 1DTGA 3TTMA 4M4GA 4ZDMA 1BTJA 1DMBA 5JTYB 5M2VA 3MUQA 1UIVA 3C9HA 3SKPA 3MZBA 1IIWA 2IA4A 1QUJA 2HZKA 4IO6A 1PBPA 4OHNA 3RGYA 3G7WA 2XXQA 4THIA 1ZU0A 3U8QA 2QS2A 4RJZA 4I9DA 1XOCA 3TTNA 4PFWA 3A09A 2D21A 5CBRA 5DVJA 3JV9A 4RXLA 4YMAA 2OZZA 1CE2A 1NNPA 3PPNA 2QPQA 4FIMA 1B52A 4I62A 4E0WA 2V93A 3KOSA 2I48A 2Y84A 3PMXA 5CMCA 1LAFE 3OO6A 1MM7A 3RPWA 3VXCA 1EU8A 3GZGA 3IOVA 2VGQA 1JQFA 5JEIA 3FJ7A 2OK2A 4U4SA 5DTBA 4EF1A 4R73A 4OERA 1TWYA 3QXMA 3IJOB 5H8SA 3ZKKA 5FTHA 3MVXA 1B3LA 1MQJA 2OWTA 1EH3A 3P7IA 1SI1A 3OO8A 4YKJA 1UTHA 5K2XA 4R9GA 4F3BA 5IKBA 3EPEA 5FTIA 1JW4A 1QUKA 3OSQA 4G68A 4OWDA 1FTLA 4LA9A 3HHFA 4IY5A 3IOWA 3C33A 1B3FA 3Q27A 4ZS9A 1B4ZA 2WOLA 2OWSA 4BLAA 4ZEIA 2PT2A 1ZKBA 4KD5A 5L9OA 1YTVA 4DXBA 4ZZEA 5DYHA 1B3GA 2WOPA 3MPKA 3F11A 3W15C 3ILTB 3OENA 5AA2D 1MG1A 5ITPA 1Z7ME 2QS4A 3QIMA 2O7IA 2Y7RA 1JETA 2A5TA 1B6HA 1IUDA 3THIA 1IITA 3W9VA 2G29A 3TQWA 2FYIA 3EQ1A 1N7WA 2XD3A 2THIA 4N6PA 3TCGA 1N04A 1JNFA 3MWBA 4JWOA 4RPNA 2I0BA 4QF9A 4KFQA 5AA2B 3IL1B 3VXBA 3CR9A 1M5BA 3PUVE 2F34A 1MXWA 4Q0CA 3KBRA 2V3TA 5F1QA 1UTHB 4R9FA 4DZ1A 3PPOA 1US5A 3FXUA 4PE5B 3S9MC 2AYSA 1TFAA 2H5YA 1UQWA 3UN6A 5BUUA 1B5IA 3C4MA 3IB1A 4G68B 4WKMA 4ZE8A 1N0TA 5AA3A 2Z22A 2O68A 2HAUA 1XHYA 2XX8A 2PMSA 3PPQA 3Q26A 2QMXA 3LC8A 4R74A 3UP9A 4NF5B 1AOVA 5TP9B 5CBSA 1B7UA 3PUYE 3O28A 3PUXE 4EQBA 1SVXB 1H3DA 3CFZA 3OSRA 3IOTA 4JXIA 3K4UA 1Y1MA 3GLBA 2FNCA 4AB6A 4LZ5A 4ZEDA 3TTLA 1USYE 5FHOA 1SBPA 1JVXA 2X26A 5CI5A 4OFOA 4LUBA 3H06B 1GGGA 3IR1A 1MQGA 1VE4A 1B7HA 3OEMA 3KSJA 2B3FA 3FTOA 2XXPA 1Y9UA 2NOOA 1B3EA 1QW0A 1FTMA 1RYOA 4EDPA 4OTEA 3DRHA 3TUSA 3TPAA 3K6UA 3BFUA 2ESNA 4QFPA 1B32A 4PETA 3VVEA 3OEKA 1P1OA 1WVJA 4OETA 3L6HA 1J1NA 3HSTA 4NEDA 5B7DA 3H6WA 4IO7A 3H4ZA 3MVZA 2XD2A 5H8QB 4MH5A 4GQOA 3HO7A 2ZYOA 4H1XA 1LAXA 1XC1A 3PD9A 4LZ8A 4LQ2A 4WXJA 3VFJA 4JSDA 5H8FA 2KLFA 4NF4A 3MZ9A 1URGA 4IO2A 4RYAA 3UK4A 3FJMA 1BLFA 4O3BA 3GBBA 1LFHA 2F6GA 2B65A 4WEDA 4OFLA 1B1XA 4YZZA 3PMWA 3SEUA 2Q8JA 2P2AA 1N3XA 2ONKE 1NH8A 2DSFA 2OLBA 1A40A 1GR2A 1PB8A 3OOAA 2DE4A 4F3GA 3Q28A 5F7VA 4G77A 3LR1A 1OQHA 1ZMGA 3PV0E 4KYSA 3KFMA 3C31A 3MC2A 3E3KA 4OMBA 4O3AA 2XXWA 4FEBA 1OQGA 4NWDA 5L9SA 1VFDA 5J1DA 3N94A 3IB2A 1MH3A 1FQDA 5ICTA 4NTLA 4N13A 3LBSA 1LB9A 1A54A 1XT8A 4G8NA 3MP6A 3LSXA 2M8CA 3TEPA 3T93B 4JWYA 2HQ0A 3S9EA 4XKPA 3HHGA 3R7XA 4EQ7A 4NWCA 2WKYA 4L17A 3A3UA 3TTRA 2HAVA 2F36A 3MAMA 3OELA 3TFLA 4YU0A 4F3SA 3TODA 2ZNSA 4X9TA 4GOTA 1DPEA 1ZBMA 4C0RA 3PMVA 1QULA 1PBQA 2UVHA 3K6XA 4ELPA 1MDQA 1EZOA 2OJTA 5K2YA 2DWIA 3QK6A 5H8HA 4NF8A 4F1VA 5IAIA 1PC3A 2XXVA 3SEXA 1A99A 1M5CA 4R6YA 3O29A 2ZNTA 3SDFA
chains in the Genus database with same CATH superfamily
3OO9A 1A8EA 2O6AA 2B3BA 4H8JA 2I4BA 3B7DA 3MPLA 2Q2CA 2X7PA 1AH5A 2Y5KA 5I57A 1QKAA 1R9QA 1MY4A 3IO6A 2HXRA 4QRZA 4YMBA 1B5HA 3IFAA 4MLQA 5I2KB 4K3FA 1FQAA 1D9VA 1FPFA 1FBCA 5ITOA 4AB5A 2FVZA 1MQDA 4I40A 1EZ9A 2Q88A 4MJOA 4QSDA 1Y4CA 4FBPA 4KHZE 4YB5A 3LUYA 2RKMA 1MDP1 1B1HA 4X8RA 1IEJA 4GRKA 3MW0A 1MXVA 5EQ7A 1R6ZA 3FV2A 4YKKA 3WAEA 5KZTA 1LFIA 2X7QA 1HSEA 1SW2A 1I6BA 4NE4A 5KCJB 4QXDA 4POWA 4GWXA 2DOJA 4FEDA 2Q9TA 3D4GA 3B6QA 2R71A 3ZSFA 2Q89A 2UYFA 2O84X 4JSOA 4BDLA 5I2NB 4U4XA 4DDDA 1OMPA 1IXHA 3V89B 4DLDA 2BJJX 1B51A 1GVCA 3R26A 4NF8B 3RT6B 4IO3A 3KJ7A 2GFEA 4ELRA 4PQJA 1SW5A 1DTZA 4ZECA 4BDMA 3JYRA 2H99A 4NGUA 2I3WA 4NG7A 3U65A 2REJA 4XTCQ 5LOMA 3KGCA 4DIGA 5I84A 1FW0A 4NF6B 1LBYA 4OENA 4DCXA 1B46A 4PC9A 1M5FA 2B4MA 5EQAA 1ZTYA 3PGFA 4F22A 2DVCA 3WAFA 5IM2A 5DEXB 2Y7PA 2RCBA 2Q8MA 5I58A 4JDFA 2NWJA 5HBCA 3C32A 1BIYA 4GX3A 5AA1A 3TCHA 1YCJA 1MPBA 4I3EA 1T0KA 1Y3PA 1B5JA 1H43A 2GQ1A 4C1TA 1OVTA 1IQ7A 1Q9DA 5A5XA 1OLCA 1MY3A 2XXYA 4GL8A 3D4CA 3MP1A 1B05A 1FTOA 3T96B 1TXFA 1LBZA 1FQCA 2V84A 4QHQA 2XA5A 3VLVA 3S9LC 3OXNA 5TPAA 3B50A 4H67A 2I58A 3I6VA 4HE0A 4IR8A 3E78A 2V4CA 3QUFA 1DSNA 1FQBA 1MY2A 4ELQA 4OFJA 1NV5A 5ELVA 1YYZA 2H25A 4KYEA 1OLAA 2V3UA 4QBAA 4QFNA 1NV7A 4U21A 3FUZA 2VP1A 1MY1A 4PAIA 4F3PA 4KCCA 2RC7A 3H6VA 3TTKA 1FTAA 3GXAA 3IFCA 3FVKA 2QJEA 3SETA 2DYXA 2QL3A 4EXLA 2FIXA 5L9MA 2Q74A 2ZNUA 1PEBA 3PUZE 3BFTA 1KZ8A 1TT1A 3IOUA 2B4LA 1LLSA 2DE2A 4N6KA 1LB8A 4MF3A 1K9ZA 3T9XB 4NAPA 4RNSA 1S7YA 3PAMA 3IK6B 3VV5A 1AL3A 2CEYA 1MQIA 2XWOA 4F39A 4MNPA 1Q1KA 1BP5A 1B2HA 4KR5A 3FZVA 1MQHA 4PP0A 2XX7A 1MH4A 3FBPA 2DP8A 1LBBA 3G3HA 3U1OA 5KDTA 4XKQA 3LSWA 3KOTA 1NV4A 1XVYA 2HXWA 4GWOA 3T22A 3K01A 4YB7A 2NXOA 3T1BA 3ZKLA 3CI8A 1R1NA 1N84A 1IXGA 1POY1 4PF6A 2OWZA 4N4UA 2F97A 4R6KA 1SQYA 1P99A 4H46A 3C36A 2IEEA 4R2FA 1P1QA 2DWHA 1NNTA 2ZZVA 3ZS6A 2Y7WA 2GHAA 4LATA 1QGXA 4F1YA 3OO7A 4HTGA 3KEIA 5IGAA 1LAHE 3VLWA 1LCTA 3FXRA 2D3IA 2UVIA 3PU5A 1GV8A 2CZHA 2A5TB 1FQFA 2Y7IA 2RINA 2R9JA 1IMBA 4PGPA 1A8FA 1MXXA 4OA4A 2ZYMA 1SYHA 1BKAA 4GLIA 4KQPA 4LN5A 5H8NA 3K00A 3HCQA 4AQ4A 5CM6A 3N6UA 4EUOA 3MVWA 3C34A 3FVOA 3DRJA 3DRIA 2Y7KA 1FPLA 1EYIA 2ONRA 1I6AA 4DXCA 3VLUA 3TYHA 3A3CA 1H45A 1N7XA 2F78A 4AS4A 1JEUA 4OQOA 4R6HA 1Y3QA 1A55A 3VE1B 3O6GA 3RUMA 1IXCA 1I6QA 2ALUA 3ECRA 3FV1A 4WEPA 2XXIA 3U93A 3MJNA 4OYVA 4ESXA 4MNCA 4P47A 1OVBA 4G8HA 2FA7A 5ET5A 1P1WA 1CB6A 3QMFA 4I1DA 2WBBA 3RTWB 1BK4A 4PCDA 1NFTA 1JW5A 2NVUB 2I49A 5L8DA 1LFGA 1FJ9A 1LGBC 3O2AA 2I4CA 4YB6A 2O51A 3SEWA 1M5DA 4DCYA 3CIJA 1VFEA 2AIXA 1LEVA 3U92A 2OCUA 1SYIA 1R9LA 4KI0E 1RYXA 5I59A 4KCDA 4U2RA 2YPNA 3TELA 4NMYA 1IZ1A 4HE2A 3RLFE 2JJKA 4BDOA 3FJGA 3G3KA 3E13X 4EQ9A 2WYPA 2CEXA 4X04A 5LDZA 3RY3A 4MMPA 4ND9A 5I5PA 4QFKA 4JWXA 1F9BA 4YICA 4U23A 4PF8A 4O94A 4TLLB 3JZJA 4BDRA 1SI0A 3RN8A 3UGWA 5CMKA 1ZLQA 3CSGA 2FIEA 3E9XA 4MFIA 4BDNA 2PVUA 4OVRA 5H8FB 3FVNA 1NUZA 3RTFB 4YKPA 5TU0A 4G8MA 2H98A 1MS7A 3CG1A 4NF4B 5FHNA 1EYKA 2F7AA 3FGSA 4TQUQ 2LAOA 3EHUA 2YJPA 2E0SA 4X48A 2UYEA 2RF1A 4H45A 2WOKA 1UTBA 4HS7A 5J16A 4O7MA 4F2QA 1PB9A 1B0HA 4H5FA 2REGA 3H7MA 3R6UA 4ZE9A 1FTKA 2UVGA 1NUWA 4XF5A 3ONMA 5BWJA 1QVSA 4DI3D 5EYFA 2VD3A 2XWVA 5I59B 2UVJA 2O69A 2ZXTA 2F7BA 3KC0A 5FHMA 4R72A 3ILUB 3IB0A 1USYH 4F2OA 1MXUA 3RT8A 3G3IA 4GL0A 4MAGA 3EHTA 2VHAA 4F1UA 1NMUA 1ZJLA 2RC9A 4Q5TA 4P9KA 1FCKA 4IGRA 4P0IA 1O63A 1RDYA 3MP8A 2XXKA 3DRFA 2DWAA 3T0JA 1NI9A 4N91A 2XXXA 3BKIB 5CMMA 1FPGA 1I69A 1OIBA 1XVXA 3QAXA 5DVIA 1LSTA 1AIVA 4GVOA 2ONSA 1B7ZA 4POXA 4ECFA 3K1MA 3KJTA 3KSXA 3FATA 2QVVA 2ZYKA 4IY6A 4XFEA 2QS3A 3PUWE 3I3VA 3DLNA 4MHFA 1D3KA 4NHBA 1KA0A 2AL4A 3SESA 3EF7A 4E0XA 1II5A 4KYDA 4RPOA 5I56A 4GF8A 4YKIA 1P1UA 2CMOA 1UTBB 4Q30B 2DWJA 4QFOA 1NV2A 1K9YA 5H8HB 1O64A 2ZYNA 3CFLA 4H8IA 1Y4TA 3S9NC 1LCFA 1AWBA 3PD8A 1EZPA 3VVDA 5AE4A 2I0CA 4UA8A 2NUVA 1S50A 4LP2B 5EHMA 1MXYA 1MPDA 5I57B 4GX4A 4NX1A 3O97A 2A5SA 5ET7A 1N3WA 4P0GA 1PDAA 3N5LA 3RYAA 3RNNA 1TFDA 3DELB 3FASA 4OVJA 3V8XB 2Z8FA 4IO5A 4FJPA 4YAHX 3NOHA 2HZLA 3S2VA 5AA4A 3QUJA 5ET6A 1URSA 4PDDA 4QSCA 2VD2A 1D4NA 3HPIA 3T9UA 3RYBA 3KZGA 1WDNA 2HEUA 1G0HA 2GH9A 1H44A 4PFIA 5AA2A 4KPTA 1HSLA 4RK9A 2VPOA 3KG2A 3TKDA 4N15A 1QUIA 2DXRA 4U22A 4X1BA 3T9VA 4ONYA 2ABHA 3HN0A 1HSJA 3LSLA 4MBPA 4U1OA 3UA8A 5I56B 3IAZA 3CHGA 4IB2A 3TQLA 1VR5A 2F3BA 3FXQA 1MXZA 2YLNA 1FBPA 4HCYA 1VDWA 3RQTA 4F29A 2XXUA 4QFLA 1WODA 1SW1A 3O6PA 1QKBA 2W7YA 2GHBA 2AL5A 4MEVA 4LVQA 4NF5A 5TP9A 2DXYA 3CG3A 3IJXB 3BBRA 5CRYA 5DT6A 4RY1A 1ANFA 5T3JA 3K1NA 4JB7A 2O1MA 3L6GA 4ZEKA 2I6EA 3IO4A 4HE1A 3KN8A 3O6HA 1ATGA 2DQVA 3O6IA 3TCFA 3FIRA 2FHYA 1NNKA 3TAJA 1Z7NE 3OMBA 4Z7EA 5I58B 4PAKA 3G3FA 3VVFA 1JEVA 4PFYA 5EHSA 3IX1A 3VDFA 4GWYA 4F31B 1Y1ZA 3OD7A 1URDA 4HW8A 1B40A 1FBHA 5AA4B 4OZ9A 3N26A 3SZPA 4FORA 4GFRA 3IORA 3S4UA 4FE8A 1B0LA 4FECA 3K0VA 2XXTA 3AXFA 5A5XB 1FTJA 2F8DA 1N76A 4H0WA 4EXKA 1NH7A 4P1EA 3T66A 4MLVA 3ROJA 3RPLA 1FBGA 2RCAA 2V25A 2F35A 1Y20A 5DVFA 1MPCA 1SD3A 5H8QA 5TPAB 1KWHA 4AS5A 2D5WA 2PBWA 2HPGA 2ZMBA 4XKNA 4PBQA 2OBGA 1NNFA 2VOZA 1IXIA 3HV1A 1POTA 2Q2AA 3UORA 3LSFB 2ZZWA 2H4IA 3H6TA 2PX1A 2FBPA 2F6PA 4O3CA 2QRYA 2O7UA 4OEUA 4TLMB 5HPQA 2UXAA 2RC8A 3U94A 2BJIA 2G93A 2I3VA 4LONB 3M8UA 4F19A 4RA1A 3SEYA 3B6TA 1DBZA 2DVZA 2CZIA 1P1NA 3FD3A 4FATA 3EHSA 4OESA 1IMAA 5IZ1A 2VPNA 3C35A 4PE3A 4N6DA 1B3HA 3K1PA 3KN3A 3UIFA 5CMBA 4QSEA 4GIZA 1NKXA 3PPRA 1M5EA 1JW1A 2HCAA 4PBHA 3BIGA 1MM6A 1PB7A 1DPPA 1FPIA 1B58A 4GXAA 4OXVA 3G3JA 1CNQA 3V5AA 4UACA 5KDTB 2ANJA 2KR0A 3BIHA 5HM4B 1AMFA 2QSXA 4RK2A 4ESWA 2Z8EA 3H6UA 5EYHA 4U1ZA 3ODBA 3E4RA 3EKIA 1RDXA 1LBVA 4LZ7A 1LAGE 2H9BA 4PFUA 1NV0A 4N81A 2Z23A 3CRBA 2QS1A 4XKRA 5ISUA 2V3QA 1Y3NA 3Q29A 4JBZA 2GRVA 3M3FA 5JK4A 4IGTA 4P1LA 3DP4A 1O7TA 2P0SA 3N6TA 4GXSB 3DM0A 1NUXA 3K2DA 3D1RA 3A29A 1DCUA 2HFBA 1SDXA 1D9YA 3PTYA 3TMGA 3DP8A 3SEVA 5F24A 4DXUA 3V83A 4Z0IA 2QVUA 3KN7A 1US4A 5H8NB 2WYKA 4BDQA 4LQ5A 3E79A 4XIGQ 1B4HA 4GD5A 3I5OA 3H3GA 4N07A 1XS5A 1JP4A 3LV0A 5CC2A 1ZIUA 1IMEA 1H76A 1FQEA 4R75A 3O9PA 3G3GA 2E1SA 3EN3A 5B70A 3K6WA 4PFTA 4X1DA 2CZLA 3U72A 5I2KA 1RKMA 1B9JA 2P3VA 4Q8RA 2QMWA 4H5GA 4ELOA 4HCWA 3RYDA 3PPPA 3CFXA 1JVYA 4G68C 3Q25A 3TZAA 3USDA 1G0IA 4H65A 2QFLA 3O66A 3CSBA 3M3KA 1SW4A 3DRGA 5ICQA 5JTYA 3H03A 2DS9A 2WEFA 3QSLA 4JVDA 3CVGA 1Q35A 2OX3A 4OEVA 4FAJA 3B6WA 1L5TA 5KCJA 1FPBA 1NL5A 4OVTA 3GBAA 4I3YA 3K02A 3MQ9A 3DP6A 1MY0A 4XXUA 4ZEBA 4GWWA 4ZZAA 1A7LA 3W9WA 3MZ1A 5I2NA 3MVYA 1DOTA 1QJMA 2XX9A 1GTKA 4IO4A 2F5XA 2R6GE 4P3LA 4P8BA 5ET8A 4TOZA 3QYTA 1UIUA 2PYYA 3TDJA 2XXHA 1FRPA 2XXRA 2F7CA 1VSOA 3SERA 1S9TA 2CZKA 2P1SA 4JVIA 2PT1A 1YPNA 4F18A 2Z8DA 4NF6A 4UABA 4P11A 4M1VA 4ISUA 4DE8A 1MRPA 4G2ZA 4I8CA 2DE3A 3DRKA 2P3NA 3T9HB 3M3LA 5EQ8A 4ZEFA 2XHDA 1LBCA 3LVUA 4G4PA 1YAEA 4C1UA 4EF2A 5DEXA 4H6DA 3MBPA 1ELJA 4GBVA 3KBZA 3FVGA 2MKZA 2O1LA 3K6VA 4R2BA 1DTGA 3TTMA 4M4GA 4ZDMA 1BTJA 1DMBA 5JTYB 5M2VA 3MUQA 1UIVA 3C9HA 3SKPA 3MZBA 1IIWA 2IA4A 1QUJA 2HZKA 4IO6A 1PBPA 4OHNA 3RGYA 3G7WA 2XXQA 3KC1A 1ZU0A 4THIA 3U8QA 2QS2A 4RJZA 4I9DA 1XOCA 3TTNA 4PFWA 3MYUA 3A09A 2D21A 5CBRA 5DVJA 3JV9A 4KXPA 4RXLA 4YMAA 2OZZA 1CE2A 1NNPA 3PPNA 5IZ3A 2PCRA 2QPQA 2Y5LA 2WX9A 4PDHA 4FIMA 1B52A 4I62A 4E0WA 2V93A 3KOSA 1FBFA 2I48A 2Y84A 3PMXA 5CMCA 1LAFE 3OO6A 1MM7A 3RPWA 3VXCA 1EU8A 3GZGA 3IOVA 2VGQA 1JQFA 5JEIA 3FJ7A 2OK2A 4U4SA 5DTBA 4EF1A 4OVSA 4R73A 4OERA 1TWYA 3QXMA 3IJOB 5H8SA 3ZKKA 5FTHA 3MVXA 1B3LA 1MQJA 2OWTA 1EH3A 1FJ6A 3P7IA 1SI1A 3OO8A 4YKJA 1UTHA 4MNIA 5K2XA 4R9GA 4F3BA 5IKBA 3EPEA 4O8MA 2VT5A 5FTIA 1IMDA 1JW4A 1QUKA 3OSQA 4G68A 5FBPA 4OWDA 1FTLA 4LA9A 3HHFA 4IY5A 3IOWA 4OVPA 3C33A 1B3FA 3Q27A 4ZS9A 1FPDA 1B4ZA 2WOLA 3GYYA 2OWSA 4BLAA 4ZEIA 2PT2A 1ZKBA 4KD5A 4NF0A 5IZ3B 5L9OA 1YTVA 4DXBA 4ZZEA 1FPEA 5DYHA 4DI4B 1B3GA 1NV3A 5EQ9A 2WOPA 3MPKA 3F11A 3W15C 3ILTB 3OENA 5EYGA 1YXIA 5AA2D 4MX6A 4PFBA 1MG1A 5ITPA 1Z7ME 2QS4A 4PAFA 3QIMA 1INPA 2O7IA 2Y7RA 1JETA 2PFZA 2A5TA 1B6HA 1IUDA 1YZ0A 3THIA 1IITA 4NQ8A 3W9VA 2G29A 3TQWA 2FYIA 3EQ1A 1N7WA 4XEQA 2XD3A 2THIA 4N6PA 3TCGA 1N04A 1JNFA 3MWBA 4JWOA 4MCOA 4RPNA 2I0BA 4QF9A 4KFQA 5AA2B 3IL1B 3VXBA 3CR9A 1M5BA 3PUVE 2F34A 2HHMA 5LTCA 1MXWA 4Q0CA 3KBRA 2V3TA 5F1QA 1UTHB 4R9FA 4DZ1A 3PPOA 1US5A 3FXUA 4PE5B 3S9MC 2AYSA 1TFAA 5A5LA 2H5YA 1UQWA 3UN6A 4OANA 5BUUA 4N17A 1B5IA 3C4MA 3IB1A 4G68B 4WKMA 4ZE8A 1N0TA 5AA3A 2Z22A 2O68A 2HAUA 1XHYA 2XX8A 2PMSA 3PPQA 1EYJA 3Q26A 1NUYA 2QMXA 3LC8A 4R74A 3UP9A 4NF5B 1AOVA 5TP9B 4PGNA 5CBSA 2XWKA 1B7UA 3PUYE 3O28A 3PUXE 4EQBA 1SVXB 1H3DA 3CFZA 3OSRA 3IOTA 4JXIA 1XI6A 3K4UA 1Y1MA 3GLBA 2FNCA 4AB6A 4LZ5A 4ZEDA 1USYE 3TTLA 5FHOA 1SBPA 1JVXA 2X26A 5CI5A 4OFOA 4LUBA 3H06B 1GGGA 3IR1A 1FSAA 1MQGA 1VE4A 1B7HA 3OEMA 3KSJA 2B3FA 3FTOA 2XXPA 1Y9UA 2ZZXA 2NOOA 1B3EA 1QW0A 3ISPA 1FTMA 2PFYA 1SPIA 1RYOA 3MSTA 4EDPA 4OTEA 1D9QA 4N8GA 4P56A 3DRHA 3TUSA 2L5VA 1FBEA 2F3DA 3TPAA 4GX6A 3K6UA 3BFUA 2ESNA 4QFPA 1B32A 4PETA 3VVEA 3OEKA 1FPKA 1P1OA 3RPLB 2R8TA 1WVJA 4GWZA 4OETA 3L6HA 1J1NA 3HSTA 4NEDA 5B7DA 3H6WA 4IO7A 3H4ZA 3MVZA 3B8BA 1LBXA 2XD2A 5H8QB 4MH5A 4GQOA 3HO7A 1LBWA 2ZYOA 4H1XA 1LAXA 1XC1A 3PD9A 4LZ8A 4GWSA 4NN3A 4LQ2A 4WXJA 3VFJA 4JSDA 5H8FA 2KLFA 4NF4A 3MZ9A 2XWIA 1URGA 1FPJA 4HXVA 4IO2A 4MIJA 4G61A 1IMFA 2KQZA 4RYAA 3UK4A 3FJMA 1BLFA 4O3BA 5DW8A 4PTKA 2DDKA 3GBBA 1LFHA 2F6GA 2B65A 4WEDA 4OFLA 1B1XA 4YZZA 3PMWA 3SEUA 2Q8JA 2P2AA 1N3XA 2ONKE 1NH8A 2DSFA 2OLBA 1A40A 1GR2A 1PB8A 3OOAA 2DE4A 4F3GA 4N8YA 3Q28A 5F7VA 1NV1A 4G77A 3LR1A 1OQHA 1ZMGA 4GBWA 2QVRA 3PV0E 4KYSA 3KFMA 3C31A 3MC2A 3E3KA 4OMBA 3LUZA 4O3AA 2XXWA 4FEBA 1OQGA 4NWDA 5L9SA 1VFDA 5J1DA 1RDZA 3N94A 4JVCA 3IB2A 1MH3A 1KA1A 1FQDA 3HFUA 5ICTA 1DK4A 4NTLA 4N13A 3LBSA 1LB9A 1A54A 1XT8A 4G8NA 3MP6A 3LSXA 2M8CA 3TEPA 4OVQA 3T93B 4JWYA 2HQ0A 3S9EA 4XKPA 3HHGA 1FBDA 3R7XA 5ESYA 4EQ7A 4NWCA 2WKYA 4L17A 3A3UA 4GWUA 2HAVA 3TTRA 2F36A 3MAMA 3OELA 3TFLA 4YU0A 4F3SA 5I7IA 1NV6A 3TODA 2ZNSA 4X9TA 2WBDA 4GOTA 1IMCA 1DPEA 1ZBMA 4C0RA 3PMVA 1QULA 1PBQA 2UVHA 3K6XA 4ELPA 4O7IA 3FXBA 5IZZA 1MDQA 1EZOA 4PFRA 2OJTA 5K2YA 2DWIA 3QK6A 5H8HA 4NF8A 4F1VA 5IAIA 1PC3A 5I3SA 2XXVA 3SEXA 1A99A 1M5CA 4R6YA 3O29A 2ZNTA 3SDFA
chains in the Genus database with same CATH topology
3OO9A 1A8EA 2O6AA 2B3BA 4H8JA 2I4BA 3B7DA 3MPLA 2Q2CA 2X7PA 1AH5A 5I57A 1QKAA 1R9QA 1MY4A 3IO6A 4QRZA 4YMBA 1B5HA 4MLQA 5I2KB 4K3FA 1FQAA 1D9VA 5ITOA 4AB5A 1MQDA 1EZ9A 2Q88A 4QSDA 1Y4CA 4KHZE 4YB5A 3LUYA 2RKMA 1MDP1 1B1HA 1IEJA 4GRKA 3MW0A 1MXVA 1R6ZA 3FV2A 4YKKA 3WAEA 5KZTA 1LFIA 2X7QA 1HSEA 1SW2A 1I6BA 4NE4A 5KCJB 4POWA 2DOJA 4FEDA 2Q9TA 3D4GA 3B6QA 2R71A 3ZSFA 2Q89A 2UYFA 2O84X 4JSOA 4BDLA 5I2NB 4U4XA 4DDDA 1OMPA 1IXHA 3V89B 4DLDA 2BJJX 1B51A 1GVCA 3R26A 4NF8B 3RT6B 4IO3A 3KJ7A 2GFEA 4ELRA 4PQJA 1SW5A 1DTZA 4ZECA 4BDMA 3JYRA 2H99A 2I3WA 2REJA 4XTCQ 5LOMA 3KGCA 4DIGA 5I84A 1FW0A 4NF6B 4OENA 4DCXA 1B46A 1M5FA 2B4MA 1ZTYA 3PGFA 4F22A 2DVCA 3WAFA 5DEXB 2Y7PA 2RCBA 5I58A 4JDFA 2NWJA 5HBCA 3C32A 1BIYA 5AA1A 3TCHA 1YCJA 1MPBA 1T0KA 1Y3PA 1B5JA 1H43A 4C1TA 1OVTA 1IQ7A 5A5XA 1OLCA 1MY3A 2XXYA 4GL8A 3D4CA 3MP1A 1B05A 1FTOA 3T96B 1TXFA 1FQCA 2V84A 4QHQA 3VLVA 3S9LC 3OXNA 5TPAA 4H67A 2I58A 3I6VA 3QUFA 1DSNA 1FQBA 1MY2A 4ELQA 4OFJA 5ELVA 2H25A 4KYEA 1OLAA 2V3UA 4QFNA 4U21A 3FUZA 2VP1A 1MY1A 4F3PA 4KCCA 2RC7A 3H6VA 3TTKA 3GXAA 3FVKA 2QJEA 3SETA 2DYXA 2QL3A 4EXLA 5L9MA 2ZNUA 1PEBA 3PUZE 3BFTA 3IOUA 1TT1A 2B4LA 1LLSA 2DE2A 1LB8A 4MF3A 3T9XB 4RNSA 1S7YA 3PAMA 3IK6B 3VV5A 1AL3A 1MQIA 4F39A 1Q1KA 1BP5A 1B2HA 4KR5A 3FZVA 1MQHA 4PP0A 2XX7A 1MH4A 2DP8A 1LBBA 3G3HA 3U1OA 5KDTA 4XKQA 3LSWA 3KOTA 1XVYA 2HXWA 4GWOA 3T22A 3K01A 4YB7A 2NXOA 3ZKLA 3CI8A 1R1NA 1N84A 1IXGA 1POY1 2F97A 4R6KA 1SQYA 1P99A 3C36A 2IEEA 4R2FA 1P1QA 2DWHA 1NNTA 3ZS6A 2Y7WA 2GHAA 4LATA 4F1YA 3OO7A 4HTGA 3KEIA 1LAHE 3VLWA 1LCTA 3FXRA 2D3IA 2UVIA 3PU5A 1GV8A 2A5TB 1FQFA 2Y7IA 2RINA 2R9JA 1A8FA 1MXXA 2ZYMA 1SYHA 1BKAA 4GLIA 4KQPA 5H8NA 3K00A 3HCQA 4AQ4A 5CM6A 3N6UA 4EUOA 3MVWA 3C34A 3FVOA 3DRJA 3DRIA 2Y7KA 2ONRA 1I6AA 4DXCA 3VLUA 3TYHA 3A3CA 1H45A 1N7XA 2F78A 1JEUA 4OQOA 4R6HA 1Y3QA 1A55A 3VE1B 3O6GA 3RUMA 1IXCA 1I6QA 2ALUA 3ECRA 3FV1A 4WEPA 2XXIA 3U93A 3MJNA 4OYVA 4ESXA 1OVBA 4G8HA 2FA7A 1P1WA 1CB6A 4I1DA 3RTWB 1NFTA 1JW5A 2NVUB 2I49A 5L8DA 1LFGA 1LGBC 3O2AA 2I4CA 4YB6A 2O51A 3SEWA 1M5DA 4DCYA 3CIJA 1VFEA 2AIXA 3U92A 2OCUA 1SYIA 1R9LA 4KI0E 1RYXA 5I59A 4KCDA 4U2RA 2YPNA 3TELA 4NMYA 1IZ1A 3RLFE 4BDOA 3FJGA 3G3KA 3E13X 4EQ9A 3RY3A 4ND9A 4QFKA 4JWXA 1F9BA 4YICA 4U23A 4TLLB 3JZJA 4BDRA 1SI0A 3RN8A 3UGWA 5CMKA 1ZLQA 3CSGA 3E9XA 4MFIA 4BDNA 2PVUA 5H8FB 3FVNA 3RTFB 4YKPA 5TU0A 4G8MA 2H98A 1MS7A 3CG1A 4NF4B 5FHNA 2F7AA 3FGSA 4TQUQ 2LAOA 3EHUA 2YJPA 2E0SA 4X48A 2UYEA 2RF1A 2WOKA 1UTBA 4HS7A 4F2QA 1PB9A 1B0HA 4H5FA 2REGA 3H7MA 3R6UA 4ZE9A 1FTKA 2UVGA 3ONMA 5BWJA 1QVSA 5EYFA 2VD3A 5I59B 2UVJA 2O69A 2ZXTA 2F7BA 5FHMA 4R72A 3ILUB 3IB0A 1USYH 4F2OA 1MXUA 3RT8A 3G3IA 4GL0A 3EHTA 2VHAA 4F1UA 1NMUA 1ZJLA 2RC9A 4Q5TA 1FCKA 4IGRA 4P0IA 1O63A 3MP8A 3DRFA 2DWAA 2XXXA 3BKIB 5CMMA 1I69A 1OIBA 1XVXA 3QAXA 5DVIA 1LSTA 1AIVA 4GVOA 2ONSA 1B7ZA 4POXA 4ECFA 3K1MA 3KJTA 3KSXA 3FATA 2ZYKA 4IY6A 2QS3A 3PUWE 3I3VA 3DLNA 1D3KA 3SESA 2AL4A 3EF7A 4E0XA 1II5A 4KYDA 4RPOA 5I56A 4GF8A 4YKIA 1P1UA 2CMOA 1UTBB 4Q30B 2DWJA 4QFOA 5H8HB 1O64A 2ZYNA 3CFLA 4H8IA 1Y4TA 3S9NC 1LCFA 3PD8A 1EZPA 3VVDA 5AE4A 2I0CA 4UA8A 2NUVA 1S50A 4LP2B 5EHMA 1MXYA 1MPDA 5I57B 3O97A 2A5SA 1N3WA 4P0GA 1PDAA 3N5LA 3RYAA 3RNNA 1TFDA 3DELB 3FASA 4OVJA 3V8XB 2Z8FA 4IO5A 4FJPA 4YAHX 2HZLA 3S2VA 5AA4A 3QUJA 1URSA 4QSCA 2VD2A 1D4NA 3HPIA 3T9UA 3RYBA 3KZGA 1WDNA 2HEUA 2GH9A 1H44A 5AA2A 4KPTA 1HSLA 4RK9A 3KG2A 3TKDA 1QUIA 2DXRA 4U22A 4X1BA 3T9VA 4ONYA 2ABHA 3HN0A 1HSJA 3LSLA 4MBPA 4U1OA 3UA8A 5I56B 3IAZA 3CHGA 4IB2A 3TQLA 1VR5A 3FXQA 1MXZA 2YLNA 4HCYA 3RQTA 4F29A 2XXUA 4QFLA 1WODA 1SW1A 3O6PA 1QKBA 2W7YA 2GHBA 2AL5A 4LVQA 4NF5A 5TP9A 2DXYA 3CG3A 3IJXB 3BBRA 5CRYA 5DT6A 4RY1A 1ANFA 3K1NA 4JB7A 2O1MA 3L6GA 4ZEKA 2I6EA 3IO4A 3KN8A 3O6HA 1ATGA 2DQVA 3O6IA 3TCFA 3FIRA 1NNKA 3TAJA 1Z7NE 3OMBA 4Z7EA 5I58B 3G3FA 3VVFA 1JEVA 4PFYA 5EHSA 3IX1A 3VDFA 4F31B 1Y1ZA 3OD7A 1URDA 4HW8A 1B40A 5AA4B 4OZ9A 3N26A 4FORA 4GFRA 3IORA 3S4UA 4FE8A 1B0LA 4FECA 3K0VA 2XXTA 3AXFA 5A5XB 1FTJA 2F8DA 1N76A 4H0WA 4EXKA 1NH7A 3T66A 4MLVA 2RCAA 2V25A 2F35A 1Y20A 5DVFA 1MPCA 1SD3A 5H8QA 5TPAB 1KWHA 2D5WA 2PBWA 2ZMBA 4XKNA 2OBGA 1NNFA 2VOZA 1IXIA 3HV1A 1POTA 2Q2AA 3UORA 3LSFB 2H4IA 3H6TA 2PX1A 2F6PA 4O3CA 2QRYA 2O7UA 4OEUA 4TLMB 5HPQA 2UXAA 2RC8A 3U94A 2G93A 2I3VA 4LONB 3M8UA 4F19A 4RA1A 3SEYA 3B6TA 2DVZA 1P1NA 3FD3A 4FATA 3EHSA 4OESA 3C35A 1B3HA 3K1PA 3KN3A 3UIFA 5CMBA 4QSEA 4GIZA 1NKXA 3PPRA 1M5EA 1JW1A 2HCAA 1MM6A 1PB7A 1DPPA 1B58A 4GXAA 4OXVA 3G3JA 3V5AA 4UACA 5KDTB 2ANJA 5HM4B 1AMFA 2QSXA 4RK2A 4ESWA 2Z8EA 3H6UA 4U1ZA 3ODBA 3E4RA 4LZ7A 1LAGE 2H9BA 4PFUA 2Z23A 3CRBA 2QS1A 4XKRA 5ISUA 2V3QA 1Y3NA 3Q29A 4JBZA 2GRVA 3M3FA 5JK4A 4IGTA 3DP4A 1O7TA 2P0SA 3N6TA 4GXSB 3DM0A 3K2DA 2HFBA 1SDXA 1D9YA 3TMGA 3DP8A 3SEVA 4DXUA 3V83A 4Z0IA 3KN7A 1US4A 5H8NB 4BDQA 4LQ5A 4XIGQ 1B4HA 4GD5A 3I5OA 3H3GA 4N07A 1XS5A 5CC2A 1ZIUA 1H76A 1FQEA 4R75A 3O9PA 3G3GA 2E1SA 3EN3A 5B70A 3K6WA 4PFTA 4X1DA 2CZLA 3U72A 5I2KA 1RKMA 1B9JA 4Q8RA 2QMWA 4H5GA 4ELOA 4HCWA 3PPPA 3CFXA 1JVYA 4G68C 3Q25A 3TZAA 3USDA 4H65A 3O66A 3CSBA 3M3KA 1SW4A 3DRGA 5ICQA 5JTYA 3H03A 2DS9A 3QSLA 3CVGA 1Q35A 4OEVA 4FAJA 3B6WA 1L5TA 5KCJA 1NL5A 3GBAA 3K02A 3MQ9A 3DP6A 1MY0A 4XXUA 4ZEBA 4ZZAA 1A7LA 3W9WA 3MZ1A 5I2NA 3MVYA 1DOTA 1QJMA 2XX9A 1GTKA 4IO4A 2F5XA 2R6GE 4TOZA 3QYTA 1UIUA 2PYYA 3TDJA 2XXHA 2XXRA 2F7CA 1VSOA 3SERA 1S9TA 2P1SA 2PT1A 1YPNA 4F18A 2Z8DA 4NF6A 4P11A 4M1VA 4ISUA 4DE8A 1MRPA 4G2ZA 4I8CA 2DE3A 3DRKA 3T9HB 3M3LA 4ZEFA 2XHDA 1LBCA 3LVUA 4G4PA 1YAEA 4C1UA 4EF2A 5DEXA 4H6DA 3MBPA 1ELJA 3FVGA 2O1LA 3K6VA 4R2BA 1DTGA 3TTMA 4M4GA 4ZDMA 1BTJA 1DMBA 5JTYB 5M2VA 3MUQA 1UIVA 3C9HA 3SKPA 3MZBA 1IIWA 2IA4A 1QUJA 2HZKA 4IO6A 1PBPA 4OHNA 3RGYA 3G7WA 2XXQA 4THIA 1ZU0A 3U8QA 2QS2A 4RJZA 4I9DA 1XOCA 3TTNA 4PFWA 3A09A 2D21A 5CBRA 5DVJA 3JV9A 4RXLA 4YMAA 2OZZA 1CE2A 1NNPA 3PPNA 2QPQA 4FIMA 1B52A 4I62A 4E0WA 2V93A 3KOSA 2I48A 2Y84A 3PMXA 5CMCA 1LAFE 3OO6A 1MM7A 3RPWA 3VXCA 1EU8A 3GZGA 3IOVA 2VGQA 1JQFA 5JEIA 3FJ7A 2OK2A 4U4SA 5DTBA 4EF1A 4R73A 4OERA 1TWYA 3QXMA 3IJOB 5H8SA 3ZKKA 5FTHA 3MVXA 1B3LA 1MQJA 2OWTA 1EH3A 3P7IA 1SI1A 3OO8A 4YKJA 1UTHA 5K2XA 4R9GA 4F3BA 5IKBA 3EPEA 5FTIA 1JW4A 1QUKA 3OSQA 4G68A 4OWDA 1FTLA 4LA9A 3HHFA 4IY5A 3IOWA 3C33A 1B3FA 3Q27A 4ZS9A 1B4ZA 2WOLA 2OWSA 4BLAA 4ZEIA 2PT2A 1ZKBA 4KD5A 5L9OA 1YTVA 4DXBA 4ZZEA 5DYHA 1B3GA 2WOPA 3MPKA 3F11A 3W15C 3ILTB 3OENA 5AA2D 1MG1A 5ITPA 1Z7ME 2QS4A 3QIMA 2O7IA 2Y7RA 1JETA 2A5TA 1B6HA 1IUDA 3THIA 1IITA 3W9VA 2G29A 3TQWA 2FYIA 3EQ1A 1N7WA 2XD3A 2THIA 4N6PA 3TCGA 1N04A 1JNFA 3MWBA 4JWOA 4RPNA 2I0BA 4QF9A 4KFQA 5AA2B 3IL1B 3VXBA 3CR9A 1M5BA 3PUVE 2F34A 1MXWA 4Q0CA 3KBRA 2V3TA 5F1QA 1UTHB 4R9FA 4DZ1A 3PPOA 1US5A 3FXUA 4PE5B 3S9MC 2AYSA 1TFAA 2H5YA 1UQWA 3UN6A 5BUUA 1B5IA 3C4MA 3IB1A 4G68B 4WKMA 4ZE8A 1N0TA 5AA3A 2Z22A 2O68A 2HAUA 1XHYA 2XX8A 2PMSA 3PPQA 3Q26A 2QMXA 3LC8A 4R74A 3UP9A 4NF5B 1AOVA 5TP9B 5CBSA 1B7UA 3PUYE 3O28A 3PUXE 4EQBA 1SVXB 1H3DA 3CFZA 3OSRA 3IOTA 4JXIA 3K4UA 1Y1MA 3GLBA 2FNCA 4AB6A 4LZ5A 4ZEDA 3TTLA 1USYE 5FHOA 1SBPA 1JVXA 2X26A 5CI5A 4OFOA 4LUBA 3H06B 1GGGA 3IR1A 1MQGA 1VE4A 1B7HA 3OEMA 3KSJA 2B3FA 3FTOA 2XXPA 1Y9UA 2NOOA 1B3EA 1QW0A 1FTMA 1RYOA 4EDPA 4OTEA 3DRHA 3TUSA 3TPAA 3K6UA 3BFUA 2ESNA 4QFPA 1B32A 4PETA 3VVEA 3OEKA 1P1OA 1WVJA 4OETA 3L6HA 1J1NA 3HSTA 4NEDA 5B7DA 3H6WA 4IO7A 3H4ZA 3MVZA 2XD2A 5H8QB 4MH5A 4GQOA 3HO7A 2ZYOA 4H1XA 1LAXA 1XC1A 3PD9A 4LZ8A 4LQ2A 4WXJA 3VFJA 4JSDA 5H8FA 2KLFA 4NF4A 3MZ9A 1URGA 4IO2A 4RYAA 3UK4A 3FJMA 1BLFA 4O3BA 3GBBA 1LFHA 2F6GA 2B65A 4WEDA 4OFLA 1B1XA 4YZZA 3PMWA 3SEUA 2Q8JA 2P2AA 1N3XA 2ONKE 1NH8A 2DSFA 2OLBA 1A40A 1GR2A 1PB8A 3OOAA 2DE4A 4F3GA 3Q28A 5F7VA 4G77A 3LR1A 1OQHA 1ZMGA 3PV0E 4KYSA 3KFMA 3C31A 3MC2A 3E3KA 4OMBA 4O3AA 2XXWA 4FEBA 1OQGA 4NWDA 5L9SA 1VFDA 5J1DA 3N94A 3IB2A 1MH3A 1FQDA 5ICTA 4NTLA 4N13A 3LBSA 1LB9A 1A54A 1XT8A 4G8NA 3MP6A 3LSXA 2M8CA 3TEPA 3T93B 4JWYA 2HQ0A 3S9EA 4XKPA 3HHGA 3R7XA 4EQ7A 4NWCA 2WKYA 4L17A 3A3UA 3TTRA 2HAVA 2F36A 3MAMA 3OELA 3TFLA 4YU0A 4F3SA 3TODA 2ZNSA 4X9TA 4GOTA 1DPEA 1ZBMA 4C0RA 3PMVA 1QULA 1PBQA 2UVHA 3K6XA 4ELPA 1MDQA 1EZOA 2OJTA 5K2YA 2DWIA 3QK6A 5H8HA 4NF8A 4F1VA 5IAIA 1PC3A 2XXVA 3SEXA 1A99A 1M5CA 4R6YA 3O29A 2ZNTA 3SDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OO9 A;  1A8E A;  2O6A A;  2B3B A;  4H8J A;  2I4B A;  3B7D A;  3MPL A;  2Q2C A;  2X7P A;  1AH5 A;  5I57 A;  1QKA A;  1R9Q A;  1MY4 A;  3IO6 A;  4QRZ A;  4YMB A;  1B5H A;  4MLQ A;  5I2K B;  4K3F A;  1FQA A;  1D9V A;  5ITO A;  4AB5 A;  1MQD A;  1EZ9 A;  2Q88 A;  4QSD A;  1Y4C A;  4KHZ E;  4YB5 A;  3LUY A;  2RKM A;  1MDP 1;  1B1H A;  1IEJ A;  4GRK A;  3MW0 A;  1MXV A;  1R6Z A;  3FV2 A;  4YKK A;  3WAE A;  5KZT A;  1LFI A;  2X7Q A;  1HSE A;  1SW2 A;  1I6B A;  4NE4 A;  5KCJ B;  4POW A;  2DOJ A;  4FED A;  2Q9T A;  3D4G A;  3B6Q A;  2R71 A;  3ZSF A;  2Q89 A;  2UYF A;  2O84 X;  4JSO A;  4BDL A;  5I2N B;  4U4X A;  4DDD A;  1OMP A;  1IXH A;  3V89 B;  4DLD A;  2BJJ X;  1B51 A;  1GVC A;  3R26 A;  4NF8 B;  3RT6 B;  4IO3 A;  3KJ7 A;  2GFE A;  4ELR A;  4PQJ A;  1SW5 A;  1DTZ A;  4ZEC A;  4BDM A;  3JYR A;  2H99 A;  2I3W A;  2REJ A;  4XTC Q;  5LOM A;  3KGC A;  4DIG A;  5I84 A;  1FW0 A;  4NF6 B;  4OEN A;  4DCX A;  1B46 A;  1M5F A;  2B4M A;  1ZTY A;  3PGF A;  4F22 A;  2DVC A;  3WAF A;  5DEX B;  2Y7P A;  2RCB A;  5I58 A;  4JDF A;  2NWJ A;  5HBC A;  3C32 A;  1BIY A;  5AA1 A;  3TCH A;  1YCJ A;  1MPB A;  1T0K A;  1Y3P A;  1B5J A;  1H43 A;  4C1T A;  1OVT A;  1IQ7 A;  5A5X A;  1OLC A;  1MY3 A;  2XXY A;  4GL8 A;  3D4C A;  3MP1 A;  1B05 A;  1FTO A;  3T96 B;  1TXF A;  1FQC A;  2V84 A;  4QHQ A;  3VLV A;  3S9L C;  3OXN A;  5TPA A;  4H67 A;  2I58 A;  3I6V A;  3QUF A;  1DSN A;  1FQB A;  1MY2 A;  4ELQ A;  4OFJ A;  5ELV A;  2H25 A;  4KYE A;  1OLA A;  2V3U A;  4QFN A;  4U21 A;  3FUZ A;  2VP1 A;  1MY1 A;  4F3P A;  4KCC A;  2RC7 A;  3H6V A;  3TTK A;  3GXA A;  3FVK A;  2QJE A;  3SET A;  2DYX A;  2QL3 A;  4EXL A;  5L9M A;  2ZNU A;  1PEB A;  3PUZ E;  3BFT A;  3IOU A;  1TT1 A;  2B4L A;  1LLS A;  2DE2 A;  1LB8 A;  4MF3 A;  3T9X B;  4RNS A;  1S7Y A;  3PAM A;  3IK6 B;  3VV5 A;  1AL3 A;  1MQI A;  4F39 A;  1Q1K A;  1BP5 A;  1B2H A;  4KR5 A;  3FZV A;  1MQH A;  4PP0 A;  2XX7 A;  1MH4 A;  2DP8 A;  1LBB A;  3G3H A;  3U1O A;  5KDT A;  4XKQ A;  3LSW A;  3KOT A;  1XVY A;  2HXW A;  4GWO A;  3T22 A;  3K01 A;  4YB7 A;  2NXO A;  3ZKL A;  3CI8 A;  1R1N A;  1N84 A;  1IXG A;  1POY 1;  2F97 A;  4R6K A;  1SQY A;  1P99 A;  3C36 A;  2IEE A;  4R2F A;  1P1Q A;  2DWH A;  1NNT A;  3ZS6 A;  2Y7W A;  2GHA A;  4LAT A;  4F1Y A;  3OO7 A;  4HTG A;  3KEI A;  1LAH E;  3VLW A;  1LCT A;  3FXR A;  2D3I A;  2UVI A;  3PU5 A;  1GV8 A;  2A5T B;  1FQF A;  2Y7I A;  2RIN A;  2R9J A;  1A8F A;  1MXX A;  2ZYM A;  1SYH A;  1BKA A;  4GLI A;  4KQP A;  5H8N A;  3K00 A;  3HCQ A;  4AQ4 A;  5CM6 A;  3N6U A;  4EUO A;  3MVW A;  3C34 A;  3FVO A;  3DRJ A;  3DRI A;  2Y7K A;  2ONR A;  1I6A A;  4DXC A;  3VLU A;  3TYH A;  3A3C A;  1H45 A;  1N7X A;  2F78 A;  1JEU A;  4OQO A;  4R6H A;  1Y3Q A;  1A55 A;  3VE1 B;  3O6G A;  3RUM A;  1IXC A;  1I6Q A;  2ALU A;  3ECR A;  3FV1 A;  4WEP A;  2XXI A;  3U93 A;  3MJN A;  4OYV A;  4ESX A;  1OVB A;  4G8H A;  2FA7 A;  1P1W A;  1CB6 A;  4I1D A;  3RTW B;  1NFT A;  1JW5 A;  2NVU B;  2I49 A;  5L8D A;  1LFG A;  1LGB C;  3O2A A;  2I4C A;  4YB6 A;  2O51 A;  3SEW A;  1M5D A;  4DCY A;  3CIJ A;  1VFE A;  2AIX A;  3U92 A;  2OCU A;  1SYI A;  1R9L A;  4KI0 E;  1RYX A;  5I59 A;  4KCD A;  4U2R A;  2YPN A;  3TEL A;  4NMY A;  1IZ1 A;  3RLF E;  4BDO A;  3FJG A;  3G3K A;  3E13 X;  4EQ9 A;  3RY3 A;  4ND9 A;  4QFK A;  4JWX A;  1F9B A;  4YIC A;  4U23 A;  4TLL B;  3JZJ A;  4BDR A;  1SI0 A;  3RN8 A;  3UGW A;  5CMK A;  1ZLQ A;  3CSG A;  3E9X A;  4MFI A;  4BDN A;  2PVU A;  5H8F B;  3FVN A;  3RTF B;  4YKP A;  5TU0 A;  4G8M A;  2H98 A;  1MS7 A;  3CG1 A;  4NF4 B;  5FHN A;  2F7A A;  3FGS A;  4TQU Q;  2LAO A;  3EHU A;  2YJP A;  2E0S A;  4X48 A;  2UYE A;  2RF1 A;  2WOK A;  1UTB A;  4HS7 A;  4F2Q A;  1PB9 A;  1B0H A;  4H5F A;  2REG A;  3H7M A;  3R6U A;  4ZE9 A;  1FTK A;  2UVG A;  3ONM A;  5BWJ A;  1QVS A;  5EYF A;  2VD3 A;  5I59 B;  2UVJ A;  2O69 A;  2ZXT A;  2F7B A;  5FHM A;  4R72 A;  3ILU B;  3IB0 A;  1USY H;  4F2O A;  1MXU A;  3RT8 A;  3G3I A;  4GL0 A;  3EHT A;  2VHA A;  4F1U A;  1NMU A;  1ZJL A;  2RC9 A;  4Q5T A;  1FCK A;  4IGR A;  4P0I A;  1O63 A;  3MP8 A;  3DRF A;  2DWA A;  2XXX A;  3BKI B;  5CMM A;  1I69 A;  1OIB A;  1XVX A;  3QAX A;  5DVI A;  1LST A;  1AIV A;  4GVO A;  2ONS A;  1B7Z A;  4POX A;  4ECF A;  3K1M A;  3KJT A;  3KSX A;  3FAT A;  2ZYK A;  4IY6 A;  2QS3 A;  3PUW E;  3I3V A;  3DLN A;  1D3K A;  3SES A;  2AL4 A;  3EF7 A;  4E0X A;  1II5 A;  4KYD A;  4RPO A;  5I56 A;  4GF8 A;  4YKI A;  1P1U A;  2CMO A;  1UTB B;  4Q30 B;  2DWJ A;  4QFO A;  5H8H B;  1O64 A;  2ZYN A;  3CFL A;  4H8I A;  1Y4T A;  3S9N C;  1LCF A;  3PD8 A;  1EZP A;  3VVD A;  5AE4 A;  2I0C A;  4UA8 A;  2NUV A;  1S50 A;  4LP2 B;  5EHM A;  1MXY A;  1MPD A;  5I57 B;  3O97 A;  2A5S A;  1N3W A;  4P0G A;  1PDA A;  3N5L A;  3RYA A;  3RNN A;  1TFD A;  3DEL B;  3FAS A;  4OVJ A;  3V8X B;  2Z8F A;  4IO5 A;  4FJP A;  4YAH X;  2HZL A;  3S2V A;  5AA4 A;  3QUJ A;  1URS A;  4QSC A;  2VD2 A;  1D4N A;  3HPI A;  3T9U A;  3RYB A;  3KZG A;  1WDN A;  2HEU A;  2GH9 A;  1H44 A;  5AA2 A;  4KPT A;  1HSL A;  4RK9 A;  3KG2 A;  3TKD A;  1QUI A;  2DXR A;  4U22 A;  4X1B A;  3T9V A;  4ONY A;  2ABH A;  3HN0 A;  1HSJ A;  3LSL A;  4MBP A;  4U1O A;  3UA8 A;  5I56 B;  3IAZ A;  3CHG A;  4IB2 A;  3TQL A;  1VR5 A;  3FXQ A;  1MXZ A;  2YLN A;  4HCY A;  3RQT A;  4F29 A;  2XXU A;  4QFL A;  1WOD A;  1SW1 A;  3O6P A;  1QKB A;  2W7Y A;  2GHB A;  2AL5 A;  4LVQ A;  4NF5 A;  5TP9 A;  2DXY A;  3CG3 A;  3IJX B;  3BBR A;  5CRY A;  5DT6 A;  4RY1 A;  1ANF A;  3K1N A;  4JB7 A;  2O1M A;  3L6G A;  4ZEK A;  2I6E A;  3IO4 A;  3KN8 A;  3O6H A;  1ATG A;  2DQV A;  3O6I A;  3TCF A;  3FIR A;  1NNK A;  3TAJ A;  1Z7N E;  3OMB A;  4Z7E A;  5I58 B;  3G3F A;  3VVF A;  1JEV A;  4PFY A;  5EHS A;  3IX1 A;  3VDF A;  4F31 B;  1Y1Z A;  3OD7 A;  1URD A;  4HW8 A;  1B40 A;  5AA4 B;  4OZ9 A;  3N26 A;  4FOR A;  4GFR A;  3IOR A;  3S4U A;  4FE8 A;  1B0L A;  4FEC A;  3K0V A;  2XXT A;  3AXF A;  5A5X B;  1FTJ A;  2F8D A;  1N76 A;  4H0W A;  4EXK A;  1NH7 A;  3T66 A;  4MLV A;  2RCA A;  2V25 A;  2F35 A;  1Y20 A;  5DVF A;  1MPC A;  1SD3 A;  5H8Q A;  5TPA B;  1KWH A;  2D5W A;  2PBW A;  2ZMB A;  4XKN A;  2OBG A;  1NNF A;  2VOZ A;  1IXI A;  3HV1 A;  1POT A;  2Q2A A;  3UOR A;  3LSF B;  2H4I A;  3H6T A;  2PX1 A;  2F6P A;  4O3C A;  2QRY A;  2O7U A;  4OEU A;  4TLM B;  5HPQ A;  2UXA A;  2RC8 A;  3U94 A;  2G93 A;  2I3V A;  4LON B;  3M8U A;  4F19 A;  4RA1 A;  3SEY A;  3B6T A;  2DVZ A;  1P1N A;  3FD3 A;  4FAT A;  3EHS A;  4OES A;  3C35 A;  1B3H A;  3K1P A;  3KN3 A;  3UIF A;  5CMB A;  4QSE A;  4GIZ A;  1NKX A;  3PPR A;  1M5E A;  1JW1 A;  2HCA A;  1MM6 A;  1PB7 A;  1DPP A;  1B58 A;  4GXA A;  4OXV A;  3G3J A;  3V5A A;  4UAC A;  5KDT B;  2ANJ A;  5HM4 B;  1AMF A;  2QSX A;  4RK2 A;  4ESW A;  2Z8E A;  3H6U A;  4U1Z A;  3ODB A;  3E4R A;  4LZ7 A;  1LAG E;  2H9B A;  4PFU A;  2Z23 A;  3CRB A;  2QS1 A;  4XKR A;  5ISU A;  2V3Q A;  1Y3N A;  3Q29 A;  4JBZ A;  2GRV A;  3M3F A;  5JK4 A;  4IGT A;  3DP4 A;  1O7T A;  2P0S A;  3N6T A;  4GXS B;  3DM0 A;  3K2D A;  2HFB A;  1SDX A;  1D9Y A;  3TMG A;  3DP8 A;  3SEV A;  4DXU A;  3V83 A;  4Z0I A;  3KN7 A;  1US4 A;  5H8N B;  4BDQ A;  4LQ5 A;  4XIG Q;  1B4H A;  4GD5 A;  3I5O A;  3H3G A;  4N07 A;  1XS5 A;  5CC2 A;  1ZIU A;  1H76 A;  1FQE A;  4R75 A;  3O9P A;  3G3G A;  2E1S A;  3EN3 A;  5B70 A;  3K6W A;  4PFT A;  4X1D A;  2CZL A;  3U72 A;  5I2K A;  1RKM A;  1B9J A;  4Q8R A;  2QMW A;  4H5G A;  4ELO A;  4HCW A;  3PPP A;  3CFX A;  1JVY A;  4G68 C;  3Q25 A;  3TZA A;  3USD A;  4H65 A;  3O66 A;  3CSB A;  3M3K A;  1SW4 A;  3DRG A;  5ICQ A;  5JTY A;  3H03 A;  2DS9 A;  3QSL A;  3CVG A;  1Q35 A;  4OEV A;  4FAJ A;  3B6W A;  1L5T A;  5KCJ A;  1NL5 A;  3GBA A;  3K02 A;  3MQ9 A;  3DP6 A;  1MY0 A;  4XXU A;  4ZEB A;  4ZZA A;  1A7L A;  3W9W A;  3MZ1 A;  5I2N A;  3MVY A;  1DOT A;  1QJM A;  2XX9 A;  1GTK A;  4IO4 A;  2F5X A;  2R6G E;  4TOZ A;  3QYT A;  1UIU A;  2PYY A;  3TDJ A;  2XXH A;  2XXR A;  2F7C A;  1VSO A;  3SER A;  1S9T A;  2P1S A;  2PT1 A;  1YPN A;  4F18 A;  2Z8D A;  4NF6 A;  4P11 A;  4M1V A;  4ISU A;  4DE8 A;  1MRP A;  4G2Z A;  4I8C A;  2DE3 A;  3DRK A;  3T9H B;  3M3L A;  4ZEF A;  2XHD A;  1LBC A;  3LVU A;  4G4P A;  1YAE A;  4C1U A;  4EF2 A;  5DEX A;  4H6D A;  3MBP A;  1ELJ A;  3FVG A;  2O1L A;  3K6V A;  4R2B A;  1DTG A;  3TTM A;  4M4G A;  4ZDM A;  1BTJ A;  1DMB A;  5JTY B;  5M2V A;  3MUQ A;  1UIV A;  3C9H A;  3SKP A;  3MZB A;  1IIW A;  2IA4 A;  1QUJ A;  2HZK A;  4IO6 A;  1PBP A;  4OHN A;  3RGY A;  3G7W A;  2XXQ A;  4THI A;  1ZU0 A;  3U8Q A;  2QS2 A;  4RJZ A;  4I9D A;  1XOC A;  3TTN A;  4PFW A;  3A09 A;  2D21 A;  5CBR A;  5DVJ A;  3JV9 A;  4RXL A;  4YMA A;  2OZZ A;  1CE2 A;  1NNP A;  3PPN A;  2QPQ A;  4FIM A;  1B52 A;  4I62 A;  4E0W A;  2V93 A;  3KOS A;  2I48 A;  2Y84 A;  3PMX A;  5CMC A;  1LAF E;  3OO6 A;  1MM7 A;  3RPW A;  3VXC A;  1EU8 A;  3GZG A;  3IOV A;  2VGQ A;  1JQF A;  5JEI A;  3FJ7 A;  2OK2 A;  4U4S A;  5DTB A;  4EF1 A;  4R73 A;  4OER A;  1TWY A;  3QXM A;  3IJO B;  5H8S A;  3ZKK A;  5FTH A;  3MVX A;  1B3L A;  1MQJ A;  2OWT A;  1EH3 A;  3P7I A;  1SI1 A;  3OO8 A;  4YKJ A;  1UTH A;  5K2X A;  4R9G A;  4F3B A;  5IKB A;  3EPE A;  5FTI A;  1JW4 A;  1QUK A;  3OSQ A;  4G68 A;  4OWD A;  1FTL A;  4LA9 A;  3HHF A;  4IY5 A;  3IOW A;  3C33 A;  1B3F A;  3Q27 A;  4ZS9 A;  1B4Z A;  2WOL A;  2OWS A;  4BLA A;  4ZEI A;  2PT2 A;  1ZKB A;  4KD5 A;  5L9O A;  1YTV A;  4DXB A;  4ZZE A;  5DYH A;  1B3G A;  2WOP A;  3MPK A;  3F11 A;  3W15 C;  3ILT B;  3OEN A;  5AA2 D;  1MG1 A;  5ITP A;  1Z7M E;  2QS4 A;  3QIM A;  2O7I A;  2Y7R A;  1JET A;  2A5T A;  1B6H A;  1IUD A;  3THI A;  1IIT A;  3W9V A;  2G29 A;  3TQW A;  2FYI A;  3EQ1 A;  1N7W A;  2XD3 A;  2THI A;  4N6P A;  3TCG A;  1N04 A;  1JNF A;  3MWB A;  4JWO A;  4RPN A;  2I0B A;  4QF9 A;  4KFQ A;  5AA2 B;  3IL1 B;  3VXB A;  3CR9 A;  1M5B A;  3PUV E;  2F34 A;  1MXW A;  4Q0C A;  3KBR A;  2V3T A;  5F1Q A;  1UTH B;  4R9F A;  4DZ1 A;  3PPO A;  1US5 A;  3FXU A;  4PE5 B;  3S9M C;  2AYS A;  1TFA A;  2H5Y A;  1UQW A;  3UN6 A;  5BUU A;  1B5I A;  3C4M A;  3IB1 A;  4G68 B;  4WKM A;  4ZE8 A;  1N0T A;  5AA3 A;  2Z22 A;  2O68 A;  2HAU A;  1XHY A;  2XX8 A;  2PMS A;  3PPQ A;  3Q26 A;  2QMX A;  3LC8 A;  4R74 A;  3UP9 A;  4NF5 B;  1AOV A;  5TP9 B;  5CBS A;  1B7U A;  3PUY E;  3O28 A;  3PUX E;  4EQB A;  1SVX B;  1H3D A;  3CFZ A;  3OSR A;  3IOT A;  4JXI A;  3K4U A;  1Y1M A;  3GLB A;  2FNC A;  4AB6 A;  4LZ5 A;  4ZED A;  3TTL A;  1USY E;  5FHO A;  1SBP A;  1JVX A;  2X26 A;  5CI5 A;  4OFO A;  4LUB A;  3H06 B;  1GGG A;  3IR1 A;  1MQG A;  1VE4 A;  1B7H A;  3OEM A;  3KSJ A;  2B3F A;  3FTO A;  2XXP A;  1Y9U A;  2NOO A;  1B3E A;  1QW0 A;  1FTM A;  1RYO A;  4EDP A;  4OTE A;  3DRH A;  3TUS A;  3TPA A;  3K6U A;  3BFU A;  2ESN A;  4QFP A;  1B32 A;  4PET A;  3VVE A;  3OEK A;  1P1O A;  1WVJ A;  4OET A;  3L6H A;  1J1N A;  3HST A;  4NED A;  5B7D A;  3H6W A;  4IO7 A;  3H4Z A;  3MVZ A;  2XD2 A;  5H8Q B;  4MH5 A;  4GQO A;  3HO7 A;  2ZYO A;  4H1X A;  1LAX A;  1XC1 A;  3PD9 A;  4LZ8 A;  4LQ2 A;  4WXJ A;  3VFJ A;  4JSD A;  5H8F A;  2KLF A;  4NF4 A;  3MZ9 A;  1URG A;  4IO2 A;  4RYA A;  3UK4 A;  3FJM A;  1BLF A;  4O3B A;  3GBB A;  1LFH A;  2F6G A;  2B65 A;  4WED A;  4OFL A;  1B1X A;  4YZZ A;  3PMW A;  3SEU A;  2Q8J A;  2P2A A;  1N3X A;  2ONK E;  1NH8 A;  2DSF A;  2OLB A;  1A40 A;  1GR2 A;  1PB8 A;  3OOA A;  2DE4 A;  4F3G A;  3Q28 A;  5F7V A;  4G77 A;  3LR1 A;  1OQH A;  1ZMG A;  3PV0 E;  4KYS A;  3KFM A;  3C31 A;  3MC2 A;  3E3K A;  4OMB A;  4O3A A;  2XXW A;  4FEB A;  1OQG A;  4NWD A;  5L9S A;  1VFD A;  5J1D A;  3N94 A;  3IB2 A;  1MH3 A;  1FQD A;  5ICT A;  4NTL A;  4N13 A;  3LBS A;  1LB9 A;  1A54 A;  1XT8 A;  4G8N A;  3MP6 A;  3LSX A;  2M8C A;  3TEP A;  3T93 B;  4JWY A;  2HQ0 A;  3S9E A;  4XKP A;  3HHG A;  3R7X A;  4EQ7 A;  4NWC A;  2WKY A;  4L17 A;  3A3U A;  3TTR A;  2HAV A;  2F36 A;  3MAM A;  3OEL A;  3TFL A;  4YU0 A;  4F3S A;  3TOD A;  2ZNS A;  4X9T A;  4GOT A;  1DPE A;  1ZBM A;  4C0R A;  3PMV A;  1QUL A;  1PBQ A;  2UVH A;  3K6X A;  4ELP A;  1MDQ A;  1EZO A;  2OJT A;  5K2Y A;  2DWI A;  3QK6 A;  5H8H A;  4NF8 A;  4F1V A;  5IAI A;  1PC3 A;  2XXV A;  3SEX A;  1A99 A;  1M5C A;  4R6Y A;  3O29 A;  2ZNT A;  3SDF A; 
#chains in the Genus database with same CATH topology
 3OO9 A;  1A8E A;  2O6A A;  2B3B A;  4H8J A;  2I4B A;  3B7D A;  3MPL A;  2Q2C A;  2X7P A;  1AH5 A;  2Y5K A;  5I57 A;  1QKA A;  1R9Q A;  1MY4 A;  3IO6 A;  2HXR A;  4QRZ A;  4YMB A;  1B5H A;  3IFA A;  4MLQ A;  5I2K B;  4K3F A;  1FQA A;  1D9V A;  1FPF A;  1FBC A;  5ITO A;  4AB5 A;  2FVZ A;  1MQD A;  4I40 A;  1EZ9 A;  2Q88 A;  4MJO A;  4QSD A;  1Y4C A;  4FBP A;  4KHZ E;  4YB5 A;  3LUY A;  2RKM A;  1MDP 1;  1B1H A;  4X8R A;  1IEJ A;  4GRK A;  3MW0 A;  1MXV A;  5EQ7 A;  1R6Z A;  3FV2 A;  4YKK A;  3WAE A;  5KZT A;  1LFI A;  2X7Q A;  1HSE A;  1SW2 A;  1I6B A;  4NE4 A;  5KCJ B;  4QXD A;  4POW A;  4GWX A;  2DOJ A;  4FED A;  2Q9T A;  3D4G A;  3B6Q A;  2R71 A;  3ZSF A;  2Q89 A;  2UYF A;  2O84 X;  4JSO A;  4BDL A;  5I2N B;  4U4X A;  4DDD A;  1OMP A;  1IXH A;  3V89 B;  4DLD A;  2BJJ X;  1B51 A;  1GVC A;  3R26 A;  4NF8 B;  3RT6 B;  4IO3 A;  3KJ7 A;  2GFE A;  4ELR A;  4PQJ A;  1SW5 A;  1DTZ A;  4ZEC A;  4BDM A;  3JYR A;  2H99 A;  4NGU A;  2I3W A;  4NG7 A;  3U65 A;  2REJ A;  4XTC Q;  5LOM A;  3KGC A;  4DIG A;  5I84 A;  1FW0 A;  4NF6 B;  1LBY A;  4OEN A;  4DCX A;  1B46 A;  4PC9 A;  1M5F A;  2B4M A;  5EQA A;  1ZTY A;  3PGF A;  4F22 A;  2DVC A;  3WAF A;  5IM2 A;  5DEX B;  2Y7P A;  2RCB A;  2Q8M A;  5I58 A;  4JDF A;  2NWJ A;  5HBC A;  3C32 A;  1BIY A;  4GX3 A;  5AA1 A;  3TCH A;  1YCJ A;  1MPB A;  4I3E A;  1T0K A;  1Y3P A;  1B5J A;  1H43 A;  2GQ1 A;  4C1T A;  1OVT A;  1IQ7 A;  1Q9D A;  5A5X A;  1OLC A;  1MY3 A;  2XXY A;  4GL8 A;  3D4C A;  3MP1 A;  1B05 A;  1FTO A;  3T96 B;  1TXF A;  1LBZ A;  1FQC A;  2V84 A;  4QHQ A;  2XA5 A;  3VLV A;  3S9L C;  3OXN A;  5TPA A;  3B50 A;  4H67 A;  2I58 A;  3I6V A;  4HE0 A;  4IR8 A;  3E78 A;  2V4C A;  3QUF A;  1DSN A;  1FQB A;  1MY2 A;  4ELQ A;  4OFJ A;  1NV5 A;  5ELV A;  1YYZ A;  2H25 A;  4KYE A;  1OLA A;  2V3U A;  4QBA A;  4QFN A;  1NV7 A;  4U21 A;  3FUZ A;  2VP1 A;  1MY1 A;  4PAI A;  4F3P A;  4KCC A;  2RC7 A;  3H6V A;  3TTK A;  1FTA A;  3GXA A;  3IFC A;  3FVK A;  2QJE A;  3SET A;  2DYX A;  2QL3 A;  4EXL A;  2FIX A;  5L9M A;  2Q74 A;  2ZNU A;  1PEB A;  3PUZ E;  3BFT A;  1KZ8 A;  1TT1 A;  3IOU A;  2B4L A;  1LLS A;  2DE2 A;  4N6K A;  1LB8 A;  4MF3 A;  1K9Z A;  3T9X B;  4NAP A;  4RNS A;  1S7Y A;  3PAM A;  3IK6 B;  3VV5 A;  1AL3 A;  2CEY A;  1MQI A;  2XWO A;  4F39 A;  4MNP A;  1Q1K A;  1BP5 A;  1B2H A;  4KR5 A;  3FZV A;  1MQH A;  4PP0 A;  2XX7 A;  1MH4 A;  3FBP A;  2DP8 A;  1LBB A;  3G3H A;  3U1O A;  5KDT A;  4XKQ A;  3LSW A;  3KOT A;  1NV4 A;  1XVY A;  2HXW A;  4GWO A;  3T22 A;  3K01 A;  4YB7 A;  2NXO A;  3T1B A;  3ZKL A;  3CI8 A;  1R1N A;  1N84 A;  1IXG A;  1POY 1;  4PF6 A;  2OWZ A;  4N4U A;  2F97 A;  4R6K A;  1SQY A;  1P99 A;  4H46 A;  3C36 A;  2IEE A;  4R2F A;  1P1Q A;  2DWH A;  1NNT A;  2ZZV A;  3ZS6 A;  2Y7W A;  2GHA A;  4LAT A;  1QGX A;  4F1Y A;  3OO7 A;  4HTG A;  3KEI A;  5IGA A;  1LAH E;  3VLW A;  1LCT A;  3FXR A;  2D3I A;  2UVI A;  3PU5 A;  1GV8 A;  2CZH A;  2A5T B;  1FQF A;  2Y7I A;  2RIN A;  2R9J A;  1IMB A;  4PGP A;  1A8F A;  1MXX A;  4OA4 A;  2ZYM A;  1SYH A;  1BKA A;  4GLI A;  4KQP A;  4LN5 A;  5H8N A;  3K00 A;  3HCQ A;  4AQ4 A;  5CM6 A;  3N6U A;  4EUO A;  3MVW A;  3C34 A;  3FVO A;  3DRJ A;  3DRI A;  2Y7K A;  1FPL A;  1EYI A;  2ONR A;  1I6A A;  4DXC A;  3VLU A;  3TYH A;  3A3C A;  1H45 A;  1N7X A;  2F78 A;  4AS4 A;  1JEU A;  4OQO A;  4R6H A;  1Y3Q A;  1A55 A;  3VE1 B;  3O6G A;  3RUM A;  1IXC A;  1I6Q A;  2ALU A;  3ECR A;  3FV1 A;  4WEP A;  2XXI A;  3U93 A;  3MJN A;  4OYV A;  4ESX A;  4MNC A;  4P47 A;  1OVB A;  4G8H A;  2FA7 A;  5ET5 A;  1P1W A;  1CB6 A;  3QMF A;  4I1D A;  2WBB A;  3RTW B;  1BK4 A;  4PCD A;  1NFT A;  1JW5 A;  2NVU B;  2I49 A;  5L8D A;  1LFG A;  1FJ9 A;  1LGB C;  3O2A A;  2I4C A;  4YB6 A;  2O51 A;  3SEW A;  1M5D A;  4DCY A;  3CIJ A;  1VFE A;  2AIX A;  1LEV A;  3U92 A;  2OCU A;  1SYI A;  1R9L A;  4KI0 E;  1RYX A;  5I59 A;  4KCD A;  4U2R A;  2YPN A;  3TEL A;  4NMY A;  1IZ1 A;  4HE2 A;  3RLF E;  2JJK A;  4BDO A;  3FJG A;  3G3K A;  3E13 X;  4EQ9 A;  2WYP A;  2CEX A;  4X04 A;  5LDZ A;  3RY3 A;  4MMP A;  4ND9 A;  5I5P A;  4QFK A;  4JWX A;  1F9B A;  4YIC A;  4U23 A;  4PF8 A;  4O94 A;  4TLL B;  3JZJ A;  4BDR A;  1SI0 A;  3RN8 A;  3UGW A;  5CMK A;  1ZLQ A;  3CSG A;  2FIE A;  3E9X A;  4MFI A;  4BDN A;  2PVU A;  4OVR A;  5H8F B;  3FVN A;  1NUZ A;  3RTF B;  4YKP A;  5TU0 A;  4G8M A;  2H98 A;  1MS7 A;  3CG1 A;  4NF4 B;  5FHN A;  1EYK A;  2F7A A;  3FGS A;  4TQU Q;  2LAO A;  3EHU A;  2YJP A;  2E0S A;  4X48 A;  2UYE A;  2RF1 A;  4H45 A;  2WOK A;  1UTB A;  4HS7 A;  5J16 A;  4O7M A;  4F2Q A;  1PB9 A;  1B0H A;  4H5F A;  2REG A;  3H7M A;  3R6U A;  4ZE9 A;  1FTK A;  2UVG A;  1NUW A;  4XF5 A;  3ONM A;  5BWJ A;  1QVS A;  4DI3 D;  5EYF A;  2VD3 A;  2XWV A;  5I59 B;  2UVJ A;  2O69 A;  2ZXT A;  2F7B A;  3KC0 A;  5FHM A;  4R72 A;  3ILU B;  3IB0 A;  1USY H;  4F2O A;  1MXU A;  3RT8 A;  3G3I A;  4GL0 A;  4MAG A;  3EHT A;  2VHA A;  4F1U A;  1NMU A;  1ZJL A;  2RC9 A;  4Q5T A;  4P9K A;  1FCK A;  4IGR A;  4P0I A;  1O63 A;  1RDY A;  3MP8 A;  2XXK A;  3DRF A;  2DWA A;  3T0J A;  1NI9 A;  4N91 A;  2XXX A;  3BKI B;  5CMM A;  1FPG A;  1I69 A;  1OIB A;  1XVX A;  3QAX A;  5DVI A;  1LST A;  1AIV A;  4GVO A;  2ONS A;  1B7Z A;  4POX A;  4ECF A;  3K1M A;  3KJT A;  3KSX A;  3FAT A;  2QVV A;  2ZYK A;  4IY6 A;  4XFE A;  2QS3 A;  3PUW E;  3I3V A;  3DLN A;  4MHF A;  1D3K A;  4NHB A;  1KA0 A;  2AL4 A;  3SES A;  3EF7 A;  4E0X A;  1II5 A;  4KYD A;  4RPO A;  5I56 A;  4GF8 A;  4YKI A;  1P1U A;  2CMO A;  1UTB B;  4Q30 B;  2DWJ A;  4QFO A;  1NV2 A;  1K9Y A;  5H8H B;  1O64 A;  2ZYN A;  3CFL A;  4H8I A;  1Y4T A;  3S9N C;  1LCF A;  1AWB A;  3PD8 A;  1EZP A;  3VVD A;  5AE4 A;  2I0C A;  4UA8 A;  2NUV A;  1S50 A;  4LP2 B;  5EHM A;  1MXY A;  1MPD A;  5I57 B;  4GX4 A;  4NX1 A;  3O97 A;  2A5S A;  5ET7 A;  1N3W A;  4P0G A;  1PDA A;  3N5L A;  3RYA A;  3RNN A;  1TFD A;  3DEL B;  3FAS A;  4OVJ A;  3V8X B;  2Z8F A;  4IO5 A;  4FJP A;  4YAH X;  3NOH A;  2HZL A;  3S2V A;  5AA4 A;  3QUJ A;  5ET6 A;  1URS A;  4PDD A;  4QSC A;  2VD2 A;  1D4N A;  3HPI A;  3T9U A;  3RYB A;  3KZG A;  1WDN A;  2HEU A;  1G0H A;  2GH9 A;  1H44 A;  4PFI A;  5AA2 A;  4KPT A;  1HSL A;  4RK9 A;  2VPO A;  3KG2 A;  3TKD A;  4N15 A;  1QUI A;  2DXR A;  4U22 A;  4X1B A;  3T9V A;  4ONY A;  2ABH A;  3HN0 A;  1HSJ A;  3LSL A;  4MBP A;  4U1O A;  3UA8 A;  5I56 B;  3IAZ A;  3CHG A;  4IB2 A;  3TQL A;  1VR5 A;  2F3B A;  3FXQ A;  1MXZ A;  2YLN A;  1FBP A;  4HCY A;  1VDW A;  3RQT A;  4F29 A;  2XXU A;  4QFL A;  1WOD A;  1SW1 A;  3O6P A;  1QKB A;  2W7Y A;  2GHB A;  2AL5 A;  4MEV A;  4LVQ A;  4NF5 A;  5TP9 A;  2DXY A;  3CG3 A;  3IJX B;  3BBR A;  5CRY A;  5DT6 A;  4RY1 A;  1ANF A;  5T3J A;  3K1N A;  4JB7 A;  2O1M A;  3L6G A;  4ZEK A;  2I6E A;  3IO4 A;  4HE1 A;  3KN8 A;  3O6H A;  1ATG A;  2DQV A;  3O6I A;  3TCF A;  3FIR A;  2FHY A;  1NNK A;  3TAJ A;  1Z7N E;  3OMB A;  4Z7E A;  5I58 B;  4PAK A;  3G3F A;  3VVF A;  1JEV A;  4PFY A;  5EHS A;  3IX1 A;  3VDF A;  4GWY A;  4F31 B;  1Y1Z A;  3OD7 A;  1URD A;  4HW8 A;  1B40 A;  1FBH A;  5AA4 B;  4OZ9 A;  3N26 A;  3SZP A;  4FOR A;  4GFR A;  3IOR A;  3S4U A;  4FE8 A;  1B0L A;  4FEC A;  3K0V A;  2XXT A;  3AXF A;  5A5X B;  1FTJ A;  2F8D A;  1N76 A;  4H0W A;  4EXK A;  1NH7 A;  4P1E A;  3T66 A;  4MLV A;  3ROJ A;  3RPL A;  1FBG A;  2RCA A;  2V25 A;  2F35 A;  1Y20 A;  5DVF A;  1MPC A;  1SD3 A;  5H8Q A;  5TPA B;  1KWH A;  4AS5 A;  2D5W A;  2PBW A;  2HPG A;  2ZMB A;  4XKN A;  4PBQ A;  2OBG A;  1NNF A;  2VOZ A;  1IXI A;  3HV1 A;  1POT A;  2Q2A A;  3UOR A;  3LSF B;  2ZZW A;  2H4I A;  3H6T A;  2PX1 A;  2FBP A;  2F6P A;  4O3C A;  2QRY A;  2O7U A;  4OEU A;  4TLM B;  5HPQ A;  2UXA A;  2RC8 A;  3U94 A;  2BJI A;  2G93 A;  2I3V A;  4LON B;  3M8U A;  4F19 A;  4RA1 A;  3SEY A;  3B6T A;  1DBZ A;  2DVZ A;  2CZI A;  1P1N A;  3FD3 A;  4FAT A;  3EHS A;  4OES A;  1IMA A;  5IZ1 A;  2VPN A;  3C35 A;  4PE3 A;  4N6D A;  1B3H A;  3K1P A;  3KN3 A;  3UIF A;  5CMB A;  4QSE A;  4GIZ A;  1NKX A;  3PPR A;  1M5E A;  1JW1 A;  2HCA A;  4PBH A;  3BIG A;  1MM6 A;  1PB7 A;  1DPP A;  1FPI A;  1B58 A;  4GXA A;  4OXV A;  3G3J A;  1CNQ A;  3V5A A;  4UAC A;  5KDT B;  2ANJ A;  2KR0 A;  3BIH A;  5HM4 B;  1AMF A;  2QSX A;  4RK2 A;  4ESW A;  2Z8E A;  3H6U A;  5EYH A;  4U1Z A;  3ODB A;  3E4R A;  3EKI A;  1RDX A;  1LBV A;  4LZ7 A;  1LAG E;  2H9B A;  4PFU A;  1NV0 A;  4N81 A;  2Z23 A;  3CRB A;  2QS1 A;  4XKR A;  5ISU A;  2V3Q A;  1Y3N A;  3Q29 A;  4JBZ A;  2GRV A;  3M3F A;  5JK4 A;  4IGT A;  4P1L A;  3DP4 A;  1O7T A;  2P0S A;  3N6T A;  4GXS B;  3DM0 A;  1NUX A;  3K2D A;  3D1R A;  3A29 A;  1DCU A;  2HFB A;  1SDX A;  1D9Y A;  3PTY A;  3TMG A;  3DP8 A;  3SEV A;  5F24 A;  4DXU A;  3V83 A;  4Z0I A;  2QVU A;  3KN7 A;  1US4 A;  5H8N B;  2WYK A;  4BDQ A;  4LQ5 A;  3E79 A;  4XIG Q;  1B4H A;  4GD5 A;  3I5O A;  3H3G A;  4N07 A;  1XS5 A;  1JP4 A;  3LV0 A;  5CC2 A;  1ZIU A;  1IME A;  1H76 A;  1FQE A;  4R75 A;  3O9P A;  3G3G A;  2E1S A;  3EN3 A;  5B70 A;  3K6W A;  4PFT A;  4X1D A;  2CZL A;  3U72 A;  5I2K A;  1RKM A;  1B9J A;  2P3V A;  4Q8R A;  2QMW A;  4H5G A;  4ELO A;  4HCW A;  3RYD A;  3PPP A;  3CFX A;  1JVY A;  4G68 C;  3Q25 A;  3TZA A;  3USD A;  1G0I A;  4H65 A;  2QFL A;  3O66 A;  3CSB A;  3M3K A;  1SW4 A;  3DRG A;  5ICQ A;  5JTY A;  3H03 A;  2DS9 A;  2WEF A;  3QSL A;  4JVD A;  3CVG A;  1Q35 A;  2OX3 A;  4OEV A;  4FAJ A;  3B6W A;  1L5T A;  5KCJ A;  1FPB A;  1NL5 A;  4OVT A;  3GBA A;  4I3Y A;  3K02 A;  3MQ9 A;  3DP6 A;  1MY0 A;  4XXU A;  4ZEB A;  4GWW A;  4ZZA A;  1A7L A;  3W9W A;  3MZ1 A;  5I2N A;  3MVY A;  1DOT A;  1QJM A;  2XX9 A;  1GTK A;  4IO4 A;  2F5X A;  2R6G E;  4P3L A;  4P8B A;  5ET8 A;  4TOZ A;  3QYT A;  1UIU A;  2PYY A;  3TDJ A;  2XXH A;  1FRP A;  2XXR A;  2F7C A;  1VSO A;  3SER A;  1S9T A;  2CZK A;  2P1S A;  4JVI A;  2PT1 A;  1YPN A;  4F18 A;  2Z8D A;  4NF6 A;  4UAB A;  4P11 A;  4M1V A;  4ISU A;  4DE8 A;  1MRP A;  4G2Z A;  4I8C A;  2DE3 A;  3DRK A;  2P3N A;  3T9H B;  3M3L A;  5EQ8 A;  4ZEF A;  2XHD A;  1LBC A;  3LVU A;  4G4P A;  1YAE A;  4C1U A;  4EF2 A;  5DEX A;  4H6D A;  3MBP A;  1ELJ A;  4GBV A;  3KBZ A;  3FVG A;  2MKZ A;  2O1L A;  3K6V A;  4R2B A;  1DTG A;  3TTM A;  4M4G A;  4ZDM A;  1BTJ A;  1DMB A;  5JTY B;  5M2V A;  3MUQ A;  1UIV A;  3C9H A;  3SKP A;  3MZB A;  1IIW A;  2IA4 A;  1QUJ A;  2HZK A;  4IO6 A;  1PBP A;  4OHN A;  3RGY A;  3G7W A;  2XXQ A;  3KC1 A;  1ZU0 A;  4THI A;  3U8Q A;  2QS2 A;  4RJZ A;  4I9D A;  1XOC A;  3TTN A;  4PFW A;  3MYU A;  3A09 A;  2D21 A;  5CBR A;  5DVJ A;  3JV9 A;  4KXP A;  4RXL A;  4YMA A;  2OZZ A;  1CE2 A;  1NNP A;  3PPN A;  5IZ3 A;  2PCR A;  2QPQ A;  2Y5L A;  2WX9 A;  4PDH A;  4FIM A;  1B52 A;  4I62 A;  4E0W A;  2V93 A;  3KOS A;  1FBF A;  2I48 A;  2Y84 A;  3PMX A;  5CMC A;  1LAF E;  3OO6 A;  1MM7 A;  3RPW A;  3VXC A;  1EU8 A;  3GZG A;  3IOV A;  2VGQ A;  1JQF A;  5JEI A;  3FJ7 A;  2OK2 A;  4U4S A;  5DTB A;  4EF1 A;  4OVS A;  4R73 A;  4OER A;  1TWY A;  3QXM A;  3IJO B;  5H8S A;  3ZKK A;  5FTH A;  3MVX A;  1B3L A;  1MQJ A;  2OWT A;  1EH3 A;  1FJ6 A;  3P7I A;  1SI1 A;  3OO8 A;  4YKJ A;  1UTH A;  4MNI A;  5K2X A;  4R9G A;  4F3B A;  5IKB A;  3EPE A;  4O8M A;  2VT5 A;  5FTI A;  1IMD A;  1JW4 A;  1QUK A;  3OSQ A;  4G68 A;  5FBP A;  4OWD A;  1FTL A;  4LA9 A;  3HHF A;  4IY5 A;  3IOW A;  4OVP A;  3C33 A;  1B3F A;  3Q27 A;  4ZS9 A;  1FPD A;  1B4Z A;  2WOL A;  3GYY A;  2OWS A;  4BLA A;  4ZEI A;  2PT2 A;  1ZKB A;  4KD5 A;  4NF0 A;  5IZ3 B;  5L9O A;  1YTV A;  4DXB A;  4ZZE A;  1FPE A;  5DYH A;  4DI4 B;  1B3G A;  1NV3 A;  5EQ9 A;  2WOP A;  3MPK A;  3F11 A;  3W15 C;  3ILT B;  3OEN A;  5EYG A;  1YXI A;  5AA2 D;  4MX6 A;  4PFB A;  1MG1 A;  5ITP A;  1Z7M E;  2QS4 A;  4PAF A;  3QIM A;  1INP A;  2O7I A;  2Y7R A;  1JET A;  2PFZ A;  2A5T A;  1B6H A;  1IUD A;  1YZ0 A;  3THI A;  1IIT A;  4NQ8 A;  3W9V A;  2G29 A;  3TQW A;  2FYI A;  3EQ1 A;  1N7W A;  4XEQ A;  2XD3 A;  2THI A;  4N6P A;  3TCG A;  1N04 A;  1JNF A;  3MWB A;  4JWO A;  4MCO A;  4RPN A;  2I0B A;  4QF9 A;  4KFQ A;  5AA2 B;  3IL1 B;  3VXB A;  3CR9 A;  1M5B A;  3PUV E;  2F34 A;  2HHM A;  5LTC A;  1MXW A;  4Q0C A;  3KBR A;  2V3T A;  5F1Q A;  1UTH B;  4R9F A;  4DZ1 A;  3PPO A;  1US5 A;  3FXU A;  4PE5 B;  3S9M C;  2AYS A;  1TFA A;  5A5L A;  2H5Y A;  1UQW A;  3UN6 A;  4OAN A;  5BUU A;  4N17 A;  1B5I A;  3C4M A;  3IB1 A;  4G68 B;  4WKM A;  4ZE8 A;  1N0T A;  5AA3 A;  2Z22 A;  2O68 A;  2HAU A;  1XHY A;  2XX8 A;  2PMS A;  3PPQ A;  1EYJ A;  3Q26 A;  1NUY A;  2QMX A;  3LC8 A;  4R74 A;  3UP9 A;  4NF5 B;  1AOV A;  5TP9 B;  4PGN A;  5CBS A;  2XWK A;  1B7U A;  3PUY E;  3O28 A;  3PUX E;  4EQB A;  1SVX B;  1H3D A;  3CFZ A;  3OSR A;  3IOT A;  4JXI A;  1XI6 A;  3K4U A;  1Y1M A;  3GLB A;  2FNC A;  4AB6 A;  4LZ5 A;  4ZED A;  1USY E;  3TTL A;  5FHO A;  1SBP A;  1JVX A;  2X26 A;  5CI5 A;  4OFO A;  4LUB A;  3H06 B;  1GGG A;  3IR1 A;  1FSA A;  1MQG A;  1VE4 A;  1B7H A;  3OEM A;  3KSJ A;  2B3F A;  3FTO A;  2XXP A;  1Y9U A;  2ZZX A;  2NOO A;  1B3E A;  1QW0 A;  3ISP A;  1FTM A;  2PFY A;  1SPI A;  1RYO A;  3MST A;  4EDP A;  4OTE A;  1D9Q A;  4N8G A;  4P56 A;  3DRH A;  3TUS A;  2L5V A;  1FBE A;  2F3D A;  3TPA A;  4GX6 A;  3K6U A;  3BFU A;  2ESN A;  4QFP A;  1B32 A;  4PET A;  3VVE A;  3OEK A;  1FPK A;  1P1O A;  3RPL B;  2R8T A;  1WVJ A;  4GWZ A;  4OET A;  3L6H A;  1J1N A;  3HST A;  4NED A;  5B7D A;  3H6W A;  4IO7 A;  3H4Z A;  3MVZ A;  3B8B A;  1LBX A;  2XD2 A;  5H8Q B;  4MH5 A;  4GQO A;  3HO7 A;  1LBW A;  2ZYO A;  4H1X A;  1LAX A;  1XC1 A;  3PD9 A;  4LZ8 A;  4GWS A;  4NN3 A;  4LQ2 A;  4WXJ A;  3VFJ A;  4JSD A;  5H8F A;  2KLF A;  4NF4 A;  3MZ9 A;  2XWI A;  1URG A;  1FPJ A;  4HXV A;  4IO2 A;  4MIJ A;  4G61 A;  1IMF A;  2KQZ A;  4RYA A;  3UK4 A;  3FJM A;  1BLF A;  4O3B A;  5DW8 A;  4PTK A;  2DDK A;  3GBB A;  1LFH A;  2F6G A;  2B65 A;  4WED A;  4OFL A;  1B1X A;  4YZZ A;  3PMW A;  3SEU A;  2Q8J A;  2P2A A;  1N3X A;  2ONK E;  1NH8 A;  2DSF A;  2OLB A;  1A40 A;  1GR2 A;  1PB8 A;  3OOA A;  2DE4 A;  4F3G A;  4N8Y A;  3Q28 A;  5F7V A;  1NV1 A;  4G77 A;  3LR1 A;  1OQH A;  1ZMG A;  4GBW A;  2QVR A;  3PV0 E;  4KYS A;  3KFM A;  3C31 A;  3MC2 A;  3E3K A;  4OMB A;  3LUZ A;  4O3A A;  2XXW A;  4FEB A;  1OQG A;  4NWD A;  5L9S A;  1VFD A;  5J1D A;  1RDZ A;  3N94 A;  4JVC A;  3IB2 A;  1MH3 A;  1KA1 A;  1FQD A;  3HFU A;  5ICT A;  1DK4 A;  4NTL A;  4N13 A;  3LBS A;  1LB9 A;  1A54 A;  1XT8 A;  4G8N A;  3MP6 A;  3LSX A;  2M8C A;  3TEP A;  4OVQ A;  3T93 B;  4JWY A;  2HQ0 A;  3S9E A;  4XKP A;  3HHG A;  1FBD A;  3R7X A;  5ESY A;  4EQ7 A;  4NWC A;  2WKY A;  4L17 A;  3A3U A;  4GWU A;  2HAV A;  3TTR A;  2F36 A;  3MAM A;  3OEL A;  3TFL A;  4YU0 A;  4F3S A;  5I7I A;  1NV6 A;  3TOD A;  2ZNS A;  4X9T A;  2WBD A;  4GOT A;  1IMC A;  1DPE A;  1ZBM A;  4C0R A;  3PMV A;  1QUL A;  1PBQ A;  2UVH A;  3K6X A;  4ELP A;  4O7I A;  3FXB A;  5IZZ A;  1MDQ A;  1EZO A;  4PFR A;  2OJT A;  5K2Y A;  2DWI A;  3QK6 A;  5H8H A;  4NF8 A;  4F1V A;  5IAI A;  1PC3 A;  5I3S A;  2XXV A;  3SEX A;  1A99 A;  1M5C A;  4R6Y A;  3O29 A;  2ZNT A;  3SDF A; 
#chains in the Genus database with same CATH homology
 3OO9 A;  1A8E A;  2O6A A;  2B3B A;  4H8J A;  2I4B A;  3B7D A;  3MPL A;  2Q2C A;  2X7P A;  1AH5 A;  5I57 A;  1QKA A;  1R9Q A;  1MY4 A;  3IO6 A;  4QRZ A;  4YMB A;  1B5H A;  4MLQ A;  5I2K B;  4K3F A;  1FQA A;  1D9V A;  5ITO A;  4AB5 A;  1MQD A;  1EZ9 A;  2Q88 A;  4QSD A;  1Y4C A;  4KHZ E;  4YB5 A;  3LUY A;  2RKM A;  1MDP 1;  1B1H A;  1IEJ A;  4GRK A;  3MW0 A;  1MXV A;  1R6Z A;  3FV2 A;  4YKK A;  3WAE A;  5KZT A;  1LFI A;  2X7Q A;  1HSE A;  1SW2 A;  1I6B A;  4NE4 A;  5KCJ B;  4POW A;  2DOJ A;  4FED A;  2Q9T A;  3D4G A;  3B6Q A;  2R71 A;  3ZSF A;  2Q89 A;  2UYF A;  2O84 X;  4JSO A;  4BDL A;  5I2N B;  4U4X A;  4DDD A;  1OMP A;  1IXH A;  3V89 B;  4DLD A;  2BJJ X;  1B51 A;  1GVC A;  3R26 A;  4NF8 B;  3RT6 B;  4IO3 A;  3KJ7 A;  2GFE A;  4ELR A;  4PQJ A;  1SW5 A;  1DTZ A;  4ZEC A;  4BDM A;  3JYR A;  2H99 A;  2I3W A;  2REJ A;  4XTC Q;  5LOM A;  3KGC A;  4DIG A;  5I84 A;  1FW0 A;  4NF6 B;  4OEN A;  4DCX A;  1B46 A;  1M5F A;  2B4M A;  1ZTY A;  3PGF A;  4F22 A;  2DVC A;  3WAF A;  5DEX B;  2Y7P A;  2RCB A;  5I58 A;  4JDF A;  2NWJ A;  5HBC A;  3C32 A;  1BIY A;  5AA1 A;  3TCH A;  1YCJ A;  1MPB A;  1T0K A;  1Y3P A;  1B5J A;  1H43 A;  4C1T A;  1OVT A;  1IQ7 A;  5A5X A;  1OLC A;  1MY3 A;  2XXY A;  4GL8 A;  3D4C A;  3MP1 A;  1B05 A;  1FTO A;  3T96 B;  1TXF A;  1FQC A;  2V84 A;  4QHQ A;  3VLV A;  3S9L C;  3OXN A;  5TPA A;  4H67 A;  2I58 A;  3I6V A;  3QUF A;  1DSN A;  1FQB A;  1MY2 A;  4ELQ A;  4OFJ A;  5ELV A;  2H25 A;  4KYE A;  1OLA A;  2V3U A;  4QFN A;  4U21 A;  3FUZ A;  2VP1 A;  1MY1 A;  4F3P A;  4KCC A;  2RC7 A;  3H6V A;  3TTK A;  3GXA A;  3FVK A;  2QJE A;  3SET A;  2DYX A;  2QL3 A;  4EXL A;  5L9M A;  2ZNU A;  1PEB A;  3PUZ E;  3BFT A;  3IOU A;  1TT1 A;  2B4L A;  1LLS A;  2DE2 A;  1LB8 A;  4MF3 A;  3T9X B;  4RNS A;  1S7Y A;  3PAM A;  3IK6 B;  3VV5 A;  1AL3 A;  1MQI A;  4F39 A;  1Q1K A;  1BP5 A;  1B2H A;  4KR5 A;  3FZV A;  1MQH A;  4PP0 A;  2XX7 A;  1MH4 A;  2DP8 A;  1LBB A;  3G3H A;  3U1O A;  5KDT A;  4XKQ A;  3LSW A;  3KOT A;  1XVY A;  2HXW A;  4GWO A;  3T22 A;  3K01 A;  4YB7 A;  2NXO A;  3ZKL A;  3CI8 A;  1R1N A;  1N84 A;  1IXG A;  1POY 1;  2F97 A;  4R6K A;  1SQY A;  1P99 A;  3C36 A;  2IEE A;  4R2F A;  1P1Q A;  2DWH A;  1NNT A;  3ZS6 A;  2Y7W A;  2GHA A;  4LAT A;  4F1Y A;  3OO7 A;  4HTG A;  3KEI A;  1LAH E;  3VLW A;  1LCT A;  3FXR A;  2D3I A;  2UVI A;  3PU5 A;  1GV8 A;  2A5T B;  1FQF A;  2Y7I A;  2RIN A;  2R9J A;  1A8F A;  1MXX A;  2ZYM A;  1SYH A;  1BKA A;  4GLI A;  4KQP A;  5H8N A;  3K00 A;  3HCQ A;  4AQ4 A;  5CM6 A;  3N6U A;  4EUO A;  3MVW A;  3C34 A;  3FVO A;  3DRJ A;  3DRI A;  2Y7K A;  2ONR A;  1I6A A;  4DXC A;  3VLU A;  3TYH A;  3A3C A;  1H45 A;  1N7X A;  2F78 A;  1JEU A;  4OQO A;  4R6H A;  1Y3Q A;  1A55 A;  3VE1 B;  3O6G A;  3RUM A;  1IXC A;  1I6Q A;  2ALU A;  3ECR A;  3FV1 A;  4WEP A;  2XXI A;  3U93 A;  3MJN A;  4OYV A;  4ESX A;  1OVB A;  4G8H A;  2FA7 A;  1P1W A;  1CB6 A;  4I1D A;  3RTW B;  1NFT A;  1JW5 A;  2NVU B;  2I49 A;  5L8D A;  1LFG A;  1LGB C;  3O2A A;  2I4C A;  4YB6 A;  2O51 A;  3SEW A;  1M5D A;  4DCY A;  3CIJ A;  1VFE A;  2AIX A;  3U92 A;  2OCU A;  1SYI A;  1R9L A;  4KI0 E;  1RYX A;  5I59 A;  4KCD A;  4U2R A;  2YPN A;  3TEL A;  4NMY A;  1IZ1 A;  3RLF E;  4BDO A;  3FJG A;  3G3K A;  3E13 X;  4EQ9 A;  3RY3 A;  4ND9 A;  4QFK A;  4JWX A;  1F9B A;  4YIC A;  4U23 A;  4TLL B;  3JZJ A;  4BDR A;  1SI0 A;  3RN8 A;  3UGW A;  5CMK A;  1ZLQ A;  3CSG A;  3E9X A;  4MFI A;  4BDN A;  2PVU A;  5H8F B;  3FVN A;  3RTF B;  4YKP A;  5TU0 A;  4G8M A;  2H98 A;  1MS7 A;  3CG1 A;  4NF4 B;  5FHN A;  2F7A A;  3FGS A;  4TQU Q;  2LAO A;  3EHU A;  2YJP A;  2E0S A;  4X48 A;  2UYE A;  2RF1 A;  2WOK A;  1UTB A;  4HS7 A;  4F2Q A;  1PB9 A;  1B0H A;  4H5F A;  2REG A;  3H7M A;  3R6U A;  4ZE9 A;  1FTK A;  2UVG A;  3ONM A;  5BWJ A;  1QVS A;  5EYF A;  2VD3 A;  5I59 B;  2UVJ A;  2O69 A;  2ZXT A;  2F7B A;  5FHM A;  4R72 A;  3ILU B;  3IB0 A;  1USY H;  4F2O A;  1MXU A;  3RT8 A;  3G3I A;  4GL0 A;  3EHT A;  2VHA A;  4F1U A;  1NMU A;  1ZJL A;  2RC9 A;  4Q5T A;  1FCK A;  4IGR A;  4P0I A;  1O63 A;  3MP8 A;  3DRF A;  2DWA A;  2XXX A;  3BKI B;  5CMM A;  1I69 A;  1OIB A;  1XVX A;  3QAX A;  5DVI A;  1LST A;  1AIV A;  4GVO A;  2ONS A;  1B7Z A;  4POX A;  4ECF A;  3K1M A;  3KJT A;  3KSX A;  3FAT A;  2ZYK A;  4IY6 A;  2QS3 A;  3PUW E;  3I3V A;  3DLN A;  1D3K A;  3SES A;  2AL4 A;  3EF7 A;  4E0X A;  1II5 A;  4KYD A;  4RPO A;  5I56 A;  4GF8 A;  4YKI A;  1P1U A;  2CMO A;  1UTB B;  4Q30 B;  2DWJ A;  4QFO A;  5H8H B;  1O64 A;  2ZYN A;  3CFL A;  4H8I A;  1Y4T A;  3S9N C;  1LCF A;  3PD8 A;  1EZP A;  3VVD A;  5AE4 A;  2I0C A;  4UA8 A;  2NUV A;  1S50 A;  4LP2 B;  5EHM A;  1MXY A;  1MPD A;  5I57 B;  3O97 A;  2A5S A;  1N3W A;  4P0G A;  1PDA A;  3N5L A;  3RYA A;  3RNN A;  1TFD A;  3DEL B;  3FAS A;  4OVJ A;  3V8X B;  2Z8F A;  4IO5 A;  4FJP A;  4YAH X;  2HZL A;  3S2V A;  5AA4 A;  3QUJ A;  1URS A;  4QSC A;  2VD2 A;  1D4N A;  3HPI A;  3T9U A;  3RYB A;  3KZG A;  1WDN A;  2HEU A;  2GH9 A;  1H44 A;  5AA2 A;  4KPT A;  1HSL A;  4RK9 A;  3KG2 A;  3TKD A;  1QUI A;  2DXR A;  4U22 A;  4X1B A;  3T9V A;  4ONY A;  2ABH A;  3HN0 A;  1HSJ A;  3LSL A;  4MBP A;  4U1O A;  3UA8 A;  5I56 B;  3IAZ A;  3CHG A;  4IB2 A;  3TQL A;  1VR5 A;  3FXQ A;  1MXZ A;  2YLN A;  4HCY A;  3RQT A;  4F29 A;  2XXU A;  4QFL A;  1WOD A;  1SW1 A;  3O6P A;  1QKB A;  2W7Y A;  2GHB A;  2AL5 A;  4LVQ A;  4NF5 A;  5TP9 A;  2DXY A;  3CG3 A;  3IJX B;  3BBR A;  5CRY A;  5DT6 A;  4RY1 A;  1ANF A;  3K1N A;  4JB7 A;  2O1M A;  3L6G A;  4ZEK A;  2I6E A;  3IO4 A;  3KN8 A;  3O6H A;  1ATG A;  2DQV A;  3O6I A;  3TCF A;  3FIR A;  1NNK A;  3TAJ A;  1Z7N E;  3OMB A;  4Z7E A;  5I58 B;  3G3F A;  3VVF A;  1JEV A;  4PFY A;  5EHS A;  3IX1 A;  3VDF A;  4F31 B;  1Y1Z A;  3OD7 A;  1URD A;  4HW8 A;  1B40 A;  5AA4 B;  4OZ9 A;  3N26 A;  4FOR A;  4GFR A;  3IOR A;  3S4U A;  4FE8 A;  1B0L A;  4FEC A;  3K0V A;  2XXT A;  3AXF A;  5A5X B;  1FTJ A;  2F8D A;  1N76 A;  4H0W A;  4EXK A;  1NH7 A;  3T66 A;  4MLV A;  2RCA A;  2V25 A;  2F35 A;  1Y20 A;  5DVF A;  1MPC A;  1SD3 A;  5H8Q A;  5TPA B;  1KWH A;  2D5W A;  2PBW A;  2ZMB A;  4XKN A;  2OBG A;  1NNF A;  2VOZ A;  1IXI A;  3HV1 A;  1POT A;  2Q2A A;  3UOR A;  3LSF B;  2H4I A;  3H6T A;  2PX1 A;  2F6P A;  4O3C A;  2QRY A;  2O7U A;  4OEU A;  4TLM B;  5HPQ A;  2UXA A;  2RC8 A;  3U94 A;  2G93 A;  2I3V A;  4LON B;  3M8U A;  4F19 A;  4RA1 A;  3SEY A;  3B6T A;  2DVZ A;  1P1N A;  3FD3 A;  4FAT A;  3EHS A;  4OES A;  3C35 A;  1B3H A;  3K1P A;  3KN3 A;  3UIF A;  5CMB A;  4QSE A;  4GIZ A;  1NKX A;  3PPR A;  1M5E A;  1JW1 A;  2HCA A;  1MM6 A;  1PB7 A;  1DPP A;  1B58 A;  4GXA A;  4OXV A;  3G3J A;  3V5A A;  4UAC A;  5KDT B;  2ANJ A;  5HM4 B;  1AMF A;  2QSX A;  4RK2 A;  4ESW A;  2Z8E A;  3H6U A;  4U1Z A;  3ODB A;  3E4R A;  4LZ7 A;  1LAG E;  2H9B A;  4PFU A;  2Z23 A;  3CRB A;  2QS1 A;  4XKR A;  5ISU A;  2V3Q A;  1Y3N A;  3Q29 A;  4JBZ A;  2GRV A;  3M3F A;  5JK4 A;  4IGT A;  3DP4 A;  1O7T A;  2P0S A;  3N6T A;  4GXS B;  3DM0 A;  3K2D A;  2HFB A;  1SDX A;  1D9Y A;  3TMG A;  3DP8 A;  3SEV A;  4DXU A;  3V83 A;  4Z0I A;  3KN7 A;  1US4 A;  5H8N B;  4BDQ A;  4LQ5 A;  4XIG Q;  1B4H A;  4GD5 A;  3I5O A;  3H3G A;  4N07 A;  1XS5 A;  5CC2 A;  1ZIU A;  1H76 A;  1FQE A;  4R75 A;  3O9P A;  3G3G A;  2E1S A;  3EN3 A;  5B70 A;  3K6W A;  4PFT A;  4X1D A;  2CZL A;  3U72 A;  5I2K A;  1RKM A;  1B9J A;  4Q8R A;  2QMW A;  4H5G A;  4ELO A;  4HCW A;  3PPP A;  3CFX A;  1JVY A;  4G68 C;  3Q25 A;  3TZA A;  3USD A;  4H65 A;  3O66 A;  3CSB A;  3M3K A;  1SW4 A;  3DRG A;  5ICQ A;  5JTY A;  3H03 A;  2DS9 A;  3QSL A;  3CVG A;  1Q35 A;  4OEV A;  4FAJ A;  3B6W A;  1L5T A;  5KCJ A;  1NL5 A;  3GBA A;  3K02 A;  3MQ9 A;  3DP6 A;  1MY0 A;  4XXU A;  4ZEB A;  4ZZA A;  1A7L A;  3W9W A;  3MZ1 A;  5I2N A;  3MVY A;  1DOT A;  1QJM A;  2XX9 A;  1GTK A;  4IO4 A;  2F5X A;  2R6G E;  4TOZ A;  3QYT A;  1UIU A;  2PYY A;  3TDJ A;  2XXH A;  2XXR A;  2F7C A;  1VSO A;  3SER A;  1S9T A;  2P1S A;  2PT1 A;  1YPN A;  4F18 A;  2Z8D A;  4NF6 A;  4P11 A;  4M1V A;  4ISU A;  4DE8 A;  1MRP A;  4G2Z A;  4I8C A;  2DE3 A;  3DRK A;  3T9H B;  3M3L A;  4ZEF A;  2XHD A;  1LBC A;  3LVU A;  4G4P A;  1YAE A;  4C1U A;  4EF2 A;  5DEX A;  4H6D A;  3MBP A;  1ELJ A;  3FVG A;  2O1L A;  3K6V A;  4R2B A;  1DTG A;  3TTM A;  4M4G A;  4ZDM A;  1BTJ A;  1DMB A;  5JTY B;  5M2V A;  3MUQ A;  1UIV A;  3C9H A;  3SKP A;  3MZB A;  1IIW A;  2IA4 A;  1QUJ A;  2HZK A;  4IO6 A;  1PBP A;  4OHN A;  3RGY A;  3G7W A;  2XXQ A;  4THI A;  1ZU0 A;  3U8Q A;  2QS2 A;  4RJZ A;  4I9D A;  1XOC A;  3TTN A;  4PFW A;  3A09 A;  2D21 A;  5CBR A;  5DVJ A;  3JV9 A;  4RXL A;  4YMA A;  2OZZ A;  1CE2 A;  1NNP A;  3PPN A;  2QPQ A;  4FIM A;  1B52 A;  4I62 A;  4E0W A;  2V93 A;  3KOS A;  2I48 A;  2Y84 A;  3PMX A;  5CMC A;  1LAF E;  3OO6 A;  1MM7 A;  3RPW A;  3VXC A;  1EU8 A;  3GZG A;  3IOV A;  2VGQ A;  1JQF A;  5JEI A;  3FJ7 A;  2OK2 A;  4U4S A;  5DTB A;  4EF1 A;  4R73 A;  4OER A;  1TWY A;  3QXM A;  3IJO B;  5H8S A;  3ZKK A;  5FTH A;  3MVX A;  1B3L A;  1MQJ A;  2OWT A;  1EH3 A;  3P7I A;  1SI1 A;  3OO8 A;  4YKJ A;  1UTH A;  5K2X A;  4R9G A;  4F3B A;  5IKB A;  3EPE A;  5FTI A;  1JW4 A;  1QUK A;  3OSQ A;  4G68 A;  4OWD A;  1FTL A;  4LA9 A;  3HHF A;  4IY5 A;  3IOW A;  3C33 A;  1B3F A;  3Q27 A;  4ZS9 A;  1B4Z A;  2WOL A;  2OWS A;  4BLA A;  4ZEI A;  2PT2 A;  1ZKB A;  4KD5 A;  5L9O A;  1YTV A;  4DXB A;  4ZZE A;  5DYH A;  1B3G A;  2WOP A;  3MPK A;  3F11 A;  3W15 C;  3ILT B;  3OEN A;  5AA2 D;  1MG1 A;  5ITP A;  1Z7M E;  2QS4 A;  3QIM A;  2O7I A;  2Y7R A;  1JET A;  2A5T A;  1B6H A;  1IUD A;  3THI A;  1IIT A;  3W9V A;  2G29 A;  3TQW A;  2FYI A;  3EQ1 A;  1N7W A;  2XD3 A;  2THI A;  4N6P A;  3TCG A;  1N04 A;  1JNF A;  3MWB A;  4JWO A;  4RPN A;  2I0B A;  4QF9 A;  4KFQ A;  5AA2 B;  3IL1 B;  3VXB A;  3CR9 A;  1M5B A;  3PUV E;  2F34 A;  1MXW A;  4Q0C A;  3KBR A;  2V3T A;  5F1Q A;  1UTH B;  4R9F A;  4DZ1 A;  3PPO A;  1US5 A;  3FXU A;  4PE5 B;  3S9M C;  2AYS A;  1TFA A;  2H5Y A;  1UQW A;  3UN6 A;  5BUU A;  1B5I A;  3C4M A;  3IB1 A;  4G68 B;  4WKM A;  4ZE8 A;  1N0T A;  5AA3 A;  2Z22 A;  2O68 A;  2HAU A;  1XHY A;  2XX8 A;  2PMS A;  3PPQ A;  3Q26 A;  2QMX A;  3LC8 A;  4R74 A;  3UP9 A;  4NF5 B;  1AOV A;  5TP9 B;  5CBS A;  1B7U A;  3PUY E;  3O28 A;  3PUX E;  4EQB A;  1SVX B;  1H3D A;  3CFZ A;  3OSR A;  3IOT A;  4JXI A;  3K4U A;  1Y1M A;  3GLB A;  2FNC A;  4AB6 A;  4LZ5 A;  4ZED A;  3TTL A;  1USY E;  5FHO A;  1SBP A;  1JVX A;  2X26 A;  5CI5 A;  4OFO A;  4LUB A;  3H06 B;  1GGG A;  3IR1 A;  1MQG A;  1VE4 A;  1B7H A;  3OEM A;  3KSJ A;  2B3F A;  3FTO A;  2XXP A;  1Y9U A;  2NOO A;  1B3E A;  1QW0 A;  1FTM A;  1RYO A;  4EDP A;  4OTE A;  3DRH A;  3TUS A;  3TPA A;  3K6U A;  3BFU A;  2ESN A;  4QFP A;  1B32 A;  4PET A;  3VVE A;  3OEK A;  1P1O A;  1WVJ A;  4OET A;  3L6H A;  1J1N A;  3HST A;  4NED A;  5B7D A;  3H6W A;  4IO7 A;  3H4Z A;  3MVZ A;  2XD2 A;  5H8Q B;  4MH5 A;  4GQO A;  3HO7 A;  2ZYO A;  4H1X A;  1LAX A;  1XC1 A;  3PD9 A;  4LZ8 A;  4LQ2 A;  4WXJ A;  3VFJ A;  4JSD A;  5H8F A;  2KLF A;  4NF4 A;  3MZ9 A;  1URG A;  4IO2 A;  4RYA A;  3UK4 A;  3FJM A;  1BLF A;  4O3B A;  3GBB A;  1LFH A;  2F6G A;  2B65 A;  4WED A;  4OFL A;  1B1X A;  4YZZ A;  3PMW A;  3SEU A;  2Q8J A;  2P2A A;  1N3X A;  2ONK E;  1NH8 A;  2DSF A;  2OLB A;  1A40 A;  1GR2 A;  1PB8 A;  3OOA A;  2DE4 A;  4F3G A;  3Q28 A;  5F7V A;  4G77 A;  3LR1 A;  1OQH A;  1ZMG A;  3PV0 E;  4KYS A;  3KFM A;  3C31 A;  3MC2 A;  3E3K A;  4OMB A;  4O3A A;  2XXW A;  4FEB A;  1OQG A;  4NWD A;  5L9S A;  1VFD A;  5J1D A;  3N94 A;  3IB2 A;  1MH3 A;  1FQD A;  5ICT A;  4NTL A;  4N13 A;  3LBS A;  1LB9 A;  1A54 A;  1XT8 A;  4G8N A;  3MP6 A;  3LSX A;  2M8C A;  3TEP A;  3T93 B;  4JWY A;  2HQ0 A;  3S9E A;  4XKP A;  3HHG A;  3R7X A;  4EQ7 A;  4NWC A;  2WKY A;  4L17 A;  3A3U A;  3TTR A;  2HAV A;  2F36 A;  3MAM A;  3OEL A;  3TFL A;  4YU0 A;  4F3S A;  3TOD A;  2ZNS A;  4X9T A;  4GOT A;  1DPE A;  1ZBM A;  4C0R A;  3PMV A;  1QUL A;  1PBQ A;  2UVH A;  3K6X A;  4ELP A;  1MDQ A;  1EZO A;  2OJT A;  5K2Y A;  2DWI A;  3QK6 A;  5H8H A;  4NF8 A;  4F1V A;  5IAI A;  1PC3 A;  2XXV A;  3SEX A;  1A99 A;  1M5C A;  4R6Y A;  3O29 A;  2ZNT A;  3SDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...