1B33B

Structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
161
structure length
160
Chain Sequence
MQDAITAVINSSDVQGKYLDTAALEKLKSYFSTGELRVRAATTIAANAAAIVKEAVAKSLLYSDITRPGGMYTTRRYAACIRDLDYYLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPISATVQAIQAMKEVTASLVGPDAGKEMGVYFDYICSGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis at 2.2 A of orthorhombic crystals presents the asymmetry of the allophycocyanin-linker complex, AP.LC7.8, from phycobilisomes of Mastigocladus laminosus.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords ALLOPHYCOCYANIN, ALPHA CHAIN
total genus 63
structure length 160
sequence length 161
chains with identical sequence D, F, I, K, M
ec nomenclature
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00502 Phycobilisome Phycobilisome protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.20 Mainly Alpha Orthogonal Bundle Globin-like Phycocyanins 1b33B00
3KVSB 2V8AA 4GY3A 2BV8A 2UUMA 4GY3B 4F0TB 3O2CB 3KVSA 1PHNA 1ALLB 2V8AB 3V57B 1XF6C 1QGWC 2UUMB 2VJHB 2VJRA 1B8DB 1KN1A 3O18A 1KTPA 4N6SA 2C7JA 2VJTA 4L1EA 2VMLB 1GH0B 2C7LA 3DBJB 5B13G 1F99A 4RMPB 4GXEB 1I7YA 2C7LB 4F0UB 5FVBM 4Z8KA 4L1EB 2C7JB 2J96A 2UUND 1KTPB 4GXEA 5AQDM 1EYXA 2UULC 4PO5A 1F99B 4RMPA 3DBJA 3V57A 4YJJA 3V58B 4N6SB 2UUMX 3MWNA 1XG0C 5AQDA 1B8DA 2VJHA 4Q70A 3BRPB 2VJTB 1B33A 4XXKA 2BV8B 4LM6B 1LIAA 2UULA 3O2CA 4LMXB 4XXIA 2UULH 1HA7B 2UUNA 3BRPA 4F0TA 5B13A 1ALLA 1PHNB 2UULB 4Q70B 2UUNB 4ZIZA 1HA7A 1B33B 1JBOB 1LIAB 3V58A 1CPCB 1ON7A 4PO5B 4YJJB 1EYXB 2C7KB 4H0MA 4F0UA 1I7YB 4LMSB 3L0FB 4Z8KB 4H0MB 1KN1B 3O18B 3L0FA 2C7KA 2UULD 2VJRB 1JBOA 5FVBA 2VMLA 1CPCA 1GH0A 1ON7B 4ZIZB
chains in the Genus database with same CATH superfamily
2SPOA 1HHTP 1LFZA 1YENA 1YDZB 3A5GA 1XZVA 1IDRA 1V75B 3G53A 2BV8A 1K1KB 4F0TB 4XS0B 3PT8A 3SDHA 2WCRA 2AUOA 1FAWA 1J7WB 1YVTB 2HBCA 5CMVA 1YE2B 1QSIB 1MWDA 2VYWA 1CH7A 3UH6A 1JZKA 2VMLB 1SPEA 1K0YB 1GCVA 3WFXA 4B3WA 1LHTA 3GQPB 3HRWB 1C7DA 3DUTB 3H57A 1KTPB 1K0YA 1O1IA 3KUNA 4A8OA 1EYXA 3ZJPA 2H8FA 3UHVA 1COLA 1VXFA 1YVTA 1FAWB 3G4VA 2MBWA 1O1LA 2ZT4A 1J41B 1COHA 4N7PA 2FRIX 3CIUA 4FH7A 1OR6A 2V1JA 1LFVA 3QJBB 1NZ2A 2G0VA 1QI8A 1XDTT 2DN2B 1JP9A 4JYQA 3GKTA 5IKSA 3WR1B 3IC2A 3S1JA 4YJJB 1PBXB 1N9HA 4H0MA 3UI0A 2WY4A 2BKMA 1WMUA 5JDOE 1YFFB 3B75B 1PBXA 3MOUA 1Y8HB 2C7KA 3MJPB 1F5PA 3WCVC 1DLWA 1MBDA 1GCWA 1YOHA 1XXTB 2GNVA 1URVA 4GY3A 1G0BA 1V07A 1DXUA 2BK9A 3HEPA 1DDTA 4HHBB 1Y7DB 1Y7ZA 1MYJA 1A0UB 2E2YA 1KFRA 1KTPA 4H0BA 3ZJSA 1VXBA 4WJG1 2ZSXA 1BZ1A 3DBJB 1LH6A 1I7YA 3LHBA 4Z8KA 3WCVB 4A8YA 1JEBA 3VAUA 1EMYA 4X0LA 1A4FB 2QRWA 1J3ZB 3HHBA 1GDLA 4PO5A 1MLGA 1UVMA 5HBIA 2WTHA 1S6AA 1S0HB 2XYKA 2HZ3A 4NI1B 1XZ2B 4LPIA 1BINA 4ODCA 1YOGA 1XZVB 4XXIA 1RVWB 1S0HA 3OO5B 3ED9A 1JL7A 2VEBA 1HBIA 101MA 1NWIA 1C7BA 3HHBB 1HDAA 1CPCB 1I3DA 3BOMA 2BW9M 2QFNA 1Y4QA 1JY7A 4VHBA 1HDSA 4MPMA 1WVPA 4TWUA 1J3YA 1O1NB 1RPSA 1O1IB 1Y85A 2MGEA 1BABB 3GQRA 3PI3A 1S61A 1JY7B 1V4XA 1L2KA 1DWTA 3VREB 2ZFBB 3MKBA 2Z6SA 3LB4A 1Y7GB 4F6JA 4XDIA 1LH2A 4ESAB 2FRJX 1N9FA 1A01A 1TOXA 1MDTA 3UGZA 4AE0A 1UT0A 2GKNA 4F6FA 4FWZA 1SPGA 1Y0AA 2LH6A 3A5BA 3DHTB 3ODQA 2HBDB 3WCUB 4NZIA 1A9WE 2M6ZB 3ARJA 1CIOA 1YHEB 1LUEA 2D5ZB 1IBEA 1MLQA 1MZ0A 2ZS1D 2UULC 1DKEB 4WJGA 2MGJA 1HRMA 2MGFA 2QLSA 2DKCA 3WR1A 3FH9A 5CHQA 3PELA 1XZUB 4IROB 4N6SB 3V2VA 2X4AA 2ZT3A 2OIFA 1Y0AB 2O5BX 1Y5KA 2W6XA 1IWHB 4ETVA 3UHGA 1VWTB 3WCPA 1NQPA 3M39A 3LB2A 1D8UA 1LFQA 2X49A 1JP6A 1Y0DA 1V4WA 3WCTD 1SI4A 1XZ4A 1Y8IA 2ZFBA 3D1AA 3UHKA 4M4BB 2D2MC 1FDHA 3CY5A 1XZ5A 2JLFA 1A9WA 3ZJIA 2MYEA 4ESUA 3QM7A 4L7YA 3B75A 1O1MB 1N9IA 1VXDA 2PGHA 4HRTB 1SDLA 1G0AB 1YGDB 1A6KA 1HDAB 1J7SB 4XS0A 2ZT1A 1DO4A 4H2LA 4B02A 3P5QA 4NK1A 1GBVB 2B7HA 1RVWA 3D4XA 3HF4A 2V8AB 1YZIB 2Z8AA 5EETA 2ZS0A 1CG8B 2G0ZA 2DXMA 3EDAA 2PGHB 3AT5B 1A3OB 1BZ0A 1J3ZA 2C7LB 5FVBM 1GLIB 2NRMA 4L1EB 1FSXA 2UUND 1H97A 1MNHA 1Y4RA 1XZ7A 5CN8A 2ZLXB 1O1PB 3V57A 1BIJB 5CN7A 4U8UA 109MA 4HH1A 4JACA 5D5RA 5HU6A 4Q70A 4BJUA 4XXKA 110MA 1YE2A 3UBCA 3O2CA 3UHCA 4AE1A 3D1KA 2OLPA 1GZXA 6HBIA 1X46A 1SDKB 1FDHG 3S66B 2ZSSA 4Q70B 4UURA 1OFJA 3UHXA 1HBHB 1DXVA 3ZJJA 3EU1B 1LFZB 1MTJA 4IROA 2QSPB 1YGFB 1CH5A 3PI2A 2H8DB 1UVXA 3MJPA 2VM0A 5JGGA 5EU2A 1MLUA 3NG6A 2V1KA 1RQ4B 3MVCA 1X9FC 3LB3A 5EYJA 2R1HA 1CG8A 1FHJA 1U7RA 1X9FB 1JF4A 3PMCA 1LA6B 3UHSA 5CNGA 4ZIZB 2YRSA 5CNBA 4ROLA 1SPGB 1HBAB 2GNWA 1CH3A 1HGCA 3WCWC 1YIHA 1LFVB 4ETTA 3UHHA 1NEJA 1QGWC 4HRRB 1BZZB 1HBSB 1NZ5A 3AQ9A 3PI8A 1MYMA 3A0GA 3NL7A 3OZUA 4SDHA 1IOPA 1BZPA 3IA3B 1F99A 2R4ZA 2O5LX 1Y4BB 1T1NB 2JLGA 3VRFB 1MLKA 3QQRA 4NXCA 4F6BA 4A8FA 2XKIA 3O7NA 2RAOA 3UH7A 1Y8KA 1A6GA 3WCWB 5KERA 1FLPA 1QSIA 1XG0C 1NEJB 3WCUC 5F0BA 1H1XA 2DKDA 2HBCB 3K3UA 1J52A 3G4UA 1HBBB 1LIAA 3MJUB 1UC3A 1J40A 1G9VB 1XZ2A 1LA6A 2JL9A 3PELB 2D5XB 3M3AA 3UGYA 1Y09A 1A0ZA 2YSKA 2MGAA 2O5TX 4MBNA 3EOKB 3OJ1A 1NS9B 1MCYA 112MA 1YCAA 3ODQB 4MQJA 1B86A 1YEOA 2LH2A 2O5MX 3BJ3B 4ERVA 1ON7B 5C6YA 3NMMA 2G11A 2QSSA 1JW8A 2W31A 1NGKA 1YMAA 3SZKA 1VXEA 4A8QA 1Y5FA 1Y45A 1NZ4A 4N7OA 1RQAB 1A6NA 3GLNA 3WCWA 5KERB 2ZFOD 1G0BB 2MHBB 2ZLTB 2O5OX 1B8DB 1F0LA 1MYZA 3WCTB 1N9XA 1BZ6A 2ZWJA 1DUOA 3BJ3A 3NUHB 2ZS1A 1A3NA 2VHBA 1J3YB 1O1NA 1R1YA 2O58X 1WLAA 1XCHA 3OK5A 2GKMA 1JL6A 1LH1A 1Y83A 1MYIA 1G09B 2R4YA 1JZLA 1J7YA 3WFTA 3BRPB 2ZSZA 2VJTB 3HXNA 3K8BB 2ZLUB 4M4AB 4G1VA 1NXFA 1Y8WB 2ZFOA 5SW7A 2QU0B 5CNCA 3PT7B 5E6EB 1QSHB 1MOHA 1Y0CA 1MLFA 4U8UD 1LIAB 4ZVBA 3V58A 4PO5B 5CN4A 5HY8B 1IT2A 1O1MA 4F4OA 2H8FB 1Y8KB 2NSRA 3IC0B 3GIOA 1MYFA 3WCVA 3D7OA 2HHDB 1A87A 1C7DB 3ONZA 5CN6A 1YHUB 1A00A 3MBAA 104MA 1MLLA 2VMLA 1AJ9A 4G51A 1Y0DB 1YHUC 2D60A 1LFLA 5HY8A 5EE4C 1Y7ZB 1QPWB 1PMBA 1Y2ZB 1UVNA 2W72B 5E29A 1AZIA 1Y0CB 1NS6A 1DTIA 1QSHA 4F68A 2DN1B 3V57B 1YENB 1O1KB 2UUMB 3UHQA 1YE0B 2VJTA 3HXNB 1JF3A 2YRSB 4L1EA 1J7YB 4PNJA 1U7SA 2PEGA 1NS9A 1Y83B 1CG5B 5B13G 2NSSA 1YFFA 1VXGA 5ILRA 1Y4GA 5KDQA 4F0UB 1GJNA 1MNJA 4MQCB 2IN4A 1CQ2A 2DC3A 3HEOA 1HGBB 1O1JB 1Y5JA 4MU5A 1MLHA 3WCTA 1HHOB 3QJBA 1GDJA 3G46A 3WCWD 1BUWA 2H35B 4N7PB 4BJAA 4B4YA 1O1LB 1YGDA 2UULB 2Z6NB 4HRTA 1GZXB 1HA7A 1Y22A 1XYEA 1EYXB 5HAVA 1CMYA 4U8UB 5EUIA 1CBLA 5B85A 3GDJB 3PI4A 4LMSB 1VRFA 1Y4RB 1ECOA 1S5XA 3PI9A 2W6WA 3G4RA 1JWNA 2EB8A 1CPCA 3PIAB 2QMBA 3ZJRA 1GH0A 1A0ZB 1MNKA 2IG3A 4MQGB 1B0BA 107MA 3R5IB 1YZIA 2GTLA 1G9VA 3LB1A 5SW7B 1NPGA 1YDZA 1ALLB 1CH2A 4HSWA 4U8UC 3FH9B 1XF6C 2QFKA 2R1HB 2GLNA 1KD2A 2LH5A 3VHBA 3PIAA 1BBBB 4X0LB 2RAOB 1A6MA 2BMMA 2NRLA 4L7YB 1DWRA 3GDJA 1M9PA 2J96A 3FS4A 5AQDM 4ROMA 5CNEA 1RTEA 1EWAA 3UHWA 2BLIA 1MGNA 1Y01B 5EUIB 3QJEB 3HYUB 1HBGA 1CMYB 4FC3B 4TYXA 1Y35A 1CH4A 3D1AB 3UHZA 1SDKA 3OO4B 3ARKA 1YEQB 2NX0A 3D1KB 1RH1A 1MBAA 3WFWA 2UULA 3OGBA 4PQBA 2ZSPA 1CIIA 1YEQA 3WHMA 1JPBA 2HBFA 3OO4A 3GKVB 1VWTA 2W6YA 1JBOB 3RQRA 2OH8A 1Y8HA 1RPSB 2C7KB 4O1TA 1OJ6A 1YVQB 2D2MB 4KMVA 1W92A 2GL3A 1FHJB 1OUUA 3QM8A 1IBEB 5JDOF 4H0MB 2BLHA 3L0FA 1YEUB 1S5YB 2ZSYA 1KD2B 3NG6B 4MQHB 2ZLWB 1UVKA 1G08B 2R80A 2D5XA 3BJ1B 4UZVA 3ZJOA 5CHRA 2G0RA 3CIUB 3VNCA 3KVSA 4UIQA 3OZVA 2HBSA 2VJRA 1KN1A 3S1IA 3D17B 3ECXA 1AJ9B 1XQ5A 1F63A 1VXHA 2RI4A 3VREA 1DXTB 2GRHA 1VREA 5EYSA 3QM5A 2RI4B 1Y85B 1XZ4B 3W4UB 1MTKA 4F4OB 4RMPA 1Y22B 3VRGA 4NI0B 2HBSB 3G52A 3LR9A 1HI8A 2VJHA 2HHEA 5EE4D 1AJHA 2HCOA 1MNOA 1K1KA 1HJTA 2UULH 4IT8A 2G3HA 1F65A 3HF4B 1TU9A 3D4XB 1MKOA 1Y4FA 2G10A 1YIEB 1UVIA 1MWBA 2ZLUA 2R80B 4L2MA 1UIWB 3MYMA 4M4AA 5HLUA 4ODCB 1C7CB 1VXAA 4H07A 1SHRB 1YEUA 2D2ND 1I3EA 1Y4VB 1Y46A 1OFKA 4HH0A 4F0UA 2VRYA 5MBNA 1SHRA 1CLSA 1YVQA 3ZJNA 1UVYA 4MQKB 4YU4A 2G14A 2MGIA 2MYBA 2XKHA 3ZJHA 1DXVB 2WCQA 1MNIA 4KMWA 3QZXA 1A0UA 3S65B 1QPWA 3MKBB 3S48C 111MA 1LFLB 1MLMA 4BS9A 2GDMA 1OUTB 4TWVA 3ZH0A 3QJEA 2MYDA 1HBRB 3HC9A 5JDOC 4F6IA 1DWSA 5JOMA 4MQJB 2AURA 3FS4B 1XZ7B 3LQ9A 2QLSB 2HHDA 2MGGA 3D7OB 3LQDB 1DKEA 1IRDA 3E55A 1SGKA 3EDBA 1XQ5B 2AV3A 4FWXA 1BZ0B 1C7BB 4NK2A 1Y4VA 3V58B 2OHBA 2VLXA 3MWNA 3IXFA 3PT8B 3KUOA 2HZ2A 1THBA 1Y7CA 3OO5A 1NIHA 2HBDA 1KR7A 4AVDA 2BV8B 1MOCA 3PT7A 1ASHA 3AQ8A 1YIEA 1GBVA 1ABYA 1RQ3B 1HI0P 1B33B 2HCOB 1V5HA 2O5SX 3VRGB 3WCUD 3UHTA 2DHBB 3E5IA 1BZ1B 4MAXA 3LR7A 2D2MA 1HV4B 1FN3A 1A3NB 3GQRB 1BABA 2W6VA 1YEVA 3DUTA 1XZ5B 1MLNA 3PMDA 1BZRA 1OUTA 1JBOA 1XY0A 2LH1A 1Z8UB 2DHBA 1MLJA 4MXKA 3WHMB 2V1EA 1Y7DA 1OBMA 3D17A 2HBGA 4HRRA 3NMLA 1QXEA 5ILMA 2ZSTA 3PI1A 1BUWB 2G12A 4GY3B 1VHBA 2R50A 1Y35B 2MGHA 4FC3A 2D6CA 3HYUA 4ROLB 1DUKA 4A8WA 1V75A 4N6SA 1M9PB 4DC8A 3GQGA 1THBB 4FH6A 1MYHA 2ZLWA 1WMUB 4GXEB 3UH3A 2W72C 1X3KA 1RQ4A 2MGMA 2C7JB 1MBOA 2PEGB 3GYSB 4GXEA 4F6GA 2ZS0D 2ZFOC 3QJCA 1YMCA 3DBJA 2QSPA 1YH9B 1HDBB 3UH5A 1MKOB 1Y4FB 1GDIA 3GK9A 1HBRA 3ASEA 1HACA 2HHBA 4N8TB 5D1VA 4LM6B 5EOHA 3S66A 2W72A 1LH5A 2HHEB 1HBBA 1CO8A 2EVKA 1MLRA 1Y7GA 3W4UA 1FSLA 3G4WA 4O2GA 1CH9A 2D2NB 1MBCA 1XY0B 2MGCA 2ZSNA 1Y4BA 3GUQA 1FSXB 4F6DA 3RJ6A 1GLIA 1ABWB 2Z6TA 3DHRA 1KN1B 3A59A 4N7NA 2VJRB 2LHBA 1J7WA 2GRZA 2AA1B 1ITHA 2FRFA 3KVSB 3TM9A 1DTMA 4HSXA 3RGKA 2R4WA 2QU0A 2AUQA 1S56A 3AQ7A 1CH1A 2BNLA 3R5IA 4NI1A 1G09A 4MQIB 1S5YA 1J41A 1Y7CB 2ZSRA 3WFUA 1G0AA 2AA1A 1GH0B 1YG5A 2QMBB 3H58A 1BVCA 3M3BA 4A8SA 1BVDA 4RMPB 5F2AA 1A4FA 1HCOB 4QAUA 2ZS0C 3LQDA 4ETUA 3HRWA 4DC7A 2BWHA 2G0XA 2V1HA 2EKUA 2KSCA 4G1BA 1GBUA 1UX8A 3UHUA 2MHBA 3NFEA 6HBWA 4ERTA 1IT3A 3QJDA 4WCHD 2Z85A 1LFQB 1Y45B 1HA7B 4HHBA 2CMMA 2UUNA 3ZJMA 5C6EB 2MGBA 3S65A 1CP0A 3QJDB 5HLXA 4G51B 1IWHA 2WTGA 3NFEB 3UHRA 1Y5KB 1LJWB 1XXTA 1BJEA 1BIJA 3BJ1A 1FCSA 1Y4PA 1O1PA 1HDBA 1UFPA 1Y5JB 3ONZB 3UHBA 5E83A 2EVPA 1UMOA 2EKTA 1MBIA 1HCOA 4NXAA 1YHEA 3L0FB 3BJ2B 105MA 1Y0TA 1LFYB 1MTIA 2UULD 1Y46B 1HGAA 5MBAA 1VXCA 1HI1A 1EW6A 3GQGB 4MQIA 5KKKA 1JDOA 2OH9A 1C7CA 2V8AA 1UIWA 1ECNA 2EB9A 1J40B 106MA 1O1KA 2UUMA 3WCVD 3A9MA 3MJUA 2SPLA 3ZTAA 1PHNA 2SPNA 4O35A 3UHDA 2BLJM 7HBIA 4ESAA 4F69A 1YHRB 2HBEA 2MGDA 1Y2ZA 1SWMA 2VJHB 3O18A 1S5XB 3PI9B 1HLBA 4YU3A 1V4XB 3ORDA 4O4ZA 2I88A 1Q1FA 1MODA 3ZJQA 2OHAA 4YU3B 108MA 1GCVB 1XYEB 5ILEA 1Y8IB 3PI8B 4KJTA 4A8KA 2O5QX 2UUMX 4DWTA 5AQDA 1YHRA 2HBEB 1DLYA 1ECAA 2H35A 1B33A 1NQPB 1ABYB 2V1IA 1YMBA 4PQ6A 4F0TA 1ALLA 1HACB 2HHBB 1HGBA 1O1JA 1DO7A 3WTGB 2GRFA 5CNDA 3ZHWA 1R1XB 4ZIZA 1B86B 1DO1A 1YEOB 1Y8WA 2ZFOB 2XKGA 5B84A 1UVJA 4MQCA 3FEWX 2HZ1A 4MQGA 3TLDA 1G08A 2FALA 1CIKA 2AUPA 2C0KA 1IRCA 1AJGA 2V1GA 3BJ2A 3O89A 4FWYA 1DXCA 4MXLA 1Y31A 3K9ZA 1Y09B 4Z8KB 1LTWA 2ZLVA 2H8DA 1EBCA 3GOUB 2DN3A 1MWCA 2G0SA 1Y4PB 1R1XA 1DO3A 3WTGA 1HBHA 3BCQA 5M3SA 5E29B 2D2NC 3QM9A 2EF2A 2ZLTA 3O2CB 1QXEB 5EQMA 1LHSA 2MGKA 1DXUB 2ZS1C 3RJNB 5HU6B 1HSYA 2MGLA 1YHUA 1GCWB 2R4XA 1HABA 1QXDB 3NMMB 4TMAB 4OF9A 1MLOA 1F5OA 4ROMB 1CQXA 1HV4A 1HHSA 1CLSB 1Y4QB 2ZSQA 1DXDA 1YG5B 3NL7B 2ZLVB 5AZQA 1Y0WA 2DXMB 3MYNA 5CN5A 3AT6A 4A8MP 1Y4GB 1BBBA 1M6CA 1YHUD 2VYZA 3BOMB 4YJJA 2DKAA 1C40B 3WI8A 1QI8B 2DN2A 3QQQA 5JDOD 3G4YA 2GTLB 4H2LB 3BRPA 2DN1A 3UHEA 1RSEA 1NS6B 3G4QA 1CO9A 1NIHB 1COHB 3A2GA 1J7SA 3U3EA 1YCBA 1MBSA 2MB5A 1MYGA 1Y0TB 3R0GA 4NI0A 2D60B 3A59B 4N7NB 4PQCA 1UVLA 1IRDB 3OVUC 5E83B 1A00B 1I7YB 1MLSA 1YGFA 3GQPA 4C0NA 2D2MD 2D2NA 3VRFA 2FRKX 1UX9A 1O1OB 1SI4B 2V1FA 2GTLC 1WACA 3DR9A 4N7OB 3E5OA 2VEEA 3BA2A 1YOIA 3WCPB 1URYA 1BZZA 1NAZA 2QSSB 1MOBA 3UHIA 3BCQB 4GZGA 5E6EA 3ECZA 3HENA 1ECDA 1MDNA 1DM1A 1LFTB 2ZLXA 4ZVAA 3GOUA 3V2ZA 4ILZA 1MOAA 3QMAA 3ZOLA 3K8BA 2MYAA 1JP8A 1M6MA 3KMFC 4MQHA 3GYSA 2C7LA 1GVHA 1O16A 3EOKA 3AT6B 3UHYA 5EV5A 3WCTC 5KDQB 5HLQA 1CG5A 1LH3A 1R1YB 3DHTA 5ILPA 2JHOA 5JGGB 5CN9A 1YE0A 103MA 2ZT2A 4KN3A 1HABB 1LFTA 2VLZA 3GKVA 3AG0A 4O4TA 2HBFB 4AVEA 3ECLA 1A01B 3OZWA 102MA 1LH7A 5B13A 3ZOMA 2UUNB 5C6EA 1UFJA 3SZKB 1CP5A 4DWUA 3DHRB 5AB8A 1ABWA 1GBUB 1O1OA 3QM6A 1T1NA 3TM3A 2W6VB 4M4BA 1DXTA 3QZZA 2GTLD 3A0GB 3O18B 3IC0A 1HBSA 1Y31B 5FVBA 3AQ5A 3E4NA 2AV0A 1RQ3A 1NPFA 1YIHB 1V4UB 1HGCB 1S69A 1MYTA 4N8TA 1MBNA 3KMFA 2MYCA 2FAMA 5AZRA 2B7HB 3QJCB 3P5QB 1V4UA 2LH7A 3A5AA 1NWNA 1C40A 3ARLA 1LFYA 2LH3A 3AQ6A 2D5ZA 2C7JA 1J3FA 1JEBB 1SDLB 2VYYA 2ZSOA 1Y0WB 1OUUB 1ABSA 1JZMA 3WCUA 1NZ3A 2ZS1B 3EU1A 2VLYA 1LJWA 1F99B 3CY5B 1GDKA 1QXDA 1B8DA 1CBMA 3UHNA 2Z6NA 4HBIA 1RTXA 4OODA 4LMXB 1V4WB 1RQAA 3MN0A 1X9FD 6HBWB 1Y5FB 1PHNB 1HLMA 4MBAA 1TESA 1EBTA 1HHOA 3UBVA 2ZT0A 1HBAA 1ON7A 1NY9A 1YEVB 4MQKA 4YU4B 1FN3B 2DN3B 1HDSB 5CNFA 1XZUA 1YH9A 1X9FA 1A3OA 3AT5A 2SPMA 1HGAB 3M38A 1CPWA 2ZS0B 3SDNA 1V9QA 1OR4A 4NS2A 3IC2B 4C44A 2M6ZA 3ZJLA
chains in the Genus database with same CATH topology
3KVSB 2V8AA 4GY3A 2BV8A 2UUMA 4GY3B 4F0TB 3O2CB 3KVSA 1PHNA 1ALLB 2V8AB 3V57B 1XF6C 1QGWC 2UUMB 2VJHB 2VJRA 1B8DB 1KN1A 3O18A 1KTPA 4N6SA 2C7JA 2VJTA 4L1EA 2VMLB 1GH0B 2C7LA 3DBJB 5B13G 1F99A 4RMPB 4GXEB 1I7YA 2C7LB 4F0UB 5FVBM 4Z8KA 4L1EB 2C7JB 2J96A 2UUND 1KTPB 4GXEA 5AQDM 1EYXA 2UULC 4PO5A 1F99B 4RMPA 3DBJA 3V57A 4YJJA 3V58B 4N6SB 2UUMX 3MWNA 1XG0C 5AQDA 1B8DA 2VJHA 4Q70A 3BRPB 2VJTB 1B33A 4XXKA 2BV8B 4LM6B 1LIAA 2UULA 3O2CA 4LMXB 4XXIA 2UULH 1HA7B 2UUNA 3BRPA 4F0TA 5B13A 1ALLA 1PHNB 2UULB 4Q70B 2UUNB 4ZIZA 1HA7A 1B33B 1JBOB 1LIAB 3V58A 1CPCB 1ON7A 4PO5B 4YJJB 1EYXB 2C7KB 4H0MA 4F0UA 1I7YB 4LMSB 3L0FB 4Z8KB 4H0MB 1KN1B 3O18B 3L0FA 2C7KA 2UULD 2VJRB 1JBOA 5FVBA 2VMLA 1CPCA 1GH0A 1ON7B 4ZIZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVS B;  2V8A A;  4GY3 A;  2BV8 A;  2UUM A;  4GY3 B;  4F0T B;  3O2C B;  3KVS A;  1PHN A;  1ALL B;  2V8A B;  3V57 B;  1XF6 C;  1QGW C;  2UUM B;  2VJH B;  2VJR A;  1B8D B;  1KN1 A;  3O18 A;  1KTP A;  4N6S A;  2C7J A;  2VJT A;  4L1E A;  2VML B;  1GH0 B;  2C7L A;  3DBJ B;  5B13 G;  1F99 A;  4RMP B;  4GXE B;  1I7Y A;  2C7L B;  4F0U B;  5FVB M;  4Z8K A;  4L1E B;  2C7J B;  2J96 A;  2UUN D;  1KTP B;  4GXE A;  5AQD M;  1EYX A;  2UUL C;  4PO5 A;  1F99 B;  4RMP A;  3DBJ A;  3V57 A;  4YJJ A;  3V58 B;  4N6S B;  2UUM X;  3MWN A;  1XG0 C;  5AQD A;  1B8D A;  2VJH A;  4Q70 A;  3BRP B;  2VJT B;  1B33 A;  4XXK A;  2BV8 B;  4LM6 B;  1LIA A;  2UUL A;  3O2C A;  4LMX B;  4XXI A;  2UUL H;  1HA7 B;  2UUN A;  3BRP A;  4F0T A;  5B13 A;  1ALL A;  1PHN B;  2UUL B;  4Q70 B;  2UUN B;  4ZIZ A;  1HA7 A;  1B33 B;  1JBO B;  1LIA B;  3V58 A;  1CPC B;  1ON7 A;  4PO5 B;  4YJJ B;  1EYX B;  2C7K B;  4H0M A;  4F0U A;  1I7Y B;  4LMS B;  3L0F B;  4Z8K B;  4H0M B;  1KN1 B;  3O18 B;  3L0F A;  2C7K A;  2UUL D;  2VJR B;  1JBO A;  5FVB A;  2VML A;  1CPC A;  1GH0 A;  1ON7 B;  4ZIZ B; 
#chains in the Genus database with same CATH topology
 2SPO A;  1HHT P;  1LFZ A;  1YEN A;  1YDZ B;  3A5G A;  1XZV A;  1IDR A;  1V75 B;  3G53 A;  2BV8 A;  1K1K B;  4F0T B;  4XS0 B;  3PT8 A;  3SDH A;  2WCR A;  2AUO A;  1FAW A;  1J7W B;  1YVT B;  2HBC A;  5CMV A;  1YE2 B;  1QSI B;  1MWD A;  2VYW A;  1CH7 A;  3UH6 A;  1JZK A;  2VML B;  1SPE A;  1K0Y B;  1GCV A;  3WFX A;  4B3W A;  1LHT A;  3GQP B;  3HRW B;  1C7D A;  3DUT B;  3H57 A;  1KTP B;  1K0Y A;  1O1I A;  3KUN A;  4A8O A;  1EYX A;  3ZJP A;  2H8F A;  3UHV A;  1COL A;  1VXF A;  1YVT A;  1FAW B;  3G4V A;  2MBW A;  1O1L A;  2ZT4 A;  1J41 B;  1COH A;  4N7P A;  2FRI X;  3CIU A;  4FH7 A;  1OR6 A;  2V1J A;  1LFV A;  3QJB B;  1NZ2 A;  2G0V A;  1QI8 A;  1XDT T;  2DN2 B;  1JP9 A;  4JYQ A;  3GKT A;  5IKS A;  3WR1 B;  3IC2 A;  3S1J A;  4YJJ B;  1PBX B;  1N9H A;  4H0M A;  3UI0 A;  2WY4 A;  2BKM A;  1WMU A;  5JDO E;  1YFF B;  3B75 B;  1PBX A;  3MOU A;  1Y8H B;  2C7K A;  3MJP B;  1F5P A;  3WCV C;  1DLW A;  1MBD A;  1GCW A;  1YOH A;  1XXT B;  2GNV A;  1URV A;  4GY3 A;  1G0B A;  1V07 A;  1DXU A;  2BK9 A;  3HEP A;  1DDT A;  4HHB B;  1Y7D B;  1Y7Z A;  1MYJ A;  1A0U B;  2E2Y A;  1KFR A;  1KTP A;  4H0B A;  3ZJS A;  1VXB A;  4WJG 1;  2ZSX A;  1BZ1 A;  3DBJ B;  1LH6 A;  1I7Y A;  3LHB A;  4Z8K A;  3WCV B;  4A8Y A;  1JEB A;  3VAU A;  1EMY A;  4X0L A;  1A4F B;  2QRW A;  1J3Z B;  3HHB A;  1GDL A;  4PO5 A;  1MLG A;  1UVM A;  5HBI A;  2WTH A;  1S6A A;  1S0H B;  2XYK A;  2HZ3 A;  4NI1 B;  1XZ2 B;  4LPI A;  1BIN A;  4ODC A;  1YOG A;  1XZV B;  4XXI A;  1RVW B;  1S0H A;  3OO5 B;  3ED9 A;  1JL7 A;  2VEB A;  1HBI A;  101M A;  1NWI A;  1C7B A;  3HHB B;  1HDA A;  1CPC B;  1I3D A;  3BOM A;  2BW9 M;  2QFN A;  1Y4Q A;  1JY7 A;  4VHB A;  1HDS A;  4MPM A;  1WVP A;  4TWU A;  1J3Y A;  1O1N B;  1RPS A;  1O1I B;  1Y85 A;  2MGE A;  1BAB B;  3GQR A;  3PI3 A;  1S61 A;  1JY7 B;  1V4X A;  1L2K A;  1DWT A;  3VRE B;  2ZFB B;  3MKB A;  2Z6S A;  3LB4 A;  1Y7G B;  4F6J A;  4XDI A;  1LH2 A;  4ESA B;  2FRJ X;  1N9F A;  1A01 A;  1TOX A;  1MDT A;  3UGZ A;  4AE0 A;  1UT0 A;  2GKN A;  4F6F A;  4FWZ A;  1SPG A;  1Y0A A;  2LH6 A;  3A5B A;  3DHT B;  3ODQ A;  2HBD B;  3WCU B;  4NZI A;  1A9W E;  2M6Z B;  3ARJ A;  1CIO A;  1YHE B;  1LUE A;  2D5Z B;  1IBE A;  1MLQ A;  1MZ0 A;  2ZS1 D;  2UUL C;  1DKE B;  4WJG A;  2MGJ A;  1HRM A;  2MGF A;  2QLS A;  2DKC A;  3WR1 A;  3FH9 A;  5CHQ A;  3PEL A;  1XZU B;  4IRO B;  4N6S B;  3V2V A;  2X4A A;  2ZT3 A;  2OIF A;  1Y0A B;  2O5B X;  1Y5K A;  2W6X A;  1IWH B;  4ETV A;  3UHG A;  1VWT B;  3WCP A;  1NQP A;  3M39 A;  3LB2 A;  1D8U A;  1LFQ A;  2X49 A;  1JP6 A;  1Y0D A;  1V4W A;  3WCT D;  1SI4 A;  1XZ4 A;  1Y8I A;  2ZFB A;  3D1A A;  3UHK A;  4M4B B;  2D2M C;  1FDH A;  3CY5 A;  1XZ5 A;  2JLF A;  1A9W A;  3ZJI A;  2MYE A;  4ESU A;  3QM7 A;  4L7Y A;  3B75 A;  1O1M B;  1N9I A;  1VXD A;  2PGH A;  4HRT B;  1SDL A;  1G0A B;  1YGD B;  1A6K A;  1HDA B;  1J7S B;  4XS0 A;  2ZT1 A;  1DO4 A;  4H2L A;  4B02 A;  3P5Q A;  4NK1 A;  1GBV B;  2B7H A;  1RVW A;  3D4X A;  3HF4 A;  2V8A B;  1YZI B;  2Z8A A;  5EET A;  2ZS0 A;  1CG8 B;  2G0Z A;  2DXM A;  3EDA A;  2PGH B;  3AT5 B;  1A3O B;  1BZ0 A;  1J3Z A;  2C7L B;  5FVB M;  1GLI B;  2NRM A;  4L1E B;  1FSX A;  2UUN D;  1H97 A;  1MNH A;  1Y4R A;  1XZ7 A;  5CN8 A;  2ZLX B;  1O1P B;  3V57 A;  1BIJ B;  5CN7 A;  4U8U A;  109M A;  4HH1 A;  4JAC A;  5D5R A;  5HU6 A;  4Q70 A;  4BJU A;  4XXK A;  110M A;  1YE2 A;  3UBC A;  3O2C A;  3UHC A;  4AE1 A;  3D1K A;  2OLP A;  1GZX A;  6HBI A;  1X46 A;  1SDK B;  1FDH G;  3S66 B;  2ZSS A;  4Q70 B;  4UUR A;  1OFJ A;  3UHX A;  1HBH B;  1DXV A;  3ZJJ A;  3EU1 B;  1LFZ B;  1MTJ A;  4IRO A;  2QSP B;  1YGF B;  1CH5 A;  3PI2 A;  2H8D B;  1UVX A;  3MJP A;  2VM0 A;  5JGG A;  5EU2 A;  1MLU A;  3NG6 A;  2V1K A;  1RQ4 B;  3MVC A;  1X9F C;  3LB3 A;  5EYJ A;  2R1H A;  1CG8 A;  1FHJ A;  1U7R A;  1X9F B;  1JF4 A;  3PMC A;  1LA6 B;  3UHS A;  5CNG A;  4ZIZ B;  2YRS A;  5CNB A;  4ROL A;  1SPG B;  1HBA B;  2GNW A;  1CH3 A;  1HGC A;  3WCW C;  1YIH A;  1LFV B;  4ETT A;  3UHH A;  1NEJ A;  1QGW C;  4HRR B;  1BZZ B;  1HBS B;  1NZ5 A;  3AQ9 A;  3PI8 A;  1MYM A;  3A0G A;  3NL7 A;  3OZU A;  4SDH A;  1IOP A;  1BZP A;  3IA3 B;  1F99 A;  2R4Z A;  2O5L X;  1Y4B B;  1T1N B;  2JLG A;  3VRF B;  1MLK A;  3QQR A;  4NXC A;  4F6B A;  4A8F A;  2XKI A;  3O7N A;  2RAO A;  3UH7 A;  1Y8K A;  1A6G A;  3WCW B;  5KER A;  1FLP A;  1QSI A;  1XG0 C;  1NEJ B;  3WCU C;  5F0B A;  1H1X A;  2DKD A;  2HBC B;  3K3U A;  1J52 A;  3G4U A;  1HBB B;  1LIA A;  3MJU B;  1UC3 A;  1J40 A;  1G9V B;  1XZ2 A;  1LA6 A;  2JL9 A;  3PEL B;  2D5X B;  3M3A A;  3UGY A;  1Y09 A;  1A0Z A;  2YSK A;  2MGA A;  2O5T X;  4MBN A;  3EOK B;  3OJ1 A;  1NS9 B;  1MCY A;  112M A;  1YCA A;  3ODQ B;  4MQJ A;  1B86 A;  1YEO A;  2LH2 A;  2O5M X;  3BJ3 B;  4ERV A;  1ON7 B;  5C6Y A;  3NMM A;  2G11 A;  2QSS A;  1JW8 A;  2W31 A;  1NGK A;  1YMA A;  3SZK A;  1VXE A;  4A8Q A;  1Y5F A;  1Y45 A;  1NZ4 A;  4N7O A;  1RQA B;  1A6N A;  3GLN A;  3WCW A;  5KER B;  2ZFO D;  1G0B B;  2MHB B;  2ZLT B;  2O5O X;  1B8D B;  1F0L A;  1MYZ A;  3WCT B;  1N9X A;  1BZ6 A;  2ZWJ A;  1DUO A;  3BJ3 A;  3NUH B;  2ZS1 A;  1A3N A;  2VHB A;  1J3Y B;  1O1N A;  1R1Y A;  2O58 X;  1WLA A;  1XCH A;  3OK5 A;  2GKM A;  1JL6 A;  1LH1 A;  1Y83 A;  1MYI A;  1G09 B;  2R4Y A;  1JZL A;  1J7Y A;  3WFT A;  3BRP B;  2ZSZ A;  2VJT B;  3HXN A;  3K8B B;  2ZLU B;  4M4A B;  4G1V A;  1NXF A;  1Y8W B;  2ZFO A;  5SW7 A;  2QU0 B;  5CNC A;  3PT7 B;  5E6E B;  1QSH B;  1MOH A;  1Y0C A;  1MLF A;  4U8U D;  1LIA B;  4ZVB A;  3V58 A;  4PO5 B;  5CN4 A;  5HY8 B;  1IT2 A;  1O1M A;  4F4O A;  2H8F B;  1Y8K B;  2NSR A;  3IC0 B;  3GIO A;  1MYF A;  3WCV A;  3D7O A;  2HHD B;  1A87 A;  1C7D B;  3ONZ A;  5CN6 A;  1YHU B;  1A00 A;  3MBA A;  104M A;  1MLL A;  2VML A;  1AJ9 A;  4G51 A;  1Y0D B;  1YHU C;  2D60 A;  1LFL A;  5HY8 A;  5EE4 C;  1Y7Z B;  1QPW B;  1PMB A;  1Y2Z B;  1UVN A;  2W72 B;  5E29 A;  1AZI A;  1Y0C B;  1NS6 A;  1DTI A;  1QSH A;  4F68 A;  2DN1 B;  3V57 B;  1YEN B;  1O1K B;  2UUM B;  3UHQ A;  1YE0 B;  2VJT A;  3HXN B;  1JF3 A;  2YRS B;  4L1E A;  1J7Y B;  4PNJ A;  1U7S A;  2PEG A;  1NS9 A;  1Y83 B;  1CG5 B;  5B13 G;  2NSS A;  1YFF A;  1VXG A;  5ILR A;  1Y4G A;  5KDQ A;  4F0U B;  1GJN A;  1MNJ A;  4MQC B;  2IN4 A;  1CQ2 A;  2DC3 A;  3HEO A;  1HGB B;  1O1J B;  1Y5J A;  4MU5 A;  1MLH A;  3WCT A;  1HHO B;  3QJB A;  1GDJ A;  3G46 A;  3WCW D;  1BUW A;  2H35 B;  4N7P B;  4BJA A;  4B4Y A;  1O1L B;  1YGD A;  2UUL B;  2Z6N B;  4HRT A;  1GZX B;  1HA7 A;  1Y22 A;  1XYE A;  1EYX B;  5HAV A;  1CMY A;  4U8U B;  5EUI A;  1CBL A;  5B85 A;  3GDJ B;  3PI4 A;  4LMS B;  1VRF A;  1Y4R B;  1ECO A;  1S5X A;  3PI9 A;  2W6W A;  3G4R A;  1JWN A;  2EB8 A;  1CPC A;  3PIA B;  2QMB A;  3ZJR A;  1GH0 A;  1A0Z B;  1MNK A;  2IG3 A;  4MQG B;  1B0B A;  107M A;  3R5I B;  1YZI A;  2GTL A;  1G9V A;  3LB1 A;  5SW7 B;  1NPG A;  1YDZ A;  1ALL B;  1CH2 A;  4HSW A;  4U8U C;  3FH9 B;  1XF6 C;  2QFK A;  2R1H B;  2GLN A;  1KD2 A;  2LH5 A;  3VHB A;  3PIA A;  1BBB B;  4X0L B;  2RAO B;  1A6M A;  2BMM A;  2NRL A;  4L7Y B;  1DWR A;  3GDJ A;  1M9P A;  2J96 A;  3FS4 A;  5AQD M;  4ROM A;  5CNE A;  1RTE A;  1EWA A;  3UHW A;  2BLI A;  1MGN A;  1Y01 B;  5EUI B;  3QJE B;  3HYU B;  1HBG A;  1CMY B;  4FC3 B;  4TYX A;  1Y35 A;  1CH4 A;  3D1A B;  3UHZ A;  1SDK A;  3OO4 B;  3ARK A;  1YEQ B;  2NX0 A;  3D1K B;  1RH1 A;  1MBA A;  3WFW A;  2UUL A;  3OGB A;  4PQB A;  2ZSP A;  1CII A;  1YEQ A;  3WHM A;  1JPB A;  2HBF A;  3OO4 A;  3GKV B;  1VWT A;  2W6Y A;  1JBO B;  3RQR A;  2OH8 A;  1Y8H A;  1RPS B;  2C7K B;  4O1T A;  1OJ6 A;  1YVQ B;  2D2M B;  4KMV A;  1W92 A;  2GL3 A;  1FHJ B;  1OUU A;  3QM8 A;  1IBE B;  5JDO F;  4H0M B;  2BLH A;  3L0F A;  1YEU B;  1S5Y B;  2ZSY A;  1KD2 B;  3NG6 B;  4MQH B;  2ZLW B;  1UVK A;  1G08 B;  2R80 A;  2D5X A;  3BJ1 B;  4UZV A;  3ZJO A;  5CHR A;  2G0R A;  3CIU B;  3VNC A;  3KVS A;  4UIQ A;  3OZV A;  2HBS A;  2VJR A;  1KN1 A;  3S1I A;  3D17 B;  3ECX A;  1AJ9 B;  1XQ5 A;  1F63 A;  1VXH A;  2RI4 A;  3VRE A;  1DXT B;  2GRH A;  1VRE A;  5EYS A;  3QM5 A;  2RI4 B;  1Y85 B;  1XZ4 B;  3W4U B;  1MTK A;  4F4O B;  4RMP A;  1Y22 B;  3VRG A;  4NI0 B;  2HBS B;  3G52 A;  3LR9 A;  1HI8 A;  2VJH A;  2HHE A;  5EE4 D;  1AJH A;  2HCO A;  1MNO A;  1K1K A;  1HJT A;  2UUL H;  4IT8 A;  2G3H A;  1F65 A;  3HF4 B;  1TU9 A;  3D4X B;  1MKO A;  1Y4F A;  2G10 A;  1YIE B;  1UVI A;  1MWB A;  2ZLU A;  2R80 B;  4L2M A;  1UIW B;  3MYM A;  4M4A A;  5HLU A;  4ODC B;  1C7C B;  1VXA A;  4H07 A;  1SHR B;  1YEU A;  2D2N D;  1I3E A;  1Y4V B;  1Y46 A;  1OFK A;  4HH0 A;  4F0U A;  2VRY A;  5MBN A;  1SHR A;  1CLS A;  1YVQ A;  3ZJN A;  1UVY A;  4MQK B;  4YU4 A;  2G14 A;  2MGI A;  2MYB A;  2XKH A;  3ZJH A;  1DXV B;  2WCQ A;  1MNI A;  4KMW A;  3QZX A;  1A0U A;  3S65 B;  1QPW A;  3MKB B;  3S48 C;  111M A;  1LFL B;  1MLM A;  4BS9 A;  2GDM A;  1OUT B;  4TWV A;  3ZH0 A;  3QJE A;  2MYD A;  1HBR B;  3HC9 A;  5JDO C;  4F6I A;  1DWS A;  5JOM A;  4MQJ B;  2AUR A;  3FS4 B;  1XZ7 B;  3LQ9 A;  2QLS B;  2HHD A;  2MGG A;  3D7O B;  3LQD B;  1DKE A;  1IRD A;  3E55 A;  1SGK A;  3EDB A;  1XQ5 B;  2AV3 A;  4FWX A;  1BZ0 B;  1C7B B;  4NK2 A;  1Y4V A;  3V58 B;  2OHB A;  2VLX A;  3MWN A;  3IXF A;  3PT8 B;  3KUO A;  2HZ2 A;  1THB A;  1Y7C A;  3OO5 A;  1NIH A;  2HBD A;  1KR7 A;  4AVD A;  2BV8 B;  1MOC A;  3PT7 A;  1ASH A;  3AQ8 A;  1YIE A;  1GBV A;  1ABY A;  1RQ3 B;  1HI0 P;  1B33 B;  2HCO B;  1V5H A;  2O5S X;  3VRG B;  3WCU D;  3UHT A;  2DHB B;  3E5I A;  1BZ1 B;  4MAX A;  3LR7 A;  2D2M A;  1HV4 B;  1FN3 A;  1A3N B;  3GQR B;  1BAB A;  2W6V A;  1YEV A;  3DUT A;  1XZ5 B;  1MLN A;  3PMD A;  1BZR A;  1OUT A;  1JBO A;  1XY0 A;  2LH1 A;  1Z8U B;  2DHB A;  1MLJ A;  4MXK A;  3WHM B;  2V1E A;  1Y7D A;  1OBM A;  3D17 A;  2HBG A;  4HRR A;  3NML A;  1QXE A;  5ILM A;  2ZST A;  3PI1 A;  1BUW B;  2G12 A;  4GY3 B;  1VHB A;  2R50 A;  1Y35 B;  2MGH A;  4FC3 A;  2D6C A;  3HYU A;  4ROL B;  1DUK A;  4A8W A;  1V75 A;  4N6S A;  1M9P B;  4DC8 A;  3GQG A;  1THB B;  4FH6 A;  1MYH A;  2ZLW A;  1WMU B;  4GXE B;  3UH3 A;  2W72 C;  1X3K A;  1RQ4 A;  2MGM A;  2C7J B;  1MBO A;  2PEG B;  3GYS B;  4GXE A;  4F6G A;  2ZS0 D;  2ZFO C;  3QJC A;  1YMC A;  3DBJ A;  2QSP A;  1YH9 B;  1HDB B;  3UH5 A;  1MKO B;  1Y4F B;  1GDI A;  3GK9 A;  1HBR A;  3ASE A;  1HAC A;  2HHB A;  4N8T B;  5D1V A;  4LM6 B;  5EOH A;  3S66 A;  2W72 A;  1LH5 A;  2HHE B;  1HBB A;  1CO8 A;  2EVK A;  1MLR A;  1Y7G A;  3W4U A;  1FSL A;  3G4W A;  4O2G A;  1CH9 A;  2D2N B;  1MBC A;  1XY0 B;  2MGC A;  2ZSN A;  1Y4B A;  3GUQ A;  1FSX B;  4F6D A;  3RJ6 A;  1GLI A;  1ABW B;  2Z6T A;  3DHR A;  1KN1 B;  3A59 A;  4N7N A;  2VJR B;  2LHB A;  1J7W A;  2GRZ A;  2AA1 B;  1ITH A;  2FRF A;  3KVS B;  3TM9 A;  1DTM A;  4HSX A;  3RGK A;  2R4W A;  2QU0 A;  2AUQ A;  1S56 A;  3AQ7 A;  1CH1 A;  2BNL A;  3R5I A;  4NI1 A;  1G09 A;  4MQI B;  1S5Y A;  1J41 A;  1Y7C B;  2ZSR A;  3WFU A;  1G0A A;  2AA1 A;  1GH0 B;  1YG5 A;  2QMB B;  3H58 A;  1BVC A;  3M3B A;  4A8S A;  1BVD A;  4RMP B;  5F2A A;  1A4F A;  1HCO B;  4QAU A;  2ZS0 C;  3LQD A;  4ETU A;  3HRW A;  4DC7 A;  2BWH A;  2G0X A;  2V1H A;  2EKU A;  2KSC A;  4G1B A;  1GBU A;  1UX8 A;  3UHU A;  2MHB A;  3NFE A;  6HBW A;  4ERT A;  1IT3 A;  3QJD A;  4WCH D;  2Z85 A;  1LFQ B;  1Y45 B;  1HA7 B;  4HHB A;  2CMM A;  2UUN A;  3ZJM A;  5C6E B;  2MGB A;  3S65 A;  1CP0 A;  3QJD B;  5HLX A;  4G51 B;  1IWH A;  2WTG A;  3NFE B;  3UHR A;  1Y5K B;  1LJW B;  1XXT A;  1BJE A;  1BIJ A;  3BJ1 A;  1FCS A;  1Y4P A;  1O1P A;  1HDB A;  1UFP A;  1Y5J B;  3ONZ B;  3UHB A;  5E83 A;  2EVP A;  1UMO A;  2EKT A;  1MBI A;  1HCO A;  4NXA A;  1YHE A;  3L0F B;  3BJ2 B;  105M A;  1Y0T A;  1LFY B;  1MTI A;  2UUL D;  1Y46 B;  1HGA A;  5MBA A;  1VXC A;  1HI1 A;  1EW6 A;  3GQG B;  4MQI A;  5KKK A;  1JDO A;  2OH9 A;  1C7C A;  2V8A A;  1UIW A;  1ECN A;  2EB9 A;  1J40 B;  106M A;  1O1K A;  2UUM A;  3WCV D;  3A9M A;  3MJU A;  2SPL A;  3ZTA A;  1PHN A;  2SPN A;  4O35 A;  3UHD A;  2BLJ M;  7HBI A;  4ESA A;  4F69 A;  1YHR B;  2HBE A;  2MGD A;  1Y2Z A;  1SWM A;  2VJH B;  3O18 A;  1S5X B;  3PI9 B;  1HLB A;  4YU3 A;  1V4X B;  3ORD A;  4O4Z A;  2I88 A;  1Q1F A;  1MOD A;  3ZJQ A;  2OHA A;  4YU3 B;  108M A;  1GCV B;  1XYE B;  5ILE A;  1Y8I B;  3PI8 B;  4KJT A;  4A8K A;  2O5Q X;  2UUM X;  4DWT A;  5AQD A;  1YHR A;  2HBE B;  1DLY A;  1ECA A;  2H35 A;  1B33 A;  1NQP B;  1ABY B;  2V1I A;  1YMB A;  4PQ6 A;  4F0T A;  1ALL A;  1HAC B;  2HHB B;  1HGB A;  1O1J A;  1DO7 A;  3WTG B;  2GRF A;  5CND A;  3ZHW A;  1R1X B;  4ZIZ A;  1B86 B;  1DO1 A;  1YEO B;  1Y8W A;  2ZFO B;  2XKG A;  5B84 A;  1UVJ A;  4MQC A;  3FEW X;  2HZ1 A;  4MQG A;  3TLD A;  1G08 A;  2FAL A;  1CIK A;  2AUP A;  2C0K A;  1IRC A;  1AJG A;  2V1G A;  3BJ2 A;  3O89 A;  4FWY A;  1DXC A;  4MXL A;  1Y31 A;  3K9Z A;  1Y09 B;  4Z8K B;  1LTW A;  2ZLV A;  2H8D A;  1EBC A;  3GOU B;  2DN3 A;  1MWC A;  2G0S A;  1Y4P B;  1R1X A;  1DO3 A;  3WTG A;  1HBH A;  3BCQ A;  5M3S A;  5E29 B;  2D2N C;  3QM9 A;  2EF2 A;  2ZLT A;  3O2C B;  1QXE B;  5EQM A;  1LHS A;  2MGK A;  1DXU B;  2ZS1 C;  3RJN B;  5HU6 B;  1HSY A;  2MGL A;  1YHU A;  1GCW B;  2R4X A;  1HAB A;  1QXD B;  3NMM B;  4TMA B;  4OF9 A;  1MLO A;  1F5O A;  4ROM B;  1CQX A;  1HV4 A;  1HHS A;  1CLS B;  1Y4Q B;  2ZSQ A;  1DXD A;  1YG5 B;  3NL7 B;  2ZLV B;  5AZQ A;  1Y0W A;  2DXM B;  3MYN A;  5CN5 A;  3AT6 A;  4A8M P;  1Y4G B;  1BBB A;  1M6C A;  1YHU D;  2VYZ A;  3BOM B;  4YJJ A;  2DKA A;  1C40 B;  3WI8 A;  1QI8 B;  2DN2 A;  3QQQ A;  5JDO D;  3G4Y A;  2GTL B;  4H2L B;  3BRP A;  2DN1 A;  3UHE A;  1RSE A;  1NS6 B;  3G4Q A;  1CO9 A;  1NIH B;  1COH B;  3A2G A;  1J7S A;  3U3E A;  1YCB A;  1MBS A;  2MB5 A;  1MYG A;  1Y0T B;  3R0G A;  4NI0 A;  2D60 B;  3A59 B;  4N7N B;  4PQC A;  1UVL A;  1IRD B;  3OVU C;  5E83 B;  1A00 B;  1I7Y B;  1MLS A;  1YGF A;  3GQP A;  4C0N A;  2D2M D;  2D2N A;  3VRF A;  2FRK X;  1UX9 A;  1O1O B;  1SI4 B;  2V1F A;  2GTL C;  1WAC A;  3DR9 A;  4N7O B;  3E5O A;  2VEE A;  3BA2 A;  1YOI A;  3WCP B;  1URY A;  1BZZ A;  1NAZ A;  2QSS B;  1MOB A;  3UHI A;  3BCQ B;  4GZG A;  5E6E A;  3ECZ A;  3HEN A;  1ECD A;  1MDN A;  1DM1 A;  1LFT B;  2ZLX A;  4ZVA A;  3GOU A;  3V2Z A;  4ILZ A;  1MOA A;  3QMA A;  3ZOL A;  3K8B A;  2MYA A;  1JP8 A;  1M6M A;  3KMF C;  4MQH A;  3GYS A;  2C7L A;  1GVH A;  1O16 A;  3EOK A;  3AT6 B;  3UHY A;  5EV5 A;  3WCT C;  5KDQ B;  5HLQ A;  1CG5 A;  1LH3 A;  1R1Y B;  3DHT A;  5ILP A;  2JHO A;  5JGG B;  5CN9 A;  1YE0 A;  103M A;  2ZT2 A;  4KN3 A;  1HAB B;  1LFT A;  2VLZ A;  3GKV A;  3AG0 A;  4O4T A;  2HBF B;  4AVE A;  3ECL A;  1A01 B;  3OZW A;  102M A;  1LH7 A;  5B13 A;  3ZOM A;  2UUN B;  5C6E A;  1UFJ A;  3SZK B;  1CP5 A;  4DWU A;  3DHR B;  5AB8 A;  1ABW A;  1GBU B;  1O1O A;  3QM6 A;  1T1N A;  3TM3 A;  2W6V B;  4M4B A;  1DXT A;  3QZZ A;  2GTL D;  3A0G B;  3O18 B;  3IC0 A;  1HBS A;  1Y31 B;  5FVB A;  3AQ5 A;  3E4N A;  2AV0 A;  1RQ3 A;  1NPF A;  1YIH B;  1V4U B;  1HGC B;  1S69 A;  1MYT A;  4N8T A;  1MBN A;  3KMF A;  2MYC A;  2FAM A;  5AZR A;  2B7H B;  3QJC B;  3P5Q B;  1V4U A;  2LH7 A;  3A5A A;  1NWN A;  1C40 A;  3ARL A;  1LFY A;  2LH3 A;  3AQ6 A;  2D5Z A;  2C7J A;  1J3F A;  1JEB B;  1SDL B;  2VYY A;  2ZSO A;  1Y0W B;  1OUU B;  1ABS A;  1JZM A;  3WCU A;  1NZ3 A;  2ZS1 B;  3EU1 A;  2VLY A;  1LJW A;  1F99 B;  3CY5 B;  1GDK A;  1QXD A;  1B8D A;  1CBM A;  3UHN A;  2Z6N A;  4HBI A;  1RTX A;  4OOD A;  4LMX B;  1V4W B;  1RQA A;  3MN0 A;  1X9F D;  6HBW B;  1Y5F B;  1PHN B;  1HLM A;  4MBA A;  1TES A;  1EBT A;  1HHO A;  3UBV A;  2ZT0 A;  1HBA A;  1ON7 A;  1NY9 A;  1YEV B;  4MQK A;  4YU4 B;  1FN3 B;  2DN3 B;  1HDS B;  5CNF A;  1XZU A;  1YH9 A;  1X9F A;  1A3O A;  3AT5 A;  2SPM A;  1HGA B;  3M38 A;  1CPW A;  2ZS0 B;  3SDN A;  1V9Q A;  1OR4 A;  4NS2 A;  3IC2 B;  4C44 A;  2M6Z A;  3ZJL A; 
#chains in the Genus database with same CATH homology
 3KVS B;  2V8A A;  4GY3 A;  2BV8 A;  2UUM A;  4GY3 B;  4F0T B;  3O2C B;  3KVS A;  1PHN A;  1ALL B;  2V8A B;  3V57 B;  1XF6 C;  1QGW C;  2UUM B;  2VJH B;  2VJR A;  1B8D B;  1KN1 A;  3O18 A;  1KTP A;  4N6S A;  2C7J A;  2VJT A;  4L1E A;  2VML B;  1GH0 B;  2C7L A;  3DBJ B;  5B13 G;  1F99 A;  4RMP B;  4GXE B;  1I7Y A;  2C7L B;  4F0U B;  5FVB M;  4Z8K A;  4L1E B;  2C7J B;  2J96 A;  2UUN D;  1KTP B;  4GXE A;  5AQD M;  1EYX A;  2UUL C;  4PO5 A;  1F99 B;  4RMP A;  3DBJ A;  3V57 A;  4YJJ A;  3V58 B;  4N6S B;  2UUM X;  3MWN A;  1XG0 C;  5AQD A;  1B8D A;  2VJH A;  4Q70 A;  3BRP B;  2VJT B;  1B33 A;  4XXK A;  2BV8 B;  4LM6 B;  1LIA A;  2UUL A;  3O2C A;  4LMX B;  4XXI A;  2UUL H;  1HA7 B;  2UUN A;  3BRP A;  4F0T A;  5B13 A;  1ALL A;  1PHN B;  2UUL B;  4Q70 B;  2UUN B;  4ZIZ A;  1HA7 A;  1B33 B;  1JBO B;  1LIA B;  3V58 A;  1CPC B;  1ON7 A;  4PO5 B;  4YJJ B;  1EYX B;  2C7K B;  4H0M A;  4F0U A;  1I7Y B;  4LMS B;  3L0F B;  4Z8K B;  4H0M B;  1KN1 B;  3O18 B;  3L0F A;  2C7K A;  2UUL D;  2VJR B;  1JBO A;  5FVB A;  2VML A;  1CPC A;  1GH0 A;  1ON7 B;  4ZIZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...