1B3FA

Oligo-peptide binding protein (oppa) complexed with khk
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
total genus 193
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b3fA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b3fA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b3fA02
4F22A 4TOZA 5I2NB 2XX7A 4F39A 3G3GA 5EHSA 1B2HA 3SEXA 4DE8A 1FQFA 2QMXA 2A5TA 1MY2A 3OELA 1PBPA 1ELJA 3TTKA 1UTHA 3EF7A 5TPAB 4N13A 3K6XA 3LSWA 1B3GA 2V3UA 2FA7A 1FTLA 3Q26A 4THIA 2NUVA 1SBPA 1P1OA 2V3TA 3E9XA 4F2QA 1LSTA 2Q9TA 4O3AA 3SESA 1BIYA 3S2VA 2BJJX 2GHAA 2X7PA 2HZLA 3VDFA 4DXBA 1IXCA 3KGCA 2XD3A 2VGQA 4NF6A 4QFKA 4MFIA 2IEEA 2E1SA 1TFAA 3IB2A 4ZZAA 2NVUB 4LQ2A 1Y3QA 4EF1A 1XVXA 1QULA 2DE2A 1Y1MA 2QMWA 2OBGA 4FATA 5AA2A 2V84A 4YICA 4ONYA 2RKMA 4H67A 4R6YA 1RKMA 3OEMA 3MZBA 5FTHA 3BFTA 2ZNUA 3RTFB 2HEUA 3UORA 1T0KA 4GOTA 1AH5A 3TQLA 3N6TA 3RYBA 3E13X 3FIRA 5H8QB 4HCYA 1JEUA 1SW1A 1POY1 1IITA 4G8NA 3KBRA 4NF5B 3AXFA 2XXPA 4JSDA 3ILUB 4N6PA 5CMKA 3C9HA 3HSTA 4IY5A 3I6VA 3O6HA 3JV9A 1SDXA 1R6ZA 2O6AA 2ZXTA 4RK2A 4H1XA 3K6WA 3MVZA 4U4SA 2PMSA 3PMXA 2I49A 3T22A 3CIJA 2P0SA 5AA4A 2VD3A 5TP9B 3A09A 5JK4A 2I48A 3W9WA 1IXGA 4R75A 4TLLB 2NWJA 3HCQA 4X1BA 3THIA 5L9OA 1S9TA 1B3HA 1P1NA 3TCHA 1FQDA 1SI0A 2O51A 1MY1A 2DS9A 3M3LA 4HCWA 2X7QA 3UP9A 5DYHA 4EUOA 2QS1A 1Y20A 1ZIUA 3O28A 4IO7A 2F36A 3VLWA 2ZMBA 2Y7KA 4O3BA 5DT6A 4KI0E 1IEJA 3K02A 2F34A 2XXTA 2M8CA 2VOZA 4R6KA 1QKBA 1IIWA 4POWA 3BBRA 1ZMGA 3H03A 3W15C 3DM0A 5FHNA 3EN3A 3H6UA 4G68A 5DEXA 4DCXA 3FJMA 3TDJA 2RC9A 1MXZA 2ONSA 4IGTA 5K2YA 4YAHX 4YB5A 3TTRA 3JYRA 4F1UA 3F11A 2XXVA 2XXWA 3UA8A 1B4HA 4GQOA 2CMOA 1MPDA 2F7AA 2QS4A 4H5GA 5L9MA 1MM7A 1MQHA 1JQFA 1LAGE 2ESNA 1MRPA 2I4BA 3C33A 4JBZA 5ITOA 4AB6A 2ZYOA 4ELRA 2I0BA 1F9BA 2Z8EA 4U21A 4WXJA 4LVQA 3QUJA 3SEWA 1P1UA 1XVYA 2RF1A 3TUSA 3MPLA 1D4NA 2QJEA 4F3SA 1PC3A 4GXAA 1MQGA 1B51A 2GH9A 3PUWE 3LSLA 1DOTA 4HTGA 1MY3A 5ELVA 5H8QA 1PDAA 3TQWA 2Y7PA 3A3UA 3U72A 4RXLA 2HAVA 1SW2A 4OFLA 1WVJA 5TU0A 1JW5A 5I58B 3TCFA 4FJPA 1B3EA 4KYDA 3U8QA 3FUZA 4YMBA 1EZOA 2F8DA 2O68A 3ZKKA 3LBSA 3DRJA 4XTCQ 4R2BA 2XXIA 1MDQA 2ABHA 3UGWA 1B7ZA 1QUIA 3DELB 3ODBA 3SETA 3LC8A 4KD5A 3TFLA 5IAIA 2Q2CA 1A7LA 2XHDA 3S9LC 3HHFA 4IO5A 2Q89A 4ZEIA 4ZEKA 2O1MA 1AMFA 4AB5A 2UYEA 4OFJA 4EXLA 5I84A 1B1XA 1OVBA 2DWJA 3PAMA 3VE1B 3VLVA 5I59B 3FGSA 1GVCA 3OOAA 3C35A 3ECRA 1PBQA 3IOUA 3U1OA 4F2OA 1Y4CA 3PD8A 5F1QA 1HSJA 2H9BA 3IJXB 1WODA 4RK9A 4BDMA 1II5A 2ZNSA 2IA4A 3W9VA 4ELQA 4IGRA 2Y7RA 3EHUA 4G4PA 4OTEA 3D4GA 2PT1A 2I3WA 2Y7IA 2GFEA 2H25A 2PVUA 4M4GA 3DRGA 1LAFE 5AA2D 5KCJB 1TXFA 2V25A 1QJMA 1I69A 4MH5A 3TEPA 2DOJA 3MVWA 4PQJA 1DPEA 1MY0A 4OMBA 2R9JA 1SYIA 4QSEA 5DTBA 1B0LA 4XXUA 1XS5A 4JWYA 3HHGA 3PMVA 2AL4A 3IX1A 3M3FA 1B7UA 4MLQA 1M5CA 3C4MA 4QFNA 3FZVA 1SW4A 2AIXA 2B4LA 3C36A 3MZ1A 2Z23A 4NF4A 1IZ1A 1Y1ZA 3LVUA 3R26A 1USYE 4GVOA 3FV2A 4RYAA 4ECFA 1BP5A 1DMBA 3K01A 1PEBA 2RC7A 3K00A 3QSLA 4WEPA 1Z7NE 3Q27A 4QSDA 4R74A 4UA8A 3SERA 3TMGA 4XKRA 3PUZE 4QFOA 3DRIA 1B40A 2OK2A 3FXQA 1LCFA 4JWOA 3MVXA 3TKDA 3WAEA 4OERA 3V89B 2RC8A 3G3IA 4NE4A 3KOTA 4Q30B 4PE5B 3N94A 2Q8JA 5EHMA 2OZZA 2Q2AA 4I9DA 3KN3A 4FECA 2Y84A 3T9HB 4F3BA 2O7UA 1MXWA 2F6GA 1MQJA 3IOVA 3OEKA 4ZS9A 4DXUA 1RYOA 5I56B 4LZ5A 4OESA 2H4IA 1B3FA 4YKJA 1OMPA 1YCJA 3T93B 2WOLA 3FVKA 1RYXA 3S9NC 1JW1A 5HM4B 1NNPA 1VFEA 3PGFA 5DEXB 5I2NA 2Z8DA 4U2RA 1LLSA 1NNTA 4H6DA 4TQUQ 3MW0A 1GGGA 1LBBA 4JXIA 3QK6A 3IK6B 5KDTB 2REJA 2F6PA 1M5BA 4FAJA 4Z7EA 3HPIA 2DP8A 4FIMA 5TPAA 1FQEA 1B3LA 1SYHA 4Q8RA 5ICQA 3IAZA 4R72A 4OZ9A 3ONMA 3KZGA 5I2KB 2ZNTA 2HCAA 2P1SA 3PV0E 4ELPA 1EU8A 2XXRA 4LZ8A 1Y9UA 4IO4A 4KR5A 2XXYA 1YAEA 3MWBA 4ESWA 4NF6B 2D21A 3ZKLA 1B4ZA 1FTMA 1JVXA 1MXUA 3IO4A 3O6IA 3KN7A 3HN0A 3ZS6A 5L9SA 3OMBA 2QL3A 1Q1KA 4RA1A 3FVGA 5H8HA 1IUDA 3PMWA 4NF8A 1EH3A 2KLFA 3B6TA 3TTNA 1R9QA 5H8NA 4MF3A 3GLBA 3SKPA 3FASA 3OSQA 4GF8A 4ZE8A 5CRYA 1JETA 1MXVA 1ZBMA 2H99A 2QS3A 3MP8A 4GWOA 4EXKA 3RY3A 5H8FB 3RNNA 1O7TA 3MP1A 4NF5A 4BDRA 4LP2B 3RN8A 2DQVA 4C1TA 4U23A 1JEVA 4LUBA 4R9FA 4OEVA 2ONRA 1ZKBA 4JDFA 4YZZA 3C34A 4R2FA 5ISUA 2DXRA 3EHSA 5H8NB 4G77A 1XHYA 4OWDA 1B5JA 2F35A 4ZEDA 2UXAA 4C0RA 1S7YA 1JNFA 3H4ZA 1FQBA 1MY4A 3IB1A 1N3XA 4ZECA 5DVJA 2A5TB 4WKMA 4OQOA 3V5AA 4PFTA 4LQ5A 3MVYA 2GRVA 1LFHA 2A5SA 4OYVA 4EQ7A 2HZKA 4OEUA 1I6QA 4XKNA 1I6AA 1B5IA 3O2AA 3B6WA 2NOOA 3CHGA 4LA9A 4YB7A 2OWSA 1KWHA 3RTWB 2O7IA 2R71A 1VSOA 1XC1A 1B5HA 1MQDA 1LFIA 1TT1A 3CFLA 2V3QA 3OD7A 3V8XB 4KPTA 1MH4A 4OFOA 2F78A 1B58A 2DWAA 3GBAA 3RT6B 3Q25A 1R1NA 1CB6A 2V93A 4X1DA 4FE8A 5CI5A 1PB9A 4I1DA 4U1ZA 2D3IA 1Z7ME 1UTBB 1Y4TA 4FEDA 2QPQA 4IO3A 5ICTA 4FORA 2LAOA 3O29A 3UN6A 5DVFA 3OENA 4X9TA 4M1VA 5JEIA 3MAMA 2Z8FA 5EYFA 3KOSA 3G7WA 2PT2A 4PFUA 3ILTB 3PPRA 2I3VA 3FD3A 4NTLA 4PETA 3L6GA 4WEDA 3EQ1A 3S9MC 2QRYA 1YTVA 2CZLA 1OIBA 5CM6A 3QXMA 3PUYE 1XOCA 1MXYA 3G3FA 3KSXA 3N26A 3OSRA 4KYSA 4BDLA 4QFLA 1D9YA 2F97A 1SD3A 1R9LA 1I6BA 2ONKE 1B32A 2AL5A 1B46A 2XXUA 3E4RA 3EHTA 4G2ZA 3ZSFA 4BDQA 3HO7A 2OCUA 4MBPA 1BTJA 1ATGA 1D3KA 2XX8A 4PP0A 4F19A 4I62A 1L5TA 1N84A 1PB7A 3R6UA 1FQAA 1NL5A 3T96B 4EDPA 2WOPA 4GIZA 3FVNA 4MLVA 3VV5A 4DIGA 5IKBA 3V83A 2RCAA 3TELA 2DE4A 3B6QA 4XIGQ 3VXBA 2XXXA 3H06B 4OXVA 3TODA 4IO2A 4IY6A 4P11A 4UACA 5JTYA 1NNFA 1QUJA 3JZJA 2WOKA 2ZYKA 3G3JA 1J1NA 3P7IA 3VVFA 1A8EA 3MC2A 3KFMA 1URDA 1SVXB 4U22A 5AE4A 3WAFA 2YLNA 1H45A 1URGA 1ZJLA 3LSFB 4H8JA 1HSLA 4NEDA 1TFDA 2PYYA 2XXQA 3USDA 1SI1A 3FXUA 3HV1A 4G8HA 4GXSB 1FCKA 4U4XA 4QFPA 2DVZA 2HFBA 3BFUA 3DLNA 4EQ9A 2NXOA 1POTA 2DWIA 4OETA 1B6HA 1H76A 1DSNA 1LAHE 1A40A 1NH7A 3H6VA 5BUUA 5CMCA 1N04A 3IOWA 3E3KA 1PB8A 3RUMA 3S4UA 4ZEBA 3CFXA 3FXRA 4H0WA 2G29A 4F18A 5CBSA 2FYIA 4GL8A 3K6UA 3UIFA 3B7DA 1B05A 1BKAA 1M5EA 1MQIA 4G68B 2X26A 4BLAA 1N7WA 3FATA 2VHAA 3CVGA 3G3HA 2UVIA 1EZPA 1YPNA 2YPNA 1USYH 5LOMA 5H8HB 4IO6A 3IL1B 4N07A 4Q5TA 2UVJA 3KEIA 1TWYA 4ELOA 2RCBA 1DTGA 1H44A 3CRBA 3N5LA 4G8MA 4GD5A 3RT8A 4YKIA 5CBRA 5H8SA 4DDDA 3D4CA 5AA3A 5HBCA 5H8FA 1A99A 4U1OA 5FHOA 1GTKA 1NKXA 1QVSA 3K1NA 3Q28A 1QUKA 2XX9A 1FTJA 1VE4A 4QSCA 1OLCA 2R6GE 2F7BA 2FNCA 1B1HA 1H43A 1QKAA 3PUXE 4OHNA 3TAJA 2F5XA 1D9VA 1US4A 5TP9A 3IORA 4JB7A 5FTIA 3C31A 4ZEFA 1XT8A 3DRKA 4HS7A 4EF2A 1WDNA 4H65A 4ISUA 4LATA 3VXCA 2H5YA 3IR1A 4R6HA 1UIUA 2HQ0A 2OJTA 3MQ9A 4QHQA 4YU0A 1P99A 1JVYA 2Z22A 2DWHA 3CR9A 3GBBA 3TZAA 5BWJA 3PPQA 3RYAA 4Z0IA 4G68C 2G93A 4R73A 2O69A 2QSXA 3GXAA 4DZ1A 4PFWA 2YJPA 3FJGA 4OVJA 1N7XA 3MPKA 1SW5A 1NMUA 3TTLA 2F7CA 1A55A 1O63A 2DXYA 1MPBA 2AYSA 2O1LA 5K2XA 1ZTYA 4NWCA 2H98A 3L6HA 3IO6A 3CI8A 2B3FA 1QW0A 3U93A 4NWDA 1OVTA 2VD2A 4AQ4A 4BDOA 3DRFA 3I3VA 4GL0A 3K4UA 5CMMA 1N0TA 1FW0A 1ZLQA 4RPNA 3KG2A 1GV8A 3C32A 3T9XB 2HXWA 5I59A 3RGYA 1LGBC 3FJ7A 2DYXA 3DP6A 3KN8A 3H7MA 5KCJA 1AIVA 4Q0CA 5M2VA 1DPPA 3DRHA 2VP1A 1N3WA 2I0CA 3K1MA 1UIVA 4JWXA 4KCDA 3T9UA 3M8UA 1OQHA 3RLFE 4F31B 2B3BA 3CSBA 2D5WA 4O3CA 5I57B 1UQWA 1N76A 3A3CA 5A5XA 1M5DA 3O6PA 1B7HA 4ZE9A 3K6VA 1A8FA 3PD9A 5I2KA 1AOVA 3N6UA 4I8CA 4EQBA 4YKKA 2THIA 4FEBA 1ZU0A 5J1DA 5DVIA 3OO7A 1LAXA 1B9JA 2Q88A 3VVEA 3SDFA 2WKYA 1AL3A 3H6TA 1EZ9A 3OO6A 1H3DA 1DTZA 3PPPA 3PUVE 1A54A 4QRZA 4RPOA 1LB9A 4E0WA 5I58A 4P0IA 4F1YA 2B65A 2PBWA 3FVOA 3T9VA 2W7YA 1US5A 1O64A 3TCGA 2E0SA 5HPQA 1FTOA 1M5FA 5JTYB 1VFDA 3DP4A 3MZ9A 3FTOA 1IXHA 3U92A 1LB8A 4F1VA 3KSJA 2UVHA 1MH3A 2XXHA 3K2DA 1JW4A 3CG1A 4GRKA 3SEYA 3VFJA 4HW8A 1MG1A 3Q29A 5I56A 5L8DA 3T66A 3O6GA 4YMAA 5AA4B 4PFYA 3CSGA 4KYEA 1UTHB 4RY1A 2ANJA 3PU5A 4F3GA 4POXA 2UVGA 5ITPA 1Y3PA 2OLBA 1NFTA 3K1PA 3KJTA 3O97A 3QAXA 4GLIA 3RPWA 1ANFA 4F29A 3R7XA 2Y7WA 3SEVA 1BLFA 4LONB 5CC2A 1HSEA 1VR5A 3CG3A 1P1QA 3GZGA 3OO8A 3IB0A 3SEUA 3FV1A 1S50A 3RQTA 2P2AA 3TPAA 1OLAA 1MPCA 2RINA 4TLMB 3DP8A 2XD2A 4P0GA 5AA2B 1LBCA 5KDTA 3PPOA 1NH8A 3MP6A 1FTKA 3OO9A 2ALUA 4QF9A 5FHMA 5B7DA 2I6EA 2QS2A 2I58A 4ND9A 5CMBA 3TYHA 4DLDA 4BDNA 4C1UA 3S9EA 1NNKA 5KZTA 3H3GA 4H5FA 1UTBA 1MXXA 3M3KA 3H6WA 4KFQA 4L17A 5AA1A 1MDP1 4GFRA 2B4MA 1Q35A 4K3FA 3IJOB 4NF8B 3TTMA 1B52A 1Y3NA 3O66A 3PPNA 4YB6A 2OWTA 4X48A 3UK4A 5I57A 1MS7A 4NF4B 1GR2A 1B0HA 2ZYMA 2GHBA 4ESXA 5A5XB 3EPEA 3MJNA 1FQCA 3OXNA 4XKPA 3VVDA 4LZ7A 1URSA 4IB2A 4JSOA 4DCYA 3QYTA 2HAUA 1IQ7A 1SQYA 2UYFA 3IOTA 3O9PA 1IXIA 4XKQA 4RJZA 4H8IA 4ZDMA 3QIMA 3LSXA 2REGA 3CFZA 3QUFA 4KCCA 3I5OA 1LCTA 4KHZE 1MM6A 4R9GA 3LUYA 4OENA 4RNSA 4YKPA 3KJ7A 2PX1A 3LR1A 4DXCA 3MBPA 2O84X 3G3KA 1CE2A 3VLUA 2DE3A 2DVCA 4NMYA 4ZZEA 2I4CA 3K0VA 3MUQA 4F3PA 2ZYNA 5F7VA 1LFGA 4E0XA 2DSFA 3BKIB 4KQPA 3U94A 5B70A 1OQGA 1P1WA
chains in the Genus database with same CATH superfamily
5I2NB 3RYDA 3G3GA 1EYKA 3EF7A 3K6XA 2V3UA 2V3TA 4O3AA 4OVRA 3S2VA 2BJJX 2GHAA 5I3SA 2VGQA 2IEEA 4ZZAA 1Y3QA 1XVXA 5ET8A 2Y5LA 4YICA 4ONYA 3UORA 1T0KA 1AH5A 3E13X 4O7IA 1JEUA 3ILUB 2XXPA 3HSTA 4IY5A 1SDXA 3T0JA 3FXBA 3K6WA 1NV4A 4U4SA 3PMXA 2I49A 3CIJA 1SI0A 3UP9A 4PAFA 3O28A 3LV0A 3BBRA 1ZMGA 3EN3A 3H6UA 5DEXA 1MXZA 5K2YA 4YAHX 3JYRA 3UA8A 4GQOA 2GQ1A 4JVCA 1MPDA 2F7AA 4H5GA 5L9MA 1MM7A 2I4BA 2ESNA 4PGNA 4U21A 4WXJA 2RF1A 4NF0A 4MNIA 2CEYA 4MX6A 1PC3A 1RDXA 3LSLA 1DOTA 5ELVA 1MY3A 1SW2A 1WVJA 5I58B 3U8QA 4PGPA 2O68A 3DELB 3S9LC 4ZEIA 1AMFA 2UYEA 5I84A 2DWJA 3OOAA 1LBXA 5I7IA 4F2OA 1Y4CA 1HSJA 2H9BA 3IJXB 1II5A 4QBAA 2I3WA 2Y7IA 3DRGA 4GX3A 1TXFA 1MY0A 4QSEA 2XWVA 4XXUA 3HHGA 5LTCA 1SW4A 3MZ1A 2Z23A 4NF4A 3LVUA 4RYAA 1NUXA 3Q27A 4QSDA 4NGUA 1B40A 3WAEA 4OERA 3V89B 4PE3A 2Q2AA 4MNPA 2Y84A 2O7UA 1MQJA 4LZ5A 2WOLA 3S9NC 1VFEA 1NNPA 5DEXB 1LLSA 1NV5A 1LBBA 4JXIA 1FBFA 4Z7EA 4Q8RA 4R72A 2P1SA 2KR0A 4IO4A 4ESWA 1YAEA 2D21A 1B4ZA 1JVXA 3KN7A 3OMBA 4RA1A 5H8HA 1R9QA 4MF3A 3SKPA 4GF8A 1JETA 3MP8A 2H99A 3RNNA 1FPKA 1JEVA 3C34A 4R2FA 5ISUA 4ZEDA 1S7YA 1JNFA 4ZECA 3V5AA 4WKMA 4OQOA 4PFTA 4LQ5A 3MVYA 2GRVA 4N91A 4OEUA 1I6QA 1LBVA 4YB7A 1KWHA 4N8GA 2R71A 5IM2A 1MH4A 2F78A 3RT6B 2DWAA 4N15A 3Q25A 1CB6A 4X1DA 1UTBB 4IO3A 2LAOA 3O29A 3UN6A 5EQ9A 3OENA 3KOSA 2PT2A 3PPRA 4OVSA 1OIBA 1RDZA 3QXMA 1LBYA 2ONKE 1I6BA 4N4UA 1BTJA 1D3KA 1EYIA 2XX8A 1L5TA 3R6UA 1NL5A 4EDPA 2WOPA 4GIZA 4O8MA 1D9QA 5JTYA 4UACA 2WOKA 4PC9A 3KFMA 4U22A 4H8JA 4NEDA 3FXUA 4UABA 5FBPA 2DVZA 3DLNA 4OETA 1CNQA 1DSNA 1LAHE 1A40A 3H6VA 1EYJA 3RUMA 2FVZA 3UIFA 1B05A 2QVVA 2VHAA 4DI4B 2YPNA 5LOMA 3B50A 3KEIA 1TWYA 4ELOA 1H44A 3N5LA 5CBRA 5H8SA 5AA3A 4HE1A 1QUKA 1VE4A 2F5XA 3C31A 1LBWA 3DRKA 4HS7A 4EF2A 1WDNA 3CR9A 5BWJA 3PPQA 2O69A 2QSXA 3GXAA 2YJPA 3FJGA 4OVJA 1N7XA 3TTLA 2DXYA 2H98A 3IO6A 3CI8A 1OVTA 4BDOA 4GL0A 1GV8A 5I59A 3IFCA 4PF6A 1OQHA 2B3BA 4O3CA 1UQWA 3A3CA 4OVTA 5A5XA 4PFBA 3BIHA 5J1DA 3SZPA 1B9JA 1NV7A 4RPOA 1H3DA 2WX9A 1RDYA 1A54A 1FPBA 2W7YA 1US5A 2E0SA 1IXHA 4HW8A 3K2DA 3SEYA 5I56A 3Q29A 1NV2A 2OLBA 1FBPA 1ANFA 3R7XA 5CC2A 3CG3A 1FPIA 1LEVA 3GZGA 1QGXA 3RQTA 5AA2B 3PPOA 3OO9A 1FTKA 3TYHA 1UTBA 4NF8B 4O94A 4X48A 2KQZA 2GHBA 5A5XB 3MJNA 4XKPA 4LZ7A 4DCYA 3IOTA 2WBDA 1IXIA 1MM6A 3LUYA 2F3DA 2CZHA 3G3KA 4F3PA 4E0XA 3U94A 1OQGA 1FJ9A 4F22A 4MHFA 1FQFA 1MY2A 5TPAB 3LSWA 2FA7A 1FTLA 1SBPA 1P1OA 2XWIA 2Q9TA 3SESA 3VDFA 2X7PA 4QFKA 4MFIA 2NVUB 4LQ2A 4FATA 2OBGA 5AA2A 2V84A 2RKMA 1RKMA 3OEMA 5FTHA 2ZNUA 2HEUA 4GOTA 5H8QB 2FIEA 4N6PA 3JV9A 2O6AA 2PMSA 4MJOA 2QVRA 5JK4A 4TLLB 2NWJA 3HCQA 4X1BA 3TCHA 5ET6A 2X7QA 2QS1A 2XXTA 4POWA 3H03A 3W15C 1FJ6A 2RC9A 2ONSA 3TTRA 2XXVA 1B4HA 2QS4A 5ITOA 4PFIA 3C33A 2Z8EA 1XVYA 1D4NA 4F3SA 4GXAA 4HTGA 1PDAA 3U65A 4OFLA 1JW5A 3LBSA 3DRJA 3ODBA 4KD5A 3TFLA 1A7LA 2HHMA 4ZEKA 2O1MA 4OFJA 3PAMA 1PBQA 1FPJA 5ET7A 1WODA 4RK9A 4ELQA 2Q8MA 2Y7RA 5AA2D 1LAFE 5KCJB 1QJMA 3MVWA 4PQJA 1DPEA 1SYIA 5DTBA 3NOHA 4IR8A 1B0LA 1K9ZA 4JWYA 3IX1A 1NV0A 3C4MA 3C36A 5HPQA 1Y1ZA 4ECFA 5EHSA 2RC7A 1Z7NE 3SERA 3PUZE 3DRIA 3MVXA 1FTAA 4NE4A 3KOTA 3N94A 2OZZA 3KN3A 4OANA 3OEKA 4ZS9A 4XFEA 5I56B 4OESA 2H4IA 1OMPA 1YCJA 3T93B 1JW1A 2FIXA 3PGFA 5KDTB 5IZZA 1M5BA 3HPIA 2DP8A 4FIMA 3BIGA 5TPAA 1B3LA 1IMBA 1SYHA 4OZ9A 3ONMA 2ZNTA 3PV0E 1EU8A 2XXYA 3MWBA 3ZKLA 3HFUA 3IO4A 3HN0A 3FVGA 1IUDA 1EH3A 3OSQA 5CRYA 4BDRA 4NF5A 2DDKA 2DQVA 4MIJA 4U23A 4C1TA 4OEVA 2DXRA 5H8NB 4G77A 1DCUA 1FQBA 5DVJA 2A5SA 2HZKA 2CZKA 3O2AA 3CFLA 2F3BA 4OFOA 1G0IA 4FE8A 4MNCA 2D3IA 1Y4TA 2QPQA 4FORA 4X9TA 4M1VA 2Z8FA 5EYFA 3G7WA 2I3VA 1LBZA 2QRYA 2CZLA 3PUYE 3KSXA 4KYSA 1D9YA 2F97A 4G8NA 3EHTA 1B32A 4PP0A 1N84A 4PTKA 3B6QA 3VXBA 3H06B 5DW8A 3TODA 4IY6A 4P11A 4H45A 1QUJA 1J1NA 3MC2A 1URDA 1URGA 3LSFB 1HSLA 1TFDA 1SI1A 4GXSB 4U4XA 4QFPA 3BFUA 1B6HA 1H76A 1NH7A 1N04A 3IOWA 1PB8A 3FXRA 4H0WA 1IMFA 2FYIA 3K6UA 3B7DA 2X26A 2UVIA 3IL1B 4GD5A 4YKIA 3D4CA 1A99A 4U1OA 1GTKA 3TMGA 2XX9A 4QSCA 1OLCA 2FNCA 4OHNA 1H43A 3PUXE 5TP9A 3IORA 4JB7A 3PTYA 4R6HA 2HQ0A 3MQ9A 1P99A 2Z22A 2DWHA 4G68C 2G93A 1NMUA 2F7CA 2AYSA 4NWCA 4KXPA 3I3VA 4RPNA 3KG2A 3C32A 2HXWA 1LGBC 3H7MA 1AIVA 1DK4A 5M2VA 1DPPA 3DRHA 2I0CA 2XWKA 1UIVA 4JWXA 3M8UA 3RLFE 4F31B 5I57B 4PAKA 3O6PA 1B7HA 1AOVA 5I2KA 4N17A 4YKKA 1KA1A 3A29A 2WKYA 1AL3A 3H6TA 3OO6A 4P0IA 4F1YA 3FVOA 1O64A 1FTOA 1M5FA 3DP4A 3U92A 4F1VA 1JW4A 3CG1A 3T66A 4YMAA 3CSGA 4KYEA 1UTHB 2ANJA 1FBEA 3PU5A 2UVGA 1Y3PA 1NFTA 3QAXA 4NAPA 2Y7WA 4NQ8A 1BLFA 4LONB 3FV1A 1FPLA 1OLAA 1MPCA 4TLMB 2XD2A 3MP6A 5EQ7A 4QF9A 5B7DA 5CMBA 2PFZA 4BDNA 1MXXA 4K3FA 3PPNA 3UK4A 4H46A 1MS7A 1B0HA 4GX4A 3OXNA 1URSA 4JSOA 1SQYA 2UYFA 3O9PA 4RJZA 3LSXA 3I5OA 4R9GA 4OENA 3E78A 3KJ7A 4DXCA 2O84X 3VLUA 1CE2A 2DVCA 4ZZEA 3MUQA 5F7VA 4PBHA 2DSFA 3BKIB 4KQPA 1KZ8A 4KCDA 1P1WA 4TOZA 2XX7A 2WYKA 1B2HA 3SEXA 4DE8A 2QMXA 2XXKA 3OELA 1PBPA 1ELJA 5IZ3A 3TTKA 2OX3A 1NUZA 4THIA 4MMPA 2NUVA 3E9XA 1LSTA 1BIYA 2HZLA 3KGCA 2XD3A 4JVDA 2MKZA 4JVIA 1TFAA 3IB2A 1QULA 2QMWA 4H67A 4P9KA 3TQLA 1VDWA 3RYBA 3FIRA 1POY1 2BJIA 4NF5B 3KBRA 4JSDA 5CMKA 3I6VA 3O6HA 2ZXTA 2XWOA 3B8BA 3MVZA 3T22A 2VD3A 5TP9B 3A09A 2I48A 3W9WA 5L9OA 1B3HA 2O51A 4HCWA 4NHBA 3M3LA 1Y20A 1ZIUA 2F36A 2ZMBA 4KI0E 4OA4A 3FBPA 4G68A 4HE2A 4IGTA 4YB5A 2XXWA 2CMOA 4EUOA 1MQHA 1JQFA 1LAGE 1MRPA 4JBZA 4AB6A 4ELRA 3SEWA 4P47A 1P1UA 3MPLA 3PUWE 5H8QA 3TQWA 2Y7PA 3U72A 2HAVA 4KYDA 2QFLA 3FUZA 1XI6A 4XTCQ 4R2BA 2XXIA 2ABHA 1B7ZA 3SETA 3LC8A 5IGAA 3FGSA 4N8YA 3ECRA 1FPGA 5F1QA 2Y5KA 4IGRA 4G4PA 4QXDA 1I69A 2DOJA 2CEXA 4OMBA 2R9JA 1XS5A 3FZVA 1IMEA 2B4LA 1USYE 3FV2A 1BP5A 5BUUA 3K01A 1PEBA 3K00A 4WEPA 5ICTA 4GBVA 4R74A 4XKRA 4JWOA 3FXQA 1LCFA 3TKDA 3G3IA 4Q30B 4PE5B 2Q8JA 4FECA 2WEFA 3T9HB 4DXUA 1RYOA 4YKJA 3FVKA 4I3YA 1RYXA 3KC1A 5HM4B 2Z8DA 4H6DA 3MW0A 3IK6B 2VT5A 1YXIA 5EQ8A 5I2KB 3KZGA 4P1EA 4ELPA 4LZ8A 1Y9UA 4KR5A 4NF6B 4PF8A 1MXUA 5ESYA 5L9SA 3ZS6A 3PMWA 4NF8A 3B6TA 3TTNA 3GLBA 3FASA 1MXVA 1ZBMA 2QS3A 4GWOA 3RY3A 1NV3A 1O7TA 4LP2B 2HXRA 4LUBA 4R9FA 1ZKBA 1XHYA 1B5JA 2F35A 2UXAA 4C0RA 4P3LA 1MY4A 2A5TB 3D1RA 2CZIA 4OYVA 4EQ7A 4XKNA 1I6AA 1B5IA 3B6WA 2NOOA 2OWZA 3RTWB 2O7IA 4MH5A 1VSOA 1TT1A 2V3QA 4KPTA 3GBAA 1B58A 5IZ3B 1R1NA 2V93A 1PB9A 4U1ZA 2WBBA 3MAMA 4NTLA 3FD3A 4PETA 4WEDA 3S9MC 4G61A 1YTVA 5CM6A 1MXYA 3N26A 3OSRA 4QFLA 4P8BA 2XXUA 2AL5A 1B46A 4G2ZA 3E4RA 4BDQA 2OCUA 4MBPA 4I62A 5IKBA 3FVNA 4DIGA 4NN3A 3V83A 3TELA 2L5VA 4AS5A 1NNFA 2ZYKA 3P7IA 3VVFA 1A8EA 5AE4A 2YLNA 3USDA 2XXQA 4G8HA 1POTA 2DWIA 3E3KA 3S4UA 4ZEBA 2XA5A 2G29A 4GL8A 1BKAA 1M5EA 4BLAA 1N7WA 3FATA 3G3HA 4Q5TA 2UVJA 3CRBA 4G8MA 4DDDA 3RPLA 5HBCA 5H8FA 3K1NA 3Q28A 1FTJA 5IZ1A 3VLVA 4P1LA 2F7BA 1B1HA 3TAJA 1SPIA 1D9VA 4ZEFA 4LATA 3VXCA 3IR1A 1UIUA 4YU0A 3TZAA 3RYAA 4Z0IA 4DZ1A 4PFWA 3MPKA 1A55A 1MPBA 5K2XA 1YZ0A 3L6HA 2B3FA 1QW0A 4NWDA 2VD2A 4AQ4A 1FW0A 5F24A 3FJ7A 2DYXA 3KN8A 4Q0CA 2VP1A 3T9UA 4P56A 1M5DA 1A8FA 2THIA 1ZU0A 3OO7A 1LAXA 4GWXA 3VVEA 3PUVE 1EZ9A 5IAIA 3PPPA 4I3EA 3T1BA 2B65A 2PBWA 1KA0A 3T9VA 3ROJA 1FBHA 3TCGA 1DBZA 1VFDA 3FTOA 1LB8A 3KSJA 2UVHA 1MH3A 3VFJA 1MG1A 5L8DA 4O7MA 4RY1A 4POXA 1K9YA 5ITPA 3K1PA 3KJTA 3O97A 3RPWA 1NI9A 1HSEA 1P1QA 3IB0A 1S50A 2RINA 1LBCA 5KDTA 2PCRA 5FHMA 2I58A 4H5FA 5KZTA 4F3GA 3M3KA 4N81A 4L17A 1MDP1 1Q35A 4DXBA 3TTMA 1Y3NA 3O66A 1FBGA 4YB6A 5I57A 4ESXA 1GR2A 3EPEA 5EYGA 1FQCA 4IB2A 2P3NA 3QYTA 2HAUA 1IQ7A 3QIMA 4KHZE 4RNSA 1LCTA 4MAGA 2DE3A 4NMYA 2I4CA 2ZYNA 2VPNA 4F39A 5EYHA 2A5TA 2V4CA 1UTHA 2ZZWA 4N13A 1B3GA 3Q26A 4F2QA 1IXCA 4NF6A 2E1SA 2QVUA 4EF1A 2DE2A 1Y1MA 4R6YA 3RTFB 3MZBA 3BFTA 3N6TA 4HCYA 1SW1A 1IITA 3IFAA 3AXFA 3C9HA 1R6ZA 4RK2A 4H1XA 4LN5A 2P0SA 5AA4A 4I40A 1IXGA 4PCDA 1Q9DA 4R75A 1NUWA 3THIA 1FRPA 1S9TA 1P1NA 5J16A 1FQDA 1MY1A 2DS9A 5DYHA 3VLWA 4IO7A 2Y7KA 4O3BA 5DT6A 1IEJA 3K02A 2F34A 2M8CA 2VOZA 4R6KA 1QKBA 1IIWA 3GYYA 3DM0A 5FHNA 4DCXA 3FJMA 3TDJA 3ISPA 4F1UA 3F11A 2HPGA 1NV1A 2ZYOA 2I0BA 1F9BA 4X04A 4LVQA 3QUJA 4XF5A 3TUSA 5A5LA 2QJEA 1MQGA 1B51A 2GH9A 3QMFA 4GWSA 3A3UA 4RXLA 5TU0A 4GWYA 3TCFA 4FJPA 1B3EA 4YMBA 1EZOA 2F8DA 3ZKKA 1MDQA 1FPDA 4N6KA 3UGWA 1QUIA 3MSTA 2Q2CA 2XHDA 3HHFA 4IO5A 2Q89A 4AB5A 4EXLA 1B1XA 1OVBA 3VE1B 5I59B 1GVCA 3C35A 4PAIA 3IOUA 4GWZA 2JJKA 3U1OA 1IMAA 3PD8A 4BDMA 2ZNSA 2IA4A 3W9VA 3EHUA 4OTEA 3D4GA 2PT1A 1G0HA 2GFEA 1FPFA 2H25A 2PVUA 4M4GA 2V25A 3TEPA 5ET5A 4MLQA 3PMVA 2AL4A 3M3FA 1B7UA 1M5CA 4QFNA 2AIXA 4GWUA 1IZ1A 3R26A 4GVOA 1DMBA 3QSLA 4DI3D 1NV6A 4UA8A 3LUZA 3E79A 4QFOA 2OK2A 2RC8A 1JP4A 5EHMA 2VPOA 4I9DA 4F3BA 4XEQA 1FSAA 1MXWA 2F6GA 4PFRA 3IOVA 4N6DA 1B3FA 2FHYA 5I2NA 4U2RA 1NNTA 4TQUQ 1GGGA 3QK6A 2R8TA 2F6PA 2REJA 4NG7A 4FAJA 1FQEA 5ICQA 3KBZA 3IAZA 4PDDA 2HCAA 2XXRA 4OVQA 1IMDA 1FTMA 3O6IA 2QL3A 1Q1KA 3MYUA 2ZZVA 2KLFA 4ZE8A 3RPLB 4EXKA 5H8FB 3MP1A 3RN8A 2ONRA 4YZZA 4JDFA 3EHSA 4OWDA 3H4ZA 3IB1A 1N3XA 1LFHA 1FBCA 3CHGA 4LA9A 2OWSA 1XC1A 3OD7A 1B5HA 1MQDA 1LFIA 3V8XB 5CI5A 4I1DA 1Z7ME 4FEDA 5DVFA 5JEIA 4PFUA 3ILTB 3L6GA 3EQ1A 1XOCA 3G3FA 4OVPA 4BDLA 1SD3A 1R9LA 3ZSFA 1FBDA 3HO7A 1ATGA 4F19A 1PB7A 1FQAA 3T96B 3VV5A 4MCOA 4MLVA 2RCAA 2PFYA 5I5PA 2DE4A 2XXXA 4OXVA 4IO2A 3JZJA 1AWBA 3G3JA 1SVXB 3WAFA 1H45A 1ZJLA 2PYYA 3HV1A 4EQ9A 1FCKA 2HFBA 2NXOA 5EQAA 5CMCA 3CFXA 4HXVA 2P3VA 4F18A 5CBSA 1YYZA 4G68B 1MQIA 3CVGA 1EZPA 5LDZA 1YPNA 1USYH 5H8HB 4IO6A 4N07A 2RCBA 1DTGA 3RT8A 5FHOA 1NKXA 1QVSA 3EKIA 2R6GE 1QKAA 1US4A 3KC0A 5FTIA 1XT8A 4H65A 4ISUA 2H5YA 2OJTA 4QHQA 4AS4A 1JVYA 3GBBA 1NUYA 4PDHA 4R73A 1SW5A 4FBPA 1O63A 2O1LA 1ZTYA 3U93A 3DRFA 3K4UA 5CMMA 1N0TA 1FPEA 1ZLQA 3T9XB 3RGYA 3DP6A 5KCJA 1INPA 1N3WA 3K1MA 3CSBA 2D5WA 4HE0A 1N76A 2ZZXA 3K6VA 4ZE9A 3PD9A 3N6UA 4I8CA 4EQBA 4FEBA 5DVIA 2Q88A 3SDFA 4QRZA 4NX1A 1DTZA 4E0WA 4GBWA 1LB9A 5I58A 4X8RA 5JTYB 3MZ9A 2XXHA 4GRKA 3O6GA 5AA4B 4PFYA 4PBQA 4GLIA 4F29A 3SEVA 1VR5A 3OO8A 3SEUA 1BK4A 4GX6A 2P2AA 4GWWA 3TPAA 1IMCA 3DP8A 4P0GA 1NH8A 2ALUA 2I6EA 2QS2A 4ND9A 4DLDA 3S9EA 4C1UA 1NNKA 3H3GA 4KFQA 5AA1A 2WYPA 3H6WA 4GFRA 2B4MA 3IJOB 1B52A 2OWTA 4NF4B 2ZYMA 3VVDA 5T3JA 4XKQA 5H8NA 4H8IA 4ZDMA 4KCCA 2REGA 3CFZA 3QUFA 4YKPA 2FBPA 2PX1A 3LR1A 3MBPA 2Q74A 3K0VA 1LFGA 5B70A 4XIGQ 4MEVA
chains in the Genus database with same CATH topology
4F22A 4TOZA 5I2NB 2XX7A 4F39A 3G3GA 5EHSA 1B2HA 3SEXA 4DE8A 1FQFA 2QMXA 2A5TA 1MY2A 3OELA 1PBPA 1ELJA 3TTKA 1UTHA 3EF7A 5TPAB 4N13A 3K6XA 3LSWA 1B3GA 2V3UA 2FA7A 1FTLA 3Q26A 4THIA 2NUVA 1SBPA 1P1OA 2V3TA 3E9XA 4F2QA 1LSTA 2Q9TA 4O3AA 3SESA 1BIYA 3S2VA 2BJJX 2GHAA 2X7PA 2HZLA 3VDFA 4DXBA 1IXCA 3KGCA 2XD3A 2VGQA 4NF6A 4QFKA 4MFIA 2IEEA 2E1SA 1TFAA 3IB2A 4ZZAA 2NVUB 4LQ2A 1Y3QA 4EF1A 1XVXA 1QULA 2DE2A 1Y1MA 2QMWA 2OBGA 4FATA 5AA2A 2V84A 4YICA 4ONYA 2RKMA 4H67A 4R6YA 1RKMA 3OEMA 3MZBA 5FTHA 3BFTA 2ZNUA 3RTFB 2HEUA 3UORA 1T0KA 4GOTA 1AH5A 3TQLA 3N6TA 3RYBA 3E13X 3FIRA 5H8QB 4HCYA 1JEUA 1SW1A 1POY1 1IITA 4G8NA 3KBRA 4NF5B 3AXFA 2XXPA 4JSDA 3ILUB 4N6PA 5CMKA 3C9HA 3HSTA 4IY5A 3I6VA 3O6HA 3JV9A 1SDXA 1R6ZA 2O6AA 2ZXTA 4RK2A 4H1XA 3K6WA 3MVZA 4U4SA 2PMSA 3PMXA 2I49A 3T22A 3CIJA 2P0SA 5AA4A 2VD3A 5TP9B 3A09A 5JK4A 2I48A 3W9WA 1IXGA 4R75A 4TLLB 2NWJA 3HCQA 4X1BA 3THIA 5L9OA 1S9TA 1B3HA 1P1NA 3TCHA 1FQDA 1SI0A 2O51A 1MY1A 2DS9A 3M3LA 4HCWA 2X7QA 3UP9A 5DYHA 4EUOA 2QS1A 1Y20A 1ZIUA 3O28A 4IO7A 2F36A 3VLWA 2ZMBA 2Y7KA 4O3BA 5DT6A 4KI0E 1IEJA 3K02A 2F34A 2XXTA 2M8CA 2VOZA 4R6KA 1QKBA 1IIWA 4POWA 3BBRA 1ZMGA 3H03A 3W15C 3DM0A 5FHNA 3EN3A 3H6UA 4G68A 5DEXA 4DCXA 3FJMA 3TDJA 2RC9A 1MXZA 2ONSA 4IGTA 5K2YA 4YAHX 4YB5A 3TTRA 3JYRA 4F1UA 3F11A 2XXVA 2XXWA 3UA8A 1B4HA 4GQOA 2CMOA 1MPDA 2F7AA 2QS4A 4H5GA 5L9MA 1MM7A 1MQHA 1JQFA 1LAGE 2ESNA 1MRPA 2I4BA 3C33A 4JBZA 5ITOA 4AB6A 2ZYOA 4ELRA 2I0BA 1F9BA 2Z8EA 4U21A 4WXJA 4LVQA 3QUJA 3SEWA 1P1UA 1XVYA 2RF1A 3TUSA 3MPLA 1D4NA 2QJEA 4F3SA 1PC3A 4GXAA 1MQGA 1B51A 2GH9A 3PUWE 3LSLA 1DOTA 4HTGA 1MY3A 5ELVA 5H8QA 1PDAA 3TQWA 2Y7PA 3A3UA 3U72A 4RXLA 2HAVA 1SW2A 4OFLA 1WVJA 5TU0A 1JW5A 5I58B 3TCFA 4FJPA 1B3EA 4KYDA 3U8QA 3FUZA 4YMBA 1EZOA 2F8DA 2O68A 3ZKKA 3LBSA 3DRJA 4XTCQ 4R2BA 2XXIA 1MDQA 2ABHA 3UGWA 1B7ZA 1QUIA 3DELB 3ODBA 3SETA 3LC8A 4KD5A 3TFLA 5IAIA 2Q2CA 1A7LA 2XHDA 3S9LC 3HHFA 4IO5A 2Q89A 4ZEIA 4ZEKA 2O1MA 1AMFA 4AB5A 2UYEA 4OFJA 4EXLA 5I84A 1B1XA 1OVBA 2DWJA 3PAMA 3VE1B 3VLVA 5I59B 3FGSA 1GVCA 3OOAA 3C35A 3ECRA 1PBQA 3IOUA 3U1OA 4F2OA 1Y4CA 3PD8A 5F1QA 1HSJA 2H9BA 3IJXB 1WODA 4RK9A 4BDMA 1II5A 2ZNSA 2IA4A 3W9VA 4ELQA 4IGRA 2Y7RA 3EHUA 4G4PA 4OTEA 3D4GA 2PT1A 2I3WA 2Y7IA 2GFEA 2H25A 2PVUA 4M4GA 3DRGA 1LAFE 5AA2D 5KCJB 1TXFA 2V25A 1QJMA 1I69A 4MH5A 3TEPA 2DOJA 3MVWA 4PQJA 1DPEA 1MY0A 4OMBA 2R9JA 1SYIA 4QSEA 5DTBA 1B0LA 4XXUA 1XS5A 4JWYA 3HHGA 3PMVA 2AL4A 3IX1A 3M3FA 1B7UA 4MLQA 1M5CA 3C4MA 4QFNA 3FZVA 1SW4A 2AIXA 2B4LA 3C36A 3MZ1A 2Z23A 4NF4A 1IZ1A 1Y1ZA 3LVUA 3R26A 1USYE 4GVOA 3FV2A 4RYAA 4ECFA 1BP5A 1DMBA 3K01A 1PEBA 2RC7A 3K00A 3QSLA 4WEPA 1Z7NE 3Q27A 4QSDA 4R74A 4UA8A 3SERA 3TMGA 4XKRA 3PUZE 4QFOA 3DRIA 1B40A 2OK2A 3FXQA 1LCFA 4JWOA 3MVXA 3TKDA 3WAEA 4OERA 3V89B 2RC8A 3G3IA 4NE4A 3KOTA 4Q30B 4PE5B 3N94A 2Q8JA 5EHMA 2OZZA 2Q2AA 4I9DA 3KN3A 4FECA 2Y84A 3T9HB 4F3BA 2O7UA 1MXWA 2F6GA 1MQJA 3IOVA 3OEKA 4ZS9A 4DXUA 1RYOA 5I56B 4LZ5A 4OESA 2H4IA 1B3FA 4YKJA 1OMPA 1YCJA 3T93B 2WOLA 3FVKA 1RYXA 3S9NC 1JW1A 5HM4B 1NNPA 1VFEA 3PGFA 5DEXB 5I2NA 2Z8DA 4U2RA 1LLSA 1NNTA 4H6DA 4TQUQ 3MW0A 1GGGA 1LBBA 4JXIA 3QK6A 3IK6B 5KDTB 2REJA 2F6PA 1M5BA 4FAJA 4Z7EA 3HPIA 2DP8A 4FIMA 5TPAA 1FQEA 1B3LA 1SYHA 4Q8RA 5ICQA 3IAZA 4R72A 4OZ9A 3ONMA 3KZGA 5I2KB 2ZNTA 2HCAA 2P1SA 3PV0E 4ELPA 1EU8A 2XXRA 4LZ8A 1Y9UA 4IO4A 4KR5A 2XXYA 1YAEA 3MWBA 4ESWA 4NF6B 2D21A 3ZKLA 1B4ZA 1FTMA 1JVXA 1MXUA 3IO4A 3O6IA 3KN7A 3HN0A 3ZS6A 5L9SA 3OMBA 2QL3A 1Q1KA 4RA1A 3FVGA 5H8HA 1IUDA 3PMWA 4NF8A 1EH3A 2KLFA 3B6TA 3TTNA 1R9QA 5H8NA 4MF3A 3GLBA 3SKPA 3FASA 3OSQA 4GF8A 4ZE8A 5CRYA 1JETA 1MXVA 1ZBMA 2H99A 2QS3A 3MP8A 4GWOA 4EXKA 3RY3A 5H8FB 3RNNA 1O7TA 3MP1A 4NF5A 4BDRA 4LP2B 3RN8A 2DQVA 4C1TA 4U23A 1JEVA 4LUBA 4R9FA 4OEVA 2ONRA 1ZKBA 4JDFA 4YZZA 3C34A 4R2FA 5ISUA 2DXRA 3EHSA 5H8NB 4G77A 1XHYA 4OWDA 1B5JA 2F35A 4ZEDA 2UXAA 4C0RA 1S7YA 1JNFA 3H4ZA 1FQBA 1MY4A 3IB1A 1N3XA 4ZECA 5DVJA 2A5TB 4WKMA 4OQOA 3V5AA 4PFTA 4LQ5A 3MVYA 2GRVA 1LFHA 2A5SA 4OYVA 4EQ7A 2HZKA 4OEUA 1I6QA 4XKNA 1I6AA 1B5IA 3O2AA 3B6WA 2NOOA 3CHGA 4LA9A 4YB7A 2OWSA 1KWHA 3RTWB 2O7IA 2R71A 1VSOA 1XC1A 1B5HA 1MQDA 1LFIA 1TT1A 3CFLA 2V3QA 3OD7A 3V8XB 4KPTA 1MH4A 4OFOA 2F78A 1B58A 2DWAA 3GBAA 3RT6B 3Q25A 1R1NA 1CB6A 2V93A 4X1DA 4FE8A 5CI5A 1PB9A 4I1DA 4U1ZA 2D3IA 1Z7ME 1UTBB 1Y4TA 4FEDA 2QPQA 4IO3A 5ICTA 4FORA 2LAOA 3O29A 3UN6A 5DVFA 3OENA 4X9TA 4M1VA 5JEIA 3MAMA 2Z8FA 5EYFA 3KOSA 3G7WA 2PT2A 4PFUA 3ILTB 3PPRA 2I3VA 3FD3A 4NTLA 4PETA 3L6GA 4WEDA 3EQ1A 3S9MC 2QRYA 1YTVA 2CZLA 1OIBA 5CM6A 3QXMA 3PUYE 1XOCA 1MXYA 3G3FA 3KSXA 3N26A 3OSRA 4KYSA 4BDLA 4QFLA 1D9YA 2F97A 1SD3A 1R9LA 1I6BA 2ONKE 1B32A 2AL5A 1B46A 2XXUA 3E4RA 3EHTA 4G2ZA 3ZSFA 4BDQA 3HO7A 2OCUA 4MBPA 1BTJA 1ATGA 1D3KA 2XX8A 4PP0A 4F19A 4I62A 1L5TA 1N84A 1PB7A 3R6UA 1FQAA 1NL5A 3T96B 4EDPA 2WOPA 4GIZA 3FVNA 4MLVA 3VV5A 4DIGA 5IKBA 3V83A 2RCAA 3TELA 2DE4A 3B6QA 4XIGQ 3VXBA 2XXXA 3H06B 4OXVA 3TODA 4IO2A 4IY6A 4P11A 4UACA 5JTYA 1NNFA 1QUJA 3JZJA 2WOKA 2ZYKA 3G3JA 1J1NA 3P7IA 3VVFA 1A8EA 3MC2A 3KFMA 1URDA 1SVXB 4U22A 5AE4A 3WAFA 2YLNA 1H45A 1URGA 1ZJLA 3LSFB 4H8JA 1HSLA 4NEDA 1TFDA 2PYYA 2XXQA 3USDA 1SI1A 3FXUA 3HV1A 4G8HA 4GXSB 1FCKA 4U4XA 4QFPA 2DVZA 2HFBA 3BFUA 3DLNA 4EQ9A 2NXOA 1POTA 2DWIA 4OETA 1B6HA 1H76A 1DSNA 1LAHE 1A40A 1NH7A 3H6VA 5BUUA 5CMCA 1N04A 3IOWA 3E3KA 1PB8A 3RUMA 3S4UA 4ZEBA 3CFXA 3FXRA 4H0WA 2G29A 4F18A 5CBSA 2FYIA 4GL8A 3K6UA 3UIFA 3B7DA 1B05A 1BKAA 1M5EA 1MQIA 4G68B 2X26A 4BLAA 1N7WA 3FATA 2VHAA 3CVGA 3G3HA 2UVIA 1EZPA 1YPNA 2YPNA 1USYH 5LOMA 5H8HB 4IO6A 3IL1B 4N07A 4Q5TA 2UVJA 3KEIA 1TWYA 4ELOA 2RCBA 1DTGA 1H44A 3CRBA 3N5LA 4G8MA 4GD5A 3RT8A 4YKIA 5CBRA 5H8SA 4DDDA 3D4CA 5AA3A 5HBCA 5H8FA 1A99A 4U1OA 5FHOA 1GTKA 1NKXA 1QVSA 3K1NA 3Q28A 1QUKA 2XX9A 1FTJA 1VE4A 4QSCA 1OLCA 2R6GE 2F7BA 2FNCA 1B1HA 1H43A 1QKAA 3PUXE 4OHNA 3TAJA 2F5XA 1D9VA 1US4A 5TP9A 3IORA 4JB7A 5FTIA 3C31A 4ZEFA 1XT8A 3DRKA 4HS7A 4EF2A 1WDNA 4H65A 4ISUA 4LATA 3VXCA 2H5YA 3IR1A 4R6HA 1UIUA 2HQ0A 2OJTA 3MQ9A 4QHQA 4YU0A 1P99A 1JVYA 2Z22A 2DWHA 3CR9A 3GBBA 3TZAA 5BWJA 3PPQA 3RYAA 4Z0IA 4G68C 2G93A 4R73A 2O69A 2QSXA 3GXAA 4DZ1A 4PFWA 2YJPA 3FJGA 4OVJA 1N7XA 3MPKA 1SW5A 1NMUA 3TTLA 2F7CA 1A55A 1O63A 2DXYA 1MPBA 2AYSA 2O1LA 5K2XA 1ZTYA 4NWCA 2H98A 3L6HA 3IO6A 3CI8A 2B3FA 1QW0A 3U93A 4NWDA 1OVTA 2VD2A 4AQ4A 4BDOA 3DRFA 3I3VA 4GL0A 3K4UA 5CMMA 1N0TA 1FW0A 1ZLQA 4RPNA 3KG2A 1GV8A 3C32A 3T9XB 2HXWA 5I59A 3RGYA 1LGBC 3FJ7A 2DYXA 3DP6A 3KN8A 3H7MA 5KCJA 1AIVA 4Q0CA 5M2VA 1DPPA 3DRHA 2VP1A 1N3WA 2I0CA 3K1MA 1UIVA 4JWXA 4KCDA 3T9UA 3M8UA 1OQHA 3RLFE 4F31B 2B3BA 3CSBA 2D5WA 4O3CA 5I57B 1UQWA 1N76A 3A3CA 5A5XA 1M5DA 3O6PA 1B7HA 4ZE9A 3K6VA 1A8FA 3PD9A 5I2KA 1AOVA 3N6UA 4I8CA 4EQBA 4YKKA 2THIA 4FEBA 1ZU0A 5J1DA 5DVIA 3OO7A 1LAXA 1B9JA 2Q88A 3VVEA 3SDFA 2WKYA 1AL3A 3H6TA 1EZ9A 3OO6A 1H3DA 1DTZA 3PPPA 3PUVE 1A54A 4QRZA 4RPOA 1LB9A 4E0WA 5I58A 4P0IA 4F1YA 2B65A 2PBWA 3FVOA 3T9VA 2W7YA 1US5A 1O64A 3TCGA 2E0SA 5HPQA 1FTOA 1M5FA 5JTYB 1VFDA 3DP4A 3MZ9A 3FTOA 1IXHA 3U92A 1LB8A 4F1VA 3KSJA 2UVHA 1MH3A 2XXHA 3K2DA 1JW4A 3CG1A 4GRKA 3SEYA 3VFJA 4HW8A 1MG1A 3Q29A 5I56A 5L8DA 3T66A 3O6GA 4YMAA 5AA4B 4PFYA 3CSGA 4KYEA 1UTHB 4RY1A 2ANJA 3PU5A 4F3GA 4POXA 2UVGA 5ITPA 1Y3PA 2OLBA 1NFTA 3K1PA 3KJTA 3O97A 3QAXA 4GLIA 3RPWA 1ANFA 4F29A 3R7XA 2Y7WA 3SEVA 1BLFA 4LONB 5CC2A 1HSEA 1VR5A 3CG3A 1P1QA 3GZGA 3OO8A 3IB0A 3SEUA 3FV1A 1S50A 3RQTA 2P2AA 3TPAA 1OLAA 1MPCA 2RINA 4TLMB 3DP8A 2XD2A 4P0GA 5AA2B 1LBCA 5KDTA 3PPOA 1NH8A 3MP6A 1FTKA 3OO9A 2ALUA 4QF9A 5FHMA 5B7DA 2I6EA 2QS2A 2I58A 4ND9A 5CMBA 3TYHA 4DLDA 4BDNA 4C1UA 3S9EA 1NNKA 5KZTA 3H3GA 4H5FA 1UTBA 1MXXA 3M3KA 3H6WA 4KFQA 4L17A 5AA1A 1MDP1 4GFRA 2B4MA 1Q35A 4K3FA 3IJOB 4NF8B 3TTMA 1B52A 1Y3NA 3O66A 3PPNA 4YB6A 2OWTA 4X48A 3UK4A 5I57A 1MS7A 4NF4B 1GR2A 1B0HA 2ZYMA 2GHBA 4ESXA 5A5XB 3EPEA 3MJNA 1FQCA 3OXNA 4XKPA 3VVDA 4LZ7A 1URSA 4IB2A 4JSOA 4DCYA 3QYTA 2HAUA 1IQ7A 1SQYA 2UYFA 3IOTA 3O9PA 1IXIA 4XKQA 4RJZA 4H8IA 4ZDMA 3QIMA 3LSXA 2REGA 3CFZA 3QUFA 4KCCA 3I5OA 1LCTA 4KHZE 1MM6A 4R9GA 3LUYA 4OENA 4RNSA 4YKPA 3KJ7A 2PX1A 3LR1A 4DXCA 3MBPA 2O84X 3G3KA 1CE2A 3VLUA 2DE3A 2DVCA 4NMYA 4ZZEA 2I4CA 3K0VA 3MUQA 4F3PA 2ZYNA 5F7VA 1LFGA 4E0XA 2DSFA 3BKIB 4KQPA 3U94A 5B70A 1OQGA 1P1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F22 A;  4TOZ A;  5I2N B;  2XX7 A;  4F39 A;  3G3G A;  5EHS A;  1B2H A;  3SEX A;  4DE8 A;  1FQF A;  2QMX A;  2A5T A;  1MY2 A;  3OEL A;  1PBP A;  1ELJ A;  3TTK A;  1UTH A;  3EF7 A;  5TPA B;  4N13 A;  3K6X A;  3LSW A;  1B3G A;  2V3U A;  2FA7 A;  1FTL A;  3Q26 A;  4THI A;  2NUV A;  1SBP A;  1P1O A;  2V3T A;  3E9X A;  4F2Q A;  1LST A;  2Q9T A;  4O3A A;  3SES A;  1BIY A;  3S2V A;  2BJJ X;  2GHA A;  2X7P A;  2HZL A;  3VDF A;  4DXB A;  1IXC A;  3KGC A;  2XD3 A;  2VGQ A;  4NF6 A;  4QFK A;  4MFI A;  2IEE A;  2E1S A;  1TFA A;  3IB2 A;  4ZZA A;  2NVU B;  4LQ2 A;  1Y3Q A;  4EF1 A;  1XVX A;  1QUL A;  2DE2 A;  1Y1M A;  2QMW A;  2OBG A;  4FAT A;  5AA2 A;  2V84 A;  4YIC A;  4ONY A;  2RKM A;  4H67 A;  4R6Y A;  1RKM A;  3OEM A;  3MZB A;  5FTH A;  3BFT A;  2ZNU A;  3RTF B;  2HEU A;  3UOR A;  1T0K A;  4GOT A;  1AH5 A;  3TQL A;  3N6T A;  3RYB A;  3E13 X;  3FIR A;  5H8Q B;  4HCY A;  1JEU A;  1SW1 A;  1POY 1;  1IIT A;  4G8N A;  3KBR A;  4NF5 B;  3AXF A;  2XXP A;  4JSD A;  3ILU B;  4N6P A;  5CMK A;  3C9H A;  3HST A;  4IY5 A;  3I6V A;  3O6H A;  3JV9 A;  1SDX A;  1R6Z A;  2O6A A;  2ZXT A;  4RK2 A;  4H1X A;  3K6W A;  3MVZ A;  4U4S A;  2PMS A;  3PMX A;  2I49 A;  3T22 A;  3CIJ A;  2P0S A;  5AA4 A;  2VD3 A;  5TP9 B;  3A09 A;  5JK4 A;  2I48 A;  3W9W A;  1IXG A;  4R75 A;  4TLL B;  2NWJ A;  3HCQ A;  4X1B A;  3THI A;  5L9O A;  1S9T A;  1B3H A;  1P1N A;  3TCH A;  1FQD A;  1SI0 A;  2O51 A;  1MY1 A;  2DS9 A;  3M3L A;  4HCW A;  2X7Q A;  3UP9 A;  5DYH A;  4EUO A;  2QS1 A;  1Y20 A;  1ZIU A;  3O28 A;  4IO7 A;  2F36 A;  3VLW A;  2ZMB A;  2Y7K A;  4O3B A;  5DT6 A;  4KI0 E;  1IEJ A;  3K02 A;  2F34 A;  2XXT A;  2M8C A;  2VOZ A;  4R6K A;  1QKB A;  1IIW A;  4POW A;  3BBR A;  1ZMG A;  3H03 A;  3W15 C;  3DM0 A;  5FHN A;  3EN3 A;  3H6U A;  4G68 A;  5DEX A;  4DCX A;  3FJM A;  3TDJ A;  2RC9 A;  1MXZ A;  2ONS A;  4IGT A;  5K2Y A;  4YAH X;  4YB5 A;  3TTR A;  3JYR A;  4F1U A;  3F11 A;  2XXV A;  2XXW A;  3UA8 A;  1B4H A;  4GQO A;  2CMO A;  1MPD A;  2F7A A;  2QS4 A;  4H5G A;  5L9M A;  1MM7 A;  1MQH A;  1JQF A;  1LAG E;  2ESN A;  1MRP A;  2I4B A;  3C33 A;  4JBZ A;  5ITO A;  4AB6 A;  2ZYO A;  4ELR A;  2I0B A;  1F9B A;  2Z8E A;  4U21 A;  4WXJ A;  4LVQ A;  3QUJ A;  3SEW A;  1P1U A;  1XVY A;  2RF1 A;  3TUS A;  3MPL A;  1D4N A;  2QJE A;  4F3S A;  1PC3 A;  4GXA A;  1MQG A;  1B51 A;  2GH9 A;  3PUW E;  3LSL A;  1DOT A;  4HTG A;  1MY3 A;  5ELV A;  5H8Q A;  1PDA A;  3TQW A;  2Y7P A;  3A3U A;  3U72 A;  4RXL A;  2HAV A;  1SW2 A;  4OFL A;  1WVJ A;  5TU0 A;  1JW5 A;  5I58 B;  3TCF A;  4FJP A;  1B3E A;  4KYD A;  3U8Q A;  3FUZ A;  4YMB A;  1EZO A;  2F8D A;  2O68 A;  3ZKK A;  3LBS A;  3DRJ A;  4XTC Q;  4R2B A;  2XXI A;  1MDQ A;  2ABH A;  3UGW A;  1B7Z A;  1QUI A;  3DEL B;  3ODB A;  3SET A;  3LC8 A;  4KD5 A;  3TFL A;  5IAI A;  2Q2C A;  1A7L A;  2XHD A;  3S9L C;  3HHF A;  4IO5 A;  2Q89 A;  4ZEI A;  4ZEK A;  2O1M A;  1AMF A;  4AB5 A;  2UYE A;  4OFJ A;  4EXL A;  5I84 A;  1B1X A;  1OVB A;  2DWJ A;  3PAM A;  3VE1 B;  3VLV A;  5I59 B;  3FGS A;  1GVC A;  3OOA A;  3C35 A;  3ECR A;  1PBQ A;  3IOU A;  3U1O A;  4F2O A;  1Y4C A;  3PD8 A;  5F1Q A;  1HSJ A;  2H9B A;  3IJX B;  1WOD A;  4RK9 A;  4BDM A;  1II5 A;  2ZNS A;  2IA4 A;  3W9V A;  4ELQ A;  4IGR A;  2Y7R A;  3EHU A;  4G4P A;  4OTE A;  3D4G A;  2PT1 A;  2I3W A;  2Y7I A;  2GFE A;  2H25 A;  2PVU A;  4M4G A;  3DRG A;  1LAF E;  5AA2 D;  5KCJ B;  1TXF A;  2V25 A;  1QJM A;  1I69 A;  4MH5 A;  3TEP A;  2DOJ A;  3MVW A;  4PQJ A;  1DPE A;  1MY0 A;  4OMB A;  2R9J A;  1SYI A;  4QSE A;  5DTB A;  1B0L A;  4XXU A;  1XS5 A;  4JWY A;  3HHG A;  3PMV A;  2AL4 A;  3IX1 A;  3M3F A;  1B7U A;  4MLQ A;  1M5C A;  3C4M A;  4QFN A;  3FZV A;  1SW4 A;  2AIX A;  2B4L A;  3C36 A;  3MZ1 A;  2Z23 A;  4NF4 A;  1IZ1 A;  1Y1Z A;  3LVU A;  3R26 A;  1USY E;  4GVO A;  3FV2 A;  4RYA A;  4ECF A;  1BP5 A;  1DMB A;  3K01 A;  1PEB A;  2RC7 A;  3K00 A;  3QSL A;  4WEP A;  1Z7N E;  3Q27 A;  4QSD A;  4R74 A;  4UA8 A;  3SER A;  3TMG A;  4XKR A;  3PUZ E;  4QFO A;  3DRI A;  1B40 A;  2OK2 A;  3FXQ A;  1LCF A;  4JWO A;  3MVX A;  3TKD A;  3WAE A;  4OER A;  3V89 B;  2RC8 A;  3G3I A;  4NE4 A;  3KOT A;  4Q30 B;  4PE5 B;  3N94 A;  2Q8J A;  5EHM A;  2OZZ A;  2Q2A A;  4I9D A;  3KN3 A;  4FEC A;  2Y84 A;  3T9H B;  4F3B A;  2O7U A;  1MXW A;  2F6G A;  1MQJ A;  3IOV A;  3OEK A;  4ZS9 A;  4DXU A;  1RYO A;  5I56 B;  4LZ5 A;  4OES A;  2H4I A;  1B3F A;  4YKJ A;  1OMP A;  1YCJ A;  3T93 B;  2WOL A;  3FVK A;  1RYX A;  3S9N C;  1JW1 A;  5HM4 B;  1NNP A;  1VFE A;  3PGF A;  5DEX B;  5I2N A;  2Z8D A;  4U2R A;  1LLS A;  1NNT A;  4H6D A;  4TQU Q;  3MW0 A;  1GGG A;  1LBB A;  4JXI A;  3QK6 A;  3IK6 B;  5KDT B;  2REJ A;  2F6P A;  1M5B A;  4FAJ A;  4Z7E A;  3HPI A;  2DP8 A;  4FIM A;  5TPA A;  1FQE A;  1B3L A;  1SYH A;  4Q8R A;  5ICQ A;  3IAZ A;  4R72 A;  4OZ9 A;  3ONM A;  3KZG A;  5I2K B;  2ZNT A;  2HCA A;  2P1S A;  3PV0 E;  4ELP A;  1EU8 A;  2XXR A;  4LZ8 A;  1Y9U A;  4IO4 A;  4KR5 A;  2XXY A;  1YAE A;  3MWB A;  4ESW A;  4NF6 B;  2D21 A;  3ZKL A;  1B4Z A;  1FTM A;  1JVX A;  1MXU A;  3IO4 A;  3O6I A;  3KN7 A;  3HN0 A;  3ZS6 A;  5L9S A;  3OMB A;  2QL3 A;  1Q1K A;  4RA1 A;  3FVG A;  5H8H A;  1IUD A;  3PMW A;  4NF8 A;  1EH3 A;  2KLF A;  3B6T A;  3TTN A;  1R9Q A;  5H8N A;  4MF3 A;  3GLB A;  3SKP A;  3FAS A;  3OSQ A;  4GF8 A;  4ZE8 A;  5CRY A;  1JET A;  1MXV A;  1ZBM A;  2H99 A;  2QS3 A;  3MP8 A;  4GWO A;  4EXK A;  3RY3 A;  5H8F B;  3RNN A;  1O7T A;  3MP1 A;  4NF5 A;  4BDR A;  4LP2 B;  3RN8 A;  2DQV A;  4C1T A;  4U23 A;  1JEV A;  4LUB A;  4R9F A;  4OEV A;  2ONR A;  1ZKB A;  4JDF A;  4YZZ A;  3C34 A;  4R2F A;  5ISU A;  2DXR A;  3EHS A;  5H8N B;  4G77 A;  1XHY A;  4OWD A;  1B5J A;  2F35 A;  4ZED A;  2UXA A;  4C0R A;  1S7Y A;  1JNF A;  3H4Z A;  1FQB A;  1MY4 A;  3IB1 A;  1N3X A;  4ZEC A;  5DVJ A;  2A5T B;  4WKM A;  4OQO A;  3V5A A;  4PFT A;  4LQ5 A;  3MVY A;  2GRV A;  1LFH A;  2A5S A;  4OYV A;  4EQ7 A;  2HZK A;  4OEU A;  1I6Q A;  4XKN A;  1I6A A;  1B5I A;  3O2A A;  3B6W A;  2NOO A;  3CHG A;  4LA9 A;  4YB7 A;  2OWS A;  1KWH A;  3RTW B;  2O7I A;  2R71 A;  1VSO A;  1XC1 A;  1B5H A;  1MQD A;  1LFI A;  1TT1 A;  3CFL A;  2V3Q A;  3OD7 A;  3V8X B;  4KPT A;  1MH4 A;  4OFO A;  2F78 A;  1B58 A;  2DWA A;  3GBA A;  3RT6 B;  3Q25 A;  1R1N A;  1CB6 A;  2V93 A;  4X1D A;  4FE8 A;  5CI5 A;  1PB9 A;  4I1D A;  4U1Z A;  2D3I A;  1Z7M E;  1UTB B;  1Y4T A;  4FED A;  2QPQ A;  4IO3 A;  5ICT A;  4FOR A;  2LAO A;  3O29 A;  3UN6 A;  5DVF A;  3OEN A;  4X9T A;  4M1V A;  5JEI A;  3MAM A;  2Z8F A;  5EYF A;  3KOS A;  3G7W A;  2PT2 A;  4PFU A;  3ILT B;  3PPR A;  2I3V A;  3FD3 A;  4NTL A;  4PET A;  3L6G A;  4WED A;  3EQ1 A;  3S9M C;  2QRY A;  1YTV A;  2CZL A;  1OIB A;  5CM6 A;  3QXM A;  3PUY E;  1XOC A;  1MXY A;  3G3F A;  3KSX A;  3N26 A;  3OSR A;  4KYS A;  4BDL A;  4QFL A;  1D9Y A;  2F97 A;  1SD3 A;  1R9L A;  1I6B A;  2ONK E;  1B32 A;  2AL5 A;  1B46 A;  2XXU A;  3E4R A;  3EHT A;  4G2Z A;  3ZSF A;  4BDQ A;  3HO7 A;  2OCU A;  4MBP A;  1BTJ A;  1ATG A;  1D3K A;  2XX8 A;  4PP0 A;  4F19 A;  4I62 A;  1L5T A;  1N84 A;  1PB7 A;  3R6U A;  1FQA A;  1NL5 A;  3T96 B;  4EDP A;  2WOP A;  4GIZ A;  3FVN A;  4MLV A;  3VV5 A;  4DIG A;  5IKB A;  3V83 A;  2RCA A;  3TEL A;  2DE4 A;  3B6Q A;  4XIG Q;  3VXB A;  2XXX A;  3H06 B;  4OXV A;  3TOD A;  4IO2 A;  4IY6 A;  4P11 A;  4UAC A;  5JTY A;  1NNF A;  1QUJ A;  3JZJ A;  2WOK A;  2ZYK A;  3G3J A;  1J1N A;  3P7I A;  3VVF A;  1A8E A;  3MC2 A;  3KFM A;  1URD A;  1SVX B;  4U22 A;  5AE4 A;  3WAF A;  2YLN A;  1H45 A;  1URG A;  1ZJL A;  3LSF B;  4H8J A;  1HSL A;  4NED A;  1TFD A;  2PYY A;  2XXQ A;  3USD A;  1SI1 A;  3FXU A;  3HV1 A;  4G8H A;  4GXS B;  1FCK A;  4U4X A;  4QFP A;  2DVZ A;  2HFB A;  3BFU A;  3DLN A;  4EQ9 A;  2NXO A;  1POT A;  2DWI A;  4OET A;  1B6H A;  1H76 A;  1DSN A;  1LAH E;  1A40 A;  1NH7 A;  3H6V A;  5BUU A;  5CMC A;  1N04 A;  3IOW A;  3E3K A;  1PB8 A;  3RUM A;  3S4U A;  4ZEB A;  3CFX A;  3FXR A;  4H0W A;  2G29 A;  4F18 A;  5CBS A;  2FYI A;  4GL8 A;  3K6U A;  3UIF A;  3B7D A;  1B05 A;  1BKA A;  1M5E A;  1MQI A;  4G68 B;  2X26 A;  4BLA A;  1N7W A;  3FAT A;  2VHA A;  3CVG A;  3G3H A;  2UVI A;  1EZP A;  1YPN A;  2YPN A;  1USY H;  5LOM A;  5H8H B;  4IO6 A;  3IL1 B;  4N07 A;  4Q5T A;  2UVJ A;  3KEI A;  1TWY A;  4ELO A;  2RCB A;  1DTG A;  1H44 A;  3CRB A;  3N5L A;  4G8M A;  4GD5 A;  3RT8 A;  4YKI A;  5CBR A;  5H8S A;  4DDD A;  3D4C A;  5AA3 A;  5HBC A;  5H8F A;  1A99 A;  4U1O A;  5FHO A;  1GTK A;  1NKX A;  1QVS A;  3K1N A;  3Q28 A;  1QUK A;  2XX9 A;  1FTJ A;  1VE4 A;  4QSC A;  1OLC A;  2R6G E;  2F7B A;  2FNC A;  1B1H A;  1H43 A;  1QKA A;  3PUX E;  4OHN A;  3TAJ A;  2F5X A;  1D9V A;  1US4 A;  5TP9 A;  3IOR A;  4JB7 A;  5FTI A;  3C31 A;  4ZEF A;  1XT8 A;  3DRK A;  4HS7 A;  4EF2 A;  1WDN A;  4H65 A;  4ISU A;  4LAT A;  3VXC A;  2H5Y A;  3IR1 A;  4R6H A;  1UIU A;  2HQ0 A;  2OJT A;  3MQ9 A;  4QHQ A;  4YU0 A;  1P99 A;  1JVY A;  2Z22 A;  2DWH A;  3CR9 A;  3GBB A;  3TZA A;  5BWJ A;  3PPQ A;  3RYA A;  4Z0I A;  4G68 C;  2G93 A;  4R73 A;  2O69 A;  2QSX A;  3GXA A;  4DZ1 A;  4PFW A;  2YJP A;  3FJG A;  4OVJ A;  1N7X A;  3MPK A;  1SW5 A;  1NMU A;  3TTL A;  2F7C A;  1A55 A;  1O63 A;  2DXY A;  1MPB A;  2AYS A;  2O1L A;  5K2X A;  1ZTY A;  4NWC A;  2H98 A;  3L6H A;  3IO6 A;  3CI8 A;  2B3F A;  1QW0 A;  3U93 A;  4NWD A;  1OVT A;  2VD2 A;  4AQ4 A;  4BDO A;  3DRF A;  3I3V A;  4GL0 A;  3K4U A;  5CMM A;  1N0T A;  1FW0 A;  1ZLQ A;  4RPN A;  3KG2 A;  1GV8 A;  3C32 A;  3T9X B;  2HXW A;  5I59 A;  3RGY A;  1LGB C;  3FJ7 A;  2DYX A;  3DP6 A;  3KN8 A;  3H7M A;  5KCJ A;  1AIV A;  4Q0C A;  5M2V A;  1DPP A;  3DRH A;  2VP1 A;  1N3W A;  2I0C A;  3K1M A;  1UIV A;  4JWX A;  4KCD A;  3T9U A;  3M8U A;  1OQH A;  3RLF E;  4F31 B;  2B3B A;  3CSB A;  2D5W A;  4O3C A;  5I57 B;  1UQW A;  1N76 A;  3A3C A;  5A5X A;  1M5D A;  3O6P A;  1B7H A;  4ZE9 A;  3K6V A;  1A8F A;  3PD9 A;  5I2K A;  1AOV A;  3N6U A;  4I8C A;  4EQB A;  4YKK A;  2THI A;  4FEB A;  1ZU0 A;  5J1D A;  5DVI A;  3OO7 A;  1LAX A;  1B9J A;  2Q88 A;  3VVE A;  3SDF A;  2WKY A;  1AL3 A;  3H6T A;  1EZ9 A;  3OO6 A;  1H3D A;  1DTZ A;  3PPP A;  3PUV E;  1A54 A;  4QRZ A;  4RPO A;  1LB9 A;  4E0W A;  5I58 A;  4P0I A;  4F1Y A;  2B65 A;  2PBW A;  3FVO A;  3T9V A;  2W7Y A;  1US5 A;  1O64 A;  3TCG A;  2E0S A;  5HPQ A;  1FTO A;  1M5F A;  5JTY B;  1VFD A;  3DP4 A;  3MZ9 A;  3FTO A;  1IXH A;  3U92 A;  1LB8 A;  4F1V A;  3KSJ A;  2UVH A;  1MH3 A;  2XXH A;  3K2D A;  1JW4 A;  3CG1 A;  4GRK A;  3SEY A;  3VFJ A;  4HW8 A;  1MG1 A;  3Q29 A;  5I56 A;  5L8D A;  3T66 A;  3O6G A;  4YMA A;  5AA4 B;  4PFY A;  3CSG A;  4KYE A;  1UTH B;  4RY1 A;  2ANJ A;  3PU5 A;  4F3G A;  4POX A;  2UVG A;  5ITP A;  1Y3P A;  2OLB A;  1NFT A;  3K1P A;  3KJT A;  3O97 A;  3QAX A;  4GLI A;  3RPW A;  1ANF A;  4F29 A;  3R7X A;  2Y7W A;  3SEV A;  1BLF A;  4LON B;  5CC2 A;  1HSE A;  1VR5 A;  3CG3 A;  1P1Q A;  3GZG A;  3OO8 A;  3IB0 A;  3SEU A;  3FV1 A;  1S50 A;  3RQT A;  2P2A A;  3TPA A;  1OLA A;  1MPC A;  2RIN A;  4TLM B;  3DP8 A;  2XD2 A;  4P0G A;  5AA2 B;  1LBC A;  5KDT A;  3PPO A;  1NH8 A;  3MP6 A;  1FTK A;  3OO9 A;  2ALU A;  4QF9 A;  5FHM A;  5B7D A;  2I6E A;  2QS2 A;  2I58 A;  4ND9 A;  5CMB A;  3TYH A;  4DLD A;  4BDN A;  4C1U A;  3S9E A;  1NNK A;  5KZT A;  3H3G A;  4H5F A;  1UTB A;  1MXX A;  3M3K A;  3H6W A;  4KFQ A;  4L17 A;  5AA1 A;  1MDP 1;  4GFR A;  2B4M A;  1Q35 A;  4K3F A;  3IJO B;  4NF8 B;  3TTM A;  1B52 A;  1Y3N A;  3O66 A;  3PPN A;  4YB6 A;  2OWT A;  4X48 A;  3UK4 A;  5I57 A;  1MS7 A;  4NF4 B;  1GR2 A;  1B0H A;  2ZYM A;  2GHB A;  4ESX A;  5A5X B;  3EPE A;  3MJN A;  1FQC A;  3OXN A;  4XKP A;  3VVD A;  4LZ7 A;  1URS A;  4IB2 A;  4JSO A;  4DCY A;  3QYT A;  2HAU A;  1IQ7 A;  1SQY A;  2UYF A;  3IOT A;  3O9P A;  1IXI A;  4XKQ A;  4RJZ A;  4H8I A;  4ZDM A;  3QIM A;  3LSX A;  2REG A;  3CFZ A;  3QUF A;  4KCC A;  3I5O A;  1LCT A;  4KHZ E;  1MM6 A;  4R9G A;  3LUY A;  4OEN A;  4RNS A;  4YKP A;  3KJ7 A;  2PX1 A;  3LR1 A;  4DXC A;  3MBP A;  2O84 X;  3G3K A;  1CE2 A;  3VLU A;  2DE3 A;  2DVC A;  4NMY A;  4ZZE A;  2I4C A;  3K0V A;  3MUQ A;  4F3P A;  2ZYN A;  5F7V A;  1LFG A;  4E0X A;  2DSF A;  3BKI B;  4KQP A;  3U94 A;  5B70 A;  1OQG A;  1P1W A; 
#chains in the Genus database with same CATH topology
 5I2N B;  3RYD A;  3G3G A;  1EYK A;  3EF7 A;  3K6X A;  2V3U A;  2V3T A;  4O3A A;  4OVR A;  3S2V A;  2BJJ X;  2GHA A;  5I3S A;  2VGQ A;  2IEE A;  4ZZA A;  1Y3Q A;  1XVX A;  5ET8 A;  2Y5L A;  4YIC A;  4ONY A;  3UOR A;  1T0K A;  1AH5 A;  3E13 X;  4O7I A;  1JEU A;  3ILU B;  2XXP A;  3HST A;  4IY5 A;  1SDX A;  3T0J A;  3FXB A;  3K6W A;  1NV4 A;  4U4S A;  3PMX A;  2I49 A;  3CIJ A;  1SI0 A;  3UP9 A;  4PAF A;  3O28 A;  3LV0 A;  3BBR A;  1ZMG A;  3EN3 A;  3H6U A;  5DEX A;  1MXZ A;  5K2Y A;  4YAH X;  3JYR A;  3UA8 A;  4GQO A;  2GQ1 A;  4JVC A;  1MPD A;  2F7A A;  4H5G A;  5L9M A;  1MM7 A;  2I4B A;  2ESN A;  4PGN A;  4U21 A;  4WXJ A;  2RF1 A;  4NF0 A;  4MNI A;  2CEY A;  4MX6 A;  1PC3 A;  1RDX A;  3LSL A;  1DOT A;  5ELV A;  1MY3 A;  1SW2 A;  1WVJ A;  5I58 B;  3U8Q A;  4PGP A;  2O68 A;  3DEL B;  3S9L C;  4ZEI A;  1AMF A;  2UYE A;  5I84 A;  2DWJ A;  3OOA A;  1LBX A;  5I7I A;  4F2O A;  1Y4C A;  1HSJ A;  2H9B A;  3IJX B;  1II5 A;  4QBA A;  2I3W A;  2Y7I A;  3DRG A;  4GX3 A;  1TXF A;  1MY0 A;  4QSE A;  2XWV A;  4XXU A;  3HHG A;  5LTC A;  1SW4 A;  3MZ1 A;  2Z23 A;  4NF4 A;  3LVU A;  4RYA A;  1NUX A;  3Q27 A;  4QSD A;  4NGU A;  1B40 A;  3WAE A;  4OER A;  3V89 B;  4PE3 A;  2Q2A A;  4MNP A;  2Y84 A;  2O7U A;  1MQJ A;  4LZ5 A;  2WOL A;  3S9N C;  1VFE A;  1NNP A;  5DEX B;  1LLS A;  1NV5 A;  1LBB A;  4JXI A;  1FBF A;  4Z7E A;  4Q8R A;  4R72 A;  2P1S A;  2KR0 A;  4IO4 A;  4ESW A;  1YAE A;  2D21 A;  1B4Z A;  1JVX A;  3KN7 A;  3OMB A;  4RA1 A;  5H8H A;  1R9Q A;  4MF3 A;  3SKP A;  4GF8 A;  1JET A;  3MP8 A;  2H99 A;  3RNN A;  1FPK A;  1JEV A;  3C34 A;  4R2F A;  5ISU A;  4ZED A;  1S7Y A;  1JNF A;  4ZEC A;  3V5A A;  4WKM A;  4OQO A;  4PFT A;  4LQ5 A;  3MVY A;  2GRV A;  4N91 A;  4OEU A;  1I6Q A;  1LBV A;  4YB7 A;  1KWH A;  4N8G A;  2R71 A;  5IM2 A;  1MH4 A;  2F78 A;  3RT6 B;  2DWA A;  4N15 A;  3Q25 A;  1CB6 A;  4X1D A;  1UTB B;  4IO3 A;  2LAO A;  3O29 A;  3UN6 A;  5EQ9 A;  3OEN A;  3KOS A;  2PT2 A;  3PPR A;  4OVS A;  1OIB A;  1RDZ A;  3QXM A;  1LBY A;  2ONK E;  1I6B A;  4N4U A;  1BTJ A;  1D3K A;  1EYI A;  2XX8 A;  1L5T A;  3R6U A;  1NL5 A;  4EDP A;  2WOP A;  4GIZ A;  4O8M A;  1D9Q A;  5JTY A;  4UAC A;  2WOK A;  4PC9 A;  3KFM A;  4U22 A;  4H8J A;  4NED A;  3FXU A;  4UAB A;  5FBP A;  2DVZ A;  3DLN A;  4OET A;  1CNQ A;  1DSN A;  1LAH E;  1A40 A;  3H6V A;  1EYJ A;  3RUM A;  2FVZ A;  3UIF A;  1B05 A;  2QVV A;  2VHA A;  4DI4 B;  2YPN A;  5LOM A;  3B50 A;  3KEI A;  1TWY A;  4ELO A;  1H44 A;  3N5L A;  5CBR A;  5H8S A;  5AA3 A;  4HE1 A;  1QUK A;  1VE4 A;  2F5X A;  3C31 A;  1LBW A;  3DRK A;  4HS7 A;  4EF2 A;  1WDN A;  3CR9 A;  5BWJ A;  3PPQ A;  2O69 A;  2QSX A;  3GXA A;  2YJP A;  3FJG A;  4OVJ A;  1N7X A;  3TTL A;  2DXY A;  2H98 A;  3IO6 A;  3CI8 A;  1OVT A;  4BDO A;  4GL0 A;  1GV8 A;  5I59 A;  3IFC A;  4PF6 A;  1OQH A;  2B3B A;  4O3C A;  1UQW A;  3A3C A;  4OVT A;  5A5X A;  4PFB A;  3BIH A;  5J1D A;  3SZP A;  1B9J A;  1NV7 A;  4RPO A;  1H3D A;  2WX9 A;  1RDY A;  1A54 A;  1FPB A;  2W7Y A;  1US5 A;  2E0S A;  1IXH A;  4HW8 A;  3K2D A;  3SEY A;  5I56 A;  3Q29 A;  1NV2 A;  2OLB A;  1FBP A;  1ANF A;  3R7X A;  5CC2 A;  3CG3 A;  1FPI A;  1LEV A;  3GZG A;  1QGX A;  3RQT A;  5AA2 B;  3PPO A;  3OO9 A;  1FTK A;  3TYH A;  1UTB A;  4NF8 B;  4O94 A;  4X48 A;  2KQZ A;  2GHB A;  5A5X B;  3MJN A;  4XKP A;  4LZ7 A;  4DCY A;  3IOT A;  2WBD A;  1IXI A;  1MM6 A;  3LUY A;  2F3D A;  2CZH A;  3G3K A;  4F3P A;  4E0X A;  3U94 A;  1OQG A;  1FJ9 A;  4F22 A;  4MHF A;  1FQF A;  1MY2 A;  5TPA B;  3LSW A;  2FA7 A;  1FTL A;  1SBP A;  1P1O A;  2XWI A;  2Q9T A;  3SES A;  3VDF A;  2X7P A;  4QFK A;  4MFI A;  2NVU B;  4LQ2 A;  4FAT A;  2OBG A;  5AA2 A;  2V84 A;  2RKM A;  1RKM A;  3OEM A;  5FTH A;  2ZNU A;  2HEU A;  4GOT A;  5H8Q B;  2FIE A;  4N6P A;  3JV9 A;  2O6A A;  2PMS A;  4MJO A;  2QVR A;  5JK4 A;  4TLL B;  2NWJ A;  3HCQ A;  4X1B A;  3TCH A;  5ET6 A;  2X7Q A;  2QS1 A;  2XXT A;  4POW A;  3H03 A;  3W15 C;  1FJ6 A;  2RC9 A;  2ONS A;  3TTR A;  2XXV A;  1B4H A;  2QS4 A;  5ITO A;  4PFI A;  3C33 A;  2Z8E A;  1XVY A;  1D4N A;  4F3S A;  4GXA A;  4HTG A;  1PDA A;  3U65 A;  4OFL A;  1JW5 A;  3LBS A;  3DRJ A;  3ODB A;  4KD5 A;  3TFL A;  1A7L A;  2HHM A;  4ZEK A;  2O1M A;  4OFJ A;  3PAM A;  1PBQ A;  1FPJ A;  5ET7 A;  1WOD A;  4RK9 A;  4ELQ A;  2Q8M A;  2Y7R A;  5AA2 D;  1LAF E;  5KCJ B;  1QJM A;  3MVW A;  4PQJ A;  1DPE A;  1SYI A;  5DTB A;  3NOH A;  4IR8 A;  1B0L A;  1K9Z A;  4JWY A;  3IX1 A;  1NV0 A;  3C4M A;  3C36 A;  5HPQ A;  1Y1Z A;  4ECF A;  5EHS A;  2RC7 A;  1Z7N E;  3SER A;  3PUZ E;  3DRI A;  3MVX A;  1FTA A;  4NE4 A;  3KOT A;  3N94 A;  2OZZ A;  3KN3 A;  4OAN A;  3OEK A;  4ZS9 A;  4XFE A;  5I56 B;  4OES A;  2H4I A;  1OMP A;  1YCJ A;  3T93 B;  1JW1 A;  2FIX A;  3PGF A;  5KDT B;  5IZZ A;  1M5B A;  3HPI A;  2DP8 A;  4FIM A;  3BIG A;  5TPA A;  1B3L A;  1IMB A;  1SYH A;  4OZ9 A;  3ONM A;  2ZNT A;  3PV0 E;  1EU8 A;  2XXY A;  3MWB A;  3ZKL A;  3HFU A;  3IO4 A;  3HN0 A;  3FVG A;  1IUD A;  1EH3 A;  3OSQ A;  5CRY A;  4BDR A;  4NF5 A;  2DDK A;  2DQV A;  4MIJ A;  4U23 A;  4C1T A;  4OEV A;  2DXR A;  5H8N B;  4G77 A;  1DCU A;  1FQB A;  5DVJ A;  2A5S A;  2HZK A;  2CZK A;  3O2A A;  3CFL A;  2F3B A;  4OFO A;  1G0I A;  4FE8 A;  4MNC A;  2D3I A;  1Y4T A;  2QPQ A;  4FOR A;  4X9T A;  4M1V A;  2Z8F A;  5EYF A;  3G7W A;  2I3V A;  1LBZ A;  2QRY A;  2CZL A;  3PUY E;  3KSX A;  4KYS A;  1D9Y A;  2F97 A;  4G8N A;  3EHT A;  1B32 A;  4PP0 A;  1N84 A;  4PTK A;  3B6Q A;  3VXB A;  3H06 B;  5DW8 A;  3TOD A;  4IY6 A;  4P11 A;  4H45 A;  1QUJ A;  1J1N A;  3MC2 A;  1URD A;  1URG A;  3LSF B;  1HSL A;  1TFD A;  1SI1 A;  4GXS B;  4U4X A;  4QFP A;  3BFU A;  1B6H A;  1H76 A;  1NH7 A;  1N04 A;  3IOW A;  1PB8 A;  3FXR A;  4H0W A;  1IMF A;  2FYI A;  3K6U A;  3B7D A;  2X26 A;  2UVI A;  3IL1 B;  4GD5 A;  4YKI A;  3D4C A;  1A99 A;  4U1O A;  1GTK A;  3TMG A;  2XX9 A;  4QSC A;  1OLC A;  2FNC A;  4OHN A;  1H43 A;  3PUX E;  5TP9 A;  3IOR A;  4JB7 A;  3PTY A;  4R6H A;  2HQ0 A;  3MQ9 A;  1P99 A;  2Z22 A;  2DWH A;  4G68 C;  2G93 A;  1NMU A;  2F7C A;  2AYS A;  4NWC A;  4KXP A;  3I3V A;  4RPN A;  3KG2 A;  3C32 A;  2HXW A;  1LGB C;  3H7M A;  1AIV A;  1DK4 A;  5M2V A;  1DPP A;  3DRH A;  2I0C A;  2XWK A;  1UIV A;  4JWX A;  3M8U A;  3RLF E;  4F31 B;  5I57 B;  4PAK A;  3O6P A;  1B7H A;  1AOV A;  5I2K A;  4N17 A;  4YKK A;  1KA1 A;  3A29 A;  2WKY A;  1AL3 A;  3H6T A;  3OO6 A;  4P0I A;  4F1Y A;  3FVO A;  1O64 A;  1FTO A;  1M5F A;  3DP4 A;  3U92 A;  4F1V A;  1JW4 A;  3CG1 A;  3T66 A;  4YMA A;  3CSG A;  4KYE A;  1UTH B;  2ANJ A;  1FBE A;  3PU5 A;  2UVG A;  1Y3P A;  1NFT A;  3QAX A;  4NAP A;  2Y7W A;  4NQ8 A;  1BLF A;  4LON B;  3FV1 A;  1FPL A;  1OLA A;  1MPC A;  4TLM B;  2XD2 A;  3MP6 A;  5EQ7 A;  4QF9 A;  5B7D A;  5CMB A;  2PFZ A;  4BDN A;  1MXX A;  4K3F A;  3PPN A;  3UK4 A;  4H46 A;  1MS7 A;  1B0H A;  4GX4 A;  3OXN A;  1URS A;  4JSO A;  1SQY A;  2UYF A;  3O9P A;  4RJZ A;  3LSX A;  3I5O A;  4R9G A;  4OEN A;  3E78 A;  3KJ7 A;  4DXC A;  2O84 X;  3VLU A;  1CE2 A;  2DVC A;  4ZZE A;  3MUQ A;  5F7V A;  4PBH A;  2DSF A;  3BKI B;  4KQP A;  1KZ8 A;  4KCD A;  1P1W A;  4TOZ A;  2XX7 A;  2WYK A;  1B2H A;  3SEX A;  4DE8 A;  2QMX A;  2XXK A;  3OEL A;  1PBP A;  1ELJ A;  5IZ3 A;  3TTK A;  2OX3 A;  1NUZ A;  4THI A;  4MMP A;  2NUV A;  3E9X A;  1LST A;  1BIY A;  2HZL A;  3KGC A;  2XD3 A;  4JVD A;  2MKZ A;  4JVI A;  1TFA A;  3IB2 A;  1QUL A;  2QMW A;  4H67 A;  4P9K A;  3TQL A;  1VDW A;  3RYB A;  3FIR A;  1POY 1;  2BJI A;  4NF5 B;  3KBR A;  4JSD A;  5CMK A;  3I6V A;  3O6H A;  2ZXT A;  2XWO A;  3B8B A;  3MVZ A;  3T22 A;  2VD3 A;  5TP9 B;  3A09 A;  2I48 A;  3W9W A;  5L9O A;  1B3H A;  2O51 A;  4HCW A;  4NHB A;  3M3L A;  1Y20 A;  1ZIU A;  2F36 A;  2ZMB A;  4KI0 E;  4OA4 A;  3FBP A;  4G68 A;  4HE2 A;  4IGT A;  4YB5 A;  2XXW A;  2CMO A;  4EUO A;  1MQH A;  1JQF A;  1LAG E;  1MRP A;  4JBZ A;  4AB6 A;  4ELR A;  3SEW A;  4P47 A;  1P1U A;  3MPL A;  3PUW E;  5H8Q A;  3TQW A;  2Y7P A;  3U72 A;  2HAV A;  4KYD A;  2QFL A;  3FUZ A;  1XI6 A;  4XTC Q;  4R2B A;  2XXI A;  2ABH A;  1B7Z A;  3SET A;  3LC8 A;  5IGA A;  3FGS A;  4N8Y A;  3ECR A;  1FPG A;  5F1Q A;  2Y5K A;  4IGR A;  4G4P A;  4QXD A;  1I69 A;  2DOJ A;  2CEX A;  4OMB A;  2R9J A;  1XS5 A;  3FZV A;  1IME A;  2B4L A;  1USY E;  3FV2 A;  1BP5 A;  5BUU A;  3K01 A;  1PEB A;  3K00 A;  4WEP A;  5ICT A;  4GBV A;  4R74 A;  4XKR A;  4JWO A;  3FXQ A;  1LCF A;  3TKD A;  3G3I A;  4Q30 B;  4PE5 B;  2Q8J A;  4FEC A;  2WEF A;  3T9H B;  4DXU A;  1RYO A;  4YKJ A;  3FVK A;  4I3Y A;  1RYX A;  3KC1 A;  5HM4 B;  2Z8D A;  4H6D A;  3MW0 A;  3IK6 B;  2VT5 A;  1YXI A;  5EQ8 A;  5I2K B;  3KZG A;  4P1E A;  4ELP A;  4LZ8 A;  1Y9U A;  4KR5 A;  4NF6 B;  4PF8 A;  1MXU A;  5ESY A;  5L9S A;  3ZS6 A;  3PMW A;  4NF8 A;  3B6T A;  3TTN A;  3GLB A;  3FAS A;  1MXV A;  1ZBM A;  2QS3 A;  4GWO A;  3RY3 A;  1NV3 A;  1O7T A;  4LP2 B;  2HXR A;  4LUB A;  4R9F A;  1ZKB A;  1XHY A;  1B5J A;  2F35 A;  2UXA A;  4C0R A;  4P3L A;  1MY4 A;  2A5T B;  3D1R A;  2CZI A;  4OYV A;  4EQ7 A;  4XKN A;  1I6A A;  1B5I A;  3B6W A;  2NOO A;  2OWZ A;  3RTW B;  2O7I A;  4MH5 A;  1VSO A;  1TT1 A;  2V3Q A;  4KPT A;  3GBA A;  1B58 A;  5IZ3 B;  1R1N A;  2V93 A;  1PB9 A;  4U1Z A;  2WBB A;  3MAM A;  4NTL A;  3FD3 A;  4PET A;  4WED A;  3S9M C;  4G61 A;  1YTV A;  5CM6 A;  1MXY A;  3N26 A;  3OSR A;  4QFL A;  4P8B A;  2XXU A;  2AL5 A;  1B46 A;  4G2Z A;  3E4R A;  4BDQ A;  2OCU A;  4MBP A;  4I62 A;  5IKB A;  3FVN A;  4DIG A;  4NN3 A;  3V83 A;  3TEL A;  2L5V A;  4AS5 A;  1NNF A;  2ZYK A;  3P7I A;  3VVF A;  1A8E A;  5AE4 A;  2YLN A;  3USD A;  2XXQ A;  4G8H A;  1POT A;  2DWI A;  3E3K A;  3S4U A;  4ZEB A;  2XA5 A;  2G29 A;  4GL8 A;  1BKA A;  1M5E A;  4BLA A;  1N7W A;  3FAT A;  3G3H A;  4Q5T A;  2UVJ A;  3CRB A;  4G8M A;  4DDD A;  3RPL A;  5HBC A;  5H8F A;  3K1N A;  3Q28 A;  1FTJ A;  5IZ1 A;  3VLV A;  4P1L A;  2F7B A;  1B1H A;  3TAJ A;  1SPI A;  1D9V A;  4ZEF A;  4LAT A;  3VXC A;  3IR1 A;  1UIU A;  4YU0 A;  3TZA A;  3RYA A;  4Z0I A;  4DZ1 A;  4PFW A;  3MPK A;  1A55 A;  1MPB A;  5K2X A;  1YZ0 A;  3L6H A;  2B3F A;  1QW0 A;  4NWD A;  2VD2 A;  4AQ4 A;  1FW0 A;  5F24 A;  3FJ7 A;  2DYX A;  3KN8 A;  4Q0C A;  2VP1 A;  3T9U A;  4P56 A;  1M5D A;  1A8F A;  2THI A;  1ZU0 A;  3OO7 A;  1LAX A;  4GWX A;  3VVE A;  3PUV E;  1EZ9 A;  5IAI A;  3PPP A;  4I3E A;  3T1B A;  2B65 A;  2PBW A;  1KA0 A;  3T9V A;  3ROJ A;  1FBH A;  3TCG A;  1DBZ A;  1VFD A;  3FTO A;  1LB8 A;  3KSJ A;  2UVH A;  1MH3 A;  3VFJ A;  1MG1 A;  5L8D A;  4O7M A;  4RY1 A;  4POX A;  1K9Y A;  5ITP A;  3K1P A;  3KJT A;  3O97 A;  3RPW A;  1NI9 A;  1HSE A;  1P1Q A;  3IB0 A;  1S50 A;  2RIN A;  1LBC A;  5KDT A;  2PCR A;  5FHM A;  2I58 A;  4H5F A;  5KZT A;  4F3G A;  3M3K A;  4N81 A;  4L17 A;  1MDP 1;  1Q35 A;  4DXB A;  3TTM A;  1Y3N A;  3O66 A;  1FBG A;  4YB6 A;  5I57 A;  4ESX A;  1GR2 A;  3EPE A;  5EYG A;  1FQC A;  4IB2 A;  2P3N A;  3QYT A;  2HAU A;  1IQ7 A;  3QIM A;  4KHZ E;  4RNS A;  1LCT A;  4MAG A;  2DE3 A;  4NMY A;  2I4C A;  2ZYN A;  2VPN A;  4F39 A;  5EYH A;  2A5T A;  2V4C A;  1UTH A;  2ZZW A;  4N13 A;  1B3G A;  3Q26 A;  4F2Q A;  1IXC A;  4NF6 A;  2E1S A;  2QVU A;  4EF1 A;  2DE2 A;  1Y1M A;  4R6Y A;  3RTF B;  3MZB A;  3BFT A;  3N6T A;  4HCY A;  1SW1 A;  1IIT A;  3IFA A;  3AXF A;  3C9H A;  1R6Z A;  4RK2 A;  4H1X A;  4LN5 A;  2P0S A;  5AA4 A;  4I40 A;  1IXG A;  4PCD A;  1Q9D A;  4R75 A;  1NUW A;  3THI A;  1FRP A;  1S9T A;  1P1N A;  5J16 A;  1FQD A;  1MY1 A;  2DS9 A;  5DYH A;  3VLW A;  4IO7 A;  2Y7K A;  4O3B A;  5DT6 A;  1IEJ A;  3K02 A;  2F34 A;  2M8C A;  2VOZ A;  4R6K A;  1QKB A;  1IIW A;  3GYY A;  3DM0 A;  5FHN A;  4DCX A;  3FJM A;  3TDJ A;  3ISP A;  4F1U A;  3F11 A;  2HPG A;  1NV1 A;  2ZYO A;  2I0B A;  1F9B A;  4X04 A;  4LVQ A;  3QUJ A;  4XF5 A;  3TUS A;  5A5L A;  2QJE A;  1MQG A;  1B51 A;  2GH9 A;  3QMF A;  4GWS A;  3A3U A;  4RXL A;  5TU0 A;  4GWY A;  3TCF A;  4FJP A;  1B3E A;  4YMB A;  1EZO A;  2F8D A;  3ZKK A;  1MDQ A;  1FPD A;  4N6K A;  3UGW A;  1QUI A;  3MST A;  2Q2C A;  2XHD A;  3HHF A;  4IO5 A;  2Q89 A;  4AB5 A;  4EXL A;  1B1X A;  1OVB A;  3VE1 B;  5I59 B;  1GVC A;  3C35 A;  4PAI A;  3IOU A;  4GWZ A;  2JJK A;  3U1O A;  1IMA A;  3PD8 A;  4BDM A;  2ZNS A;  2IA4 A;  3W9V A;  3EHU A;  4OTE A;  3D4G A;  2PT1 A;  1G0H A;  2GFE A;  1FPF A;  2H25 A;  2PVU A;  4M4G A;  2V25 A;  3TEP A;  5ET5 A;  4MLQ A;  3PMV A;  2AL4 A;  3M3F A;  1B7U A;  1M5C A;  4QFN A;  2AIX A;  4GWU A;  1IZ1 A;  3R26 A;  4GVO A;  1DMB A;  3QSL A;  4DI3 D;  1NV6 A;  4UA8 A;  3LUZ A;  3E79 A;  4QFO A;  2OK2 A;  2RC8 A;  1JP4 A;  5EHM A;  2VPO A;  4I9D A;  4F3B A;  4XEQ A;  1FSA A;  1MXW A;  2F6G A;  4PFR A;  3IOV A;  4N6D A;  1B3F A;  2FHY A;  5I2N A;  4U2R A;  1NNT A;  4TQU Q;  1GGG A;  3QK6 A;  2R8T A;  2F6P A;  2REJ A;  4NG7 A;  4FAJ A;  1FQE A;  5ICQ A;  3KBZ A;  3IAZ A;  4PDD A;  2HCA A;  2XXR A;  4OVQ A;  1IMD A;  1FTM A;  3O6I A;  2QL3 A;  1Q1K A;  3MYU A;  2ZZV A;  2KLF A;  4ZE8 A;  3RPL B;  4EXK A;  5H8F B;  3MP1 A;  3RN8 A;  2ONR A;  4YZZ A;  4JDF A;  3EHS A;  4OWD A;  3H4Z A;  3IB1 A;  1N3X A;  1LFH A;  1FBC A;  3CHG A;  4LA9 A;  2OWS A;  1XC1 A;  3OD7 A;  1B5H A;  1MQD A;  1LFI A;  3V8X B;  5CI5 A;  4I1D A;  1Z7M E;  4FED A;  5DVF A;  5JEI A;  4PFU A;  3ILT B;  3L6G A;  3EQ1 A;  1XOC A;  3G3F A;  4OVP A;  4BDL A;  1SD3 A;  1R9L A;  3ZSF A;  1FBD A;  3HO7 A;  1ATG A;  4F19 A;  1PB7 A;  1FQA A;  3T96 B;  3VV5 A;  4MCO A;  4MLV A;  2RCA A;  2PFY A;  5I5P A;  2DE4 A;  2XXX A;  4OXV A;  4IO2 A;  3JZJ A;  1AWB A;  3G3J A;  1SVX B;  3WAF A;  1H45 A;  1ZJL A;  2PYY A;  3HV1 A;  4EQ9 A;  1FCK A;  2HFB A;  2NXO A;  5EQA A;  5CMC A;  3CFX A;  4HXV A;  2P3V A;  4F18 A;  5CBS A;  1YYZ A;  4G68 B;  1MQI A;  3CVG A;  1EZP A;  5LDZ A;  1YPN A;  1USY H;  5H8H B;  4IO6 A;  4N07 A;  2RCB A;  1DTG A;  3RT8 A;  5FHO A;  1NKX A;  1QVS A;  3EKI A;  2R6G E;  1QKA A;  1US4 A;  3KC0 A;  5FTI A;  1XT8 A;  4H65 A;  4ISU A;  2H5Y A;  2OJT A;  4QHQ A;  4AS4 A;  1JVY A;  3GBB A;  1NUY A;  4PDH A;  4R73 A;  1SW5 A;  4FBP A;  1O63 A;  2O1L A;  1ZTY A;  3U93 A;  3DRF A;  3K4U A;  5CMM A;  1N0T A;  1FPE A;  1ZLQ A;  3T9X B;  3RGY A;  3DP6 A;  5KCJ A;  1INP A;  1N3W A;  3K1M A;  3CSB A;  2D5W A;  4HE0 A;  1N76 A;  2ZZX A;  3K6V A;  4ZE9 A;  3PD9 A;  3N6U A;  4I8C A;  4EQB A;  4FEB A;  5DVI A;  2Q88 A;  3SDF A;  4QRZ A;  4NX1 A;  1DTZ A;  4E0W A;  4GBW A;  1LB9 A;  5I58 A;  4X8R A;  5JTY B;  3MZ9 A;  2XXH A;  4GRK A;  3O6G A;  5AA4 B;  4PFY A;  4PBQ A;  4GLI A;  4F29 A;  3SEV A;  1VR5 A;  3OO8 A;  3SEU A;  1BK4 A;  4GX6 A;  2P2A A;  4GWW A;  3TPA A;  1IMC A;  3DP8 A;  4P0G A;  1NH8 A;  2ALU A;  2I6E A;  2QS2 A;  4ND9 A;  4DLD A;  3S9E A;  4C1U A;  1NNK A;  3H3G A;  4KFQ A;  5AA1 A;  2WYP A;  3H6W A;  4GFR A;  2B4M A;  3IJO B;  1B52 A;  2OWT A;  4NF4 B;  2ZYM A;  3VVD A;  5T3J A;  4XKQ A;  5H8N A;  4H8I A;  4ZDM A;  4KCC A;  2REG A;  3CFZ A;  3QUF A;  4YKP A;  2FBP A;  2PX1 A;  3LR1 A;  3MBP A;  2Q74 A;  3K0V A;  1LFG A;  5B70 A;  4XIG Q;  4MEV A; 
#chains in the Genus database with same CATH homology
 4F22 A;  4TOZ A;  5I2N B;  2XX7 A;  4F39 A;  3G3G A;  5EHS A;  1B2H A;  3SEX A;  4DE8 A;  1FQF A;  2QMX A;  2A5T A;  1MY2 A;  3OEL A;  1PBP A;  1ELJ A;  3TTK A;  1UTH A;  3EF7 A;  5TPA B;  4N13 A;  3K6X A;  3LSW A;  1B3G A;  2V3U A;  2FA7 A;  1FTL A;  3Q26 A;  4THI A;  2NUV A;  1SBP A;  1P1O A;  2V3T A;  3E9X A;  4F2Q A;  1LST A;  2Q9T A;  4O3A A;  3SES A;  1BIY A;  3S2V A;  2BJJ X;  2GHA A;  2X7P A;  2HZL A;  3VDF A;  4DXB A;  1IXC A;  3KGC A;  2XD3 A;  2VGQ A;  4NF6 A;  4QFK A;  4MFI A;  2IEE A;  2E1S A;  1TFA A;  3IB2 A;  4ZZA A;  2NVU B;  4LQ2 A;  1Y3Q A;  4EF1 A;  1XVX A;  1QUL A;  2DE2 A;  1Y1M A;  2QMW A;  2OBG A;  4FAT A;  5AA2 A;  2V84 A;  4YIC A;  4ONY A;  2RKM A;  4H67 A;  4R6Y A;  1RKM A;  3OEM A;  3MZB A;  5FTH A;  3BFT A;  2ZNU A;  3RTF B;  2HEU A;  3UOR A;  1T0K A;  4GOT A;  1AH5 A;  3TQL A;  3N6T A;  3RYB A;  3E13 X;  3FIR A;  5H8Q B;  4HCY A;  1JEU A;  1SW1 A;  1POY 1;  1IIT A;  4G8N A;  3KBR A;  4NF5 B;  3AXF A;  2XXP A;  4JSD A;  3ILU B;  4N6P A;  5CMK A;  3C9H A;  3HST A;  4IY5 A;  3I6V A;  3O6H A;  3JV9 A;  1SDX A;  1R6Z A;  2O6A A;  2ZXT A;  4RK2 A;  4H1X A;  3K6W A;  3MVZ A;  4U4S A;  2PMS A;  3PMX A;  2I49 A;  3T22 A;  3CIJ A;  2P0S A;  5AA4 A;  2VD3 A;  5TP9 B;  3A09 A;  5JK4 A;  2I48 A;  3W9W A;  1IXG A;  4R75 A;  4TLL B;  2NWJ A;  3HCQ A;  4X1B A;  3THI A;  5L9O A;  1S9T A;  1B3H A;  1P1N A;  3TCH A;  1FQD A;  1SI0 A;  2O51 A;  1MY1 A;  2DS9 A;  3M3L A;  4HCW A;  2X7Q A;  3UP9 A;  5DYH A;  4EUO A;  2QS1 A;  1Y20 A;  1ZIU A;  3O28 A;  4IO7 A;  2F36 A;  3VLW A;  2ZMB A;  2Y7K A;  4O3B A;  5DT6 A;  4KI0 E;  1IEJ A;  3K02 A;  2F34 A;  2XXT A;  2M8C A;  2VOZ A;  4R6K A;  1QKB A;  1IIW A;  4POW A;  3BBR A;  1ZMG A;  3H03 A;  3W15 C;  3DM0 A;  5FHN A;  3EN3 A;  3H6U A;  4G68 A;  5DEX A;  4DCX A;  3FJM A;  3TDJ A;  2RC9 A;  1MXZ A;  2ONS A;  4IGT A;  5K2Y A;  4YAH X;  4YB5 A;  3TTR A;  3JYR A;  4F1U A;  3F11 A;  2XXV A;  2XXW A;  3UA8 A;  1B4H A;  4GQO A;  2CMO A;  1MPD A;  2F7A A;  2QS4 A;  4H5G A;  5L9M A;  1MM7 A;  1MQH A;  1JQF A;  1LAG E;  2ESN A;  1MRP A;  2I4B A;  3C33 A;  4JBZ A;  5ITO A;  4AB6 A;  2ZYO A;  4ELR A;  2I0B A;  1F9B A;  2Z8E A;  4U21 A;  4WXJ A;  4LVQ A;  3QUJ A;  3SEW A;  1P1U A;  1XVY A;  2RF1 A;  3TUS A;  3MPL A;  1D4N A;  2QJE A;  4F3S A;  1PC3 A;  4GXA A;  1MQG A;  1B51 A;  2GH9 A;  3PUW E;  3LSL A;  1DOT A;  4HTG A;  1MY3 A;  5ELV A;  5H8Q A;  1PDA A;  3TQW A;  2Y7P A;  3A3U A;  3U72 A;  4RXL A;  2HAV A;  1SW2 A;  4OFL A;  1WVJ A;  5TU0 A;  1JW5 A;  5I58 B;  3TCF A;  4FJP A;  1B3E A;  4KYD A;  3U8Q A;  3FUZ A;  4YMB A;  1EZO A;  2F8D A;  2O68 A;  3ZKK A;  3LBS A;  3DRJ A;  4XTC Q;  4R2B A;  2XXI A;  1MDQ A;  2ABH A;  3UGW A;  1B7Z A;  1QUI A;  3DEL B;  3ODB A;  3SET A;  3LC8 A;  4KD5 A;  3TFL A;  5IAI A;  2Q2C A;  1A7L A;  2XHD A;  3S9L C;  3HHF A;  4IO5 A;  2Q89 A;  4ZEI A;  4ZEK A;  2O1M A;  1AMF A;  4AB5 A;  2UYE A;  4OFJ A;  4EXL A;  5I84 A;  1B1X A;  1OVB A;  2DWJ A;  3PAM A;  3VE1 B;  3VLV A;  5I59 B;  3FGS A;  1GVC A;  3OOA A;  3C35 A;  3ECR A;  1PBQ A;  3IOU A;  3U1O A;  4F2O A;  1Y4C A;  3PD8 A;  5F1Q A;  1HSJ A;  2H9B A;  3IJX B;  1WOD A;  4RK9 A;  4BDM A;  1II5 A;  2ZNS A;  2IA4 A;  3W9V A;  4ELQ A;  4IGR A;  2Y7R A;  3EHU A;  4G4P A;  4OTE A;  3D4G A;  2PT1 A;  2I3W A;  2Y7I A;  2GFE A;  2H25 A;  2PVU A;  4M4G A;  3DRG A;  1LAF E;  5AA2 D;  5KCJ B;  1TXF A;  2V25 A;  1QJM A;  1I69 A;  4MH5 A;  3TEP A;  2DOJ A;  3MVW A;  4PQJ A;  1DPE A;  1MY0 A;  4OMB A;  2R9J A;  1SYI A;  4QSE A;  5DTB A;  1B0L A;  4XXU A;  1XS5 A;  4JWY A;  3HHG A;  3PMV A;  2AL4 A;  3IX1 A;  3M3F A;  1B7U A;  4MLQ A;  1M5C A;  3C4M A;  4QFN A;  3FZV A;  1SW4 A;  2AIX A;  2B4L A;  3C36 A;  3MZ1 A;  2Z23 A;  4NF4 A;  1IZ1 A;  1Y1Z A;  3LVU A;  3R26 A;  1USY E;  4GVO A;  3FV2 A;  4RYA A;  4ECF A;  1BP5 A;  1DMB A;  3K01 A;  1PEB A;  2RC7 A;  3K00 A;  3QSL A;  4WEP A;  1Z7N E;  3Q27 A;  4QSD A;  4R74 A;  4UA8 A;  3SER A;  3TMG A;  4XKR A;  3PUZ E;  4QFO A;  3DRI A;  1B40 A;  2OK2 A;  3FXQ A;  1LCF A;  4JWO A;  3MVX A;  3TKD A;  3WAE A;  4OER A;  3V89 B;  2RC8 A;  3G3I A;  4NE4 A;  3KOT A;  4Q30 B;  4PE5 B;  3N94 A;  2Q8J A;  5EHM A;  2OZZ A;  2Q2A A;  4I9D A;  3KN3 A;  4FEC A;  2Y84 A;  3T9H B;  4F3B A;  2O7U A;  1MXW A;  2F6G A;  1MQJ A;  3IOV A;  3OEK A;  4ZS9 A;  4DXU A;  1RYO A;  5I56 B;  4LZ5 A;  4OES A;  2H4I A;  1B3F A;  4YKJ A;  1OMP A;  1YCJ A;  3T93 B;  2WOL A;  3FVK A;  1RYX A;  3S9N C;  1JW1 A;  5HM4 B;  1NNP A;  1VFE A;  3PGF A;  5DEX B;  5I2N A;  2Z8D A;  4U2R A;  1LLS A;  1NNT A;  4H6D A;  4TQU Q;  3MW0 A;  1GGG A;  1LBB A;  4JXI A;  3QK6 A;  3IK6 B;  5KDT B;  2REJ A;  2F6P A;  1M5B A;  4FAJ A;  4Z7E A;  3HPI A;  2DP8 A;  4FIM A;  5TPA A;  1FQE A;  1B3L A;  1SYH A;  4Q8R A;  5ICQ A;  3IAZ A;  4R72 A;  4OZ9 A;  3ONM A;  3KZG A;  5I2K B;  2ZNT A;  2HCA A;  2P1S A;  3PV0 E;  4ELP A;  1EU8 A;  2XXR A;  4LZ8 A;  1Y9U A;  4IO4 A;  4KR5 A;  2XXY A;  1YAE A;  3MWB A;  4ESW A;  4NF6 B;  2D21 A;  3ZKL A;  1B4Z A;  1FTM A;  1JVX A;  1MXU A;  3IO4 A;  3O6I A;  3KN7 A;  3HN0 A;  3ZS6 A;  5L9S A;  3OMB A;  2QL3 A;  1Q1K A;  4RA1 A;  3FVG A;  5H8H A;  1IUD A;  3PMW A;  4NF8 A;  1EH3 A;  2KLF A;  3B6T A;  3TTN A;  1R9Q A;  5H8N A;  4MF3 A;  3GLB A;  3SKP A;  3FAS A;  3OSQ A;  4GF8 A;  4ZE8 A;  5CRY A;  1JET A;  1MXV A;  1ZBM A;  2H99 A;  2QS3 A;  3MP8 A;  4GWO A;  4EXK A;  3RY3 A;  5H8F B;  3RNN A;  1O7T A;  3MP1 A;  4NF5 A;  4BDR A;  4LP2 B;  3RN8 A;  2DQV A;  4C1T A;  4U23 A;  1JEV A;  4LUB A;  4R9F A;  4OEV A;  2ONR A;  1ZKB A;  4JDF A;  4YZZ A;  3C34 A;  4R2F A;  5ISU A;  2DXR A;  3EHS A;  5H8N B;  4G77 A;  1XHY A;  4OWD A;  1B5J A;  2F35 A;  4ZED A;  2UXA A;  4C0R A;  1S7Y A;  1JNF A;  3H4Z A;  1FQB A;  1MY4 A;  3IB1 A;  1N3X A;  4ZEC A;  5DVJ A;  2A5T B;  4WKM A;  4OQO A;  3V5A A;  4PFT A;  4LQ5 A;  3MVY A;  2GRV A;  1LFH A;  2A5S A;  4OYV A;  4EQ7 A;  2HZK A;  4OEU A;  1I6Q A;  4XKN A;  1I6A A;  1B5I A;  3O2A A;  3B6W A;  2NOO A;  3CHG A;  4LA9 A;  4YB7 A;  2OWS A;  1KWH A;  3RTW B;  2O7I A;  2R71 A;  1VSO A;  1XC1 A;  1B5H A;  1MQD A;  1LFI A;  1TT1 A;  3CFL A;  2V3Q A;  3OD7 A;  3V8X B;  4KPT A;  1MH4 A;  4OFO A;  2F78 A;  1B58 A;  2DWA A;  3GBA A;  3RT6 B;  3Q25 A;  1R1N A;  1CB6 A;  2V93 A;  4X1D A;  4FE8 A;  5CI5 A;  1PB9 A;  4I1D A;  4U1Z A;  2D3I A;  1Z7M E;  1UTB B;  1Y4T A;  4FED A;  2QPQ A;  4IO3 A;  5ICT A;  4FOR A;  2LAO A;  3O29 A;  3UN6 A;  5DVF A;  3OEN A;  4X9T A;  4M1V A;  5JEI A;  3MAM A;  2Z8F A;  5EYF A;  3KOS A;  3G7W A;  2PT2 A;  4PFU A;  3ILT B;  3PPR A;  2I3V A;  3FD3 A;  4NTL A;  4PET A;  3L6G A;  4WED A;  3EQ1 A;  3S9M C;  2QRY A;  1YTV A;  2CZL A;  1OIB A;  5CM6 A;  3QXM A;  3PUY E;  1XOC A;  1MXY A;  3G3F A;  3KSX A;  3N26 A;  3OSR A;  4KYS A;  4BDL A;  4QFL A;  1D9Y A;  2F97 A;  1SD3 A;  1R9L A;  1I6B A;  2ONK E;  1B32 A;  2AL5 A;  1B46 A;  2XXU A;  3E4R A;  3EHT A;  4G2Z A;  3ZSF A;  4BDQ A;  3HO7 A;  2OCU A;  4MBP A;  1BTJ A;  1ATG A;  1D3K A;  2XX8 A;  4PP0 A;  4F19 A;  4I62 A;  1L5T A;  1N84 A;  1PB7 A;  3R6U A;  1FQA A;  1NL5 A;  3T96 B;  4EDP A;  2WOP A;  4GIZ A;  3FVN A;  4MLV A;  3VV5 A;  4DIG A;  5IKB A;  3V83 A;  2RCA A;  3TEL A;  2DE4 A;  3B6Q A;  4XIG Q;  3VXB A;  2XXX A;  3H06 B;  4OXV A;  3TOD A;  4IO2 A;  4IY6 A;  4P11 A;  4UAC A;  5JTY A;  1NNF A;  1QUJ A;  3JZJ A;  2WOK A;  2ZYK A;  3G3J A;  1J1N A;  3P7I A;  3VVF A;  1A8E A;  3MC2 A;  3KFM A;  1URD A;  1SVX B;  4U22 A;  5AE4 A;  3WAF A;  2YLN A;  1H45 A;  1URG A;  1ZJL A;  3LSF B;  4H8J A;  1HSL A;  4NED A;  1TFD A;  2PYY A;  2XXQ A;  3USD A;  1SI1 A;  3FXU A;  3HV1 A;  4G8H A;  4GXS B;  1FCK A;  4U4X A;  4QFP A;  2DVZ A;  2HFB A;  3BFU A;  3DLN A;  4EQ9 A;  2NXO A;  1POT A;  2DWI A;  4OET A;  1B6H A;  1H76 A;  1DSN A;  1LAH E;  1A40 A;  1NH7 A;  3H6V A;  5BUU A;  5CMC A;  1N04 A;  3IOW A;  3E3K A;  1PB8 A;  3RUM A;  3S4U A;  4ZEB A;  3CFX A;  3FXR A;  4H0W A;  2G29 A;  4F18 A;  5CBS A;  2FYI A;  4GL8 A;  3K6U A;  3UIF A;  3B7D A;  1B05 A;  1BKA A;  1M5E A;  1MQI A;  4G68 B;  2X26 A;  4BLA A;  1N7W A;  3FAT A;  2VHA A;  3CVG A;  3G3H A;  2UVI A;  1EZP A;  1YPN A;  2YPN A;  1USY H;  5LOM A;  5H8H B;  4IO6 A;  3IL1 B;  4N07 A;  4Q5T A;  2UVJ A;  3KEI A;  1TWY A;  4ELO A;  2RCB A;  1DTG A;  1H44 A;  3CRB A;  3N5L A;  4G8M A;  4GD5 A;  3RT8 A;  4YKI A;  5CBR A;  5H8S A;  4DDD A;  3D4C A;  5AA3 A;  5HBC A;  5H8F A;  1A99 A;  4U1O A;  5FHO A;  1GTK A;  1NKX A;  1QVS A;  3K1N A;  3Q28 A;  1QUK A;  2XX9 A;  1FTJ A;  1VE4 A;  4QSC A;  1OLC A;  2R6G E;  2F7B A;  2FNC A;  1B1H A;  1H43 A;  1QKA A;  3PUX E;  4OHN A;  3TAJ A;  2F5X A;  1D9V A;  1US4 A;  5TP9 A;  3IOR A;  4JB7 A;  5FTI A;  3C31 A;  4ZEF A;  1XT8 A;  3DRK A;  4HS7 A;  4EF2 A;  1WDN A;  4H65 A;  4ISU A;  4LAT A;  3VXC A;  2H5Y A;  3IR1 A;  4R6H A;  1UIU A;  2HQ0 A;  2OJT A;  3MQ9 A;  4QHQ A;  4YU0 A;  1P99 A;  1JVY A;  2Z22 A;  2DWH A;  3CR9 A;  3GBB A;  3TZA A;  5BWJ A;  3PPQ A;  3RYA A;  4Z0I A;  4G68 C;  2G93 A;  4R73 A;  2O69 A;  2QSX A;  3GXA A;  4DZ1 A;  4PFW A;  2YJP A;  3FJG A;  4OVJ A;  1N7X A;  3MPK A;  1SW5 A;  1NMU A;  3TTL A;  2F7C A;  1A55 A;  1O63 A;  2DXY A;  1MPB A;  2AYS A;  2O1L A;  5K2X A;  1ZTY A;  4NWC A;  2H98 A;  3L6H A;  3IO6 A;  3CI8 A;  2B3F A;  1QW0 A;  3U93 A;  4NWD A;  1OVT A;  2VD2 A;  4AQ4 A;  4BDO A;  3DRF A;  3I3V A;  4GL0 A;  3K4U A;  5CMM A;  1N0T A;  1FW0 A;  1ZLQ A;  4RPN A;  3KG2 A;  1GV8 A;  3C32 A;  3T9X B;  2HXW A;  5I59 A;  3RGY A;  1LGB C;  3FJ7 A;  2DYX A;  3DP6 A;  3KN8 A;  3H7M A;  5KCJ A;  1AIV A;  4Q0C A;  5M2V A;  1DPP A;  3DRH A;  2VP1 A;  1N3W A;  2I0C A;  3K1M A;  1UIV A;  4JWX A;  4KCD A;  3T9U A;  3M8U A;  1OQH A;  3RLF E;  4F31 B;  2B3B A;  3CSB A;  2D5W A;  4O3C A;  5I57 B;  1UQW A;  1N76 A;  3A3C A;  5A5X A;  1M5D A;  3O6P A;  1B7H A;  4ZE9 A;  3K6V A;  1A8F A;  3PD9 A;  5I2K A;  1AOV A;  3N6U A;  4I8C A;  4EQB A;  4YKK A;  2THI A;  4FEB A;  1ZU0 A;  5J1D A;  5DVI A;  3OO7 A;  1LAX A;  1B9J A;  2Q88 A;  3VVE A;  3SDF A;  2WKY A;  1AL3 A;  3H6T A;  1EZ9 A;  3OO6 A;  1H3D A;  1DTZ A;  3PPP A;  3PUV E;  1A54 A;  4QRZ A;  4RPO A;  1LB9 A;  4E0W A;  5I58 A;  4P0I A;  4F1Y A;  2B65 A;  2PBW A;  3FVO A;  3T9V A;  2W7Y A;  1US5 A;  1O64 A;  3TCG A;  2E0S A;  5HPQ A;  1FTO A;  1M5F A;  5JTY B;  1VFD A;  3DP4 A;  3MZ9 A;  3FTO A;  1IXH A;  3U92 A;  1LB8 A;  4F1V A;  3KSJ A;  2UVH A;  1MH3 A;  2XXH A;  3K2D A;  1JW4 A;  3CG1 A;  4GRK A;  3SEY A;  3VFJ A;  4HW8 A;  1MG1 A;  3Q29 A;  5I56 A;  5L8D A;  3T66 A;  3O6G A;  4YMA A;  5AA4 B;  4PFY A;  3CSG A;  4KYE A;  1UTH B;  4RY1 A;  2ANJ A;  3PU5 A;  4F3G A;  4POX A;  2UVG A;  5ITP A;  1Y3P A;  2OLB A;  1NFT A;  3K1P A;  3KJT A;  3O97 A;  3QAX A;  4GLI A;  3RPW A;  1ANF A;  4F29 A;  3R7X A;  2Y7W A;  3SEV A;  1BLF A;  4LON B;  5CC2 A;  1HSE A;  1VR5 A;  3CG3 A;  1P1Q A;  3GZG A;  3OO8 A;  3IB0 A;  3SEU A;  3FV1 A;  1S50 A;  3RQT A;  2P2A A;  3TPA A;  1OLA A;  1MPC A;  2RIN A;  4TLM B;  3DP8 A;  2XD2 A;  4P0G A;  5AA2 B;  1LBC A;  5KDT A;  3PPO A;  1NH8 A;  3MP6 A;  1FTK A;  3OO9 A;  2ALU A;  4QF9 A;  5FHM A;  5B7D A;  2I6E A;  2QS2 A;  2I58 A;  4ND9 A;  5CMB A;  3TYH A;  4DLD A;  4BDN A;  4C1U A;  3S9E A;  1NNK A;  5KZT A;  3H3G A;  4H5F A;  1UTB A;  1MXX A;  3M3K A;  3H6W A;  4KFQ A;  4L17 A;  5AA1 A;  1MDP 1;  4GFR A;  2B4M A;  1Q35 A;  4K3F A;  3IJO B;  4NF8 B;  3TTM A;  1B52 A;  1Y3N A;  3O66 A;  3PPN A;  4YB6 A;  2OWT A;  4X48 A;  3UK4 A;  5I57 A;  1MS7 A;  4NF4 B;  1GR2 A;  1B0H A;  2ZYM A;  2GHB A;  4ESX A;  5A5X B;  3EPE A;  3MJN A;  1FQC A;  3OXN A;  4XKP A;  3VVD A;  4LZ7 A;  1URS A;  4IB2 A;  4JSO A;  4DCY A;  3QYT A;  2HAU A;  1IQ7 A;  1SQY A;  2UYF A;  3IOT A;  3O9P A;  1IXI A;  4XKQ A;  4RJZ A;  4H8I A;  4ZDM A;  3QIM A;  3LSX A;  2REG A;  3CFZ A;  3QUF A;  4KCC A;  3I5O A;  1LCT A;  4KHZ E;  1MM6 A;  4R9G A;  3LUY A;  4OEN A;  4RNS A;  4YKP A;  3KJ7 A;  2PX1 A;  3LR1 A;  4DXC A;  3MBP A;  2O84 X;  3G3K A;  1CE2 A;  3VLU A;  2DE3 A;  2DVC A;  4NMY A;  4ZZE A;  2I4C A;  3K0V A;  3MUQ A;  4F3P A;  2ZYN A;  5F7V A;  1LFG A;  4E0X A;  2DSF A;  3BKI B;  4KQP A;  3U94 A;  5B70 A;  1OQG A;  1P1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...