1B3JA

Structure of the mhc class i homolog mic-a, a gammadelta t cell ligand
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
274
structure length
264
Chain Sequence
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I HOMOLOG MIC-A
publication title Crystal structure of the MHC class I homolog MIC-A, a gammadelta T cell ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 54
structure length 264
sequence length 274
ec nomenclature
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b3jA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1b3jA01
4PJ5E 2LFGA 1T4KA 3RVWC 6CGTA 1GGIH 2I9LB 4JHAL 3U7YL 3OB0K 2XXCB 3IS1X 1NGPL 2WUCH 1ETZA 3KDMA 3QHFL 5JOPD 4K3EH 1EERB 4JGJA 1MIEL 3UZVB 4P5KB 2LTQB 4LHUA 5C0GA 4DAGL 3ULSB 3BIBX 5ITFA 2C1OA 5I8CB 4A2MA 4HWBH 3WLBA 4CADB 4XBPB 1P9MC 4PRBA 3VMOA 3B6SB 4M5YH 3C9NB 1OAQL 4PJ5A 3BW9A 3DBXB 3U6RB 3IKKA 1NKOA 2X4UA 3SE3C 1KCVL 1C08A 1F11A 3SKOA 2PETA 2A9NH 1T1YB 3OKYA 5C0BD 3U0TB 3GMOB 3MJ6A 5FOBB 4HX1B 1PG7L 1DDHB 2ITCB 2J8UB 5ETUA 3MREA 1IRAY 1HIML 1TQCC 4U2YA 3B4NA 3G08B 2UVEA 1QBBA 4WTWA 3FQWA 3T4AB 1A7PH 1HH6B 3PQYE 4M43H 5DRWB 3VMNA 1CFNB 3B9KC 3TIDB 1NFDE 1FE8H 4KMTH 1FPTL 4QLRA 4LLYB 4NGHH 5B21A 4U1LA 4QWWD 2ZUTA 2JTDA 2V6HA 3UTZA 4TTDD 4GJTB 3VW3L 1UJ3A 2DL2A 4NO3B 2BNRD 5KSVA 3WJLC 2WMPA 4CU6A 4P9MH 4Y4KA 5DUBB 5SV3A 2K7QA 2K3TA 4LCWA 5L7XL 2HKFL 1DZBA 4H1LG 3U83A 1G6RB 3QZWG 3ZE1F 5KSAA 1XF5A 1KV3A 1LP9B 3BWUC 3FO1B 4O00A 3H9HA 3WFBL 4QRPD 5IVXF 1K3ZA 1QTYT 3LPWA 3UBXA 4ONOA 2V2TA 1NGYB 4LEOA 2R2HA 3MRFA 1XCTA 3HFMH 4TUKL 4OSUL 2DIBA 2ZNXA 4QXTA 3IFPB 1E4WL 4ODUB 4OD2B 2FEEI 1NMCB 5C0RH 4UU9B 5F71A 5IR1B 3U4EB 2FBJH 1TTUA 3EYOA 5IBLC 4WDIA 4AIOA 4RFEA 3L3IB 2J88L 3PL6B 4LPXA 3BKYL 2E27H 3V6OE 2P8LB 3QEGH 1QRNE 2P7TA 4XP1L 2PYFB 4KKLC 4ZUVA 4PRHB 1FHGA 4BFGA 4QNPE 1L0YA 3CDCA 1MVUA 3QUZB 5E6IC 5DUMH 5ISZE 2NZIA 5J6HB 3WNPA 1K8IA 2VLRB 4MSWA 4G7YL 5CJXA 2JELL 4PRDA 5DK0B 1JHTB 1JGUL 4HUUB 2WWKO 3DVNA 1VCAA 4FFZL 4IRSD 5DJZB 4JREC 3LRSA 3WLWC 4BK5A 5EUOA 5LXGL 1MJUH 4PFEA 1Q72L 4DQOH 3QA3B 1E6OH 3N85H 2EE9A 2V2WA 4F58L 5I73B 3PF2A 2R1YB 3DMMD 3V7MA 5EU6E 2IQ9H 2P42B 1TQBB 4H25B 3G5ZB 3VWJC 1S7RB 3FMGH 2FEDC 4EN3C 1QFUL 3T0WA 4QRRD 1EMTH 4BM7A 1B0RB 5JXEC 4HIXL 5TF1L 4X4ZA 1QSZA 1S9YB 3KYAA 1DN0A 2GCYB 4CGTA 3FTGB 5DJDA 2DWEB 1VFMA 3I9GL 4JQXC 2NY6B 4LRIC 3KPRA 3V0VB 3FRPA 1EHLL 4QHUB 3OHXB 1JWSB 2V5SA 2VE6A 3TJHC 1JVKA 4JM2C 4X4YA 4XNUH 3QDGD 3KWWA 3BWAA 5EOCH 3B83A 3W0WE 2VABA 4GO6B 4LFHD 4RFOH 1QKZL 4CDGC 4DGIH 2FJFA 5J12C 1I85A 4LAJH 3QO0B 2BRRL 2EDYA 1X5LA 3TFKD 1U93A 2YSSB 1F4XL 1KBGH 4M7LT 3QFDA 4EDXA 5C6TL 5DHXB 5J56B 3J7HA 5F7NC 1I7TB 1IQDA 2VLLA 3BPOB 3VXRB 3FOMA 3UYRL 2VL5A 4CMHB 1U8JB 2IQAB 2WBJB 1PY4A 4JPVL 4LBEA 4MD0B 1X5XA 3W0WA 1MJ7H 3ZT5A 1KIRB 5DVKA 3NFSH 1XGRB 3I75A 3D69A 1WF5A 5T1DH 5CEXB 4NZUL 1YJDH 1FYTD 1UT9A 3OPZL 1R3LA 1MFCL 3EHBC 1RVFH 5HHXH 1EZVX 4LASH 4ZOCA 5SX4H 4TSCL 1QOKA 2NY0B 4JFEB 5ABDE 1KT2B 3QFJB 4YBHA 3EBAA 3FO0L 1A1MB 5C0CE 4L29A 3RU8L 4J6RH 1OAXL 4C56D 1BD2D 3ESUF 1L7IL 4HHAA 3BKJH 2H32B 4CKVX 4L5FL 5TDPA 4YHIA 3WIHA 1S9VA 2EEDA 2XZQL 1H8SA 3V6BR 5B38A 1IT9H 3DPBA 3BJ91 1QNZH 5GS0C 4L3CA 2F5AL 4JVUA 5ACZA 2W9LA 3O2WH 3AREA 5DJCB 1EUTA 1I8MB 1CFSB 2D7TH 5D7KD 4HQQH 3TV3L 4NWTH 2VZ3A 1I1AB 5IROA 5I30L 4H8WH 2VLME 5F1NB 5E5UB 5IKCB 2CIIB 1YNLH 4MA7H 5C2BL 4FQHB 3LRHA 4KQ4H 1NCAH 1X4XA 4MB4A 3UTQA 1S7QB 3SDDC 1JPGB 1I7UB 1CU4H 1D5IH 4KRPC 5TQ0L 2VXUL 3MLSH 3U9UA 4GUPB 3FQXB 4Y8AA 3GSQA 4WENB 2D0HA 5EU6D 4P46D 1LQVA 3CK0L 1F3JA 2CKBB 2APXA 4L8DB 1FL3A 5DWUH 4CNIA 1IQWH 1GHFL 2QJDA 4XPHH 4R3SB 4BSVA 2XT1B 1T5WA 5SX4I 1BWMA 2WLYA 4UUJA 1J0YA 4N0FB 1RMFH 3E3QC 1ZHKA 4BQ8A 3O41B 4U1HA 5ID1A 2HLFD 4ZOBA 1DEEA 1NLBL 3AXLB 5JO5B 2O61B 4FABH 4PJCE 3IXAB 3VFVB 3EYVB 5IVZB 5F44A 4LARL 3QPXL 1DBKL 1Z5LB 3STZB 1XH3A 4P4RB 3U2SA 3HZYA 2YD3A 3KYNB 1KJVA 3D25B 4LF3B 1NBYB 3MRMA 4F8TA 5KVDL 5KS9B 3M8OH 3HG1A 5E2WH 3ARDD 1NCDL 2MHAB 4J3VA 2XQYK 4RISL 3WCYA 4IJ3B 2FX7H 5IFAL 2DYPA 5BV7C 3HE6D 5F1IA 4UDUB 3MBED 3P40A 5A2FA 4PJCA 4HWNA 2RBLA 5E8NB 3C60C 3DGCR 3LPGA 4OM0L 2VDKH 4R8WH 2FR4B 2CJUL 1IKFH 5B4MC 2PO6B 5EO9B 3EFDL 4OQ1A 4WW1A 3OGOE 5DJXA 3QDAA 3RVXC 3M1BB 5DRXB 5JLZA 1RJYA 4NQDA 4NNYB 1P4BH 1U8PB 1P5VA 2QHRH 1DUYA 1JHLL 1RZIB 1HXYA 4Z7QF 1WSST 1VKXB 5F88B 1QR1B 3MRQB 4YBLC 4HPYL 4P3DB 5C07E 2JJVA 3DX8A 4KRNA 4WV1C 4QHNB 4ORGB 4ZOEA 5DQDH 5GGRB 1JNLH 1RQ5A 1EEYA 1OAUH 1U91B 2I60H 3QEUB 1LO5B 3SHSA 1PKQB 2I25N 3UJTL 5J6GA 1WEJH 4N8VA 3EZ8A 2FHBA 2XI9A 2VDOL 4U1GC 3LN4B 3VG9B 4MZ2A 1AXSB 5HBBA 1HINL 1J1PH 1H3TA 3TZVC 4ZFFB 3ZTNL 1MWAH 5CLWA 4I77H 5C08A 1KELL 1U8HA 4ZNEE 2DQEL 1OWRM 4YHYC 4YHOL 3GGWA 3SDYL 4ELKA 5INCB 5DJ6B 4PJEF 3UDWC 4YQXH 5DC0A 4MJ2A 1T22A 3GBNL 4ZUSB 2QQLL 4MA8H 5HYFA 1QFHA 4M7LL 3OR6B 3CZFA 2YC1B 1A3RH 3BHBB 5C7XL 2J8HA 1XGTA 4HIEA 4N0UB 4X98B 5FB8A 1HOCB 4XWOC 3K4DA 3S35H 4EVNB 1HHIB 4HC1L 1HQ4A 5IMKB 3IDMB 1IVLA 4DOHE 4EXKA 2HMIC 5GQBA 2B5IC 4FTVD 4ONGL 5C0AE 1M6OA 3O3DB 5F1SA 2OR9L 3NGBB 3MC0A 4YUEL 3HZVA 4D94A 4MA1B 2NX5E 2AJ3B 3LEVL 4OLUH 5IGXH 4IBLT 3CFJA 5EULV 1F2QA 1NBZB 5BV7L 4M6AA 2NY1C 4QTIH 5I18H 2GAZB 5ICXA 3JWDL 3DIFB 5IQ7H 3MV01 4NNPH 1B88A 5ERWB 4NO0A 3GK8H 1NGWA 3IAGC 1S7VB 4XVJL 2XTJD 4XC1H 2DKUA 5BQ7B 5C09B 3Q1SH 1FO0L 3OXSB 4FQ1L 5DURB 2OTUB 4NDMA 2DQJH 3MMEB 1V3LA 5EOCJ 1CGYA 4L9LB 4JO1H 3PV7A 3PIQA 1ED3B 4QTHB 2WLZA 3V5KB 2Z9TA 2KUTA 1H8OA 2IG2H 3RGVC 1RK1B 4IRZH 2L7UA 4ZFOA 1BOGB 1G84A 2NX5A 3OKDB 5FKPA 4PJFA 3BAEL 1FJ1B 2YPKB 4EQ2A 1MQKH 3PP4L 1I3GL 4XHQA 2ID5A 4XVSH 5K9KB 3RNQB 4IMLB 1AO7A 4L8CB 3AAZB 4JQIH 4ZS6C 3EDKA 3QNYA 4OF8A 5I1LB 4D3CH 5BS0B 3WFZA 2DTML 4NRXB 4O9HL 1Q38A 3MV8B 3MOBL 1J8HE 1GGBH 2FH8A 4BJLA 4PG2C 5E6YA 5ALBL 5HTSA 2VAJA 1G9MC 1JL8A 1YEIH 1YEKL 2B2XH 2R2EA 4N0YL 5C3LD 2A9MH 1A0QL 2UZIH 4OM1H 4MNHB 4DW2H 1C7SA 1BQLL 1UKQA 3GSXA 1IC5H 1W8OA 5I1JL 2B0SL 2RB8A 4S1SH 1BZ9B 2YD2A 5EFIB 4FN0A 2EE3A 5C8JA 3OKEA 1QHPA 3LKQA 5IW6B 5E99H 3ULUD 2MCG1 3I6KB 4YXHL 3U9PH 1J8KA 4G8EA 2GJ6A 4K55A 3PWLA 3SE9H 5I76B 3V4UL 4PJFF 2F54B 4PRIA 4MS8A 5ID0A 2R1XB 1MFDH 4XPBL 1I8KA 1JTTA 5KN5A 2R1WB 5KJRH 3MRIA 4YR6B 2VN4A 3AMLA 3FCTA 1CDIA 1YNTA 3IDIA 5MEOA 3QRFM 3MCKA 2D31B 1CFQB 4R4FL 5DD0L 3VFUB 4HWEH 1HQRA 3TH4T 3L7FA 3TYGH 3VXQB 3TNNA 5J1SC 1LHZA 1UCBH 3QNXA 3SDAA 5E8DL 1L0QA 4J8RB 2ZUWA 4GG6F 3R0NA 5D7LA 5FYJU 3MRCA 3DXAA 3MACL 2CK0H 2LAAA 4LDOB 4M5ZL 4R2GD 5E1AA 1UB5A 3OKNB 2VZ1A 5FO9B 3NIGF 3MLRH 2H3NB 1HDMA 5HI3C 4U7KA 4PJGE 1CZ8L 1KPUB 1BJ1J 3L95B 2YRZA 4P2OB 1N0XH 3UTTB 1P6FA 5DVMA 3PHSA 1DBJH 4L3EE 2EYRA 4CU7A 3IU3B 4OFPA 1G9ML 7CGTA 4KK5D 4N8PA 3AM8A 3GMMB 2V7HB 5I16B 4HG4J 1HNFA 3EZJB 2IANA 3TA3A 3PGDA 1WFTA 1A5FH 2IF7A 4Z7UA 1T21A 1AY1H 1YMMD 4Y1AB 3O6MH 4PP1C 3SDCB 1IKNA 2W9EH 1I1YB 5FGRA 5HYSB 5KSBB 3E6HA 1M71A 1VENA 3KJ6L 5ANME 3T3ME 5MEQA 3MRPB 5A2IH 5CD5C 4PYHA 1ZLWK 1HYSC 1KN2H 5CJ8A 1ZT1A 2ITDA 5DJ0B 5D1QA 4U0RB 3SBWA 4PBVC 4ZFZB 1I8LC 2IPUK 5HXMA 4Y5YA 4FXKA 2Y06H 1H5BA 5JQ6H 4LQFL 4M48L 2X9YA 1CICC 1CGXA 4X9FA 1Z9MA 3OXRA 4DK6A 1KG0B 1AQKH 2WM0A 1J05A 2HN7A 5I15L 1X5AA 2LABA 3PDGA 5D96C 1RUAL 2AK4D 3IJHB 4PRPA 1YECH 3OTTA 5IG7B 4P2RE 2JIXA 4YHPB 1MNUL 3ZKMD 1J8HD 2D7MA 4S0TD 3T4YA 2FHCA 2VJXA 3FQNA 1NFIA 4JGUA 1CBVH 1EPFA 2X70A 4PREB 3HZMA 1UA6H 3QDMB 2PTTB 5MEND 4LCYB 4KI5F 4XVTL 4KPHL 3U7YH 1DE4B 2O5XL 4FFYL 4Z7UF 4DN4L 3O0RL 4ZMAT 4GS7C 4YDIH 1XGUA 5HDBE 4KK8D 1MIEH 3RI5F 5DD5L 4K94H 4NFDA 3VGEA 4UDTA 5IESH 4NKIL 4F3FB 3AY4A 1MFNA 4HZAA 1NKRA 2BXYA 1FZKB 5T1LA 1AFVH 3OKOB 5EZJB 4PD4K 1OSZA 3PHOA 2LTQC 4W6YB 3I02A 2VO5A 1A1NB 1VADB 4F7EB 4IIQA 4I0PD 2W60A 2FZ3B 3R0MA 3S3PA 1KCVH 4N1CA 1ONQA 5EZLA 2P24B 1U6AH 4B50A 4U05A 3D9AL 4ZS7L 4BH7B 4E41B 5I1KH 5J13B 1A2YB 2HJKB 2Q7NA 1P4IL 4LVHB 1PG7H 1A6WL 2VLKE 3VGGA 3U7AA 1HIMH 4V1DA 1U95A 2G5RA 4FA8A 4MHHG 3ECBB 3GJEA 4JCLA 5DA4A 4HIHA 2E7HA 3MLXL 3M17A 3MRRB 5SV4A 1XF3B 2EKSA 3IFLH 3W81A 1N8ZA 5FUZH 3VXMD 1FCCA 2GQHA 2BNUB 4F9LA 3CXDL 3VWKB 3VXSD 4BQCA 5JW4M 3QI9A 2CMRL 1B4RA 3VW3H 12E8L 2F15A 4YFEA 3GSWA 1SM3H 2ADIA 4QRSB 5L7XH 2HKFH 3MUGB 3UC0L 4U1JB 1DVFD 5SWQA 2VDNL 1PKOA 2VLKA 1VPOL 1GAFL 2HFFB 3WFBH 3LKRA 4KK9C 4POYA 3F62A 4ETQB 4WWKA 4CUCA 5IM7A 4TUKH 1BVLA 2AV1A 2DMCA 3UTPE 2VXSH 1FFNA 1KTRL 4PP2B 1E4WH 1DQDL 3UTSD 5ILTL 1TNNA 2YD7A 2UZYB 2IH3A 2NNAA 2EDXA 4HUXA 1FNLA 4P5TD 5C0FA 3R06A 3BKYH 1NMCC 5FXCH 1WBZB 3MV7D 5HHOB 3MLTB 5HJ3A 3G6JA 4ONFL 5JHLH 3LMJH 5HHMB 1P1ZB 3PL6C 5EZIL 2C1PA 4R9HA 3W9EB 1HCFX 2ICWB 4KZDH 3IDYB 1BBJB 1KUMA 2KZ1B 4G7YH 5FHAL 2XWBB 3WV0A 2MCPL 3QUZC 4MVBC 3VFSB 1I1CA 5HGBB 1IGYB 5EIQA 4GRWB 2CQVA 5F89B 2WP3T 4XNZB 3IDXH 4APQB 4FFZH 5DJAB 4HV8B 1CD9B 3LHPH 5EOTA 4JFFD 2YK1L 5FYKU 3V2AR 1IM9B 3QG7H 1KLUB 2B1AL 2XN9A 3T0EB 2QR0B 1RIUL 3C6LD 4HSQA 5IB2B 4MD5A 4Y16D 4OFKA 2ZSWB 5JW4Q 4PJIF 4ZO9A 1G7LB 5JW4R 4LPWA 5E00B 5AYQA 1KC5L 5GZND 5DHYB 2WWMC 1NGXA 5I73C 4MQSB 4P4KA 5E8EB 2RQ8A 1P9MA 5E8OB 4X9IA 4PPTA 1FH5L 5DI8B 5CFHA 3C09B 4FOMA 3IJSA 1TQBC 1QFUH 1T7ZA 1IL1B 8FABB 1A6ZB 5TF1H 4M61B 3HRZA 4PJHE 2YD6A 4HFWB 1I3RB 5SX5K 3BDYL 1U8NB 3I9GH 1T5XB 1EHLH 3TPUA 5GS3A 1BM3L 1IM3B 1OB1B 2NY6C 4MJ5B 1FAIL 1GIGH 4N9OB 3G6JF 4Z7NF 4ODHH 1QKZH 4JDTH 5INDA 1XZ0A 1G6RL 1K2DA 3B9KA 3MLWH 3FQTB 4NKQB 4NHUE 4QKXB 5IUSA 4E0RB 2OYPA 1RULH 4EI6B 2H6PA 2BRRH 2ZUSA 1VHPA 1YN7B 5GJTL 2A6IB 3SCMD 2EYTB 4PJHA 5EBWB 1F4XH 2VDLH 1FBIL 3MLYH 3D3VA 1KLGA 4HPOL 3QIUD 4NSKA 2X4SB 1P7KB 3RIAF 1CTNA 1NJ9A 2J4WH 3MRGA 4XXDB 3UYRH 1OAZL 3TO4B 3SOBL 1J18A 2ED8A 2YMXH 4R4ND 1ZHNB 3BPOC 3DX9B 3RVTC 1T7XA 5DRNA 3RIFK 4QT5A 5TPWL 5C92A 2MPAL 4QOKE 4URTB 2KKQA 4P0DA 4PTUB 4CMHC 1ZLUK 2WBJC 4NC1C 4YX2L 3UXFA 2Y7QB 2DBJA 3D0VA 4NZUH 2JK5A 1T20A 1NDMB 1EAJA 3LKSA 4AENA 3B5HA 4TSCH 1WIPA 4ODTL 1GSMA 4C4KT 3T2NL 3BP5A 3RA7H 1SY6L 2EH8H 3CZJA 4V2CB 3L6FA 2BOCA 4FQJL 4PIRF 3BGMA 5C1MB 1K6QH 2XNAB 1S78C 1SJHB 2NY0C 4QOKA 5I9QB 4OZFH 5DYOA 1S8DB 3FO0H 1FFPB 4RZCB 4WCYL 4U6YA 5DD3L 5HI5D 3HPLA 3V52H 4L5FH 3GM8A 4YIQA 1QBAA 3CGTA 5D2LE 2ADFL 5D1XD 1Z3GL 3L7EA 5JDJA 1EXUB 3TGXA 2CLZA 4CW1A 3DRTA 3VFWB 1DBBH 2BVUA 1J0JA 4HXAL 2F5AH 4U1MB 2W92A 4LNRB 4U1IB 4NPYB 2NW3A 4H1LH 2VR4A 5IMOA 2G60L 4OZFA 3TV3H 4PP8C 3IGAB 4EN3A 4FNLL 3Q0HA 5I30H 3DSNA 1ORQB 1G7IA 3BE1H 4OLVH 4BSWA 4I3RL 3X11A 4OV5A 1VFBB 1RZJH 4WIQA 5D2LA 1I1AC 5BCAA 4LLDA 4JQXA 4LRIA 4QRPB 1IAIM 5E24E 2WSKA 1GGCL 1KTDA 4Z7WE 4OKDA 1PG7W 3TJHA 5TQ0H 2R4SL 4JM2A 1EEQA 3KXFA 1HI6A 1NCTA 3ROOB 4XRCB 4JFYB 2LU3A 1KB5B 4JPIA 1C5CH 4BZ1H 2UY6A 4FS0A 1GHFH 4Q9RL 4NRYA 1CFVL 2Q86A 3L3HA 2R69L 5AEAA 3S34L 1M4KA 4M62L 2Q6WB 3TO2B 5MHSD 1E28A 4Q0XH 1MRDL 3F7PC 4N5ED 2FO1A 1QSED 2O93L 3CSPA 3DV6A 4ERSL 1ZGLM 4KJPC 1NLBH 5JPMB 3QDJE 1EHNA 3L1OL 5HGAB 4Y2DD 4U6HB 4LARH 4XMKL 1U92B 5DS8B 1WC7B 1M1SA 4CVXB 1E4XI 1RK0A 3BYTA 5IB5A 3L5IA 1ZK9A 2I07A 5F7FA 3IETB 4OZHB 3IAQA 3NFPA 5D8JL 4S1RL 2VZUA 5IHUH 1V3JA 4M8QB 1KJMB 1X7QB 2QSVA 2Z92B 4LOUC 3MSPA 3ZO0A 4RISH 5DVOA 3MLZH 5H2BA 5IFAH 3MZTA 5GGUA 4MAYD 5I1AA 1OP5H 3FRUB 3VI3F 1C1EL 4P49A 1FGNH 4G6FD 2IPKB 3S5LG 4IJ3C 3BH9B 5GS0H 3ISWA 5I1DA 1GPOL 3KPLB 4OM0H 4BH8A 1QPXA 2IH1A 1YEDB 2AABL 5ENWB 4GAYA 4CN4A 5FO7B 2EDLA 3ARVA 1JV5A 5EOQL 2HT2D 2H9GB 2PO6C 4WI8A 3SKMA 4W4NA 3KLDA 3IDUA 3MJ8B 1JHLH 4YPJA 1SVCP 5FYLH 5FYLE 1WBXA 3H3KA 1TJHH 2QQNL 4D9QD 1FGVH 2PCPA 3QDGB 3L5HA 3U46B 3RNKB 3QUMB 2YWZA 3GFUA 3X3FL 4MJIA 43CAB 3MLUL 3UJTH 3ZT7A 4M7KL 3VD4A 1WTLA 2VDOH 3VXTA 4RIRA 2VISA 4YO0A 2X89D 3ZTNH 4WFHE 4LKCB 1T2QL 4K07A 4XVUC 4MXWH 3VG9C 1LE5A 1OGAA 3OR7B 4Z7OF 1MHEA 3ES6A 4NHCH 1OWWA 3MGOA 1DQML 4CAGA 2SEBB 3QJHB 1FRGL 4DUWA 4KWUA 2QQLH 2NTSP 4YWGL 5I75B 5SWZD 1A02N 1A6AA 2KH2B 1S7XA 1A7OH 3WHXA 4POZD 3SDDA 1A6TB 2XZCL 5LG1A 5A3IC 3PQYB 5FDYA 3LH2H 5B3JF 3DROB 4KKAD 5HDQL 1NFDB 5IJVA 4HC1H 2YPLA 4O2CB 3WFEH 3D1MC 4I5BA 2X4TB 4DKEH 2VQ1A 5H35B 4LCCB 1AJ7L 4ZPVB 2CDGA 3CMOL 3EYQD 1ZHLA 2YD9A 4KJYB 1G7MA 5IF0B 2Z31D 3LEVH 3B5GA 5DQJB 5CAYB 4BFIA 4OBSA 2EIDA 3E3QA 5C0EA 2WV3A 3TCLB 3VCLB 3NGBC 4MA1C 4ZUUB 4MLIA 1EX0A 5CSGA 4LHUD 2C7UA 2EDJA 4OF7A 5E0QA 5I1IH 1V7ML 4XVJH 4XPAL 3UYPA 4HC1A 3TT3L 1CFTA 5FO8A 1JF1B 1BD2B 1EFQA 4LLUA 1X5IA 5F21B 4G42B 1YEJH 2BERA 2PKDA 4ZYKB 1M7DA 1EGJL 5E9DA 4HS3B 2GITB 1QYGH 4L4TE 4L9LC 4ZPTA 2JE8A 5SWSA 4K7PL 1QRNB 4OJFL 4RMQA 1OF2B 3BP6A 4PGCA 3PP4H 4LSPL 1I3GH 3LQMA 4WFGE 1LO3L 5DK2A 4HUNB 2X2YA 2ZUQB 3K1DA 5ISZB 2ZCLL 5IEKA 3C60A 5J1AA 2CUMA 3KYKL 1RHHB 3MJ9L 4P2QD 4BZ2L 1FO0A 1NEZG 4DVBB 1ZGLB 1M05B 4HGKC 3MOBH 3CFBB 5CEZL 4HS8H 2EICA 5HGDA 2B39A 5ADOL 1DTUA 5KW9L 3QIWB 1A3LH 4NRZB 4EUPH 3EAKA 2X1PA 5KVGH 4N0YH 4Y4KD 4WU7B 4KJQD 5J3HD 4C57C 1A0QH 1RUQH 4X4XA 4LCWD 3OJ2C 5EU6B 4WV1A 4ZQKA 4I3GA 4P46B 4B41A 1WZ1L 4BUGA 2V5MA 5KSAD 4O4YH 5EB9A 1BQLH 1KB9K 4FQXB 1MI5E 5I1JH 2AW2A 2X4OA 1GOGA 4GT7A 4NKDB 3IF1B 2ZWLT 3MGTB 3L3GB 3TZVA 3I3DA 4UV7L 3FB5A 4NZDA 5GRVK 1BIIB 1HKLL 1SVZA 2UWEE 1M7IA 1QUNA 4TUJB 3LEYL 3C6SA 1HE7A 3KLHC 1DANU 5GRUH 3RWEB 3BH8A 3UDWA 5ESQA 3ME0A 4U33A 2HT4C 4EUPA 4F7MB 3RPIA 3NACL 1X4ZA 5D7IE 4AH2B 4MD4B 4YHZH 3EYSL 4U1SB 2LE9A 3V4UH 5E4IA 3LD8B 3HNTL 4ZOAA 1JWUA 1R3KA 4IDLA 4JPKL 4XHJC 3QQ4B 4UT7L 1U8MA 1PG7X 2CDFA 4MDIA 4XTRC 2V7NA 3MNVB 1FL5A 4WFHD 2ZG2A 5AUMA 1MY7A 3VA2C 4NWUH 4F2MA 1KEMH 1U58B 1YEHH 5B39A 3MBEB 5HPMB 4F7TA 3MRBB 4S10A 5E8DH 5D7IA 2Y1VA 5IVOA 4JZNB 4GQ9H 3LSOB 1H3VA 3WKML 5JZ7C 2GUOA 3V6FA 4JAMB 5TDOB 4UTBL 1BLNB 4YXKH 4LLMB 1I9EA 3MRJA 3OKMB 4GRLB 1CLYL 3FQUA 2JF1A 2Y6SD 3CFEB 1T2JA 1LE9B 5IHBA 4UBDD 5BJTA 1KYOK 4GMSL 5T5FH 4KQ3H 2AAVA 4E42B 3RGVA 2PXYB 3AB0B 3VXUA 3WXVL 3TJEH 3MJ7B 2APVA 4WTZA 1CL7L 1T0NB 1OT1A 1OTUC 1MRCL 3BT2L 4P2OC 5BRZA 3KPRD 4KUCF 4WU5B 3G5YA 3HHRB 3PWNA 1FVCB 3UMTA 5HVGB 1CT8B 5GSVB 2X7LB 4TRPH 3W2DL 5C0CB 4HUKB 1WLHA 1SMAA 3KJ6H 5JTWA 3OF6D 1NDGA 2VYRE 4LDLB 1AGFB 3KNBB 4POUB 4WFFE 3SDCC 3EO9L 1N6VA 5DJ8A 3VFRB 1DUZB 1T6VN 4PG2A 3ZDYE 4A6YH 3ZL4L 1QVOA 4LLWB 1IC1A 1A7NL 4NO5B 4JN1L 3D39A 2DQDH 4M48H 3OQ3B 4U0RC 1QQDA 1O7VA 2BSTA 5B8CB 5I15H 3ZHLA 4I48B 2J12B 1INEL 4WW2A 4HKBB 5FYJL 5B39G 3CVIL 1RUAH 3LQAC 3HS0B 1I4FA 5E2JA 4KAQH 4X6FA 4FQQB 3T1FB 1F45A 2HVKB 4W6XB 1JUFB 4A6YA 4XNQA 1FN4A 1CE6B 3LS5H 4WHYG 4XCFL 3GSOB 1OSPL 1HSAB 1VEOA 2XTJB 5IEHA 1LEGA 4M1DL 1JPTL 5IHLB 1KCUL 4D2NA 1FIEA 3KLAB 1RV6X 4AJ0A 3ZHDA 4JFDE 1H3UA 3P0VL 4KPHH 3U7WH 3WFHA 1AI1L 3BGAA 4PB0L 4OCXL 1OVZA 2BFVL 4FFYH 3WD5L 4OCSL 2BSSA 4HEPG 5JIKA 1ZVSB 5IK3A 2QQQA 5DRZA 4PYGA 1OQOA 1MIML 1Q1JL 5EU5B 3T3PF 5DD5H 2NLJB 5J9PB 4NKIH 4HH9A 3ZKQD 2UUDH 4JG1L 4XNYL 1FZJA 2ZCKL 3QCVH 2X1QA 4JRWA 1NAMB 1T89C 1VESA 4UMGA 5DA0B 3FB8A 3LCYA 2BOBA 4JFDA 2WQ8A 3QXDA 4HZLB 3ARED 4DZ8B 4XCEB 3HB3D 2G75A 4EXPX 4RGND 2RGSA 5EBMB 1EEZA 4WW2F 3BIKB 5DO2C 5I1CL 4Q9QL 1IGML 3HCVA 2DL9A 3RVUC 5DVNA 4IOFD 3AS3A 2GSIA 4OIIL 3PE9A 4FFVD 2APFA 4UOW1 3BD4A 1KNOB 4XP5L 4G9FA 1VA9A 5J13C 2VRAA 4QEGA 4XCYB 2BNQE 4LVHC 5JXAL 4AEIL 4GKZA 3FQRB 5JDSB 2YUVA 1KCSH 4LSRH 5MERB 4XPFL 5E7FA 1LK3H 2VXTH 4PR5B 3FFDB 1YY9D 3CXDH 2APTA 4R7DB 5E2VH 3ZKND 2CMRH 1XR9A 3HNSL 4NC0B 3L9RA 5HI4D 3VU2A 12E8H 4OCMC 2O26U 4WI9A 5FDWA 2OSLB 1NGZB 3KPOB 4Z5RB 4OCRL 3VWKC 1SEBB 4JDZA 4LGSB 1RUML 3UC0H 2DM3A 4G9DA 5IFJB 1AD0A 3SDXF 2RHEA 5T3XL 1VPOH 5C07B 1I8LA 15C8H 5IB4B 3NIDF 2A73A 2IMNA 4PJDE 1XGQA 1D6EB 2HFTA 2ZOKB 4WFEE 1XF2B 1CICA 4I9WD 1YMHA 3HUJE 2D0FA 5IW1A 3SY0B 3QQ9D 4X0KB 4V2BA 1DLHA 4JKWA 4Y19E 4D0DA 5CKAA 1KPRA 1ZLVK 1D5XA 3E8UH 5IB1A 4LVNB 5C9JB 1R3JB 1U3HD 4ODVL 4LPYA 3ARGD 5DC9B 2FB4H 2OR8A 3HG1D 3PXHA 3OKKB 1CE1L 2P4AB 3T8XB 2AI0L 4ODWA 2VQTA 1WZLA 1QSFE 4HKZB 5EZIH 4AEEA 5E8PB 2XACC 2DYPD 1S9KC 4G59A 4R2GB 4LGPB 4PJDA 3F7VA 4NP4H 3JTTB 3MR9B 3HUJA 1T66C 3P9LB 3VFGL 4WEMB 5F7HA 3SO3B 2NPLX 3IDYC 2AV7B 4NJ9L 2R15A 2IADA 2Z35B 2V9TA 4WNQA 4XB8A 4J1UB 5C0AB 5TJWK 2WK2A 2YA0A 4TNVK 4XNZC 3T0AA 4APQC 3EOAB 4NQDD 2K7PA 4KTEL 3KPMA 3AGVA 3RX5A 3H9SE 2DQUL 4OLYH 4LLVB 3T0EC 4XPTL 2EIZB 1YMMB 3D2UB 3ULVL 1C5BL 4P5KA 2W1NA 4JFQB 2J8UE 3ULSA 4RMVA 1A47A 1FH5H 2DQCH 5JUEH 2DLHA 4NYLB 1LO4L 5I8CA 1MSPA 3N9GH 4CADA 1A21A 4OF3A 4XBPA 1BF8A 2VZTA 3GDBA 5KZCD 3VGAB 3C09C 3B6SA 5C08D 3C9NA 2X5PA 5KOMC 3DBXA 3MGAA 4PG9B 1CCZA 5F72S 5E6ZA 3P9WB 4OZIA 1T1YA 3IFOB 3U0TA 3GMOA 2I9TB 1P7QD 3HC0B 1EJOH 4GAJL 1HXMB 5F70A 3TLRA 3CLFL 5FOBA 3ALPA 1A14L 4HX1A 4NQED 1DDHA 5DMYA 2WAHA 2ITCA 2J8UA 3G08A 3T4AA 2AERT 5DRWA 4X80L 5D72H 3TIDA 4NJAL 1BVZA 4J7RA 2KPNA 1FBIH 1DBMH 4HPOH 2FJHB 1RIVL 1J8HB 4LLYA 1AC6A 2CSPA 3QEQA 4TULL 4XXCC 3KR3L 4NO3A 1T03H 1ZHBB 3CVHB 5FYKL 4QGYA 3KPPB 1NQBA 1LEIB 5DUBA 1T1WB 3TO4C 1G6RA 1LP9A 2V5YA 1BFVL 2YA1A 1EFXD 2CUIA 2E9JA 3C87A 1GL4B 4NO0D 5H94B 3U1SH 3DVFA 1NGYA 2VLRE 5E2UL 4D9RD 1S7TB 2R0KL 5DHVB 2OMBA 2NW2B 3IFPA 4OD2A 4IOIA 5T3ZH 5T3ZE 1FVEB 4UU9A 5IR1A 3U4EA 2HFGL 3T2NH 4JB9H 1OAYL 3H8NA 1TNMA 4FQJH 4F37F 3I2CL 3PL6A 2XKSA 5KANG 5T1MB 2P8LA 4I0PB 5IJKC 1TCRB 3W11D 2PYFA 4WO4D 3MLPA 4PRHA 4FXGB 4OZIF 1LK2B 3QUZA 4MVBA 1HYRC 1FDLL 1KCLA 5J6HA 4KXZH 2VLRA 5I9QC 4KI1A 4X4ME 5DK0A 1JHTA 2ADFH 4GW4B 4HUUA 3CXHJ 1FSKB 4W68A 3CU1A 2DS4A 3QULB 1QLEH 5DJZA 3CAFA 1OP3H 1GJIA 2NMSA 1SY6A 1B2WL 1X4YA 2IPTH 3QA3A 1BFTA 2EEAA 3TBWB 3VXMB 1XT5A 1TPXB 1MCWW 1KJ3H 1QSFD 2FYYB 1J0ZA 2G60H 4K3GA 3M07A 1RURL 2R1YA 4OD1L 1IGCH 1IAMA 1N7MH 2XKNB 3FO9A 5FGBC 3AFLA 4FNLH 3O6LL 5KAQF 1Q9LB 4GMTH 4LAQL 4HGWB 4QWWC 4HIJB 3IT8D 3DRQB 3G5ZA 2D7NA 1DVFB 4I3RH 4X4MA 3F6LA 1S7RA 1BQHB 2EIBA 5KAQG 1B0RA 1GGCH 3NCJH 4NO2B 2QEJA 2MOVA 4LFHG 1S9YA 1CG9B 5GZOD 2GCYA 3FTGA 3T77A 1UH3A 3V0VA 3H9SD 2GJ6D 1E6JH 4QHUA 1JWSA 3UAJD 2GIYA 5T1KB 3WUWB 4PRID 3DURB 3HI6L 4Q9RH 1ACYH 1V7NL 4DK3A 4NC1E 1CFVH 4JZJB 2VDPL 4OZ4B 1UWXK 2AVGA 3BESR 3WIIL 4P5TB 5ANMB 3S34H 3MV7B 4M62H 1JCKA 1IAKA 1TVDA 5AG9A 2GT9A 4PGBB 1MRDH 4F7PB 3CDFA 3QO0A 1JHKH 4J3SA 3MNWB 1YEEH 4KDWA 3LIZL 5DFTA 4MQ7B 4ERSH 3DWTA 2YSSA 3TBVB 1QEWB 5C0ND 3GKZA 5D7JB 1I7TA 3L3OB 1BZQK 1TMCA 1KGCE 2RIKA 3VXRA 4Z18A 4MGXA 3O4LA 4KXZI 5D7LD 1EO7A 4HAFA 2A6DB 3DOSA 3KGRA 1U8JA 4JFFB 2IQAA 2WBJA 4QF1A 4X5XB 3NAAL 4MD0A 5HVHB 4JFEE 3PXJA 1KIRA 3LKOB 3QFJE 5F7DB 5FCUL 3C6LB 5MP6H 4P9HL 4YHLH 2H2PD 4Y16B 4K8RC 4XX1E 1E4KA 4RAUA 2Z0BA 4P2RB 5K59F 1JF6A 2XRAL 1T04B 1RUPL 1IC7H 1C1EH 2H32H 3F5WB 3MBXL 3TT1H 3V8CA 4PJBF 4HJ0D 3VH8G 3BOVA 4JANB 4KVCL 1GPOH 3QDHA 1HHGA 3BVNA 3FAWA 2VB5A 4JN2B 4PUBH 2VMFA 2YEZB 5HYJD 5E4EB 3WIFB 2BVQB 1WTGT 2E8YA 3H3PL 4KI5D 4KTDL 3TPKA 1JFQL 2VERN 1KIPB 5IOPB 1I7RB 3HLAA 1KT2A 4N90E 5F1OB 3RQ3A 3QFJA 5TDNB 2OBGA 4P57B 5JOFA 1A1MA 1MFAL 3ARPA 3NBNA 2QQNH 1DANT 4M4PA 4L4VE 5CWSB 3PV6B 3X3FH 2NY5L 4YXLL 3PWJA 2H32A 4S1QL 3EJYD 1Q9KB 4ODSH 4OAWB 4HS6B 1T2QH 1IEAA 2XQBL 4B53A 2AJSH 4CJ1A 3QIUB 1X44A 4O51B 1YPZA 5DJCA 1I8MA 1CFSA 2CKBH 3TFKC 1MHCA 1CXIA 4KV5E 4TVPE 4PRPD 2R9HD 4YWGH 4D9LH 2BVEA 5LGHH 5F1NA 3OB0H 5IKCA 2CIIA 2Z8RA 1MAJA 2YZ8A 4FQHA 1FORL 3MO1B 5I75C 5EZOL 1WICA 1F3DJ 1S7QA 1JPGA 3UPCA 4EQ3A 4M3KB 1INQB 1MFEH 4WJ5B 1ZANL 2QBWA 2OI9B 2OTWB 2EDRA 3FT4A 2CKBA 4OCLC 2QHLA 1H8NA 4JLRB 4K8RL 4P3CH 4LCCC 5KS9E 4R3SA 1N6QL 1NMBL 3ARBB 2HH0H 2ZJSH 4N0FA 1W2KT 4CJ0A 3VG0H 1IARB 3MFFB 4LKXB 1H0DB 1ZA3A 3O41A 4YAQB 3ARWA 4RMTA 1F6AB 3C2AL 3AXLA 3MXVH 5JO5A 2O61A 1HZHH 3IXAA 3CSBA 3VFVA 1MCPL 2O5ZL 5ICZB 5IVZA 4XGZB 3STZA 1Z5LA 4P4RA 2BY3A 5D1XB 5DR5H 3KYNA 5L9DL 5DLML 4MXQD 2MQCA 3D25A 3Q5TA 4OZGB 4TOYH 2B20A 4K7PH 4AIXA 1YPZF 4OJFH 5IBTH 4LSPH 2WUCL 1J0KA 2MHAA 4K3EL 3V6OC 2FEEL 4F57L 3GMLB 3RZCA 5JW5B 4V1DD 2CGRH 5L0QB 1B9ZA 3KYKH 3MJ9H 3QNZB 4RQQA 4UDUA 2CLVB 2ZUQC 4HWBL 5CEZH 1G9NC 1HHHB 2COQA 2FR4A 3OGCB 1EGJA 2PO6A 5EO9A 3GM0A 4OCWH 4NZRL 3PWUB 5DRXA 1TVBB 5JIPA 2HTKD 4NNYA 5C3TA 2QKIB 1MREH 3QIWC 1WZ1H 1RZIA 1VKXA 4X7EC 1EDQA 4C55A 5F88A 1JNNH 3MRQA 1S5IH 4P3DA 3MJ9A 5FAAA 4WWKD 4P46C 4QHNA 4ORGA 4PRNB 5GGRA 4LSTH 3EYUH 1RZKC 3QEUA 3K8MA 1U91A 1TENA 4JPWL 4MQXC 1LO5A 3V5DA 1PKQA 4FQXC 4KK6C 2H2SC 2ED7A 1HKLH 1A7PL 3HAEA 4M43L 4N0UE 3LN4A 3JWNC 3MJGX 1QSEB 1Y0LB 4ZFFA 4KMTL 1K4CB 4AT6B 1PY9A 2A77L 4QO1A 3O6KH 3IS0X 1P2CA 2B7DT 5DZLA 4K7PY 4JY5H 5INCA 5DJ6A 3HNTH 4P9ML 4HJGA 3RUGA 1BIHA 2AXFB 4D0BA 4YHML 4ZUSA 1M7XA 3L5JA 3OR6A 3VRJB 2YC1A 3LD8C 3BHBA 2E9WA 5DQ9B 4A2LA 1RPQA 5GGRY 4X98A 1HOCA 3FONB 1HHIA 3HFML 5IMKA 4MAYB 5C09E 3VI3E 1JYXA 4ZSOB 4G6FB 5FV2A 3GKWH 3DETD 4TVPD 5HHQB 2XN9D 4ZFGL 3B2VH 5F8RC 3MBEC 2AJ3A 3WKMH 1ND0B 3S9DB 3H6JA 4F9PA 3UJJL 1NBZA 4JQVC 4GLRI 3KHQA 1KJ2B 2UZXB 4LSVL 1EEUA 1WZMA 2GAZA 3BXNB 4X6DF 1NEUA 3DIFA 4P4KD 1MPAL 3K7UA 1YEGH 5ERWA 5DUML 2R29L 4XZUB 4GMSH 1G9NL 1YNKL 3ARFD 1RZ8B 2ESVE 4GRLC 5BQ7A 5C09A 2GI7A 4HMEA 3OXSA 2V2XB 2OTUA 3MMEA 3VFNA 4KZEL 3FJTA 4L9LA 4RRPG 4X9GA 3WXVH 3ZDXE 5M95B 4HF5L 2XG4A 4QTHA 3V5KA 1LO0H 1C5DB 1MRCH 1N5YH 3K74B 2PXYC 3AB0C 1MJUL 1BOGA 4DQOL 4Y4HB 1E6OL 4H88L 3OKDA 3WJJC 3VFPB 3MUJA 1PYWB 4FQLH 1FJ1A 5F7KC 2QQKH 2YPKA 5JPNA 2WP3O 3WDJA 3RUGF 2XZAL 5K9KA 3RNQA 4IMLA 3LS4H 4LLQB 4L8CA 4K9EC 3AAZA 2X4PB 3RPKA 5I1LA 5BS0A 5SWZB 5J7CC 1TETL 4NRXA 3ZL4H 4WUUD 4PJXF 3MV8A 1EMTL 3D3VD 1WQVT 1QBMH 5B3JE 5CBAB 2BVPB 1WV7T 4JFHE 3ULUF 7FABH 2BJML 3GB7B 3VA6A 1FG9C 1JE6A 1AIFB 1XGPB 1CGVA 3ZE0F 1AKJB 3C08L 3QZWB 3SGDH 3JVGC 3HC4H 2F54E 5DMKB 4MNHA 1S3KH 1I3VA 4RBPK 2Z31B 1MCBA 4WVRA 5B8CC 4RFOL 3GEWB 5EFIA 4G6KH 1FC1A 1IZJA 5IVXB 1G7PB 5IBLD 5IW6A 1MCRA 4P99A 1JYNA 1KBGL 1JPTH 3O81A 1KCUH 1GOHA 4JRXD 3GHEH 3JXAA 3ZSSA 4QYOA 4UB0L 2XTJC 3P0VH 2P46B 5F8QC 3J8F7 5I76A 4PB0H 3DI2B 2BFVH 4R0LB 4KFZC 2R1XA 2FIRT 4HG4K 2YHGA 1U3JA 1JPST 3N0PB 3X13B 1F11B 3I85A 1MJ7L 2R1WA 3C8HA 1Q1JH 3NFSL 1WIUA 4YR6A 1ZT7B 2H8PB 3DVGB 1Y18B 4OGAC 4IM8A 4J4PC 1CFQA 3U0WL 4XNYH 2Q7YB 3VFUA 5T1DL 3MREB 3VXQA 4P2QB 4LASL 4XCCH 3N50A 2MNUA 1MFBL 4J8RA 1YN6B 3GSNB 4G8FB 3L3JA 4LRNH 1WT5C 1G6VK 3V9FA 2EKJA 1UM5L 3OKNA 3I6LE 1AGBB 5FO9A 2FEDD 5I1CH 1IGMH 4Y4KB 2H3NA 2IBBA 3P73A 1MCNA 4J6RL 5KSBE 4LCWB 4OIIH 2X1WL 5KSAB 1KPUA 4XP5H 3R1GH 3BKJL 1J7VR 5F9DC 3UTTA 3VD3A 3IDGB 1E4JA 3QJFB 3WE6A 3IB4A 3IU3A 4JGMA 3P4MB 4JM2D 2R2HB 3KXFD 4HEME 1SJXA 3GMMA 2V7HA 3MODH 5I16A 2BP3A 4MCZB 1NAKH 4U0QB 2E9BA 3O2WL 3LQAH 1FG2B 4S11A 4H26A 1BBDH 1KSRA 4Y1AA 4OCRH 3SDCA 4RFEB 5HHNB 5BZDB 1S7WB 3LB6C 5HYSA 1WWCA 5FECB 2N7AA 3PABB 1YYLL 3RWJB 5I1HH 4H8WL 3B3IB 4F15B 1TVHB 3GHBH 5DJ0A 4Z95L 1YNLL 1RZFL 4KQ4L 3F65A 4ZFZA 1K8IB 1NCAL 3H2WA 5HHVH 3PG2A 1UFUA 3ARXA 4W81A 4BSJA 1CU4L 3JV5A 2XA3A 4NFBA 1ACZA 3MLSL 4ISVB 2A1WL 3QDME 1KG0A 1RJLA 3CSYB 1N4XH 3H3BC 4FZEH 3ARUA 5DWUL 4O5LH 4XPHL 3F6IA 4LVNC 1G0XA 4WGVB 3MA7B 3DX6B 1RJCA 5GHWL 1NC2B 5C0JB 4Q6YA 3N1MC 2NXZD 5C0IA 4YHPA 1EK3A 2F53E 2PUQT 3P77A 4MJ4A 1UYWL 3B8SA 1IEHA 3I3EA 4R2GC 4FABL 1NCCH 1GYAA 2JLLA 4NM4L 1NAML 4PREA 1EAPA 4KKCD 3QDMA 4J3UA 4FQPA 4LCYA 5BZWB 1QBLL 3SO3C 3NFNB 4RAVB 5D2NC 4PS4H 3MXWL 4KTEH 1DE4A 3M8OL 9CGTA 2DQUH 5D5MF 5E2WL 4E41E 1SJVA 4XPTH 4KK5C 4X4YB 1R5VA 3K46A 1C5BH 4HWZB 4LIQH 4LIQE 4MJID 2VABB 1N3NA 3WUZA 4F3FA 3QXAB 1QFWH 2ARJQ 3Q48A 1T2XA 1LO4H 3T2PA 3OKOA 5D4QA 5E03A 1HH9B 4LVOB 1A1NA 1IKFL 4F7EA 3GMNB 2FZ3A 1OGAD 3KS0J 3QT2A 4L4TB 1IQDB 2DD8L 2DI9A 3VGAC 2P24A 4EOWL 4BH7A 1U0QA 4PJAF 4E41A 4CMMB 3CLFH 4QRQB 2R0LL 1A14H 4ELMA 1CDUA 4N8CH 1CGTA 1W0YT 4KRPD 4WHYH 1J88A 3ECBA 1JNLL 3HI5H 1OAUL 5IMLB 2YPLD 4NCC2 3MRRA 1T3FA 1XF3A 4ZTPH 1J1PL 1ZLSH 4KRLB 1R3LB 2BNUA 4UIKL 3CDGB 1MWAL 5HYEA 5A16B 3B9AA 3KR3H 2DI8A 3NA4A 2J5LB 1N59B 5EUKB 2GFBB 1ODAA 4QRSA 2CO6B 5HHOE 3MUGA 3C5JB 2V5TA 1MI5B 4YQXL 3BFOA 1MLCA 1BOYA 2HFFA 1A3RL 4ETQA 3DUUA 4Y5VB 5E2UH 3T3PE 2ATKB 4U1NB 2R0KH 5MI0B 2J6EH 2XY1A 4PBWD 3VXNA 3S35L 3VGFA 4HHAB 2C3HA 4GW5A 4GRWH 1WAAF 4PP2A 3RY6A 4KK8C 5TDPB 4YHIB 4OF5A 1I1RA 5E9DD 1JPSL 1FNEB 3X14A 2EDOA 2DQIL 1OAYH 1QFWI 2FSEB 3MV9D 3P11H 5SWSD 5J4MA 2NY2D 5I66B 1IAOB 1WBZA 4WI3A 3T0EE 4FMFA 4OLUL 3TVMD 5ACZB 3KPTA 3MLTA 4YEEA 3AREB 5HHMA 4G3YL 1R6VA 3RRQA 3VI4E 1K5NB 1P1ZA 3ULVF 4HW6A 5J11B 3W9EA 4I0PC 4QTIL 1R5WA 1U3YA 3C60D 4JFPB 4RGNB 5F6HJ 4ELMF 5I18L 5IQ7L 4NNPL 1BBJA 5B4MD 5GXBB 3UX9B 2XWBA 2J6EA 5CGYC 4DFHA 4XC1L 3VFSA 1MUJB 5HGBA 1IGYA 3Q1SL 4M1CD 5F89A 5K9OB 3RVXD 2DQJL 5DJAA 4HV8A 1F4YL 1B2WH 1FSKC 1IM9A 3H9YA 3REVB 1KLUA 3T0EA 1VEPA 2QR0A 2DWDB 3C5ZA 4TSBH 4PGJA 5IB2A 3QYCA 2CPCA 2ZUVA 4NIKB 1G7LA 2CIKB 3RI5K 2X4RB 5ALCL 5E00A 3PWPE 1TPXC 3F12B 3O6LH 5D6DC 1WIOA 5DHYA 2R4RH 2WINB 5DD6B 1PVHA 2FHFA 2PYED 3JTCA 3TZVD 5E8EA 4DWHA 4JQIL 5E8OA 1F6LL 3FHQA 1OW0C 2XFXB 1IL1A 1MAKA 4I4WB 8FABA 3KPSE 1YY8A 5I2IB 1A6ZA 2R56H 3NIDE 4M61A 3LQZA 1DVFC 2P8PB 1I3RA 1DEEB 1U8NA 2XTLA 5DTFA 2PF6A 2ICWI 4P2CG 5KVMC 5FKAB 1L8JA 4XAKE 1AGCA 1QG3A 4ENEC 5K9QI 3TC9A 3CVHL 3HZYB 1V7NH 1IM3A 1OB1A 4OM1L 3GJFK 5EC2B 1U3ZA 4K7PX 1U3HB 4MDJA 3WIIH 3ARGB 4PJEB 5F3BB 3ZTJH 2FX8H 4K2UH 3ZHKA 4S1SL 4HKJB 5GRWA 4E0RA 1HKFA 4JZJC 4XWGL 4P5TC 5JOPE 1YN7A 2X41A 1E0OB 2A6IA 2DYPB 2EYTA 4XXCA 5EBWA 3VGHA 4PTTB 4LPVA 2X4SA 1P7KA 2JCCF 4HLZH 3RKPA 4XXDA 1P6AB 3D18B 2C3VB 3U9PL 4B0MM 5FCSH 5D7JC 1F58L 4OI8A 1ZHNA 3SE9L 3NAAH 3RWIB 2HRPH 4TNWK 3CD4A 1MFDL 4TNVF 4XCNB 5FCUH 2P5WA 4HFUH 4GKSB 4PTUA 1DR9A 5HVHC 4PLJD 3MNZB 2C3WA 5C0BE 2Y7QA 3BMVA 4RX4D 1IJ9A 3C6LC 4Y16C 3VXUD 3BSZH 1D3CA 1NDMA 1EEYB 2DQFB 4N8VB 3G9VA 5IJKA 2Y23A 1UZ8B 5GZNC 3OAUL 1YYML 3NOIA 3CX5J 4KTDH 3S6CA 5KZCB 3W82A 1BZ7B 5C08B 1HHJB 5E4EC 4ZS6D 1U8HB 2XNAA 5D70L 4YC2B 1SJHA 5FM5M 1QACA 1S8DA 3ALXA 4I18B 5JR1L 4LU5H 1FFPA 2BNRE 4C83B 3MLRL 4RZCA 3X17A 1T22B 1P7QB 3CZFB 5HD8C 4NQEB 5TH2B 3STLB 3PDOB 2CUHA 4IRJB 4QRPE 3RZWA 5DUPL 5FB8B 3QHTC 3VFWA 1W0VB 2DKMA 3ZYJA 4LNRA 4U1IA 5FGBA 4NPYA 1KB5H 1A5FL 2WNGA 3CFKB 3D5OF 1W0WA 3O6ML 3K80A 3IGAA 3F7YA 1R3IH 3QIUC 3O3EB 4RA3A 1DQJB 2RFXB 2IAMD 2XKUA 2YXMA 4OQTH 2ORBL 1ORQA 4YJZL 4WRLA 3V4PL 4HKXB 1MRFL 1VFBA 2IBGA 5DK3A 1KN2L 2BNQB 43C9B 4WHCA 2F58H 4M9OA 1EFXB 2JB5L 5EZOH 1RU9L 4AIZA 4XPGH 2Y06L 4XMLH 5JQ6L 4XRCA 3RY4A 1AR2A 5IHZA 1ZANH 1WK0A 3K8KA 5E7BA 3CNKA 5EU7C 3PWPD 3W9DB 1AQKL 4K8RH 4I13B 4HAGA 1CGWA 4FQIL 4GXVH 3UYOD 2ZUYA 1N6QH 1NMBH 4PJFB 2OI9C 1HSBB 4OQTA 2Q6WA 1YECL 3TO2A 3KPSD 4WO4B 3HA0A 3QEHB 4M6ML 4OIAA 4KY1H 3G6DH 4KKNA 3ARBC 3T65B 5F6IB 5I8KH 1V05A 3RIAK 4L1HA 3C2AH 3QNYB 4N0CD 5JORB 4Y19B 4XP4L 2YPVH 5HGAA 5FA3B 4S0SD 3RJDA 4JG0H 1U92A 3VDBA 1CBVL 5DS8A 1WC7A 1JI1A 4QRRE 1UA6L 4CVXA 5DLMH 3VFTB 4ZD3H 5HI3D 4GG6B 1OTSD 3IETA 4KROB 4OZHA 3R8BB 2QTEA 5D1XC 4LSQL 1IGTB 2WUBH 4M8QA 4YDIL 5JQHC 1KJMA 1QSFB 1X7QA 2Z92A 4G8IA 1VGKA 3BDBA 2E7LC 3MCLL 4F57H 4Y0GA 1JTOA 5IVNA 2GTZB 5D6CB 4K94L 3QDGE 3UEZA 4EIZC 4G9FD 3BN9C 5IESL 1TZGL 3QUMH 2VDML 1BFSA 3FRUA 4MA3A 3ILQC 2IPKA 3BH9A 3O8XD 4M7JH 1AFVL 2BMKB 5L0QC 2ZSVB 4X7SH 3DVIA 5AWNL 3RWDB 4NZRH 4IS6B 5FO7A 1OP9A 3IDJB 3WEXB 5IQ9A 3FT3B 5GSRA 2O5YH 4Z7VF 2GJZB 2H9GA 1U6AL 3H9SB 3PWLB 1RY7B 5I1KL 2Q3AA 5EBGA 2C26A 5KANI 3BISA 3U46A 3RNKA 3QUMA 3O6FA 2W59A 3VJ6A 1B0WA 43CAA 5C2UB 4JPWH 2L4OA 1CICD 4G6AD 1YNTB 4HWBA 4PV9B 3IFLL 5FUZL 4X6BB 1FYTE 3QUXD 3TNNB 2A77H 4XBGB 3OR7A 4N5EC 3S4SG 3FAXA 5I6XB 2SEBA 3QJHA 3DYOA 3LZFH 1SM3L 3FO2B 4YHMH 2D0GA 5D7SL 1UQSB 3NPSB 4EZMA 1A6TA 1HDMB 3PQYA 2AEPH 1T7YA 2AGJH 1NFDA 1QO3B 1DLFL 4DTGH 5K59E 4O2CA 1GOFA 4C56E 1BD2E 2VXSL 4XH2B 1IAIH 4PJBE 2X4TA 4WHTB 2NR6D 3QISA 1F2XK 5H35A 3S37H 5T33H 4LHUG 4LCCA 4HUVB 1OGTB 2AEWA 4MAYC 4RMUA 4KJYA 3GMQB 5IF0A 4ZFGH 3TNMB 1JGVH 3G6AB 5HYJB 5F1KC 3EOBB 5DQJA 1A8JH 1I8IB 3UJJH 4BQ6A 5JHLL 3TCLA 3LMJL 4Z7UB 3VCLA 4LSVH 4WEUD 3D85D 3FB7B 4ZUUA 1JBJA 1MPAH 1HILA 3O4OB 5D7KE 3Q6FB 2R29H 3S98A 3U0PB 4Z78B 4KZDL 2IEPA 3E6HB 1BEYH 3BPNB 1G9NH 1WFUA 2OZ4H 3IFNL 1YNKH 3R4DA 2HT2C 4R26H 5MEQB 1JF1A 4QHLA 1CXHA 1ZT1B 4OLWL 4X6EB 4KZEH 3AU1B 4HF5H 4G42A 3IDXL 4B7IA 4ZYKA 3LHPL 3OJDB 5C70A 4HS3A 2GITA 3HPJB 4ODXB 2OQJB 4H88H 2Y36L 3V6OA 3QG7L 1QRNA 1OF2A 4ALAH 1J05B 1MOEA 2FCBA 2HN7B 4Y4HC 2XZAH 4RA0C 1RZKH 2EO9A 2RJMA 5ISZA 4OLEA 2I27N 1IGIH 1KPVB 4UI2A 2OZ4A 4BYHA 1RHHA 3GJFB 2LU7A 1OTTC 1TETH 4DVBA 1ZGLA 1M05A 3CH1B 1LNUB 1SYSA 3P4LA 3CFBA 3P3YA 1ZLUH 4JKKA 3LN9A 3QEQD 4G7VH 4KHTH 2BJMH 3WS3B 3QIWA 3UBXG 4POZC 4DZBB 4HXBL 1SYVB 4NRZA 1P4LB 1P69B 5I71B 3C08H 4H0HB 4RNRB 1I1FB 2ZZUT 4KKAC 4WU7A 5GRYA 1G1CA 4UOW0 4XP9H 5EU6A 4P46A 1IAII 4C58B 5EBLB 4TSAL 4OKVB 1GIGL 4XT1C 4FQXA 1QLRB 4ODHL 4R90L 4JDTL 4J3OC 4NKDA 1XGUB 1CQKA 1FFOA 3MLWL 3GUTB 3MGTA 3EYQC 4XMPH 4RWYL 1RULL 3WFDH 2Z31C 1WISA 1BIIA 4NKMB 3MRKA 4X5WB 3IKCB 2VDLL 4TUJA 2VIRA 4GXUN 3MLYL 1RZJC 4PJ8D 2FECI 1PEWA 3BI9X 3OKLB 3RWEA 5LQBH 1KFAH 2J4WL 4F7MA 5EUOF 3DYMA 1NFKA 4UB0H 4AH2A 3PL6D 3KYOB 4MD4A 1KCKA 4U1SA 2W60B 5FOJA 2J3SA 2YMXL 1ZKAA 2Q8BH 4PRHD 5F7MC 5CCKL 4QNPF 5A1AA 2UV3A 2NXYB 3NCMA 1KJ2L 3QQ4A 4R0LC 1MQ8A 3I6GB 3VGBA 3MNVA 3U0WH 4BA8A 4NQCD 2LAGB 4V1DB 1U58A 3GJEB 3GIVB 5ECJE 3RDTB 5HPMA 3AS0A 1MFBH 2DAVA 4OBRA 4JQVA 1A4KB 1MHPL 3RL2B 3RA7L 1DP0A 2EH8L 4G8GD 2WWMD 3LSOA 1K6QL 2EXYC 1UM5H 2FNBA 2HLAB 4K9EH 5TDOA 5CJQH 1BLNA 4W70A 4PJIB 1WWWX 3OKMA 4GRLA 4P5MB 2ILLA 1QSVA 3FRPG 2LVCA 3NN8B 3CFEA 4NCC1 4U6XB 3V52L 4Y4KC 4KJQC 1RFDL 5J3HC 1E4XL 4E42A 2FWOB 2PXYA 5KSAC 2HT3D 3WJJA 3MJ7A 4EBQL 5IM7B 5HGGS 1T0NA 2AV1B 1C7TA 1X5YA 1DBBL 3PNWA 4WU5A 1FVCA 2ZCHL 1G7JB 4Y7MA 1CT8A 5GSVA 2X7LA 1LEKB 3KHOA 3LKNA 5C0FB 4YH6A 4FTVE 4Y5XA 5C0CA 3RTQB 1JRHI 5IV2B 1MLBA 2X9WA 4L4VB 1LWRA 5HJ3B 1YYLH 2YUXA 1AGFA 3KNBA 1YZZA 3BE1L 4OLVL 1YDPB 1UENA 1OARH 4Z95H 1DUZA 4Y88A 1RZFH 1RZJL 1UADC 4PB9H 2P8MB 5K33A 4QXGH 1KACB 2AEQH 1PSKL 3ZDZE 5GGQL 4F15C 1YC7A 4NO5A 4V3DB 4M02A 1CXKA 1A64A 3VXRD 4QRTA 2XTJE 3JVGA 3O4LD 3CUPB 5GIRB 2A1WH 5LGJB 2R23B 4ZDHB 1C5CL 5B8CA 2WBJD 4NC2B 4BZ1L 4I48A 2VR9A 4HKBA 5FK9B 4CL7A 4K3DH 3HS0A 4M1GH 2F9BT 4G6JH 5GHWH 1A9EA 1FLTX 3O11B 3VRLF 4FQQA 1D9KB 3T1FA 1Z0MA 4BFBD 2HVKA 4Q0XL 3C8KB 1JUFA 4X6DE 1CGSH 5HYQB 1UYWH 1CE6A 4P4KB 3RY5A 3GSOA 3KPQB 1HSAA 3LN5A 2DBLH 3ARFB 3L5XH 4NM4H 1NAMH 1NLDH 3KLAA 5CHNB 1QBLH 1EVUA 3MXWH 1MH5B 2A2QT 5B38G 3RX7A 4S2SB 5F9JB 4J4PA 1B4JL 3TF7C 1ZVSA 2VTFA 3B9VA 4U1KA 5IHUL 4ZNCD 2EECA 5EU5A 2R2BB 2A6KA 3MLZL 5J9PA 1FV1B 4ZUTB 4R96B 1KOAA 1FGNL 5GS0L 2H6PB 1QFPA 1G0YR 4OGXH 1NAMA 5I17B 2GYSA 1WBYB 3DV4B 4WUUB 1I85C 5FF6B 4BQ9A 1U36A 4GBXD 3L3DA 5B22A 4NSKB 4UOJA 4HZLA 3ULUE 2DD8H 4DZ8A 3DTXB 4LVOC 5DEFB 3S3SA 1XIWD 4XCEA 3S96B 3TBSB 1T6WA 5EBMA 4EOWH 5LBSH 3ZE0E 3BIKA 5KTEL 3QBTB 3E2HB 1R5IB 3U4AA 4JY4B 2MWCA 4F80A 2R0LH 5FYLL 1ROWA 4ZAKB 4U7SA 1TJHL 4QT5B 1FGVL 1NBQA 1B6DA 1KNOA 2ARWA 4XCYA 3L5WB 4WTXA 1CDCA 5JDSA 1AE6L 5MERA 5DFVD 5JW3H 2ZP0T 1PJ9A 3GSUB 3D0VB 1AH1A 4PR5A 4UIKH 3LEXB 4MXWL 4LEXL 3KYMA 3WXWH 3BQUD 4NHCL 4JRXB 2OSLA 1NGZA 3KPOA 4Z5RA 1LQSR 1TZIB 3DYPA 3TYFB 1OD7A 2XPGB 5IFJA 2D03L 2J5LC 5C07A 1UM4L 5BVJA 2BY1A 1A7OL 5IB4A 1A6PA 4EI5D 4M6OH 4U6YB 1D6EA 2ZOKA 3LH2L 1XF2A 3BKML 4PJCF 4X0KA 3WFEL 5AD0B 4YIQB 4Y5VC 4JM4L 5D2NE 1MWAA 1JPSH 4DKEL 4FQ2L 2E6PA 5JA8B 5MI0C 2CLZB 4ZNEA 4FZ8H 2DQIH 5DMIH 1FNGA 2X09A 5C9JA 1R3HB 4L8SB 2GK2A 2EIEA 3FHAA 2P47B 3NTCH 3GRWH 1T1XB 1QA9A 2EYSA 2PTVA 3OKKA 3T8XA 3FB6B 3GBLA 5CEYA 4IHOB 4G3YH 3QWOB 2FRGP 5TQ2H 4HKZA 1CIUA 2H1PL 5E8PA 1MJ8H 2EDQA 3RZCD 3MA9H 3S5LB 1YMME 1U8QB 3AREC 3BPLB 3PGCB 3F7QA 5I1IL 4OFYA 2V17L 3JTTA 3MRLB 3MR9A 1AR1D 3P9LA 2FJGB 5J11C 4QY8B 4RGNC 1QZ1A 4OD3L 5IROC 1F4YH 1YEJL 4IOFC 2Z35A 3ILPB 2VNCA 3CIQA 4FFVC 4J1UA 5C0AA 4GKOA 4DVRL 3KXFB 3RX8A 1HI6B 4N8VG 1QYGL 3GRWA 3DSFH 4JPIB 5ALCH 1AQDB 2EEBA 4Q9BA 1XR8B 4ZXBB 3RWHB 2EIZA 3D2UA 5F9AC 3SE8L 1U2HA 3L3HB 4GOSA 4JFQA 2CRZA 5HI4C 3A67L 5BXFB 2AK4E 2ESVB 1G7HB 1E28B 4XVUD 5CEZD 4NYLA 2VXQL 4G5ZH 3TN0B 5GS2D 3IU4L 1KTLB 3DV6B 3MRDA 4HS8L 5CP7B 3MRNB 4WWID 2OP4L 1MJJB 4XC3H 3SE4C 3ZE2E 1GCFA 1A3LL 5GISH 2GY5A 5KVGL 1Z2KA 2VAAB 3CVHH 1X6NA 1L9NA 2J7LA 4Q58C 1RUQL 3IFOA 3QQ9C 2I9TA 5MENE 3HC0A 1HXMA 3HMXH 4O4YL 3D48R 3P0GB 1L9MA 3KG5A 1Q0XL 4ONHB 2CDEB 4XB7A 1U3HC 4XWGH 3ARGC 1X5FA 1DFBL 3BUYA 3K4AA 2NXZB 5KG9A 5DHVH 3NCYS 2FJHA 4UT6H 1J8HA 3P9MB 4OFVA 2VH5H 4I8DA 1YQVH 4X7FC 3O45B 5GRUL 5IB3B 5E94B 5F7WC 3CXHK 1F58H 1F4WH 1ZHBA 3CVHA 5KVFH 1QR4A 2Y9RT 3UCRA 4YHZL 1LEIA 5TFSH 2Z91B 4RAHA 3BZ4B 1JV5B 1T1WA 1CD1B 4UAOB 3SKJL 3SKMB 4YDKL 5D5ME 2EC9U 3RL1B 1Z9SA 5DGQA 1QFWM 2HVJA 2IALB 2YKLL 1S7TA 1FP5A 4PJ7E 5DURD 4MJIB 4TQEH 2NW2A 4NWUL 3K81A 3DHMA 1KEML 1U41A 1YEHL 4YNYB 1Q9WB 1FVEA 3OAUH 1YYMH 2GTWB 3V5HB 2QSQA 2ZNWA 1RJZB 5T1MA 3VXME 3VRIB 1TCRA 4GQ9L 1OGAB 5D70H 3B5TA 4JFXB 4YGVB 3VXSE 3CFCH 4FXGA 3MGOB 3WSQL 4L1DA 4YXKL 5JR1H 1LK2A 4PDCE 1NEZB 5L6YH 4YC2C 3BKCH 2AKRB 5BS0D 3KAAA 4RFNB 5CD3B 2VSCA 4I18C 3S36H 4FQCL 5T5FL 3FN9A 4KQ3L 3MV8D 1TFHA 1A9BB 3QULA 5DUPH 4ACPA 4M6NH 1LDSA 3TJEL 2YA2A 1U8OB 2YPLB 3UO1H 4NNXB 3DI3B 1RZGA 3GSRB 4IRJC 4IMKC 3REWB 3T2OA 1CVRA 1B90A 3EJZC 4FXLA 3CDYA 3TBWA 3VXMA 1C8PA 1RUKL 2FYYA 5D6DA 3UTSE 3UPRB 3NMEA 1N5AB 3PGFH 4TRPL 3NZHH 4QHKI 1LILA 2XKNA 3O2VH 1OW0A 2I24N 1EJ6A 1Q9LA 4PJGA 4HGWA 3MV7E 2ORBH 4KRMB 1H9VA 4X6CE 3K2UL 1CWVA 3V4PH 1AXTL 1MRFH 1VFAA 5L8JB 3KLHD 4P3WA 4OCNC 2XOTA 1BQHA 2JB5H 5E2TH 4L3EA 4A6YL 3VGDA 1RU9H 4NO2A 4XAWH 3UP1A 3TBTB 1UWEH 4G80A 4RMRA 1EBAA 2OJEB 5FO8B 1CG9A 3DUSA 2DQDL 3HI1B 1EHAA 4O2FA 4X9HA 1WAAE 4XHJD 3MZGB 4PLOB 4GKNB 5T1KA 3V0AC 3WUWA 5FYJD 2EDNA 4KKBC 1AHWB 3DURA 3CFDA 4LDEB 4JFFE 4FQIH 4XTRD 3EYFB 4JZJA 1PX3A 1CDHA 3MV9B 2W0FB 5SWSB 2NY2B 5ANMA 3MV7A 4KAQL 3TVMB 3BP6B 4K71B 4PGBA 3MTRA 1OM3L 4M6MH 1V5JA 4F7PA 5IFHL 4NT6B 2V9RA 3U4BL 4HK0B 4MQ7A 4MB3A 4PY8I 5J1AB 3W11C 3LS5L 1PFCA 4WO4C 3TBVA 4JRYD 1QEWA 2B8OT 4YDVB 5D7JA 1FO0B 3L3OA 4XP4H 5TGBB 5F6IC 4HIIB 2A6DA 1NL0L 4CVWA 1II4E 1FCGA 2FX9L 1ZVHA 2ZPKH 4JFFA 35C8H 3U7WL 1PLGL 4X5XA 4NUGH 3KPNA 3E0GA 4LSQH 2DIAA 3I84A 4GW1B 2EDKA 3LKOA 5F7DA 6FABH 3C6LA 3GO1H 3A0OA 4X4XB 4Y16A 3MCLH 1S9XB 4KROC 5F7UA 4PJGF 4P2RA 3SN6N 3VE0A 4NQSB 1T04A 2F53B 1KTKE 1TZGH 5ADPL 2VDMH 4HT1L 2X4OB 3UTTD 1BREA 3F5WA 1D5MB 2JB6B 4JANA 2PYEB 4JKPL 4OTXH 3QCVL 25C8L 2ICEB 4JN2A 4ODBD 1JPFB 1WZKA 2YEZA 5AWNH 4F37K 2BVQA 3A6OA 1IZKA 3P30H 1KIPA 3BH8B 5IOPA 1I7RA 4Y1AD 3WYRA 1NANH 1JGEB 5BOPA 5TDNA 3C5SB 4P57A 3ETBF 1ZLVH 2BVYA 4R4BB 5GZOC 3FFCE 2N56A 4YDJB 4I2XE 4RGOL 5CWSA 1N2RB 4U3XA 2DKSA 3S97C 2NTFA 4UV4H 4MYWB 5EU4A 1X5JA 2Q3ZA 4OAWA 1FL5B 5C0DB 4LSRL 1KCSL 3GMRB 4HS6A 2DJUA 5EU7E 5HYIA 1LK3L 2NY4B 2VXTL 2NY7H 4UINL 4F2MB 3JTSB 4WUKH 1WJ3A 2E9IA 4NM8H 4OLXH 5E2VL 1I9IL 3QIUA 5B39B 4O51A 3HE7B 4NZJA 3N1FC 3LVEA 4DUVA 5T3XD 5D7SH 2YXFA 4QXWA 1E27B 4Z77B 4JHBA 5I6XC 4GSDH 1RZ7H 3EO1B 1HHKB 4OF6A 4TNWF 3O3AB 15C8L 3CJJA 2VITB 4R7NA 3FQUB 3BJLA 3MO1A 5DXWA 32C2B 1DLFH 1MELA 1MCSA 3NPSC 2C5DC 1EZVY 3EGSB 5EO0A 3BRFA 1UWGH 3VXUB 3WNKA 3S88H 5FFLA 1D5ZA 3E8UL 3S8WA 1OY3B 2OTWA 1Y6KR 2CLRB 4OZGE 4JLRA 1RIHL 2E7LE 2FB4L 3BZFB 3G5YB 3T08A 5HDBF 3ARBA 3AM8C 3FZUD 5GGTL 2VDQH 3VFMB 4JVWA 5D1ZB 3MFFA 4LKXA 1H0DA 3IFNH 4ZG1A 4NP4L 5L8LB 1NANI 2Z93B 4P23D 1F6AA 2J2ZA 4YBQC 4DGVH 3O4OC 4OLWH 3BPNC 5ICZA 4XGZA 1L7TH 2BK8A 3IJYB 5DO2D 3NCYP 1F3RB 2Y36H 3SBWC 5CZVH 3EJYC 1S7SB 4MNQE 4LSDA 3TBYB 3ULVD 4OLYL 5DJ2B 4OUUB 4WW2B 4YZFE 4YE4H 1KYOJ 1BVKB 3GMLA 3QNZA 2W38A 2BC4B 1ZE3C 1UACH 1A1OB 3MYJB 1KIQA 2DQCL 1U8IA 2RR3A 5EWIH 5JUEL 2IAMB 1OP3K 2CLVA 3FOLB 2YWYA 4NN7B 1CR9L 3DX7B 5MHSE 3VDCA 1NUNB 3N9GL 1HHHA 4KVNH 2R9HC 3SE3A 3OGCA 1QSEE 2XWTB 3QH3A 1X5GA 4WI5A 2Y5TA 2X4QB 3QP3A 3PJSA 4HXBH 1WFOA 5IEHB 3PWUA 2ZG1A 3MX0A 4N1EA 1TVBA 2VWEC 1J5OH 4D0CA 4O2EB 3V7AG 4TSAH 3PWPB 1EJOL 5I71C 2M26A 2Q87A 4R90H 5FGCB 5EA0L 4MWFB 3LDBB 5IK3B 3SDXB 3ARYA 4AQ1B 4RWYH 5T5NF 4PRNA 5DRZB 3I3BA 3KPSB 5D72L 2G5BA 4N5EA 1QSEA 1Y0LA 5CJ5A 1DBML 3BZDA 4N5UA 1Q0YL 5T5NG 3WJLA 1K4CA 5ESVA 4ZSOE 3QIBB 3JWOC 5FYKD 3OAYH 3QXWA 1ZXQA 1ZA6A 4H5SB 2NQCA 3HR6A 3FFCD 1T03L 2DOCA 3Q3GB 4OLZH 2AXFA 2IC2A 3BRDA 3SGEI 5CCKH 5KBNC 1TITA 1KJ2H 4BKLB 4NHUA 3HCVB 5DQ9A 4MXQC 3H42H 3WNMA 3U1SL 2NXYC 1F4AA 3SKNB 3FONA 2XIDA 4D9QE 1IGFH 2C3XA 1S7UB 4MAYA 4G9FB 4HBCL 3DGGB 4ZSOA 4AG4H 3BZEA 2J8OA 5T3ZL 1DQLH 3O8XB 5CIPH 1MHPH 4S1DD 3C5ZD 4JB9L 3RDTC 4LCUB 5E6IA 1ND0A 4Z7VE 5ACLA 5FA4B 1J12A 3LV3A 1WCBA 1KJ2A 3BXNA 3H7BB 5C0BB 4XZUA 1OPGL 3GIZH 3IRZA 2NYYD 2BSRB 1RFDH 1RZ8A 1E4XH 1UWXH 1VDGA 2HTKC 5SWZE 2V2XA 3WFCH 2A73B 3FKUS 3IVKA 4PJHF 4EBQH 2B1HH 3S35X 3VXOB 1QLEL 1BGXH 5GS1B 3DECA 2X89A 1T83C 2IPTL 2ZCHH 4Y4HA 2W0KA 3VFPA 1PZ5B 3VFOB 1IMHC 1PYWA 1KPRB 3DNKA 5JHDD 1L0XA 4C54A 1KJ3L 4IDJH 5IB1B 1JGDA 3QUXB 2Z4QB 3VWJA 5DJYA 4BELD 2BNRB 1AXIB 1IGCL 1LDPH 1XCQB 1N7ML 5TE7L 5L2KD 5DC4B 4LLQA 4GMTL 2E5EA 5JXEA 1JFMA 1PD6A 3ZE1E 1HK6A 5EPMB 3RTQC 4JE4B 4QXUL 5IVXE 1V3KA 1PSKH 3JWOL 5GGQH 3NCJL 3TESA 4LHJB 4G43B 2BVPA 4KHXH 5CBAA 1YQ2A 1HN1A 5HHPB 4MNQD 1E6JL 1AIFA 1XGPA 5DDHB 1AKJA 2BHYA 4H1LA 3LKPB 2BVOA 3QZWA 2GSGB 2M1KA 2ZUXA 1ACYL 4P59H 4XI5D 5DMKA 5F93C 3UJIL 1BECA 2FO4B 2P5WD 1N0LA 2PNDA 2Z31A 5FHBH 3KPMB 4UILH 1PQZB 3O9WD 4TUOA 1KXQE 4NQXB 4NQVB 3DETC 1WWAX 1FZMB 1JHKL 5IVXA 3D85B 1GRWA 1G7PA 1YEEL 3SJVD 3JV4B 5GPRA 1UB6B 1D9KC 4Z7WA 2EZ0C 4H0IA 4P2QE 4P4KC 2Q20A 3GSNH 3QUYD 4WI2A 4IRSB 3ARFC 3BIAX 3NPZB 3P4OB 1ADQH 4R0LA 4EJ1C 1JZ3A 3STBA 1B4JH 3W5MA 2RCSL 3X13A 1MCCA 4NKOB 5MP6L 4S0UC 4YHLL 4OZIB 1ZT7A 1KEGL 2H8PA 3DVGA 1Y18A 4LCWE 3DMMB 5DVLA 3MROB 4OZFG 2Q7YA 1IC7L 3TT1L 5D2LF 3QDJA 4P2QA 4PUBL 5BO1H 4JM2F 4QRRB 2D4DA 1YN6A 3GSNA 4G8FA 1PW3A 1MHHB 3QEQB 1ADQA 4QCIB 3WO3B 1GVIA 5C71A 4KU1A 3QXVA 2Q1EA 4NUJB 5FUOH 4Q7DA 5KTEH 1AGBA 4KJWD 4U7MA 4Y4FD 1FIGH 1EA9C 2EXWC 4N68A 4WGWB 2DTSA 3E2HC 1F00I 1X3DA 1NCNA 2DDQL 1NMAH 4XNMB 4ZAKC 3ROLB 3IDGA 4ODSL 3QJFA 4E5XB 1AE6H 3O3BB 3IDNA 3T1WA 4N1HB 3P4MA 4Z7WF 1MF2H 5CMAB 4YLQT 4D8PB 3ARRA 2P5ED 1B6UA 2EC9T 4MCZA 2VZOA 3MLVH 1C16B 4IOIB 4LEXH 4KC3B 2AJSL 1NSNL 3G04A 4PJ8B 3CPLB 1FG2A 5EUOE 2CKBL 4LCIH 2VLJD 5HHNA 5BZDA 1S7WA 5ESAB 3BEWB 2D03H 2X40A 4TVPL 4JHWH 5FECA 1SBBA 1UM4H 3A6CH 3PABA 3RWJA 3B3IA 4D9LL 1TVHA 5LGHL 5I8EA 3AC0A 3GBML 3C2SA 3QG6B 4H20L 1ZT4B 2VDRL 3RGHA 3BKMH 4GAGL 2MKWA 1JK8B 3S36X 5JNYB 4DCQA 5CBEB 4PJ9D 2Q8AL 4JM4H 1LD9B 2VC2H 4NQCB 1EO8L 4ISVA 4FQ2H 1FYTB 4M9PA 2BDNH 1MFEL 1D5BA 4K8RD 3CSYA 3PHQB 5HY9A 5DSCA 1R0AH 3UBXI 3KPRE 4P3CL 1BX2B 4G8GB 2IFFH 5F97E 1AP2A 2ATPB 4L8SC 4Z0BH 2BY0A 3MA7A 3DX6A 2H1PH 3VXPB 5DT1H 1JZ2A 1NC2A 2HH0L 2ZJSL 3TM6A 5C0JA 1JYWA 3VH8B 3H0TB 3FO9B 1A7QH 1AGDB 1MCLA 3VG0L 2V17H 4YDLB 4Z0XB 3DO7B 4LHQB 1JN6B 4C56B 2VUOA 3MXVL 4OD3H 4PJBB 1HZHL 3BPLC 1J0HA 5EH1A 4PJ5D 1A6VH 4U4BA 5BZWA 3TF7A 5DR5L 4DVRH 3NFNA 4RAVA 2ADJB 3G5XA 4TOYL 3T77B 5IBTL 4UQ3B 1TLKA 3RWCB 2YBRB 4FFWD 5I0DA 4HWZA 3SE8H 5J0BA 3CCHB 1SQ2N 3O6FD 3QQ3A 4JFOB 3H7LA 1S5HA 1X6LA 2CGRL 3A67H 3QXAA 1IAKB 4Z8FH 3K3QA 4ZXBC 3OF6A 2GT9B 2VXQH 1XGYH 2OLDA 3IU4H 2H26B 5HGHB 1HH9A 2VZSA 4PGZA 1TJIH 2W65B 5LCVH 2OP4H 3T0DA 1ZSDA 3GMNA 4OCWL 4L4TA 3TN0C 1T80A 1TMCB 3O4LB 5C6PB 3F58L 2Z8VC 1MREL 4CMMA 2XYCA 5DZOA 4QRQA 4QF1B 3NIFF 3X12B 1GH7A 1JNNL 5DEZA 1S5IL 1Q0XH 2HJFB 3PQYD 3VRLE 4LSTL 3EYUL 4RAUB 4K7FB 1DFBH 5IMLA 3RVVD 4G6MH 2WANA 2C4XA 3RBGA 3WIHH 4HDIA 1HHGB 3CDGA 3BVNB 1IE5A 1TJGH 3S7GA 4DGYH 5A16A 2NXZC 3QPQD 3G5VA 3WNNA 3O6KL 1N59A 1WFNA 5KVEL 2G9HB 4OB5H 5EUKA 3CX2A 4JY5L 2GFBA 4JDVB 4X7TB 4GH7B 4L4JA 1HEZB 3C5JA 1MI5A 3HLAB 3EDFA 3SKJH 4YDKH 4KKCC 3HN3A 4JJ5B 5F3HA 2PW2B 5JOFB 4RGNE 3ARDB 1KCRL 5ITBL 3W39A 5CSZA 4Y5VA 4UAOC 2ATKA 2YKLH 4U1NA 4Z76B 1OOAA 2UWEA 3PWJB 4WY7L 1LGVA 3HE6B 2ICES 4AM0B 2ADGB 3V4VH 3AROA 1FNEA 3IRPX 3GKWL 2FSEA 1IEAB 1QRND 2FDBP 3B2VL 5I66A 1IAOA 5AZ2L 1T0PB 2DB8A 4GBXB 4KUZH 1NGQH 1YPZB 3WSQH 1JMXA 3QO1B 1K5NA 1XIWB 5ISZD 1MHCB 5BMFH 4JFPA 2ARJA 4PY7B 1H3PL 4Z7QE 1YEGL 1CK0H 1H15B 2EH7H 4O02H 4PRAB 4FQCH 1F8TH 1MUJA 1I9RL 4RBPH 5K9OA 3Q6GH 3DHJA 4RFNC 1QRKA 3QIWD 1LO0L 1N5YL 4UIMB 4I9WE 2DN7A 3REVA 1OCWH 1RUKH 2DWDA 5LVEA 3AUVA 4FQLL 2QQKL 1JI2A 2CIKA 2W07A 1BJ1H 3FT4B 2X4RA 1GZQA 4MQXD 4FQXD 3BQUB 4KK6D 2H2SD 3F12A 4EUPG 2A6JA 2WINA 4PJEE 2DQTH 5DD6A 1G9EA 3LS4L 3HG1E 5H8DA 2Y25A 3K2UH 1LO2L 1AXTH 4L8BB 3AS1A 3CC5A 2XFXA 4I4WA 3SE4A 5I2IA 1ORSB 2HJLB 2UWEF 1G0DA 1ZA3B 4EI5B 2P8PA 5GGSB 1QBML 1P84K 4JZOB 7FABL 5DMGC 1NC4A 5FKAA 1ZV5A 5D7IF 4N9GA 1R24B 4DN3L 4O58H 2LU4A 3W0WD 5CZXD 4FTVB 5EC2A 3HC4L 1U3HA 2I5YH 3CX5K 5L2JA 3HZKB 1S3KL 3ARGA 4PJEA 5TE6H 5F3BA 3C8DA 5HPOA 4NQDE 1AHWC 5F7EL 1OM3H 4HKJA 2OR7A 5IFHH 4G6KL 1ZOXA 1K8DA 3E6FB 3U4BH 2JJUA 5IP4A 2NY2C 3TVMC 3RZCB 2H41A 4K71C 4IEFB 1AD9A 4RQQB 4PTTA 3JWDC 4GRMA 5LAXB 3GHEL 2Q76B 3D18A 1NL0H 2C3VA 4Q6IB 1VFUA 5FV1L 2FX9H 3ZSTA 2QSCH 2DLEA 4OCYL 1PLGH 1DBAL 3RWIA 5C08E 4F8QA 4M1CC 3BP4B 3NH7L 1EH9A 4L9DA 4WTZG 3RBSA 4XCNA 4GRLD 4GKSA 2OMNA 4PGDB 1BFOB 3U36B 3QR2A 2WBWB 1U8LB 3MNZA 1HNGA 4X6DB 3U30B 4HT1H 5ADPH 2AXGB 2PXYD 1FNSL 4NQEE 4JKPH 3GI8H 1K4DB 2R0ZH 2DQFA 3V5DB 1I3UA 25C8H 1EUUA 5LJYH 4XCCL 4AL8L 3HAEB 1UZ8A 1CDBA 4XBEH 3PP3K 3MPCA 4OT1H 1ITCA 4LRNL 1BZ7A 3B2UD 1HHJA 5EO1A 1D6VH 1DSFH 4PV8B 1P2CB 5C0CD 1XMWA 4HD9A