1B4HA

Oligo-peptide binding protein complexed with lysyl-diaminobutyric acid-lysine
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
517
structure length
517
Chain Sequence
b'ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGO-PEPTIDE BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 194
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b4hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b4hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b4hA02
3BFTA 3HO7A 1B7UA 1P1WA 2UVJA 4I1DA 5A5XB 2H5YA 2OWSA 4HCWA 1TXFA 1Q35A 4G77A 1N76A 1O64A 3CSGA 3OO6A 3C9HA 4FAJA 5H8QB 1B1XA 2F97A 1JETA 1I6AA 1SQYA 4BLAA 3EF7A 4EQ9A 1LFHA 3EPEA 4HCYA 3SEXA 5BUUA 2G29A 3A09A 3CG1A 1USYH 4GOTA 1UTBB 1NNPA 4BDLA 3TQLA 3PPPA 3C33A 2PX1A 4H8IA 3OXNA 1QUKA 2PYYA 1TFAA 4DCXA 1SW4A 5IAIA 1AIVA 3S4UA 3MZBA 1LAXA 5DVJA 1QULA 3SEYA 1IXGA 5F7VA 1B4ZA 4G8MA 1MXXA 4R72A 3O66A 5DYHA 1AH5A 1DTZA 1LSTA 3TCGA 2F7BA 1MM7A 1Y1ZA 4KD5A 1D3KA 3KG2A 3TTKA 3PPOA 4BDQA 3H7MA 3KOSA 2F5XA 2DE4A 1MH4A 1IXHA 4O3CA 3RPWA 4PETA 3M3KA 4U1OA 4QSCA 1POTA 3OOAA 3IOWA 3O6IA 4JB7A 3SEWA 4G68A 2H98A 3E13X 3MVZA 4FORA 4KYDA 5FTIA 2O1LA 5KDTA 5CBRA 3KBRA 1UIVA 4WXJA 3IB1A 5L9OA 2XXHA 5K2YA 4GQOA 5JTYB 2F6GA 3U1OA 4U4XA 3CRBA 2RF1A 5M2VA 1SVXB 2Z8EA 3U93A 2I0BA 3H6UA 2DS9A 3Q26A 2PMSA 3CG3A 2R6GE 4ZECA 3E9XA 2D21A 1GV8A 3PMVA 1ATGA 4NE4A 5AA4A 2O51A 1DPEA 1B05A 2V3QA 4YB5A 4F2QA 4POWA 1I69A 2XXIA 4KYEA 4Z0IA 1MG1A 3PUZE 1JW1A 2ONRA 4ESWA 4XKPA 5K2XA 1B4HA 2CMOA 3HHGA 3W9VA 1B3FA 5ITOA 2HXWA 3RGYA 4IO5A 1LB9A 1GTKA 3K1NA 5EHMA 1P1QA 4XKNA 1UTHA 4MLQA 4F2OA 5ICQA 4YKJA 3DRHA 1EU8A 3N6UA 4GXAA 1URDA 3A3CA 3USDA 4DXCA 3HPIA 2F7AA 3N94A 1A8FA 5CMCA 4MH5A 3DP4A 3EHUA 4NEDA 2FNCA 4PFWA 1NFTA 2ESNA 2PT1A 4P11A 3H4ZA 3L6GA 3FUZA 4RPOA 1MQIA 4LZ7A 4R2BA 5TP9B 4HW8A 2LAOA 1FTKA 3RN8A 3SEVA 1QKBA 4FECA 3PPNA 3K2DA 1SDXA 3SESA 1O7TA 3TTRA 5KDTB 3CIJA 1N7XA 3SKPA 4RNSA 3ECRA 4GL8A 4U1ZA 2XXVA 4X9TA 4IB2A 1GGGA 1LAGE 1YTVA 2XXQA 4BDMA 4FE8A 3G7WA 2DP8A 2Q9TA 5CI5A 3CHGA 1CB6A 3FVKA 3VXCA 2Z23A 2DQVA 3G3IA 2O7IA 3TODA 4EF1A 3KN8A 4G2ZA 4JSOA 3E3KA 5KZTA 1I6BA 4H5FA 2XD3A 2XXXA 1JVXA 3M8UA 2RC9A 3FD3A 2D5WA 5KCJB 5ELVA 3W15C 4ISUA 4KR5A 3WAFA 4WEPA 2ONSA 4BDNA 2A5SA 2DOJA 4MBPA 2OZZA 2PBWA 3M3LA 2I4BA 1Y3QA 2QSXA 2YLNA 1MM6A 1FTLA 3LR1A 3TELA 3UA8A 3DP6A 1UTHB 5H8HA 5ISUA 1B7ZA 4I62A 3H6TA 1Q1KA 1AMFA 1XS5A 3K1MA 4EXLA 5CMKA 1Y3PA 2VGQA 5HM4B 3TDJA 3E4RA 1F9BA 5I56A 1H3DA 3QSLA 3AXFA 1OQGA 5I84A 1TWYA 3L6HA 5J1DA 1O63A 3IOUA 1QVSA 3BBRA 5FHNA 1A55A 1HSJA 4GF8A 2HEUA 4OERA 4KCCA 2O7UA 1N7WA 1VSOA 3QK6A 1LFGA 5H8QA 1LCFA 2A5TA 3VE1B 2H99A 4DE8A 2NVUB 3EN3A 5I59B 1OLCA 4GLIA 4OYVA 3FVGA 1UTBA 1NL5A 1BP5A 3GXAA 3T9HB 1JW5A 3MWBA 1LAHE 4KYSA 2QL3A 3JZJA 3C31A 4EUOA 4O3BA 3V5AA 3IB0A 1MQJA 3OO7A 3FVNA 3TMGA 1P99A 4Q0CA 1WVJA 1FTJA 1B3LA 4QFLA 2DSFA 4C1UA 4ZEDA 1NKXA 2FA7A 3V83A 1OIBA 1ZJLA 1MH3A 4EXKA 4I9DA 1Z7ME 2DYXA 2XD2A 3S9MC 4IO6A 1S9TA 2Q89A 3KSXA 1AL3A 4IY6A 3LSLA 4H8JA 1MDQA 4LA9A 3PMWA 3FATA 3CVGA 4F1YA 1RYOA 3PD8A 5AA2D 5DVFA 5L8DA 4RPNA 5F1QA 4RK2A 2ZYNA 5CMMA 3FXRA 1MS7A 3FV2A 1H76A 3T9UA 3MPLA 5FTHA 3PPQA 3FJGA 3OMBA 3HHFA 3ILTB 4LVQA 2ZNSA 3K6VA 2RC8A 3O2AA 1US4A 1EZPA 1LGBC 3UORA 2O1MA 1OVBA 3IB2A 3O28A 5HBCA 5JTYA 5IKBA 4FJPA 3IK6B 5I56B 2I6EA 2XX8A 3FJ7A 3MVXA 4N13A 1IITA 1MY2A 3UK4A 1FTMA 3K6UA 1TT1A 5CBSA 2O68A 4E0WA 4U2RA 3LUYA 1QUJA 3LC8A 4NWCA 2A5TB 1TFDA 3CSBA 2M8CA 1YCJA 4ZEBA 1EH3A 1B2HA 2XXWA 1B51A 3RTWB 3MVWA 4NF4B 2DVZA 2FYIA 4BDRA 2AYSA 2D3IA 2Y7PA 4YICA 1IXCA 4OHNA 4RXLA 1D9VA 3MQ9A 4IGRA 1P1OA 1LAFE 2Z22A 3CFZA 4NF8B 1PB9A 4OEUA 2UVHA 4HS7A 3A3UA 1IQ7A 4HTGA 3LBSA 3T93B 1BLFA 1ZMGA 1B6HA 2IA4A 2KLFA 3ONMA 4F22A 1A8EA 3CR9A 5TP9A 2DWJA 1JW4A 5DVIA 2HQ0A 3OO8A 3IL1B 4TOZA 2UYEA 2Z8FA 1B3GA 1ZIUA 2O69A 4DXUA 2Z8DA 4LATA 3RNNA 4RYAA 4QFPA 5I2NB 4EQBA 4OMBA 2RINA 3T66A 5CMBA 5ICTA 2OJTA 4LQ2A 2ZYMA 2WOPA 1QKAA 4YU0A 2R9JA 4O3AA 1VE4A 3U92A 1WDNA 1MQHA 2V25A 2E1SA 2HFBA 4GXSB 2ZXTA 3PUYE 4F18A 4YMBA 2DVCA 3OD7A 2BJJX 3G3FA 3VVDA 2HCAA 3C32A 4Q5TA 1IIWA 1MXWA 3LSWA 4RY1A 3DLNA 1IZ1A 3VDFA 3ZKLA 1MPDA 1MQGA 4NWDA 2WOKA 2AIXA 3K0VA 5KCJA 3B6QA 2B3FA 4F3PA 3MBPA 1NNKA 4XIGQ 1RKMA 5CC2A 3HCQA 3K6XA 1B5IA 3K1PA 3KFMA 2QS2A 2RCBA 1II5A 4TQUQ 3SETA 4THIA 1MY3A 4H65A 2GRVA 2Y84A 3DP8A 2V3TA 1NNTA 2GHBA 2F8DA 1M5FA 3UP9A 3IORA 2UVIA 1LBCA 2V84A 3KGCA 3DELB 3D4GA 5LOMA 2I48A 4ND9A 2I49A 3FTOA 4ZEFA 1MPCA 3RT6B 1XHYA 3C34A 3EHSA 2ANJA 2W7YA 4YB6A 4ZS9A 3WAEA 5TPAB 1OLAA 2PT2A 5JK4A 1PC3A 2DWAA 3OEKA 3IX1A 5I59A 3PUWE 1B58A 4ONYA 2B3BA 3DRJA 3OO9A 4GVOA 5CM6A 3C36A 5AA1A 2NUVA 2ZNUA 3H6WA 5FHMA 3O6HA 1YPNA 3D4CA 4KCDA 3U72A 3UN6A 2UVGA 4UACA 4NF6A 1FQAA 3HN0A 1FQEA 3KEIA 1FW0A 4TLMB 3N5LA 4ELQA 3T9VA 4MLVA 1JVYA 1MY1A 1LFIA 4Q30B 4YB7A 2XXTA 2DE2A 2IEEA 3QUFA 2I58A 1USYE 3RYAA 3TTMA 4PFTA 1I6QA 2X26A 3M3FA 3KOTA 1B5HA 1L5TA 2OCUA 1FQFA 3OEMA 4GIZA 2HAUA 3TFLA 3B6TA 4F3BA 4OZ9A 4XTCQ 1B46A 4R73A 2F35A 5B70A 1BIYA 1URSA 3T22A 3UIFA 3OENA 4Q8RA 4AB5A 1T0KA 2ZMBA 4WEDA 2UYFA 3G3KA 3V89B 3OSRA 3O29A 1PB8A 3R7XA 2REJA 1Y20A 3DM0A 5HPQA 1ZLQA 4L17A 3VV5A 1HSEA 3S9LC 4QSDA 3LSFB 1BTJA 3RY3A 4OQOA 2G93A 1Y4CA 3FIRA 4XXUA 1Y3NA 3TAJA 3W9WA 4N07A 4RJZA 4F3GA 1XC1A 1M5BA 3IAZA 3TEPA 3PV0E 1Y4TA 4KHZE 2DE3A 1MXZA 1S7YA 3S9NC 4NF4A 5AA2A 3GBBA 4DIGA 1PB7A 2Y7WA 5I2KB 2DWIA 2QMWA 5DEXA 4R75A 5BWJA 2XHDA 2XXRA 1PEBA 3T96B 3FXQA 4NF8A 4N6PA 4NF6B 4R9FA 3B7DA 3MAMA 2P2AA 4IGTA 3CFXA 1ZTYA 3P7IA 2Q88A 2ZYOA 4ZEKA 2DXYA 1B3EA 4EF2A 3MP6A 1IUDA 1NMUA 2O84X 3MZ9A 3C4MA 1B3HA 5B7DA 1SW2A 3Q29A 3DRIA 5AE4A 2PVUA 2QRYA 3RUMA 3GLBA 4ZE9A 4DXBA 4QFKA 2RC7A 3G3HA 3PU5A 3VFJA 4FEBA 3BFUA 3RQTA 2QS3A 4R74A 2H9BA 3HV1A 2DWHA 4PQJA 1FCKA 4F31B 3IJOB 3PAMA 1PDAA 5I2NA 1B0LA 3G3GA 4U22A 1B9JA 3MUQA 4LONB 3DRFA 1XT8A 1FQBA 1JQFA 3H6VA 3IR1A 2AL4A 3VLVA 1MXUA 5ITPA 2B4LA 4WKMA 3TUSA 4H6DA 4DCYA 2E0SA 1B0HA 4XKQA 4G8HA 2NOOA 1Z7NE 5I58B 2VOZA 1VR5A 1B40A 2QJEA 1VFDA 1H44A 4F29A 1H43A 3LVUA 4MFIA 4IO3A 4YAHX 4FATA 1YAEA 4IO2A 4AQ4A 1OMPA 3H06B 3UGWA 3DRGA 2X7QA 3I3VA 3SDFA 2HZKA 3MC2A 4NTLA 3VLUA 4OEVA 4F39A 4OFOA 3B6WA 4X48A 2I4CA 3T9XB 5AA2B 4G68C 5CRYA 2VD3A 4ZDMA 4JBZA 3OELA 3RYBA 5DEXB 3FZVA 3MP8A 3H03A 1IEJA 2VP1A 1M5CA 4NF5B 2X7PA 3FASA 4H0WA 1H45A 3EQ1A 1MPBA 3Q27A 4QF9A 1OQHA 4JSDA 4JWYA 4K3FA 3GZGA 1DPPA 3TCHA 1J1NA 4F19A 4C0RA 1ZU0A 3ZSFA 3O9PA 1JEVA 1A7LA 2H4IA 5TPAA 1MQDA 3QAXA 1DOTA 3FXUA 1LBBA 1R9QA 2O6AA 2QS1A 4LQ5A 2ZNTA 5EHSA 3PGFA 4R9GA 1GVCA 4KQPA 4KFQA 3K00A 4ELPA 3KSJA 3RT8A 4R6KA 4UA8A 4OXVA 3MP1A 1DMBA 3KN3A 1N84A 3N6TA 2AL5A 4R6HA 4R2FA 4Z7EA 4MF3A 2GH9A 2WKYA 3HSTA 1SW5A 4OTEA 3U8QA 3O6GA 1XOCA 1UIUA 2F34A 4YKPA 4GRKA 2ZYKA 4P0IA 3PD9A 4KI0E 5FHOA 1JEUA 3FGSA 1NH8A 3MVYA 4YKIA 5H8FB 2OLBA 3RLFE 2VD2A 3IOVA 4G8NA 4RK9A 3I6VA 5I57A 1SYHA 5DTBA 2NWJA 1N0TA 1R6ZA 4R6YA 3S9EA 3H3GA 4ESXA 2P0SA 3LSXA 3BKIB 3G3JA 3MW0A 1ZKBA 1A54A 4ECFA 3KJ7A 3S2VA 3VVEA 3K02A 2OK2A 1B1HA 4C1TA 2UXAA 4G4PA 1SBPA 4H67A 3CFLA 1AOVA 3FV1A 3TYHA 2I0CA 1SYIA 1FQCA 1DTGA 1PBPA 2F7CA 2ALUA 1URGA 4EDPA 4LZ5A 2VHAA 3VVFA 4M1VA 3TTLA 3QIMA 4QFNA 4F1VA 4X1BA 1LB8A 3ZKKA 2GHAA 3K4UA 2QS4A 1WODA 4IO4A 1MDP1 4TLLB 4P0GA 4JWOA 4DDDA 2ONKE 2RCAA 2OBGA 5TU0A 4EQ7A 4QRZA 1BKAA 3THIA 4ZEIA 3C35A 5H8NA 3IOTA 4ZE8A 5I2KA 4G68B 3PUVE 1OVTA 4U21A 1MY4A 1POY1 3PPRA 2REGA 4GFRA 4F3SA 2THIA 1JNFA 4ELRA 4OFJA 4ELOA 3VLWA 2QMXA 4LP2B 4QSEA 1S50A 4H1XA 3JV9A 2Y7RA 1R9LA 4U4SA 4JDFA 1XVYA 2XX7A 3TQWA 1M5EA 4OESA 2XXYA 3SEUA 4IY5A 3TTNA 3FJMA 3ILUB 1PBQA 1MXYA 4OFLA 3TCFA 3ZS6A 5I57B 5DT6A 4LZ8A 5AA4B 1R1NA 3K6WA 4U23A 4PFUA 1MRPA 2NXOA 1DSNA 3CI8A 3O6PA 1ANFA 5AA3A 3VXBA 4BDOA 1ZBMA 4QFOA 1RYXA 1ELJA 1KWHA 4OENA 5L9MA 1SI0A 1SI1A 1NH7A 4JWXA 3TPAA 1D9YA 3R6UA 2Q8JA 3QYTA 4OETA 1NNFA 4ZZEA 1MXVA 2R71A 4DZ1A 3Q25A 1Y9UA 1B32A 1HSLA 2XXPA 4LUBA 5JEIA 4RA1A 1SW1A 3PUXE 4PP0A 2F6PA 5I58A 2YJPA 1US5A 2OWTA 2WOLA 3U94A 1M5DA 4GD5A 3IJXB 1GR2A 2Y7IA 4QHQA 2I3WA 2Q2CA 2H25A 3N26A 5A5XA 3OSQA 4KPTA 1B7HA 3DRKA 1N3XA 2XXUA 1FTOA 2V93A 2I3VA 1B52A 4YMAA 2V3UA 4FEDA 3KN7A 3F11A 1P1NA 1QW0A 5H8NB 4IO7A 2F36A 1A99A 1QUIA 3IO4A 1B5JA 3RTFB 4F1UA 4XKRA 5L9SA 3SERA 2XX9A 2HZLA 4YKKA 2RKMA 4M4GA 4NF5A 1QJMA 1SD3A 3KZGA 2B4MA 4YZZA 3EHTA 1VFEA 3PMXA 1LLSA 2QPQA 1UQWA 1LCTA 3I5OA 2YPNA 2B65A 3GBAA 2P1SA 4OVJA 4GWOA 4X1DA 5EYFA 1N04A 4DLDA 4PFYA 2Q2AA 1N3WA 3MJNA 4POXA 3IO6A 2GFEA 3ODBA 4GL0A 1EZOA 1EZ9A 2F78A 5H8SA 4H5GA 1FQDA 4FIMA 4OWDA 4ZZAA 3JYRA 4NMYA 1D4NA 3QUJA 3MPKA 3QXMA 4E0XA 1Y1MA 4PE5B 3FVOA 3Q28A 1CE2A 5H8HB 4JXIA 2CZLA 1A40A 1P1UA 4I8CA 3TZAA 3TKDA 3V8XB 2DXRA 3O97A 1XVXA 1IXIA 1MY0A 3KJTA 3K01A 2HAVA 4AB6A 2ABHA 3MZ1A 2Y7KA 3R26A 5H8FA
chains in the Genus database with same CATH superfamily
3BFTA 3HO7A 5I7IA 1B7UA 1P1WA 2UVJA 4I1DA 5A5XB 2H5YA 2OWSA 4HCWA 1DK4A 1TXFA 1LBXA 1Q35A 4G77A 1N76A 1O64A 3CSGA 3OO6A 3C9HA 4FAJA 4I3EA 2XWVA 5H8QB 1B1XA 2F97A 1JETA 1I6AA 1SQYA 4BLAA 3EF7A 4EQ9A 1LFHA 3EPEA 4HCYA 3SEXA 5BUUA 2G29A 3A09A 3CG1A 1USYH 4GOTA 1UTBB 3EKIA 1NNPA 1NV6A 4BDLA 3TQLA 2CEYA 3T1BA 3PPPA 1IMDA 4I3YA 3C33A 2PX1A 4H8IA 3OXNA 3FXBA 1QUKA 2PYYA 1TFAA 1FPKA 4DCXA 1SW4A 3FBPA 5IAIA 3B8BA 1AIVA 3S4UA 3MZBA 1LAXA 5DVJA 1QULA 3SEYA 1IXGA 1LBYA 5F7VA 1B4ZA 4G8MA 4GX4A 1MXXA 4R72A 3O66A 5DYHA 1AH5A 1DTZA 1LSTA 3TCGA 2F7BA 1G0IA 1MM7A 1Y1ZA 4KD5A 1D3KA 3KG2A 3TTKA 2XWIA 2WYPA 1NI9A 3PPOA 4BDQA 3H7MA 3KOSA 2F5XA 2DE4A 1MH4A 1IXHA 1RDXA 4O3CA 3RPWA 4PETA 3M3KA 4U1OA 4QSCA 1POTA 3OOAA 3IOWA 3O6IA 4JB7A 3SEWA 4G68A 2H98A 3E13X 3MVZA 4FORA 4KYDA 5FTIA 2O1LA 5KDTA 2P3VA 5CBRA 3KBRA 1UIVA 4WXJA 3IB1A 5L9OA 2OX3A 2XXHA 1INPA 4PFRA 5K2YA 5F24A 4GQOA 5JTYB 2F6GA 3U1OA 4U4XA 3CRBA 2RF1A 5M2VA 1SVXB 2Z8EA 3U93A 2I0BA 3H6UA 2DS9A 3Q26A 2PMSA 3CG3A 2L5VA 2R6GE 3QMFA 4ZECA 3E9XA 2D21A 2F3DA 1GV8A 3PMVA 1ATGA 4NE4A 5AA4A 2O51A 1DPEA 1B05A 2V3QA 4YB5A 4FBPA 4F2QA 4I40A 4POWA 1I69A 2XXIA 4KYEA 4Z0IA 1MG1A 1YYZA 3BIGA 3PUZE 2VPNA 1JW1A 2ONRA 4ESWA 3KBZA 4XKPA 5K2XA 1B4HA 2CMOA 3HHGA 3W9VA 1B3FA 5ITOA 2HXWA 3A29A 3RGYA 4IO5A 1LB9A 1GTKA 3K1NA 5EHMA 4N17A 1P1QA 4XKNA 1UTHA 4MLQA 4F2OA 5ICQA 4YKJA 3DRHA 1EU8A 4P1LA 3N6UA 4GXAA 1URDA 3A3CA 3USDA 1SPIA 4DXCA 3HPIA 2F7AA 3N94A 1A8FA 2XWKA 5CMCA 4MH5A 2QFLA 3DP4A 2WBBA 2DDKA 3EHUA 4NEDA 4MAGA 2FNCA 4PFWA 1NFTA 2ESNA 4P56A 2PT1A 4P11A 3H4ZA 2Q8MA 3L6GA 3FUZA 4RPOA 4PAKA 1MQIA 3E79A 4LZ7A 4R2BA 5TP9B 4HW8A 4MIJA 2LAOA 1FTKA 3RN8A 3SEVA 1QKBA 2WEFA 2FVZA 4FECA 3PPNA 3K2DA 1SDXA 3SESA 1O7TA 3TTRA 5KDTB 1YXIA 1N7XA 3CIJA 3SKPA 4PFIA 5EQ9A 4RNSA 3ECRA 4PDHA 4GL8A 4U1ZA 2XXVA 4X9TA 4IB2A 1GGGA 1LAGE 1YTVA 4O7IA 2XXQA 4BDMA 4FE8A 3G7WA 2DP8A 2Q9TA 5CI5A 3CHGA 1CB6A 3FVKA 3VXCA 1XI6A 4N91A 4NX1A 2Z23A 2DQVA 3G3IA 4PBHA 2O7IA 3TODA 4EF1A 3KN8A 4G2ZA 4JSOA 4G61A 3E3KA 5KZTA 1I6BA 4H5FA 2XD3A 2XXXA 1JVXA 3M8UA 2RC9A 3FD3A 2D5WA 5KCJB 5ELVA 2HPGA 3W15C 4ISUA 4KR5A 3WAFA 4WEPA 2ONSA 4BDNA 2A5SA 2DOJA 4MBPA 2OZZA 2PBWA 3M3LA 5IZ3A 2I4BA 1Y3QA 1K9YA 2QSXA 2YLNA 1MM6A 1FTLA 3LR1A 3TELA 3UA8A 3DP6A 1UTHB 1RDYA 5H8HA 5ISUA 1B7ZA 4I62A 3H6TA 1Q1KA 1AMFA 1XS5A 3K1MA 4NHBA 4EXLA 5CMKA 1Y3PA 2VGQA 5HM4B 3TDJA 3E4RA 4GX3A 1EYKA 1F9BA 5I56A 1H3DA 3QSLA 3AXFA 1OQGA 5I84A 1TWYA 3L6HA 5J1DA 1O63A 3IOUA 1QVSA 3BBRA 5FHNA 1A55A 1HSJA 4GF8A 2HEUA 4OERA 4KCCA 1IMFA 2O7UA 1N7WA 1VSOA 1FPIA 2VT5A 2HXRA 3QK6A 1LFGA 5H8QA 1FPDA 1LCFA 2A5TA 3VE1B 2H99A 4DE8A 2NVUB 3EN3A 4QXDA 5I59B 1OLCA 4GLIA 4OYVA 3FVGA 1UTBA 1NL5A 1BP5A 3GXAA 3T9HB 1CNQA 1NUYA 1JW5A 3MWBA 1LAHE 2XXKA 4KYSA 2QL3A 2WYKA 3JZJA 3C31A 1NV2A 4EUOA 4O3BA 3V5AA 3SZPA 1LBVA 3IB0A 1QGXA 4PAIA 1MQJA 3OO7A 3FVNA 3TMGA 1P99A 4Q0CA 1WVJA 1FTJA 1B3LA 4QFLA 2DSFA 4C1UA 4ZEDA 1NKXA 2FA7A 3V83A 1OIBA 4H46A 1ZJLA 1MH3A 4EXKA 4I9DA 1Z7ME 5EQ8A 2DYXA 3LUZA 2XD2A 2ZZVA 3S9MC 4IO6A 1S9TA 2Q89A 3KSXA 1AL3A 4IY6A 3LSLA 4H8JA 1MDQA 4LA9A 3PMWA 3FATA 3CVGA 4F1YA 2MKZA 1RYOA 3PD8A 1NUWA 4MNCA 2PCRA 5DVFA 5AA2D 5L8DA 4RPNA 5F1QA 4RK2A 5IZ3B 2ZYNA 5CMMA 3FXRA 1MS7A 3FV2A 1H76A 3T9UA 3MPLA 5FTHA 3PPQA 3FJGA 3OMBA 3HHFA 3ILTB 4LVQA 2ZNSA 3K6VA 2RC8A 3KC0A 3O2AA 1US4A 1NV3A 1EZPA 1LGBC 3UORA 2O1MA 1OVBA 3IB2A 3O28A 5HBCA 5JTYA 5IKBA 4GWSA 4FJPA 3IK6B 5I56B 2I6EA 4PF8A 4MNIA 2XX8A 3FJ7A 3MVXA 4N13A 1IITA 1MY2A 3UK4A 1FTMA 3K6UA 1TT1A 5CBSA 1YZ0A 2Q74A 2O68A 4E0WA 4U2RA 3LUYA 1QUJA 3LC8A 4NWCA 2A5TB 1TFDA 3CSBA 2M8CA 1YCJA 4ZEBA 1EH3A 1B2HA 2XXWA 1B51A 1EYIA 3RTWB 3MVWA 4NF4B 2DVZA 2FYIA 4BDRA 2AYSA 2D3IA 2GQ1A 2Y7PA 4YICA 1IXCA 4OHNA 4RXLA 1D9VA 3MQ9A 4IGRA 1P1OA 1LAFE 2Z22A 3CFZA 4NF8B 1PB9A 4OEUA 2UVHA 2WX9A 4HS7A 1KA0A 3A3UA 1NUZA 4GWUA 4NG7A 1IQ7A 4HTGA 3LBSA 4PAFA 3T93B 1BLFA 1ZMGA 1B6HA 5IZZA 2IA4A 2CZKA 4O7MA 2KLFA 4NQ8A 3ONMA 4F22A 1A8EA 4PGPA 3CR9A 5TP9A 2DWJA 1JW4A 5DVIA 2HQ0A 1FBPA 3OO8A 3IL1B 1FBGA 4OVRA 4TOZA 2UYEA 2Z8FA 4JVDA 2PFZA 4P8BA 1B3GA 1ZIUA 2O69A 4DXUA 2Z8DA 4LATA 3RNNA 4RYAA 4QFPA 5A5LA 5I2NB 4N81A 4EQBA 4NN3A 3GYYA 4OMBA 3PTYA 2RINA 3T66A 5CMBA 5ICTA 2OJTA 1FPLA 4LQ2A 3HFUA 4O94A 2ZYMA 2WOPA 1QKAA 4IR8A 4YU0A 2R9JA 4O3AA 1VE4A 3U92A 1WDNA 1FPEA 1MQHA 2V25A 2E1SA 2HFBA 4GXSB 2ZXTA 3PUYE 4F18A 4YMBA 2DVCA 3OD7A 2BJJX 3G3FA 3VVDA 2HCAA 3C32A 4Q5TA 1IIWA 1MXWA 3LSWA 4RY1A 3DLNA 1IZ1A 3VDFA 3ZKLA 1MPDA 1MQGA 4NWDA 2WOKA 2AIXA 3K0VA 5KCJA 3B6QA 2B3FA 4F3PA 3MBPA 4XEQA 5EQAA 1NNKA 1FRPA 4XIGQ 1KZ8A 1RKMA 5CC2A 5I3SA 3HCQA 3K6XA 1B5IA 3K1PA 3KFMA 2QS2A 2RCBA 1II5A 4TQUQ 3SETA 4THIA 1MY3A 2F3BA 1FBFA 4H65A 2PFYA 2GRVA 3MSTA 1FTAA 2Y84A 3DP8A 2V3TA 1NNTA 2GHBA 2F8DA 1M5FA 3UP9A 3IORA 2UVIA 1FPJA 4PFBA 1LBCA 2V84A 1FBEA 3KGCA 3DELB 3D4GA 5LOMA 2I48A 4ND9A 2I49A 3FTOA 5IM2A 4P47A 4ZEFA 1MPCA 3RT6B 4AS4A 1XHYA 3C34A 3EHSA 2ANJA 2W7YA 4UABA 4YB6A 4ZS9A 3WAEA 5LDZA 5TPAB 1OLAA 4OVTA 2PT2A 5JK4A 4PF6A 1PC3A 2DWAA 4GBWA 3OEKA 3IX1A 5I59A 3PUWE 1B58A 4ONYA 2B3BA 3DRJA 3OO9A 5IZ1A 4GVOA 2P3NA 5CM6A 3C36A 1NV4A 5AA1A 2FBPA 2NUVA 2ZNUA 3H6WA 4HE2A 5FHMA 3O6HA 4GBVA 1YPNA 3D4CA 4PC9A 4KCDA 3U72A 3UN6A 1LBZA 2UVGA 4UACA 4NF6A 1FQAA 3HN0A 1FQEA 3KEIA 1FW0A 4TLMB 3N5LA 3RPLB 4ELQA 3RYDA 3T9VA 4MLVA 4X8RA 1JVYA 1MY1A 1LFIA 4PGNA 4Q30B 4YB7A 4HE1A 2XXTA 5LTCA 2DE2A 2IEEA 1NV7A 3QUFA 2I58A 1USYE 4MX6A 3RYAA 3TTMA 4PFTA 1I6QA 2X26A 3M3FA 3KOTA 1B5HA 1L5TA 2OCUA 1FQFA 3OEMA 4GIZA 2HAUA 3TFLA 3B6TA 4F3BA 4OZ9A 4XTCQ 1B46A 4R73A 2F35A 4O8MA 5B70A 1BIYA 1URSA 3T22A 3UIFA 2QVVA 3OENA 4Q8RA 4AB5A 1T0KA 2ZMBA 4WEDA 2CZIA 2UYFA 3E78A 3G3KA 3V89B 3OSRA 3O29A 1PB8A 1DBZA 3R7XA 2REJA 1Y20A 3DM0A 5HPQA 1ZLQA 4L17A 3VV5A 1D9QA 1HSEA 3S9LC 4QSDA 4OVPA 3LSFB 1BTJA 3RY3A 5ESYA 4OQOA 4MJOA 2G93A 2CEXA 1Y4CA 3FIRA 2QVRA 4XXUA 1Y3NA 3TAJA 3W9WA 4DI3D 4N07A 4RJZA 4F3GA 1XC1A 1M5BA 3IAZA 3TEPA 3PV0E 1Y4TA 4KHZE 1EYJA 2DE3A 1MXZA 1S7YA 3S9NC 4NF4A 4MEVA 4P9KA 1NV0A 4GWZA 5AA2A 3GBBA 4DIGA 1PB7A 2Y7WA 5I2KB 2DWIA 2QMWA 5DEXA 4R75A 5BWJA 2XHDA 2XXRA 4H45A 1PEBA 4DI4B 3T96B 3FXQA 4N4UA 4NF8A 4N6PA 5I5PA 2R8TA 4NF6B 4N15A 4R9FA 3B7DA 3MAMA 2P2AA 4IGTA 3CFXA 1ZTYA 3P7IA 1FPGA 2Q88A 3NOHA 2ZYOA 4ZEKA 2DXYA 1B3EA 4MCOA 4EF2A 3MP6A 1IUDA 1NMUA 2O84X 3MZ9A 3C4MA 1B3HA 5B7DA 2FIXA 1SW2A 3Q29A 3DRIA 5AE4A 2PVUA 2QRYA 3RUMA 2ZZWA 4XF5A 3GLBA 4ZE9A 4DXBA 4QFKA 4N6DA 2RC7A 3G3HA 3PU5A 3VFJA 4FEBA 1FPBA 3BFUA 3RQTA 2QS3A 4R74A 2H9BA 3HV1A 2DWHA 4PQJA 1FCKA 4F31B 1RDZA 3PAMA 3IJOB 1PDAA 5I2NA 1B0LA 3G3GA 4U22A 1B9JA 3MUQA 4LONB 3DRFA 4MHFA 1XT8A 1FQBA 1JQFA 3H6VA 3IR1A 2AL4A 3VLVA 1MXUA 5ET6A 2WBDA 5ITPA 2B4LA 4WKMA 3TUSA 5ET8A 4H6DA 4DCYA 2E0SA 1B0HA 4XKQA 4G8HA 2NOOA 1Z7NE 5I58B 2VOZA 1VR5A 1B40A 2QJEA 1VFDA 1H44A 4F29A 1H43A 3LVUA 4MFIA 4IO3A 4YAHX 4FATA 4NF0A 1FBDA 1YAEA 4IO2A 4AQ4A 1OMPA 3H06B 1FJ6A 3UGWA 3DRGA 2X7QA 3I3VA 3SDFA 2HZKA 3MC2A 4NTLA 4GWYA 4OEVA 3VLUA 4F39A 4OFOA 3B6WA 4X48A 3U65A 2I4CA 3T9XB 5AA2B 4G68C 5CRYA 2VD3A 4ZDMA 4JBZA 3OELA 3RYBA 5DEXB 3FZVA 3MP8A 3H03A 1IEJA 2VP1A 1FBCA 1M5CA 4NF5B 2X7PA 3FASA 3LV0A 4H0WA 1H45A 3EQ1A 1MPBA 3Q27A 4QF9A 1OQHA 1LBWA 4JSDA 4JWYA 4K3FA 4P1EA 3GZGA 1DPPA 4GWXA 2CZHA 3TCHA 1J1NA 5ET7A 3D1RA 4OVSA 2FHYA 4F19A 4C0RA 4GWWA 1ZU0A 3ZSFA 3O9PA 1G0HA 1JEVA 1Q9DA 1A7LA 2H4IA 5TPAA 4XFEA 1MQDA 3QAXA 1DOTA 3FXUA 1LBBA 1R9QA 2O6AA 2QS1A 4LQ5A 2ZNTA 5EHSA 3PGFA 4R9GA 4LN5A 4KQPA 1GVCA 4KFQA 4MNPA 3K00A 5EQ7A 3KSJA 4ELPA 3RT8A 4AS5A 4R6KA 4UA8A 4OXVA 3MP1A 1DMBA 2QVUA 3KN3A 1N84A 3N6TA 2AL5A 4PBQA 4OA4A 4R6HA 4R2FA 5DW8A 4Z7EA 4MF3A 2GH9A 4N8YA 2WKYA 3HSTA 1SW5A 4OTEA 5ET5A 3U8QA 3O6GA 1XOCA 1UIUA 1FPFA 2F34A 4YKPA 3RPLA 4GRKA 2ZYKA 4P0IA 3PD9A 4KI0E 5FHOA 1JEUA 3FGSA 1NH8A 3MVYA 4YKIA 5H8FB 2OLBA 3RLFE 2VD2A 3IOVA 4G8NA 4RK9A 3I6VA 5I57A 1SYHA 5EYHA 5DTBA 2NWJA 1N0TA 1R6ZA 1JP4A 4R6YA 3S9EA 3H3GA 4ESXA 2P0SA 3LSXA 3BKIB 3G3JA 3MW0A 1ZKBA 1A54A 3MYUA 4ECFA 1FBHA 3KJ7A 3S2VA 3VVEA 1VDWA 3K02A 2OK2A 1B1HA 4C1TA 2UXAA 4G4PA 1SBPA 1K9ZA 4H67A 3CFLA 1NV5A 4PE3A 4QBAA 1AOVA 3FV1A 1NV1A 3TYHA 2I0CA 1SYIA 1FQCA 1DTGA 1PBPA 2F7CA 2ALUA 1URGA 4EDPA 4LZ5A 2VHAA 3VVFA 4M1VA 3TTLA 3QIMA 4QFNA 4F1VA 4X1BA 4NAPA 1LB8A 3ZKKA 2GHAA 3K4UA 2QS4A 2Y5LA 1WODA 1DCUA 1FSAA 4IO4A 1MDP1 4TLLB 4P0GA 4JWOA 4DDDA 2ONKE 2RCAA 2OBGA 1IMBA 5TU0A 4PDDA 4EQ7A 4QRZA 1BKAA 3THIA 4ZEIA 3C35A 5H8NA 3IOTA 4ZE8A 5I2KA 4G68B 3PUVE 1OVTA 4U21A 1MY4A 1POY1 3PPRA 4HE0A 2REGA 4GFRA 4F3SA 2THIA 1JNFA 4ELRA 4OFJA 4ELOA 3VLWA 2QMXA 4LP2B 4QSEA 1S50A 4H1XA 3JV9A 2Y7RA 1R9LA 4U4SA 4JDFA 1NUXA 1XVYA 2XX7A 3TQWA 4OVQA 2OWZA 1M5EA 4OESA 4KXPA 2XXYA 3SEUA 4IY5A 3TTNA 3FJMA 5T3JA 3ILUB 3B50A 1PBQA 1MXYA 5EYGA 4OFLA 3TCFA 3ZS6A 5I57B 1AWBA 4LZ8A 5DT6A 5AA4B 1R1NA 4JVIA 3K6WA 4U23A 4PFUA 2Y5KA 1MRPA 2NXOA 1DSNA 3ISPA 3CI8A 3O6PA 1ANFA 2HHMA 5AA3A 3VXBA 4BDOA 1ZBMA 4QFOA 1RYXA 2ZZXA 1ELJA 1KWHA 4OENA 5L9MA 1SI0A 1SI1A 1NH7A 4JWXA 3TPAA 1D9YA 3R6UA 2Q8JA 3QYTA 4OETA 1NNFA 4ZZEA 1MXVA 2R71A 4DZ1A 3Q25A 1Y9UA 1B32A 1HSLA 2XXPA 4LUBA 5JEIA 3IFAA 4RA1A 1SW1A 3PUXE 4GX6A 4PP0A 2JJKA 2F6PA 5I58A 2YJPA 1FJ9A 1US5A 2OWTA 1LEVA 2WOLA 3U94A 1M5DA 4GD5A 3IJXB 1GR2A 2Y7IA 4QHQA 2I3WA 2Q2CA 2H25A 3N26A 4JVCA 5A5XA 3OSQA 4KPTA 1B7HA 3DRKA 5J16A 1N3XA 2V4CA 2XXUA 5FBPA 1FTOA 1BK4A 4OANA 2V93A 2I3VA 1B52A 4YMAA 2V3UA 4FEDA 4HXVA 4MMPA 3KN7A 3F11A 1P1NA 1QW0A 5H8NB 4IO7A 2F36A 1A99A 1QUIA 3IO4A 1B5JA 1IMCA 3RTFB 4F1UA 2FIEA 4XKRA 5L9SA 3KC1A 3SERA 2XX9A 2HZLA 4YKKA 2RKMA 4M4GA 4NF5A 1QJMA 4N6KA 1SD3A 3KZGA 2B4MA 4YZZA 3EHTA 1VFEA 3PMXA 1LLSA 2QPQA 5IGAA 1UQWA 1LCTA 3I5OA 2YPNA 2B65A 3GBAA 3ROJA 2P1SA 4OVJA 1IMAA 4GWOA 4X1DA 5EYFA 2XWOA 1N04A 3BIHA 4DLDA 4PFYA 2Q2AA 1N3WA 3MJNA 4POXA 3IO6A 2GFEA 3ODBA 4GL0A 1EZOA 1EZ9A 2F78A 5H8SA 4H5GA 1FQDA 4FIMA 4N8GA 4OWDA 4ZZAA 3JYRA 4NMYA 1D4NA 4NGUA 4PTKA 3QUJA 3MPKA 1IMEA 3QXMA 2BJIA 3T0JA 4E0XA 1Y1MA 4PCDA 2KR0A 4PE5B 3IFCA 4X04A 3FVOA 3Q28A 1CE2A 5H8HB 4JXIA 2CZLA 1A40A 4P3LA 2KQZA 1P1UA 4I8CA 3TZAA 3TKDA 3V8XB 2DXRA 3O97A 2VPOA 1XVXA 1IXIA 1MY0A 3KJTA 3K01A 1KA1A 2HAVA 4AB6A 2XA5A 2ABHA 3MZ1A 2Y7KA 3R26A 5H8FA
chains in the Genus database with same CATH topology
3BFTA 3HO7A 1B7UA 1P1WA 2UVJA 4I1DA 5A5XB 2H5YA 2OWSA 4HCWA 1TXFA 1Q35A 4G77A 1N76A 1O64A 3CSGA 3OO6A 3C9HA 4FAJA 5H8QB 1B1XA 2F97A 1JETA 1I6AA 1SQYA 4BLAA 3EF7A 4EQ9A 1LFHA 3EPEA 4HCYA 3SEXA 5BUUA 2G29A 3A09A 3CG1A 1USYH 4GOTA 1UTBB 1NNPA 4BDLA 3TQLA 3PPPA 3C33A 2PX1A 4H8IA 3OXNA 1QUKA 2PYYA 1TFAA 4DCXA 1SW4A 5IAIA 1AIVA 3S4UA 3MZBA 1LAXA 5DVJA 1QULA 3SEYA 1IXGA 5F7VA 1B4ZA 4G8MA 1MXXA 4R72A 3O66A 5DYHA 1AH5A 1DTZA 1LSTA 3TCGA 2F7BA 1MM7A 1Y1ZA 4KD5A 1D3KA 3KG2A 3TTKA 3PPOA 4BDQA 3H7MA 3KOSA 2F5XA 2DE4A 1MH4A 1IXHA 4O3CA 3RPWA 4PETA 3M3KA 4U1OA 4QSCA 1POTA 3OOAA 3IOWA 3O6IA 4JB7A 3SEWA 4G68A 2H98A 3E13X 3MVZA 4FORA 4KYDA 5FTIA 2O1LA 5KDTA 5CBRA 3KBRA 1UIVA 4WXJA 3IB1A 5L9OA 2XXHA 5K2YA 4GQOA 5JTYB 2F6GA 3U1OA 4U4XA 3CRBA 2RF1A 5M2VA 1SVXB 2Z8EA 3U93A 2I0BA 3H6UA 2DS9A 3Q26A 2PMSA 3CG3A 2R6GE 4ZECA 3E9XA 2D21A 1GV8A 3PMVA 1ATGA 4NE4A 5AA4A 2O51A 1DPEA 1B05A 2V3QA 4YB5A 4F2QA 4POWA 1I69A 2XXIA 4KYEA 4Z0IA 1MG1A 3PUZE 1JW1A 2ONRA 4ESWA 4XKPA 5K2XA 1B4HA 2CMOA 3HHGA 3W9VA 1B3FA 5ITOA 2HXWA 3RGYA 4IO5A 1LB9A 1GTKA 3K1NA 5EHMA 1P1QA 4XKNA 1UTHA 4MLQA 4F2OA 5ICQA 4YKJA 3DRHA 1EU8A 3N6UA 4GXAA 1URDA 3A3CA 3USDA 4DXCA 3HPIA 2F7AA 3N94A 1A8FA 5CMCA 4MH5A 3DP4A 3EHUA 4NEDA 2FNCA 4PFWA 1NFTA 2ESNA 2PT1A 4P11A 3H4ZA 3L6GA 3FUZA 4RPOA 1MQIA 4LZ7A 4R2BA 5TP9B 4HW8A 2LAOA 1FTKA 3RN8A 3SEVA 1QKBA 4FECA 3PPNA 3K2DA 1SDXA 3SESA 1O7TA 3TTRA 5KDTB 3CIJA 1N7XA 3SKPA 4RNSA 3ECRA 4GL8A 4U1ZA 2XXVA 4X9TA 4IB2A 1GGGA 1LAGE 1YTVA 2XXQA 4BDMA 4FE8A 3G7WA 2DP8A 2Q9TA 5CI5A 3CHGA 1CB6A 3FVKA 3VXCA 2Z23A 2DQVA 3G3IA 2O7IA 3TODA 4EF1A 3KN8A 4G2ZA 4JSOA 3E3KA 5KZTA 1I6BA 4H5FA 2XD3A 2XXXA 1JVXA 3M8UA 2RC9A 3FD3A 2D5WA 5KCJB 5ELVA 3W15C 4ISUA 4KR5A 3WAFA 4WEPA 2ONSA 4BDNA 2A5SA 2DOJA 4MBPA 2OZZA 2PBWA 3M3LA 2I4BA 1Y3QA 2QSXA 2YLNA 1MM6A 1FTLA 3LR1A 3TELA 3UA8A 3DP6A 1UTHB 5H8HA 5ISUA 1B7ZA 4I62A 3H6TA 1Q1KA 1AMFA 1XS5A 3K1MA 4EXLA 5CMKA 1Y3PA 2VGQA 5HM4B 3TDJA 3E4RA 1F9BA 5I56A 1H3DA 3QSLA 3AXFA 1OQGA 5I84A 1TWYA 3L6HA 5J1DA 1O63A 3IOUA 1QVSA 3BBRA 5FHNA 1A55A 1HSJA 4GF8A 2HEUA 4OERA 4KCCA 2O7UA 1N7WA 1VSOA 3QK6A 1LFGA 5H8QA 1LCFA 2A5TA 3VE1B 2H99A 4DE8A 2NVUB 3EN3A 5I59B 1OLCA 4GLIA 4OYVA 3FVGA 1UTBA 1NL5A 1BP5A 3GXAA 3T9HB 1JW5A 3MWBA 1LAHE 4KYSA 2QL3A 3JZJA 3C31A 4EUOA 4O3BA 3V5AA 3IB0A 1MQJA 3OO7A 3FVNA 3TMGA 1P99A 4Q0CA 1WVJA 1FTJA 1B3LA 4QFLA 2DSFA 4C1UA 4ZEDA 1NKXA 2FA7A 3V83A 1OIBA 1ZJLA 1MH3A 4EXKA 4I9DA 1Z7ME 2DYXA 2XD2A 3S9MC 4IO6A 1S9TA 2Q89A 3KSXA 1AL3A 4IY6A 3LSLA 4H8JA 1MDQA 4LA9A 3PMWA 3FATA 3CVGA 4F1YA 1RYOA 3PD8A 5AA2D 5DVFA 5L8DA 4RPNA 5F1QA 4RK2A 2ZYNA 5CMMA 3FXRA 1MS7A 3FV2A 1H76A 3T9UA 3MPLA 5FTHA 3PPQA 3FJGA 3OMBA 3HHFA 3ILTB 4LVQA 2ZNSA 3K6VA 2RC8A 3O2AA 1US4A 1EZPA 1LGBC 3UORA 2O1MA 1OVBA 3IB2A 3O28A 5HBCA 5JTYA 5IKBA 4FJPA 3IK6B 5I56B 2I6EA 2XX8A 3FJ7A 3MVXA 4N13A 1IITA 1MY2A 3UK4A 1FTMA 3K6UA 1TT1A 5CBSA 2O68A 4E0WA 4U2RA 3LUYA 1QUJA 3LC8A 4NWCA 2A5TB 1TFDA 3CSBA 2M8CA 1YCJA 4ZEBA 1EH3A 1B2HA 2XXWA 1B51A 3RTWB 3MVWA 4NF4B 2DVZA 2FYIA 4BDRA 2AYSA 2D3IA 2Y7PA 4YICA 1IXCA 4OHNA 4RXLA 1D9VA 3MQ9A 4IGRA 1P1OA 1LAFE 2Z22A 3CFZA 4NF8B 1PB9A 4OEUA 2UVHA 4HS7A 3A3UA 1IQ7A 4HTGA 3LBSA 3T93B 1BLFA 1ZMGA 1B6HA 2IA4A 2KLFA 3ONMA 4F22A 1A8EA 3CR9A 5TP9A 2DWJA 1JW4A 5DVIA 2HQ0A 3OO8A 3IL1B 4TOZA 2UYEA 2Z8FA 1B3GA 1ZIUA 2O69A 4DXUA 2Z8DA 4LATA 3RNNA 4RYAA 4QFPA 5I2NB 4EQBA 4OMBA 2RINA 3T66A 5CMBA 5ICTA 2OJTA 4LQ2A 2ZYMA 2WOPA 1QKAA 4YU0A 2R9JA 4O3AA 1VE4A 3U92A 1WDNA 1MQHA 2V25A 2E1SA 2HFBA 4GXSB 2ZXTA 3PUYE 4F18A 4YMBA 2DVCA 3OD7A 2BJJX 3G3FA 3VVDA 2HCAA 3C32A 4Q5TA 1IIWA 1MXWA 3LSWA 4RY1A 3DLNA 1IZ1A 3VDFA 3ZKLA 1MPDA 1MQGA 4NWDA 2WOKA 2AIXA 3K0VA 5KCJA 3B6QA 2B3FA 4F3PA 3MBPA 1NNKA 4XIGQ 1RKMA 5CC2A 3HCQA 3K6XA 1B5IA 3K1PA 3KFMA 2QS2A 2RCBA 1II5A 4TQUQ 3SETA 4THIA 1MY3A 4H65A 2GRVA 2Y84A 3DP8A 2V3TA 1NNTA 2GHBA 2F8DA 1M5FA 3UP9A 3IORA 2UVIA 1LBCA 2V84A 3KGCA 3DELB 3D4GA 5LOMA 2I48A 4ND9A 2I49A 3FTOA 4ZEFA 1MPCA 3RT6B 1XHYA 3C34A 3EHSA 2ANJA 2W7YA 4YB6A 4ZS9A 3WAEA 5TPAB 1OLAA 2PT2A 5JK4A 1PC3A 2DWAA 3OEKA 3IX1A 5I59A 3PUWE 1B58A 4ONYA 2B3BA 3DRJA 3OO9A 4GVOA 5CM6A 3C36A 5AA1A 2NUVA 2ZNUA 3H6WA 5FHMA 3O6HA 1YPNA 3D4CA 4KCDA 3U72A 3UN6A 2UVGA 4UACA 4NF6A 1FQAA 3HN0A 1FQEA 3KEIA 1FW0A 4TLMB 3N5LA 4ELQA 3T9VA 4MLVA 1JVYA 1MY1A 1LFIA 4Q30B 4YB7A 2XXTA 2DE2A 2IEEA 3QUFA 2I58A 1USYE 3RYAA 3TTMA 4PFTA 1I6QA 2X26A 3M3FA 3KOTA 1B5HA 1L5TA 2OCUA 1FQFA 3OEMA 4GIZA 2HAUA 3TFLA 3B6TA 4F3BA 4OZ9A 4XTCQ 1B46A 4R73A 2F35A 5B70A 1BIYA 1URSA 3T22A 3UIFA 3OENA 4Q8RA 4AB5A 1T0KA 2ZMBA 4WEDA 2UYFA 3G3KA 3V89B 3OSRA 3O29A 1PB8A 3R7XA 2REJA 1Y20A 3DM0A 5HPQA 1ZLQA 4L17A 3VV5A 1HSEA 3S9LC 4QSDA 3LSFB 1BTJA 3RY3A 4OQOA 2G93A 1Y4CA 3FIRA 4XXUA 1Y3NA 3TAJA 3W9WA 4N07A 4RJZA 4F3GA 1XC1A 1M5BA 3IAZA 3TEPA 3PV0E 1Y4TA 4KHZE 2DE3A 1MXZA 1S7YA 3S9NC 4NF4A 5AA2A 3GBBA 4DIGA 1PB7A 2Y7WA 5I2KB 2DWIA 2QMWA 5DEXA 4R75A 5BWJA 2XHDA 2XXRA 1PEBA 3T96B 3FXQA 4NF8A 4N6PA 4NF6B 4R9FA 3B7DA 3MAMA 2P2AA 4IGTA 3CFXA 1ZTYA 3P7IA 2Q88A 2ZYOA 4ZEKA 2DXYA 1B3EA 4EF2A 3MP6A 1IUDA 1NMUA 2O84X 3MZ9A 3C4MA 1B3HA 5B7DA 1SW2A 3Q29A 3DRIA 5AE4A 2PVUA 2QRYA 3RUMA 3GLBA 4ZE9A 4DXBA 4QFKA 2RC7A 3G3HA 3PU5A 3VFJA 4FEBA 3BFUA 3RQTA 2QS3A 4R74A 2H9BA 3HV1A 2DWHA 4PQJA 1FCKA 4F31B 3IJOB 3PAMA 1PDAA 5I2NA 1B0LA 3G3GA 4U22A 1B9JA 3MUQA 4LONB 3DRFA 1XT8A 1FQBA 1JQFA 3H6VA 3IR1A 2AL4A 3VLVA 1MXUA 5ITPA 2B4LA 4WKMA 3TUSA 4H6DA 4DCYA 2E0SA 1B0HA 4XKQA 4G8HA 2NOOA 1Z7NE 5I58B 2VOZA 1VR5A 1B40A 2QJEA 1VFDA 1H44A 4F29A 1H43A 3LVUA 4MFIA 4IO3A 4YAHX 4FATA 1YAEA 4IO2A 4AQ4A 1OMPA 3H06B 3UGWA 3DRGA 2X7QA 3I3VA 3SDFA 2HZKA 3MC2A 4NTLA 3VLUA 4OEVA 4F39A 4OFOA 3B6WA 4X48A 2I4CA 3T9XB 5AA2B 4G68C 5CRYA 2VD3A 4ZDMA 4JBZA 3OELA 3RYBA 5DEXB 3FZVA 3MP8A 3H03A 1IEJA 2VP1A 1M5CA 4NF5B 2X7PA 3FASA 4H0WA 1H45A 3EQ1A 1MPBA 3Q27A 4QF9A 1OQHA 4JSDA 4JWYA 4K3FA 3GZGA 1DPPA 3TCHA 1J1NA 4F19A 4C0RA 1ZU0A 3ZSFA 3O9PA 1JEVA 1A7LA 2H4IA 5TPAA 1MQDA 3QAXA 1DOTA 3FXUA 1LBBA 1R9QA 2O6AA 2QS1A 4LQ5A 2ZNTA 5EHSA 3PGFA 4R9GA 1GVCA 4KQPA 4KFQA 3K00A 4ELPA 3KSJA 3RT8A 4R6KA 4UA8A 4OXVA 3MP1A 1DMBA 3KN3A 1N84A 3N6TA 2AL5A 4R6HA 4R2FA 4Z7EA 4MF3A 2GH9A 2WKYA 3HSTA 1SW5A 4OTEA 3U8QA 3O6GA 1XOCA 1UIUA 2F34A 4YKPA 4GRKA 2ZYKA 4P0IA 3PD9A 4KI0E 5FHOA 1JEUA 3FGSA 1NH8A 3MVYA 4YKIA 5H8FB 2OLBA 3RLFE 2VD2A 3IOVA 4G8NA 4RK9A 3I6VA 5I57A 1SYHA 5DTBA 2NWJA 1N0TA 1R6ZA 4R6YA 3S9EA 3H3GA 4ESXA 2P0SA 3LSXA 3BKIB 3G3JA 3MW0A 1ZKBA 1A54A 4ECFA 3KJ7A 3S2VA 3VVEA 3K02A 2OK2A 1B1HA 4C1TA 2UXAA 4G4PA 1SBPA 4H67A 3CFLA 1AOVA 3FV1A 3TYHA 2I0CA 1SYIA 1FQCA 1DTGA 1PBPA 2F7CA 2ALUA 1URGA 4EDPA 4LZ5A 2VHAA 3VVFA 4M1VA 3TTLA 3QIMA 4QFNA 4F1VA 4X1BA 1LB8A 3ZKKA 2GHAA 3K4UA 2QS4A 1WODA 4IO4A 1MDP1 4TLLB 4P0GA 4JWOA 4DDDA 2ONKE 2RCAA 2OBGA 5TU0A 4EQ7A 4QRZA 1BKAA 3THIA 4ZEIA 3C35A 5H8NA 3IOTA 4ZE8A 5I2KA 4G68B 3PUVE 1OVTA 4U21A 1MY4A 1POY1 3PPRA 2REGA 4GFRA 4F3SA 2THIA 1JNFA 4ELRA 4OFJA 4ELOA 3VLWA 2QMXA 4LP2B 4QSEA 1S50A 4H1XA 3JV9A 2Y7RA 1R9LA 4U4SA 4JDFA 1XVYA 2XX7A 3TQWA 1M5EA 4OESA 2XXYA 3SEUA 4IY5A 3TTNA 3FJMA 3ILUB 1PBQA 1MXYA 4OFLA 3TCFA 3ZS6A 5I57B 5DT6A 4LZ8A 5AA4B 1R1NA 3K6WA 4U23A 4PFUA 1MRPA 2NXOA 1DSNA 3CI8A 3O6PA 1ANFA 5AA3A 3VXBA 4BDOA 1ZBMA 4QFOA 1RYXA 1ELJA 1KWHA 4OENA 5L9MA 1SI0A 1SI1A 1NH7A 4JWXA 3TPAA 1D9YA 3R6UA 2Q8JA 3QYTA 4OETA 1NNFA 4ZZEA 1MXVA 2R71A 4DZ1A 3Q25A 1Y9UA 1B32A 1HSLA 2XXPA 4LUBA 5JEIA 4RA1A 1SW1A 3PUXE 4PP0A 2F6PA 5I58A 2YJPA 1US5A 2OWTA 2WOLA 3U94A 1M5DA 4GD5A 3IJXB 1GR2A 2Y7IA 4QHQA 2I3WA 2Q2CA 2H25A 3N26A 5A5XA 3OSQA 4KPTA 1B7HA 3DRKA 1N3XA 2XXUA 1FTOA 2V93A 2I3VA 1B52A 4YMAA 2V3UA 4FEDA 3KN7A 3F11A 1P1NA 1QW0A 5H8NB 4IO7A 2F36A 1A99A 1QUIA 3IO4A 1B5JA 3RTFB 4F1UA 4XKRA 5L9SA 3SERA 2XX9A 2HZLA 4YKKA 2RKMA 4M4GA 4NF5A 1QJMA 1SD3A 3KZGA 2B4MA 4YZZA 3EHTA 1VFEA 3PMXA 1LLSA 2QPQA 1UQWA 1LCTA 3I5OA 2YPNA 2B65A 3GBAA 2P1SA 4OVJA 4GWOA 4X1DA 5EYFA 1N04A 4DLDA 4PFYA 2Q2AA 1N3WA 3MJNA 4POXA 3IO6A 2GFEA 3ODBA 4GL0A 1EZOA 1EZ9A 2F78A 5H8SA 4H5GA 1FQDA 4FIMA 4OWDA 4ZZAA 3JYRA 4NMYA 1D4NA 3QUJA 3MPKA 3QXMA 4E0XA 1Y1MA 4PE5B 3FVOA 3Q28A 1CE2A 5H8HB 4JXIA 2CZLA 1A40A 1P1UA 4I8CA 3TZAA 3TKDA 3V8XB 2DXRA 3O97A 1XVXA 1IXIA 1MY0A 3KJTA 3K01A 2HAVA 4AB6A 2ABHA 3MZ1A 2Y7KA 3R26A 5H8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFT A;  3HO7 A;  1B7U A;  1P1W A;  2UVJ A;  4I1D A;  5A5X B;  2H5Y A;  2OWS A;  4HCW A;  1TXF A;  1Q35 A;  4G77 A;  1N76 A;  1O64 A;  3CSG A;  3OO6 A;  3C9H A;  4FAJ A;  5H8Q B;  1B1X A;  2F97 A;  1JET A;  1I6A A;  1SQY A;  4BLA A;  3EF7 A;  4EQ9 A;  1LFH A;  3EPE A;  4HCY A;  3SEX A;  5BUU A;  2G29 A;  3A09 A;  3CG1 A;  1USY H;  4GOT A;  1UTB B;  1NNP A;  4BDL A;  3TQL A;  3PPP A;  3C33 A;  2PX1 A;  4H8I A;  3OXN A;  1QUK A;  2PYY A;  1TFA A;  4DCX A;  1SW4 A;  5IAI A;  1AIV A;  3S4U A;  3MZB A;  1LAX A;  5DVJ A;  1QUL A;  3SEY A;  1IXG A;  5F7V A;  1B4Z A;  4G8M A;  1MXX A;  4R72 A;  3O66 A;  5DYH A;  1AH5 A;  1DTZ A;  1LST A;  3TCG A;  2F7B A;  1MM7 A;  1Y1Z A;  4KD5 A;  1D3K A;  3KG2 A;  3TTK A;  3PPO A;  4BDQ A;  3H7M A;  3KOS A;  2F5X A;  2DE4 A;  1MH4 A;  1IXH A;  4O3C A;  3RPW A;  4PET A;  3M3K A;  4U1O A;  4QSC A;  1POT A;  3OOA A;  3IOW A;  3O6I A;  4JB7 A;  3SEW A;  4G68 A;  2H98 A;  3E13 X;  3MVZ A;  4FOR A;  4KYD A;  5FTI A;  2O1L A;  5KDT A;  5CBR A;  3KBR A;  1UIV A;  4WXJ A;  3IB1 A;  5L9O A;  2XXH A;  5K2Y A;  4GQO A;  5JTY B;  2F6G A;  3U1O A;  4U4X A;  3CRB A;  2RF1 A;  5M2V A;  1SVX B;  2Z8E A;  3U93 A;  2I0B A;  3H6U A;  2DS9 A;  3Q26 A;  2PMS A;  3CG3 A;  2R6G E;  4ZEC A;  3E9X A;  2D21 A;  1GV8 A;  3PMV A;  1ATG A;  4NE4 A;  5AA4 A;  2O51 A;  1DPE A;  1B05 A;  2V3Q A;  4YB5 A;  4F2Q A;  4POW A;  1I69 A;  2XXI A;  4KYE A;  4Z0I A;  1MG1 A;  3PUZ E;  1JW1 A;  2ONR A;  4ESW A;  4XKP A;  5K2X A;  1B4H A;  2CMO A;  3HHG A;  3W9V A;  1B3F A;  5ITO A;  2HXW A;  3RGY A;  4IO5 A;  1LB9 A;  1GTK A;  3K1N A;  5EHM A;  1P1Q A;  4XKN A;  1UTH A;  4MLQ A;  4F2O A;  5ICQ A;  4YKJ A;  3DRH A;  1EU8 A;  3N6U A;  4GXA A;  1URD A;  3A3C A;  3USD A;  4DXC A;  3HPI A;  2F7A A;  3N94 A;  1A8F A;  5CMC A;  4MH5 A;  3DP4 A;  3EHU A;  4NED A;  2FNC A;  4PFW A;  1NFT A;  2ESN A;  2PT1 A;  4P11 A;  3H4Z A;  3L6G A;  3FUZ A;  4RPO A;  1MQI A;  4LZ7 A;  4R2B A;  5TP9 B;  4HW8 A;  2LAO A;  1FTK A;  3RN8 A;  3SEV A;  1QKB A;  4FEC A;  3PPN A;  3K2D A;  1SDX A;  3SES A;  1O7T A;  3TTR A;  5KDT B;  3CIJ A;  1N7X A;  3SKP A;  4RNS A;  3ECR A;  4GL8 A;  4U1Z A;  2XXV A;  4X9T A;  4IB2 A;  1GGG A;  1LAG E;  1YTV A;  2XXQ A;  4BDM A;  4FE8 A;  3G7W A;  2DP8 A;  2Q9T A;  5CI5 A;  3CHG A;  1CB6 A;  3FVK A;  3VXC A;  2Z23 A;  2DQV A;  3G3I A;  2O7I A;  3TOD A;  4EF1 A;  3KN8 A;  4G2Z A;  4JSO A;  3E3K A;  5KZT A;  1I6B A;  4H5F A;  2XD3 A;  2XXX A;  1JVX A;  3M8U A;  2RC9 A;  3FD3 A;  2D5W A;  5KCJ B;  5ELV A;  3W15 C;  4ISU A;  4KR5 A;  3WAF A;  4WEP A;  2ONS A;  4BDN A;  2A5S A;  2DOJ A;  4MBP A;  2OZZ A;  2PBW A;  3M3L A;  2I4B A;  1Y3Q A;  2QSX A;  2YLN A;  1MM6 A;  1FTL A;  3LR1 A;  3TEL A;  3UA8 A;  3DP6 A;  1UTH B;  5H8H A;  5ISU A;  1B7Z A;  4I62 A;  3H6T A;  1Q1K A;  1AMF A;  1XS5 A;  3K1M A;  4EXL A;  5CMK A;  1Y3P A;  2VGQ A;  5HM4 B;  3TDJ A;  3E4R A;  1F9B A;  5I56 A;  1H3D A;  3QSL A;  3AXF A;  1OQG A;  5I84 A;  1TWY A;  3L6H A;  5J1D A;  1O63 A;  3IOU A;  1QVS A;  3BBR A;  5FHN A;  1A55 A;  1HSJ A;  4GF8 A;  2HEU A;  4OER A;  4KCC A;  2O7U A;  1N7W A;  1VSO A;  3QK6 A;  1LFG A;  5H8Q A;  1LCF A;  2A5T A;  3VE1 B;  2H99 A;  4DE8 A;  2NVU B;  3EN3 A;  5I59 B;  1OLC A;  4GLI A;  4OYV A;  3FVG A;  1UTB A;  1NL5 A;  1BP5 A;  3GXA A;  3T9H B;  1JW5 A;  3MWB A;  1LAH E;  4KYS A;  2QL3 A;  3JZJ A;  3C31 A;  4EUO A;  4O3B A;  3V5A A;  3IB0 A;  1MQJ A;  3OO7 A;  3FVN A;  3TMG A;  1P99 A;  4Q0C A;  1WVJ A;  1FTJ A;  1B3L A;  4QFL A;  2DSF A;  4C1U A;  4ZED A;  1NKX A;  2FA7 A;  3V83 A;  1OIB A;  1ZJL A;  1MH3 A;  4EXK A;  4I9D A;  1Z7M E;  2DYX A;  2XD2 A;  3S9M C;  4IO6 A;  1S9T A;  2Q89 A;  3KSX A;  1AL3 A;  4IY6 A;  3LSL A;  4H8J A;  1MDQ A;  4LA9 A;  3PMW A;  3FAT A;  3CVG A;  4F1Y A;  1RYO A;  3PD8 A;  5AA2 D;  5DVF A;  5L8D A;  4RPN A;  5F1Q A;  4RK2 A;  2ZYN A;  5CMM A;  3FXR A;  1MS7 A;  3FV2 A;  1H76 A;  3T9U A;  3MPL A;  5FTH A;  3PPQ A;  3FJG A;  3OMB A;  3HHF A;  3ILT B;  4LVQ A;  2ZNS A;  3K6V A;  2RC8 A;  3O2A A;  1US4 A;  1EZP A;  1LGB C;  3UOR A;  2O1M A;  1OVB A;  3IB2 A;  3O28 A;  5HBC A;  5JTY A;  5IKB A;  4FJP A;  3IK6 B;  5I56 B;  2I6E A;  2XX8 A;  3FJ7 A;  3MVX A;  4N13 A;  1IIT A;  1MY2 A;  3UK4 A;  1FTM A;  3K6U A;  1TT1 A;  5CBS A;  2O68 A;  4E0W A;  4U2R A;  3LUY A;  1QUJ A;  3LC8 A;  4NWC A;  2A5T B;  1TFD A;  3CSB A;  2M8C A;  1YCJ A;  4ZEB A;  1EH3 A;  1B2H A;  2XXW A;  1B51 A;  3RTW B;  3MVW A;  4NF4 B;  2DVZ A;  2FYI A;  4BDR A;  2AYS A;  2D3I A;  2Y7P A;  4YIC A;  1IXC A;  4OHN A;  4RXL A;  1D9V A;  3MQ9 A;  4IGR A;  1P1O A;  1LAF E;  2Z22 A;  3CFZ A;  4NF8 B;  1PB9 A;  4OEU A;  2UVH A;  4HS7 A;  3A3U A;  1IQ7 A;  4HTG A;  3LBS A;  3T93 B;  1BLF A;  1ZMG A;  1B6H A;  2IA4 A;  2KLF A;  3ONM A;  4F22 A;  1A8E A;  3CR9 A;  5TP9 A;  2DWJ A;  1JW4 A;  5DVI A;  2HQ0 A;  3OO8 A;  3IL1 B;  4TOZ A;  2UYE A;  2Z8F A;  1B3G A;  1ZIU A;  2O69 A;  4DXU A;  2Z8D A;  4LAT A;  3RNN A;  4RYA A;  4QFP A;  5I2N B;  4EQB A;  4OMB A;  2RIN A;  3T66 A;  5CMB A;  5ICT A;  2OJT A;  4LQ2 A;  2ZYM A;  2WOP A;  1QKA A;  4YU0 A;  2R9J A;  4O3A A;  1VE4 A;  3U92 A;  1WDN A;  1MQH A;  2V25 A;  2E1S A;  2HFB A;  4GXS B;  2ZXT A;  3PUY E;  4F18 A;  4YMB A;  2DVC A;  3OD7 A;  2BJJ X;  3G3F A;  3VVD A;  2HCA A;  3C32 A;  4Q5T A;  1IIW A;  1MXW A;  3LSW A;  4RY1 A;  3DLN A;  1IZ1 A;  3VDF A;  3ZKL A;  1MPD A;  1MQG A;  4NWD A;  2WOK A;  2AIX A;  3K0V A;  5KCJ A;  3B6Q A;  2B3F A;  4F3P A;  3MBP A;  1NNK A;  4XIG Q;  1RKM A;  5CC2 A;  3HCQ A;  3K6X A;  1B5I A;  3K1P A;  3KFM A;  2QS2 A;  2RCB A;  1II5 A;  4TQU Q;  3SET A;  4THI A;  1MY3 A;  4H65 A;  2GRV A;  2Y84 A;  3DP8 A;  2V3T A;  1NNT A;  2GHB A;  2F8D A;  1M5F A;  3UP9 A;  3IOR A;  2UVI A;  1LBC A;  2V84 A;  3KGC A;  3DEL B;  3D4G A;  5LOM A;  2I48 A;  4ND9 A;  2I49 A;  3FTO A;  4ZEF A;  1MPC A;  3RT6 B;  1XHY A;  3C34 A;  3EHS A;  2ANJ A;  2W7Y A;  4YB6 A;  4ZS9 A;  3WAE A;  5TPA B;  1OLA A;  2PT2 A;  5JK4 A;  1PC3 A;  2DWA A;  3OEK A;  3IX1 A;  5I59 A;  3PUW E;  1B58 A;  4ONY A;  2B3B A;  3DRJ A;  3OO9 A;  4GVO A;  5CM6 A;  3C36 A;  5AA1 A;  2NUV A;  2ZNU A;  3H6W A;  5FHM A;  3O6H A;  1YPN A;  3D4C A;  4KCD A;  3U72 A;  3UN6 A;  2UVG A;  4UAC A;  4NF6 A;  1FQA A;  3HN0 A;  1FQE A;  3KEI A;  1FW0 A;  4TLM B;  3N5L A;  4ELQ A;  3T9V A;  4MLV A;  1JVY A;  1MY1 A;  1LFI A;  4Q30 B;  4YB7 A;  2XXT A;  2DE2 A;  2IEE A;  3QUF A;  2I58 A;  1USY E;  3RYA A;  3TTM A;  4PFT A;  1I6Q A;  2X26 A;  3M3F A;  3KOT A;  1B5H A;  1L5T A;  2OCU A;  1FQF A;  3OEM A;  4GIZ A;  2HAU A;  3TFL A;  3B6T A;  4F3B A;  4OZ9 A;  4XTC Q;  1B46 A;  4R73 A;  2F35 A;  5B70 A;  1BIY A;  1URS A;  3T22 A;  3UIF A;  3OEN A;  4Q8R A;  4AB5 A;  1T0K A;  2ZMB A;  4WED A;  2UYF A;  3G3K A;  3V89 B;  3OSR A;  3O29 A;  1PB8 A;  3R7X A;  2REJ A;  1Y20 A;  3DM0 A;  5HPQ A;  1ZLQ A;  4L17 A;  3VV5 A;  1HSE A;  3S9L C;  4QSD A;  3LSF B;  1BTJ A;  3RY3 A;  4OQO A;  2G93 A;  1Y4C A;  3FIR A;  4XXU A;  1Y3N A;  3TAJ A;  3W9W A;  4N07 A;  4RJZ A;  4F3G A;  1XC1 A;  1M5B A;  3IAZ A;  3TEP A;  3PV0 E;  1Y4T A;  4KHZ E;  2DE3 A;  1MXZ A;  1S7Y A;  3S9N C;  4NF4 A;  5AA2 A;  3GBB A;  4DIG A;  1PB7 A;  2Y7W A;  5I2K B;  2DWI A;  2QMW A;  5DEX A;  4R75 A;  5BWJ A;  2XHD A;  2XXR A;  1PEB A;  3T96 B;  3FXQ A;  4NF8 A;  4N6P A;  4NF6 B;  4R9F A;  3B7D A;  3MAM A;  2P2A A;  4IGT A;  3CFX A;  1ZTY A;  3P7I A;  2Q88 A;  2ZYO A;  4ZEK A;  2DXY A;  1B3E A;  4EF2 A;  3MP6 A;  1IUD A;  1NMU A;  2O84 X;  3MZ9 A;  3C4M A;  1B3H A;  5B7D A;  1SW2 A;  3Q29 A;  3DRI A;  5AE4 A;  2PVU A;  2QRY A;  3RUM A;  3GLB A;  4ZE9 A;  4DXB A;  4QFK A;  2RC7 A;  3G3H A;  3PU5 A;  3VFJ A;  4FEB A;  3BFU A;  3RQT A;  2QS3 A;  4R74 A;  2H9B A;  3HV1 A;  2DWH A;  4PQJ A;  1FCK A;  4F31 B;  3IJO B;  3PAM A;  1PDA A;  5I2N A;  1B0L A;  3G3G A;  4U22 A;  1B9J A;  3MUQ A;  4LON B;  3DRF A;  1XT8 A;  1FQB A;  1JQF A;  3H6V A;  3IR1 A;  2AL4 A;  3VLV A;  1MXU A;  5ITP A;  2B4L A;  4WKM A;  3TUS A;  4H6D A;  4DCY A;  2E0S A;  1B0H A;  4XKQ A;  4G8H A;  2NOO A;  1Z7N E;  5I58 B;  2VOZ A;  1VR5 A;  1B40 A;  2QJE A;  1VFD A;  1H44 A;  4F29 A;  1H43 A;  3LVU A;  4MFI A;  4IO3 A;  4YAH X;  4FAT A;  1YAE A;  4IO2 A;  4AQ4 A;  1OMP A;  3H06 B;  3UGW A;  3DRG A;  2X7Q A;  3I3V A;  3SDF A;  2HZK A;  3MC2 A;  4NTL A;  3VLU A;  4OEV A;  4F39 A;  4OFO A;  3B6W A;  4X48 A;  2I4C A;  3T9X B;  5AA2 B;  4G68 C;  5CRY A;  2VD3 A;  4ZDM A;  4JBZ A;  3OEL A;  3RYB A;  5DEX B;  3FZV A;  3MP8 A;  3H03 A;  1IEJ A;  2VP1 A;  1M5C A;  4NF5 B;  2X7P A;  3FAS A;  4H0W A;  1H45 A;  3EQ1 A;  1MPB A;  3Q27 A;  4QF9 A;  1OQH A;  4JSD A;  4JWY A;  4K3F A;  3GZG A;  1DPP A;  3TCH A;  1J1N A;  4F19 A;  4C0R A;  1ZU0 A;  3ZSF A;  3O9P A;  1JEV A;  1A7L A;  2H4I A;  5TPA A;  1MQD A;  3QAX A;  1DOT A;  3FXU A;  1LBB A;  1R9Q A;  2O6A A;  2QS1 A;  4LQ5 A;  2ZNT A;  5EHS A;  3PGF A;  4R9G A;  1GVC A;  4KQP A;  4KFQ A;  3K00 A;  4ELP A;  3KSJ A;  3RT8 A;  4R6K A;  4UA8 A;  4OXV A;  3MP1 A;  1DMB A;  3KN3 A;  1N84 A;  3N6T A;  2AL5 A;  4R6H A;  4R2F A;  4Z7E A;  4MF3 A;  2GH9 A;  2WKY A;  3HST A;  1SW5 A;  4OTE A;  3U8Q A;  3O6G A;  1XOC A;  1UIU A;  2F34 A;  4YKP A;  4GRK A;  2ZYK A;  4P0I A;  3PD9 A;  4KI0 E;  5FHO A;  1JEU A;  3FGS A;  1NH8 A;  3MVY A;  4YKI A;  5H8F B;  2OLB A;  3RLF E;  2VD2 A;  3IOV A;  4G8N A;  4RK9 A;  3I6V A;  5I57 A;  1SYH A;  5DTB A;  2NWJ A;  1N0T A;  1R6Z A;  4R6Y A;  3S9E A;  3H3G A;  4ESX A;  2P0S A;  3LSX A;  3BKI B;  3G3J A;  3MW0 A;  1ZKB A;  1A54 A;  4ECF A;  3KJ7 A;  3S2V A;  3VVE A;  3K02 A;  2OK2 A;  1B1H A;  4C1T A;  2UXA A;  4G4P A;  1SBP A;  4H67 A;  3CFL A;  1AOV A;  3FV1 A;  3TYH A;  2I0C A;  1SYI A;  1FQC A;  1DTG A;  1PBP A;  2F7C A;  2ALU A;  1URG A;  4EDP A;  4LZ5 A;  2VHA A;  3VVF A;  4M1V A;  3TTL A;  3QIM A;  4QFN A;  4F1V A;  4X1B A;  1LB8 A;  3ZKK A;  2GHA A;  3K4U A;  2QS4 A;  1WOD A;  4IO4 A;  1MDP 1;  4TLL B;  4P0G A;  4JWO A;  4DDD A;  2ONK E;  2RCA A;  2OBG A;  5TU0 A;  4EQ7 A;  4QRZ A;  1BKA A;  3THI A;  4ZEI A;  3C35 A;  5H8N A;  3IOT A;  4ZE8 A;  5I2K A;  4G68 B;  3PUV E;  1OVT A;  4U21 A;  1MY4 A;  1POY 1;  3PPR A;  2REG A;  4GFR A;  4F3S A;  2THI A;  1JNF A;  4ELR A;  4OFJ A;  4ELO A;  3VLW A;  2QMX A;  4LP2 B;  4QSE A;  1S50 A;  4H1X A;  3JV9 A;  2Y7R A;  1R9L A;  4U4S A;  4JDF A;  1XVY A;  2XX7 A;  3TQW A;  1M5E A;  4OES A;  2XXY A;  3SEU A;  4IY5 A;  3TTN A;  3FJM A;  3ILU B;  1PBQ A;  1MXY A;  4OFL A;  3TCF A;  3ZS6 A;  5I57 B;  5DT6 A;  4LZ8 A;  5AA4 B;  1R1N A;  3K6W A;  4U23 A;  4PFU A;  1MRP A;  2NXO A;  1DSN A;  3CI8 A;  3O6P A;  1ANF A;  5AA3 A;  3VXB A;  4BDO A;  1ZBM A;  4QFO A;  1RYX A;  1ELJ A;  1KWH A;  4OEN A;  5L9M A;  1SI0 A;  1SI1 A;  1NH7 A;  4JWX A;  3TPA A;  1D9Y A;  3R6U A;  2Q8J A;  3QYT A;  4OET A;  1NNF A;  4ZZE A;  1MXV A;  2R71 A;  4DZ1 A;  3Q25 A;  1Y9U A;  1B32 A;  1HSL A;  2XXP A;  4LUB A;  5JEI A;  4RA1 A;  1SW1 A;  3PUX E;  4PP0 A;  2F6P A;  5I58 A;  2YJP A;  1US5 A;  2OWT A;  2WOL A;  3U94 A;  1M5D A;  4GD5 A;  3IJX B;  1GR2 A;  2Y7I A;  4QHQ A;  2I3W A;  2Q2C A;  2H25 A;  3N26 A;  5A5X A;  3OSQ A;  4KPT A;  1B7H A;  3DRK A;  1N3X A;  2XXU A;  1FTO A;  2V93 A;  2I3V A;  1B52 A;  4YMA A;  2V3U A;  4FED A;  3KN7 A;  3F11 A;  1P1N A;  1QW0 A;  5H8N B;  4IO7 A;  2F36 A;  1A99 A;  1QUI A;  3IO4 A;  1B5J A;  3RTF B;  4F1U A;  4XKR A;  5L9S A;  3SER A;  2XX9 A;  2HZL A;  4YKK A;  2RKM A;  4M4G A;  4NF5 A;  1QJM A;  1SD3 A;  3KZG A;  2B4M A;  4YZZ A;  3EHT A;  1VFE A;  3PMX A;  1LLS A;  2QPQ A;  1UQW A;  1LCT A;  3I5O A;  2YPN A;  2B65 A;  3GBA A;  2P1S A;  4OVJ A;  4GWO A;  4X1D A;  5EYF A;  1N04 A;  4DLD A;  4PFY A;  2Q2A A;  1N3W A;  3MJN A;  4POX A;  3IO6 A;  2GFE A;  3ODB A;  4GL0 A;  1EZO A;  1EZ9 A;  2F78 A;  5H8S A;  4H5G A;  1FQD A;  4FIM A;  4OWD A;  4ZZA A;  3JYR A;  4NMY A;  1D4N A;  3QUJ A;  3MPK A;  3QXM A;  4E0X A;  1Y1M A;  4PE5 B;  3FVO A;  3Q28 A;  1CE2 A;  5H8H B;  4JXI A;  2CZL A;  1A40 A;  1P1U A;  4I8C A;  3TZA A;  3TKD A;  3V8X B;  2DXR A;  3O97 A;  1XVX A;  1IXI A;  1MY0 A;  3KJT A;  3K01 A;  2HAV A;  4AB6 A;  2ABH A;  3MZ1 A;  2Y7K A;  3R26 A;  5H8F A; 
#chains in the Genus database with same CATH topology
 3BFT A;  3HO7 A;  5I7I A;  1B7U A;  1P1W A;  2UVJ A;  4I1D A;  5A5X B;  2H5Y A;  2OWS A;  4HCW A;  1DK4 A;  1TXF A;  1LBX A;  1Q35 A;  4G77 A;  1N76 A;  1O64 A;  3CSG A;  3OO6 A;  3C9H A;  4FAJ A;  4I3E A;  2XWV A;  5H8Q B;  1B1X A;  2F97 A;  1JET A;  1I6A A;  1SQY A;  4BLA A;  3EF7 A;  4EQ9 A;  1LFH A;  3EPE A;  4HCY A;  3SEX A;  5BUU A;  2G29 A;  3A09 A;  3CG1 A;  1USY H;  4GOT A;  1UTB B;  3EKI A;  1NNP A;  1NV6 A;  4BDL A;  3TQL A;  2CEY A;  3T1B A;  3PPP A;  1IMD A;  4I3Y A;  3C33 A;  2PX1 A;  4H8I A;  3OXN A;  3FXB A;  1QUK A;  2PYY A;  1TFA A;  1FPK A;  4DCX A;  1SW4 A;  3FBP A;  5IAI A;  3B8B A;  1AIV A;  3S4U A;  3MZB A;  1LAX A;  5DVJ A;  1QUL A;  3SEY A;  1IXG A;  1LBY A;  5F7V A;  1B4Z A;  4G8M A;  4GX4 A;  1MXX A;  4R72 A;  3O66 A;  5DYH A;  1AH5 A;  1DTZ A;  1LST A;  3TCG A;  2F7B A;  1G0I A;  1MM7 A;  1Y1Z A;  4KD5 A;  1D3K A;  3KG2 A;  3TTK A;  2XWI A;  2WYP A;  1NI9 A;  3PPO A;  4BDQ A;  3H7M A;  3KOS A;  2F5X A;  2DE4 A;  1MH4 A;  1IXH A;  1RDX A;  4O3C A;  3RPW A;  4PET A;  3M3K A;  4U1O A;  4QSC A;  1POT A;  3OOA A;  3IOW A;  3O6I A;  4JB7 A;  3SEW A;  4G68 A;  2H98 A;  3E13 X;  3MVZ A;  4FOR A;  4KYD A;  5FTI A;  2O1L A;  5KDT A;  2P3V A;  5CBR A;  3KBR A;  1UIV A;  4WXJ A;  3IB1 A;  5L9O A;  2OX3 A;  2XXH A;  1INP A;  4PFR A;  5K2Y A;  5F24 A;  4GQO A;  5JTY B;  2F6G A;  3U1O A;  4U4X A;  3CRB A;  2RF1 A;  5M2V A;  1SVX B;  2Z8E A;  3U93 A;  2I0B A;  3H6U A;  2DS9 A;  3Q26 A;  2PMS A;  3CG3 A;  2L5V A;  2R6G E;  3QMF A;  4ZEC A;  3E9X A;  2D21 A;  2F3D A;  1GV8 A;  3PMV A;  1ATG A;  4NE4 A;  5AA4 A;  2O51 A;  1DPE A;  1B05 A;  2V3Q A;  4YB5 A;  4FBP A;  4F2Q A;  4I40 A;  4POW A;  1I69 A;  2XXI A;  4KYE A;  4Z0I A;  1MG1 A;  1YYZ A;  3BIG A;  3PUZ E;  2VPN A;  1JW1 A;  2ONR A;  4ESW A;  3KBZ A;  4XKP A;  5K2X A;  1B4H A;  2CMO A;  3HHG A;  3W9V A;  1B3F A;  5ITO A;  2HXW A;  3A29 A;  3RGY A;  4IO5 A;  1LB9 A;  1GTK A;  3K1N A;  5EHM A;  4N17 A;  1P1Q A;  4XKN A;  1UTH A;  4MLQ A;  4F2O A;  5ICQ A;  4YKJ A;  3DRH A;  1EU8 A;  4P1L A;  3N6U A;  4GXA A;  1URD A;  3A3C A;  3USD A;  1SPI A;  4DXC A;  3HPI A;  2F7A A;  3N94 A;  1A8F A;  2XWK A;  5CMC A;  4MH5 A;  2QFL A;  3DP4 A;  2WBB A;  2DDK A;  3EHU A;  4NED A;  4MAG A;  2FNC A;  4PFW A;  1NFT A;  2ESN A;  4P56 A;  2PT1 A;  4P11 A;  3H4Z A;  2Q8M A;  3L6G A;  3FUZ A;  4RPO A;  4PAK A;  1MQI A;  3E79 A;  4LZ7 A;  4R2B A;  5TP9 B;  4HW8 A;  4MIJ A;  2LAO A;  1FTK A;  3RN8 A;  3SEV A;  1QKB A;  2WEF A;  2FVZ A;  4FEC A;  3PPN A;  3K2D A;  1SDX A;  3SES A;  1O7T A;  3TTR A;  5KDT B;  1YXI A;  1N7X A;  3CIJ A;  3SKP A;  4PFI A;  5EQ9 A;  4RNS A;  3ECR A;  4PDH A;  4GL8 A;  4U1Z A;  2XXV A;  4X9T A;  4IB2 A;  1GGG A;  1LAG E;  1YTV A;  4O7I A;  2XXQ A;  4BDM A;  4FE8 A;  3G7W A;  2DP8 A;  2Q9T A;  5CI5 A;  3CHG A;  1CB6 A;  3FVK A;  3VXC A;  1XI6 A;  4N91 A;  4NX1 A;  2Z23 A;  2DQV A;  3G3I A;  4PBH A;  2O7I A;  3TOD A;  4EF1 A;  3KN8 A;  4G2Z A;  4JSO A;  4G61 A;  3E3K A;  5KZT A;  1I6B A;  4H5F A;  2XD3 A;  2XXX A;  1JVX A;  3M8U A;  2RC9 A;  3FD3 A;  2D5W A;  5KCJ B;  5ELV A;  2HPG A;  3W15 C;  4ISU A;  4KR5 A;  3WAF A;  4WEP A;  2ONS A;  4BDN A;  2A5S A;  2DOJ A;  4MBP A;  2OZZ A;  2PBW A;  3M3L A;  5IZ3 A;  2I4B A;  1Y3Q A;  1K9Y A;  2QSX A;  2YLN A;  1MM6 A;  1FTL A;  3LR1 A;  3TEL A;  3UA8 A;  3DP6 A;  1UTH B;  1RDY A;  5H8H A;  5ISU A;  1B7Z A;  4I62 A;  3H6T A;  1Q1K A;  1AMF A;  1XS5 A;  3K1M A;  4NHB A;  4EXL A;  5CMK A;  1Y3P A;  2VGQ A;  5HM4 B;  3TDJ A;  3E4R A;  4GX3 A;  1EYK A;  1F9B A;  5I56 A;  1H3D A;  3QSL A;  3AXF A;  1OQG A;  5I84 A;  1TWY A;  3L6H A;  5J1D A;  1O63 A;  3IOU A;  1QVS A;  3BBR A;  5FHN A;  1A55 A;  1HSJ A;  4GF8 A;  2HEU A;  4OER A;  4KCC A;  1IMF A;  2O7U A;  1N7W A;  1VSO A;  1FPI A;  2VT5 A;  2HXR A;  3QK6 A;  1LFG A;  5H8Q A;  1FPD A;  1LCF A;  2A5T A;  3VE1 B;  2H99 A;  4DE8 A;  2NVU B;  3EN3 A;  4QXD A;  5I59 B;  1OLC A;  4GLI A;  4OYV A;  3FVG A;  1UTB A;  1NL5 A;  1BP5 A;  3GXA A;  3T9H B;  1CNQ A;  1NUY A;  1JW5 A;  3MWB A;  1LAH E;  2XXK A;  4KYS A;  2QL3 A;  2WYK A;  3JZJ A;  3C31 A;  1NV2 A;  4EUO A;  4O3B A;  3V5A A;  3SZP A;  1LBV A;  3IB0 A;  1QGX A;  4PAI A;  1MQJ A;  3OO7 A;  3FVN A;  3TMG A;  1P99 A;  4Q0C A;  1WVJ A;  1FTJ A;  1B3L A;  4QFL A;  2DSF A;  4C1U A;  4ZED A;  1NKX A;  2FA7 A;  3V83 A;  1OIB A;  4H46 A;  1ZJL A;  1MH3 A;  4EXK A;  4I9D A;  1Z7M E;  5EQ8 A;  2DYX A;  3LUZ A;  2XD2 A;  2ZZV A;  3S9M C;  4IO6 A;  1S9T A;  2Q89 A;  3KSX A;  1AL3 A;  4IY6 A;  3LSL A;  4H8J A;  1MDQ A;  4LA9 A;  3PMW A;  3FAT A;  3CVG A;  4F1Y A;  2MKZ A;  1RYO A;  3PD8 A;  1NUW A;  4MNC A;  2PCR A;  5DVF A;  5AA2 D;  5L8D A;  4RPN A;  5F1Q A;  4RK2 A;  5IZ3 B;  2ZYN A;  5CMM A;  3FXR A;  1MS7 A;  3FV2 A;  1H76 A;  3T9U A;  3MPL A;  5FTH A;  3PPQ A;  3FJG A;  3OMB A;  3HHF A;  3ILT B;  4LVQ A;  2ZNS A;  3K6V A;  2RC8 A;  3KC0 A;  3O2A A;  1US4 A;  1NV3 A;  1EZP A;  1LGB C;  3UOR A;  2O1M A;  1OVB A;  3IB2 A;  3O28 A;  5HBC A;  5JTY A;  5IKB A;  4GWS A;  4FJP A;  3IK6 B;  5I56 B;  2I6E A;  4PF8 A;  4MNI A;  2XX8 A;  3FJ7 A;  3MVX A;  4N13 A;  1IIT A;  1MY2 A;  3UK4 A;  1FTM A;  3K6U A;  1TT1 A;  5CBS A;  1YZ0 A;  2Q74 A;  2O68 A;  4E0W A;  4U2R A;  3LUY A;  1QUJ A;  3LC8 A;  4NWC A;  2A5T B;  1TFD A;  3CSB A;  2M8C A;  1YCJ A;  4ZEB A;  1EH3 A;  1B2H A;  2XXW A;  1B51 A;  1EYI A;  3RTW B;  3MVW A;  4NF4 B;  2DVZ A;  2FYI A;  4BDR A;  2AYS A;  2D3I A;  2GQ1 A;  2Y7P A;  4YIC A;  1IXC A;  4OHN A;  4RXL A;  1D9V A;  3MQ9 A;  4IGR A;  1P1O A;  1LAF E;  2Z22 A;  3CFZ A;  4NF8 B;  1PB9 A;  4OEU A;  2UVH A;  2WX9 A;  4HS7 A;  1KA0 A;  3A3U A;  1NUZ A;  4GWU A;  4NG7 A;  1IQ7 A;  4HTG A;  3LBS A;  4PAF A;  3T93 B;  1BLF A;  1ZMG A;  1B6H A;  5IZZ A;  2IA4 A;  2CZK A;  4O7M A;  2KLF A;  4NQ8 A;  3ONM A;  4F22 A;  1A8E A;  4PGP A;  3CR9 A;  5TP9 A;  2DWJ A;  1JW4 A;  5DVI A;  2HQ0 A;  1FBP A;  3OO8 A;  3IL1 B;  1FBG A;  4OVR A;  4TOZ A;  2UYE A;  2Z8F A;  4JVD A;  2PFZ A;  4P8B A;  1B3G A;  1ZIU A;  2O69 A;  4DXU A;  2Z8D A;  4LAT A;  3RNN A;  4RYA A;  4QFP A;  5A5L A;  5I2N B;  4N81 A;  4EQB A;  4NN3 A;  3GYY A;  4OMB A;  3PTY A;  2RIN A;  3T66 A;  5CMB A;  5ICT A;  2OJT A;  1FPL A;  4LQ2 A;  3HFU A;  4O94 A;  2ZYM A;  2WOP A;  1QKA A;  4IR8 A;  4YU0 A;  2R9J A;  4O3A A;  1VE4 A;  3U92 A;  1WDN A;  1FPE A;  1MQH A;  2V25 A;  2E1S A;  2HFB A;  4GXS B;  2ZXT A;  3PUY E;  4F18 A;  4YMB A;  2DVC A;  3OD7 A;  2BJJ X;  3G3F A;  3VVD A;  2HCA A;  3C32 A;  4Q5T A;  1IIW A;  1MXW A;  3LSW A;  4RY1 A;  3DLN A;  1IZ1 A;  3VDF A;  3ZKL A;  1MPD A;  1MQG A;  4NWD A;  2WOK A;  2AIX A;  3K0V A;  5KCJ A;  3B6Q A;  2B3F A;  4F3P A;  3MBP A;  4XEQ A;  5EQA A;  1NNK A;  1FRP A;  4XIG Q;  1KZ8 A;  1RKM A;  5CC2 A;  5I3S A;  3HCQ A;  3K6X A;  1B5I A;  3K1P A;  3KFM A;  2QS2 A;  2RCB A;  1II5 A;  4TQU Q;  3SET A;  4THI A;  1MY3 A;  2F3B A;  1FBF A;  4H65 A;  2PFY A;  2GRV A;  3MST A;  1FTA A;  2Y84 A;  3DP8 A;  2V3T A;  1NNT A;  2GHB A;  2F8D A;  1M5F A;  3UP9 A;  3IOR A;  2UVI A;  1FPJ A;  4PFB A;  1LBC A;  2V84 A;  1FBE A;  3KGC A;  3DEL B;  3D4G A;  5LOM A;  2I48 A;  4ND9 A;  2I49 A;  3FTO A;  5IM2 A;  4P47 A;  4ZEF A;  1MPC A;  3RT6 B;  4AS4 A;  1XHY A;  3C34 A;  3EHS A;  2ANJ A;  2W7Y A;  4UAB A;  4YB6 A;  4ZS9 A;  3WAE A;  5LDZ A;  5TPA B;  1OLA A;  4OVT A;  2PT2 A;  5JK4 A;  4PF6 A;  1PC3 A;  2DWA A;  4GBW A;  3OEK A;  3IX1 A;  5I59 A;  3PUW E;  1B58 A;  4ONY A;  2B3B A;  3DRJ A;  3OO9 A;  5IZ1 A;  4GVO A;  2P3N A;  5CM6 A;  3C36 A;  1NV4 A;  5AA1 A;  2FBP A;  2NUV A;  2ZNU A;  3H6W A;  4HE2 A;  5FHM A;  3O6H A;  4GBV A;  1YPN A;  3D4C A;  4PC9 A;  4KCD A;  3U72 A;  3UN6 A;  1LBZ A;  2UVG A;  4UAC A;  4NF6 A;  1FQA A;  3HN0 A;  1FQE A;  3KEI A;  1FW0 A;  4TLM B;  3N5L A;  3RPL B;  4ELQ A;  3RYD A;  3T9V A;  4MLV A;  4X8R A;  1JVY A;  1MY1 A;  1LFI A;  4PGN A;  4Q30 B;  4YB7 A;  4HE1 A;  2XXT A;  5LTC A;  2DE2 A;  2IEE A;  1NV7 A;  3QUF A;  2I58 A;  1USY E;  4MX6 A;  3RYA A;  3TTM A;  4PFT A;  1I6Q A;  2X26 A;  3M3F A;  3KOT A;  1B5H A;  1L5T A;  2OCU A;  1FQF A;  3OEM A;  4GIZ A;  2HAU A;  3TFL A;  3B6T A;  4F3B A;  4OZ9 A;  4XTC Q;  1B46 A;  4R73 A;  2F35 A;  4O8M A;  5B70 A;  1BIY A;  1URS A;  3T22 A;  3UIF A;  2QVV A;  3OEN A;  4Q8R A;  4AB5 A;  1T0K A;  2ZMB A;  4WED A;  2CZI A;  2UYF A;  3E78 A;  3G3K A;  3V89 B;  3OSR A;  3O29 A;  1PB8 A;  1DBZ A;  3R7X A;  2REJ A;  1Y20 A;  3DM0 A;  5HPQ A;  1ZLQ A;  4L17 A;  3VV5 A;  1D9Q A;  1HSE A;  3S9L C;  4QSD A;  4OVP A;  3LSF B;  1BTJ A;  3RY3 A;  5ESY A;  4OQO A;  4MJO A;  2G93 A;  2CEX A;  1Y4C A;  3FIR A;  2QVR A;  4XXU A;  1Y3N A;  3TAJ A;  3W9W A;  4DI3 D;  4N07 A;  4RJZ A;  4F3G A;  1XC1 A;  1M5B A;  3IAZ A;  3TEP A;  3PV0 E;  1Y4T A;  4KHZ E;  1EYJ A;  2DE3 A;  1MXZ A;  1S7Y A;  3S9N C;  4NF4 A;  4MEV A;  4P9K A;  1NV0 A;  4GWZ A;  5AA2 A;  3GBB A;  4DIG A;  1PB7 A;  2Y7W A;  5I2K B;  2DWI A;  2QMW A;  5DEX A;  4R75 A;  5BWJ A;  2XHD A;  2XXR A;  4H45 A;  1PEB A;  4DI4 B;  3T96 B;  3FXQ A;  4N4U A;  4NF8 A;  4N6P A;  5I5P A;  2R8T A;  4NF6 B;  4N15 A;  4R9F A;  3B7D A;  3MAM A;  2P2A A;  4IGT A;  3CFX A;  1ZTY A;  3P7I A;  1FPG A;  2Q88 A;  3NOH A;  2ZYO A;  4ZEK A;  2DXY A;  1B3E A;  4MCO A;  4EF2 A;  3MP6 A;  1IUD A;  1NMU A;  2O84 X;  3MZ9 A;  3C4M A;  1B3H A;  5B7D A;  2FIX A;  1SW2 A;  3Q29 A;  3DRI A;  5AE4 A;  2PVU A;  2QRY A;  3RUM A;  2ZZW A;  4XF5 A;  3GLB A;  4ZE9 A;  4DXB A;  4QFK A;  4N6D A;  2RC7 A;  3G3H A;  3PU5 A;  3VFJ A;  4FEB A;  1FPB A;  3BFU A;  3RQT A;  2QS3 A;  4R74 A;  2H9B A;  3HV1 A;  2DWH A;  4PQJ A;  1FCK A;  4F31 B;  1RDZ A;  3PAM A;  3IJO B;  1PDA A;  5I2N A;  1B0L A;  3G3G A;  4U22 A;  1B9J A;  3MUQ A;  4LON B;  3DRF A;  4MHF A;  1XT8 A;  1FQB A;  1JQF A;  3H6V A;  3IR1 A;  2AL4 A;  3VLV A;  1MXU A;  5ET6 A;  2WBD A;  5ITP A;  2B4L A;  4WKM A;  3TUS A;  5ET8 A;  4H6D A;  4DCY A;  2E0S A;  1B0H A;  4XKQ A;  4G8H A;  2NOO A;  1Z7N E;  5I58 B;  2VOZ A;  1VR5 A;  1B40 A;  2QJE A;  1VFD A;  1H44 A;  4F29 A;  1H43 A;  3LVU A;  4MFI A;  4IO3 A;  4YAH X;  4FAT A;  4NF0 A;  1FBD A;  1YAE A;  4IO2 A;  4AQ4 A;  1OMP A;  3H06 B;  1FJ6 A;  3UGW A;  3DRG A;  2X7Q A;  3I3V A;  3SDF A;  2HZK A;  3MC2 A;  4NTL A;  4GWY A;  4OEV A;  3VLU A;  4F39 A;  4OFO A;  3B6W A;  4X48 A;  3U65 A;  2I4C A;  3T9X B;  5AA2 B;  4G68 C;  5CRY A;  2VD3 A;  4ZDM A;  4JBZ A;  3OEL A;  3RYB A;  5DEX B;  3FZV A;  3MP8 A;  3H03 A;  1IEJ A;  2VP1 A;  1FBC A;  1M5C A;  4NF5 B;  2X7P A;  3FAS A;  3LV0 A;  4H0W A;  1H45 A;  3EQ1 A;  1MPB A;  3Q27 A;  4QF9 A;  1OQH A;  1LBW A;  4JSD A;  4JWY A;  4K3F A;  4P1E A;  3GZG A;  1DPP A;  4GWX A;  2CZH A;  3TCH A;  1J1N A;  5ET7 A;  3D1R A;  4OVS A;  2FHY A;  4F19 A;  4C0R A;  4GWW A;  1ZU0 A;  3ZSF A;  3O9P A;  1G0H A;  1JEV A;  1Q9D A;  1A7L A;  2H4I A;  5TPA A;  4XFE A;  1MQD A;  3QAX A;  1DOT A;  3FXU A;  1LBB A;  1R9Q A;  2O6A A;  2QS1 A;  4LQ5 A;  2ZNT A;  5EHS A;  3PGF A;  4R9G A;  4LN5 A;  4KQP A;  1GVC A;  4KFQ A;  4MNP A;  3K00 A;  5EQ7 A;  3KSJ A;  4ELP A;  3RT8 A;  4AS5 A;  4R6K A;  4UA8 A;  4OXV A;  3MP1 A;  1DMB A;  2QVU A;  3KN3 A;  1N84 A;  3N6T A;  2AL5 A;  4PBQ A;  4OA4 A;  4R6H A;  4R2F A;  5DW8 A;  4Z7E A;  4MF3 A;  2GH9 A;  4N8Y A;  2WKY A;  3HST A;  1SW5 A;  4OTE A;  5ET5 A;  3U8Q A;  3O6G A;  1XOC A;  1UIU A;  1FPF A;  2F34 A;  4YKP A;  3RPL A;  4GRK A;  2ZYK A;  4P0I A;  3PD9 A;  4KI0 E;  5FHO A;  1JEU A;  3FGS A;  1NH8 A;  3MVY A;  4YKI A;  5H8F B;  2OLB A;  3RLF E;  2VD2 A;  3IOV A;  4G8N A;  4RK9 A;  3I6V A;  5I57 A;  1SYH A;  5EYH A;  5DTB A;  2NWJ A;  1N0T A;  1R6Z A;  1JP4 A;  4R6Y A;  3S9E A;  3H3G A;  4ESX A;  2P0S A;  3LSX A;  3BKI B;  3G3J A;  3MW0 A;  1ZKB A;  1A54 A;  3MYU A;  4ECF A;  1FBH A;  3KJ7 A;  3S2V A;  3VVE A;  1VDW A;  3K02 A;  2OK2 A;  1B1H A;  4C1T A;  2UXA A;  4G4P A;  1SBP A;  1K9Z A;  4H67 A;  3CFL A;  1NV5 A;  4PE3 A;  4QBA A;  1AOV A;  3FV1 A;  1NV1 A;  3TYH A;  2I0C A;  1SYI A;  1FQC A;  1DTG A;  1PBP A;  2F7C A;  2ALU A;  1URG A;  4EDP A;  4LZ5 A;  2VHA A;  3VVF A;  4M1V A;  3TTL A;  3QIM A;  4QFN A;  4F1V A;  4X1B A;  4NAP A;  1LB8 A;  3ZKK A;  2GHA A;  3K4U A;  2QS4 A;  2Y5L A;  1WOD A;  1DCU A;  1FSA A;  4IO4 A;  1MDP 1;  4TLL B;  4P0G A;  4JWO A;  4DDD A;  2ONK E;  2RCA A;  2OBG A;  1IMB A;  5TU0 A;  4PDD A;  4EQ7 A;  4QRZ A;  1BKA A;  3THI A;  4ZEI A;  3C35 A;  5H8N A;  3IOT A;  4ZE8 A;  5I2K A;  4G68 B;  3PUV E;  1OVT A;  4U21 A;  1MY4 A;  1POY 1;  3PPR A;  4HE0 A;  2REG A;  4GFR A;  4F3S A;  2THI A;  1JNF A;  4ELR A;  4OFJ A;  4ELO A;  3VLW A;  2QMX A;  4LP2 B;  4QSE A;  1S50 A;  4H1X A;  3JV9 A;  2Y7R A;  1R9L A;  4U4S A;  4JDF A;  1NUX A;  1XVY A;  2XX7 A;  3TQW A;  4OVQ A;  2OWZ A;  1M5E A;  4OES A;  4KXP A;  2XXY A;  3SEU A;  4IY5 A;  3TTN A;  3FJM A;  5T3J A;  3ILU B;  3B50 A;  1PBQ A;  1MXY A;  5EYG A;  4OFL A;  3TCF A;  3ZS6 A;  5I57 B;  1AWB A;  4LZ8 A;  5DT6 A;  5AA4 B;  1R1N A;  4JVI A;  3K6W A;  4U23 A;  4PFU A;  2Y5K A;  1MRP A;  2NXO A;  1DSN A;  3ISP A;  3CI8 A;  3O6P A;  1ANF A;  2HHM A;  5AA3 A;  3VXB A;  4BDO A;  1ZBM A;  4QFO A;  1RYX A;  2ZZX A;  1ELJ A;  1KWH A;  4OEN A;  5L9M A;  1SI0 A;  1SI1 A;  1NH7 A;  4JWX A;  3TPA A;  1D9Y A;  3R6U A;  2Q8J A;  3QYT A;  4OET A;  1NNF A;  4ZZE A;  1MXV A;  2R71 A;  4DZ1 A;  3Q25 A;  1Y9U A;  1B32 A;  1HSL A;  2XXP A;  4LUB A;  5JEI A;  3IFA A;  4RA1 A;  1SW1 A;  3PUX E;  4GX6 A;  4PP0 A;  2JJK A;  2F6P A;  5I58 A;  2YJP A;  1FJ9 A;  1US5 A;  2OWT A;  1LEV A;  2WOL A;  3U94 A;  1M5D A;  4GD5 A;  3IJX B;  1GR2 A;  2Y7I A;  4QHQ A;  2I3W A;  2Q2C A;  2H25 A;  3N26 A;  4JVC A;  5A5X A;  3OSQ A;  4KPT A;  1B7H A;  3DRK A;  5J16 A;  1N3X A;  2V4C A;  2XXU A;  5FBP A;  1FTO A;  1BK4 A;  4OAN A;  2V93 A;  2I3V A;  1B52 A;  4YMA A;  2V3U A;  4FED A;  4HXV A;  4MMP A;  3KN7 A;  3F11 A;  1P1N A;  1QW0 A;  5H8N B;  4IO7 A;  2F36 A;  1A99 A;  1QUI A;  3IO4 A;  1B5J A;  1IMC A;  3RTF B;  4F1U A;  2FIE A;  4XKR A;  5L9S A;  3KC1 A;  3SER A;  2XX9 A;  2HZL A;  4YKK A;  2RKM A;  4M4G A;  4NF5 A;  1QJM A;  4N6K A;  1SD3 A;  3KZG A;  2B4M A;  4YZZ A;  3EHT A;  1VFE A;  3PMX A;  1LLS A;  2QPQ A;  5IGA A;  1UQW A;  1LCT A;  3I5O A;  2YPN A;  2B65 A;  3GBA A;  3ROJ A;  2P1S A;  4OVJ A;  1IMA A;  4GWO A;  4X1D A;  5EYF A;  2XWO A;  1N04 A;  3BIH A;  4DLD A;  4PFY A;  2Q2A A;  1N3W A;  3MJN A;  4POX A;  3IO6 A;  2GFE A;  3ODB A;  4GL0 A;  1EZO A;  1EZ9 A;  2F78 A;  5H8S A;  4H5G A;  1FQD A;  4FIM A;  4N8G A;  4OWD A;  4ZZA A;  3JYR A;  4NMY A;  1D4N A;  4NGU A;  4PTK A;  3QUJ A;  3MPK A;  1IME A;  3QXM A;  2BJI A;  3T0J A;  4E0X A;  1Y1M A;  4PCD A;  2KR0 A;  4PE5 B;  3IFC A;  4X04 A;  3FVO A;  3Q28 A;  1CE2 A;  5H8H B;  4JXI A;  2CZL A;  1A40 A;  4P3L A;  2KQZ A;  1P1U A;  4I8C A;  3TZA A;  3TKD A;  3V8X B;  2DXR A;  3O97 A;  2VPO A;  1XVX A;  1IXI A;  1MY0 A;  3KJT A;  3K01 A;  1KA1 A;  2HAV A;  4AB6 A;  2XA5 A;  2ABH A;  3MZ1 A;  2Y7K A;  3R26 A;  5H8F A; 
#chains in the Genus database with same CATH homology
 3BFT A;  3HO7 A;  1B7U A;  1P1W A;  2UVJ A;  4I1D A;  5A5X B;  2H5Y A;  2OWS A;  4HCW A;  1TXF A;  1Q35 A;  4G77 A;  1N76 A;  1O64 A;  3CSG A;  3OO6 A;  3C9H A;  4FAJ A;  5H8Q B;  1B1X A;  2F97 A;  1JET A;  1I6A A;  1SQY A;  4BLA A;  3EF7 A;  4EQ9 A;  1LFH A;  3EPE A;  4HCY A;  3SEX A;  5BUU A;  2G29 A;  3A09 A;  3CG1 A;  1USY H;  4GOT A;  1UTB B;  1NNP A;  4BDL A;  3TQL A;  3PPP A;  3C33 A;  2PX1 A;  4H8I A;  3OXN A;  1QUK A;  2PYY A;  1TFA A;  4DCX A;  1SW4 A;  5IAI A;  1AIV A;  3S4U A;  3MZB A;  1LAX A;  5DVJ A;  1QUL A;  3SEY A;  1IXG A;  5F7V A;  1B4Z A;  4G8M A;  1MXX A;  4R72 A;  3O66 A;  5DYH A;  1AH5 A;  1DTZ A;  1LST A;  3TCG A;  2F7B A;  1MM7 A;  1Y1Z A;  4KD5 A;  1D3K A;  3KG2 A;  3TTK A;  3PPO A;  4BDQ A;  3H7M A;  3KOS A;  2F5X A;  2DE4 A;  1MH4 A;  1IXH A;  4O3C A;  3RPW A;  4PET A;  3M3K A;  4U1O A;  4QSC A;  1POT A;  3OOA A;  3IOW A;  3O6I A;  4JB7 A;  3SEW A;  4G68 A;  2H98 A;  3E13 X;  3MVZ A;  4FOR A;  4KYD A;  5FTI A;  2O1L A;  5KDT A;  5CBR A;  3KBR A;  1UIV A;  4WXJ A;  3IB1 A;  5L9O A;  2XXH A;  5K2Y A;  4GQO A;  5JTY B;  2F6G A;  3U1O A;  4U4X A;  3CRB A;  2RF1 A;  5M2V A;  1SVX B;  2Z8E A;  3U93 A;  2I0B A;  3H6U A;  2DS9 A;  3Q26 A;  2PMS A;  3CG3 A;  2R6G E;  4ZEC A;  3E9X A;  2D21 A;  1GV8 A;  3PMV A;  1ATG A;  4NE4 A;  5AA4 A;  2O51 A;  1DPE A;  1B05 A;  2V3Q A;  4YB5 A;  4F2Q A;  4POW A;  1I69 A;  2XXI A;  4KYE A;  4Z0I A;  1MG1 A;  3PUZ E;  1JW1 A;  2ONR A;  4ESW A;  4XKP A;  5K2X A;  1B4H A;  2CMO A;  3HHG A;  3W9V A;  1B3F A;  5ITO A;  2HXW A;  3RGY A;  4IO5 A;  1LB9 A;  1GTK A;  3K1N A;  5EHM A;  1P1Q A;  4XKN A;  1UTH A;  4MLQ A;  4F2O A;  5ICQ A;  4YKJ A;  3DRH A;  1EU8 A;  3N6U A;  4GXA A;  1URD A;  3A3C A;  3USD A;  4DXC A;  3HPI A;  2F7A A;  3N94 A;  1A8F A;  5CMC A;  4MH5 A;  3DP4 A;  3EHU A;  4NED A;  2FNC A;  4PFW A;  1NFT A;  2ESN A;  2PT1 A;  4P11 A;  3H4Z A;  3L6G A;  3FUZ A;  4RPO A;  1MQI A;  4LZ7 A;  4R2B A;  5TP9 B;  4HW8 A;  2LAO A;  1FTK A;  3RN8 A;  3SEV A;  1QKB A;  4FEC A;  3PPN A;  3K2D A;  1SDX A;  3SES A;  1O7T A;  3TTR A;  5KDT B;  3CIJ A;  1N7X A;  3SKP A;  4RNS A;  3ECR A;  4GL8 A;  4U1Z A;  2XXV A;  4X9T A;  4IB2 A;  1GGG A;  1LAG E;  1YTV A;  2XXQ A;  4BDM A;  4FE8 A;  3G7W A;  2DP8 A;  2Q9T A;  5CI5 A;  3CHG A;  1CB6 A;  3FVK A;  3VXC A;  2Z23 A;  2DQV A;  3G3I A;  2O7I A;  3TOD A;  4EF1 A;  3KN8 A;  4G2Z A;  4JSO A;  3E3K A;  5KZT A;  1I6B A;  4H5F A;  2XD3 A;  2XXX A;  1JVX A;  3M8U A;  2RC9 A;  3FD3 A;  2D5W A;  5KCJ B;  5ELV A;  3W15 C;  4ISU A;  4KR5 A;  3WAF A;  4WEP A;  2ONS A;  4BDN A;  2A5S A;  2DOJ A;  4MBP A;  2OZZ A;  2PBW A;  3M3L A;  2I4B A;  1Y3Q A;  2QSX A;  2YLN A;  1MM6 A;  1FTL A;  3LR1 A;  3TEL A;  3UA8 A;  3DP6 A;  1UTH B;  5H8H A;  5ISU A;  1B7Z A;  4I62 A;  3H6T A;  1Q1K A;  1AMF A;  1XS5 A;  3K1M A;  4EXL A;  5CMK A;  1Y3P A;  2VGQ A;  5HM4 B;  3TDJ A;  3E4R A;  1F9B A;  5I56 A;  1H3D A;  3QSL A;  3AXF A;  1OQG A;  5I84 A;  1TWY A;  3L6H A;  5J1D A;  1O63 A;  3IOU A;  1QVS A;  3BBR A;  5FHN A;  1A55 A;  1HSJ A;  4GF8 A;  2HEU A;  4OER A;  4KCC A;  2O7U A;  1N7W A;  1VSO A;  3QK6 A;  1LFG A;  5H8Q A;  1LCF A;  2A5T A;  3VE1 B;  2H99 A;  4DE8 A;  2NVU B;  3EN3 A;  5I59 B;  1OLC A;  4GLI A;  4OYV A;  3FVG A;  1UTB A;  1NL5 A;  1BP5 A;  3GXA A;  3T9H B;  1JW5 A;  3MWB A;  1LAH E;  4KYS A;  2QL3 A;  3JZJ A;  3C31 A;  4EUO A;  4O3B A;  3V5A A;  3IB0 A;  1MQJ A;  3OO7 A;  3FVN A;  3TMG A;  1P99 A;  4Q0C A;  1WVJ A;  1FTJ A;  1B3L A;  4QFL A;  2DSF A;  4C1U A;  4ZED A;  1NKX A;  2FA7 A;  3V83 A;  1OIB A;  1ZJL A;  1MH3 A;  4EXK A;  4I9D A;  1Z7M E;  2DYX A;  2XD2 A;  3S9M C;  4IO6 A;  1S9T A;  2Q89 A;  3KSX A;  1AL3 A;  4IY6 A;  3LSL A;  4H8J A;  1MDQ A;  4LA9 A;  3PMW A;  3FAT A;  3CVG A;  4F1Y A;  1RYO A;  3PD8 A;  5AA2 D;  5DVF A;  5L8D A;  4RPN A;  5F1Q A;  4RK2 A;  2ZYN A;  5CMM A;  3FXR A;  1MS7 A;  3FV2 A;  1H76 A;  3T9U A;  3MPL A;  5FTH A;  3PPQ A;  3FJG A;  3OMB A;  3HHF A;  3ILT B;  4LVQ A;  2ZNS A;  3K6V A;  2RC8 A;  3O2A A;  1US4 A;  1EZP A;  1LGB C;  3UOR A;  2O1M A;  1OVB A;  3IB2 A;  3O28 A;  5HBC A;  5JTY A;  5IKB A;  4FJP A;  3IK6 B;  5I56 B;  2I6E A;  2XX8 A;  3FJ7 A;  3MVX A;  4N13 A;  1IIT A;  1MY2 A;  3UK4 A;  1FTM A;  3K6U A;  1TT1 A;  5CBS A;  2O68 A;  4E0W A;  4U2R A;  3LUY A;  1QUJ A;  3LC8 A;  4NWC A;  2A5T B;  1TFD A;  3CSB A;  2M8C A;  1YCJ A;  4ZEB A;  1EH3 A;  1B2H A;  2XXW A;  1B51 A;  3RTW B;  3MVW A;  4NF4 B;  2DVZ A;  2FYI A;  4BDR A;  2AYS A;  2D3I A;  2Y7P A;  4YIC A;  1IXC A;  4OHN A;  4RXL A;  1D9V A;  3MQ9 A;  4IGR A;  1P1O A;  1LAF E;  2Z22 A;  3CFZ A;  4NF8 B;  1PB9 A;  4OEU A;  2UVH A;  4HS7 A;  3A3U A;  1IQ7 A;  4HTG A;  3LBS A;  3T93 B;  1BLF A;  1ZMG A;  1B6H A;  2IA4 A;  2KLF A;  3ONM A;  4F22 A;  1A8E A;  3CR9 A;  5TP9 A;  2DWJ A;  1JW4 A;  5DVI A;  2HQ0 A;  3OO8 A;  3IL1 B;  4TOZ A;  2UYE A;  2Z8F A;  1B3G A;  1ZIU A;  2O69 A;  4DXU A;  2Z8D A;  4LAT A;  3RNN A;  4RYA A;  4QFP A;  5I2N B;  4EQB A;  4OMB A;  2RIN A;  3T66 A;  5CMB A;  5ICT A;  2OJT A;  4LQ2 A;  2ZYM A;  2WOP A;  1QKA A;  4YU0 A;  2R9J A;  4O3A A;  1VE4 A;  3U92 A;  1WDN A;  1MQH A;  2V25 A;  2E1S A;  2HFB A;  4GXS B;  2ZXT A;  3PUY E;  4F18 A;  4YMB A;  2DVC A;  3OD7 A;  2BJJ X;  3G3F A;  3VVD A;  2HCA A;  3C32 A;  4Q5T A;  1IIW A;  1MXW A;  3LSW A;  4RY1 A;  3DLN A;  1IZ1 A;  3VDF A;  3ZKL A;  1MPD A;  1MQG A;  4NWD A;  2WOK A;  2AIX A;  3K0V A;  5KCJ A;  3B6Q A;  2B3F A;  4F3P A;  3MBP A;  1NNK A;  4XIG Q;  1RKM A;  5CC2 A;  3HCQ A;  3K6X A;  1B5I A;  3K1P A;  3KFM A;  2QS2 A;  2RCB A;  1II5 A;  4TQU Q;  3SET A;  4THI A;  1MY3 A;  4H65 A;  2GRV A;  2Y84 A;  3DP8 A;  2V3T A;  1NNT A;  2GHB A;  2F8D A;  1M5F A;  3UP9 A;  3IOR A;  2UVI A;  1LBC A;  2V84 A;  3KGC A;  3DEL B;  3D4G A;  5LOM A;  2I48 A;  4ND9 A;  2I49 A;  3FTO A;  4ZEF A;  1MPC A;  3RT6 B;  1XHY A;  3C34 A;  3EHS A;  2ANJ A;  2W7Y A;  4YB6 A;  4ZS9 A;  3WAE A;  5TPA B;  1OLA A;  2PT2 A;  5JK4 A;  1PC3 A;  2DWA A;  3OEK A;  3IX1 A;  5I59 A;  3PUW E;  1B58 A;  4ONY A;  2B3B A;  3DRJ A;  3OO9 A;  4GVO A;  5CM6 A;  3C36 A;  5AA1 A;  2NUV A;  2ZNU A;  3H6W A;  5FHM A;  3O6H A;  1YPN A;  3D4C A;  4KCD A;  3U72 A;  3UN6 A;  2UVG A;  4UAC A;  4NF6 A;  1FQA A;  3HN0 A;  1FQE A;  3KEI A;  1FW0 A;  4TLM B;  3N5L A;  4ELQ A;  3T9V A;  4MLV A;  1JVY A;  1MY1 A;  1LFI A;  4Q30 B;  4YB7 A;  2XXT A;  2DE2 A;  2IEE A;  3QUF A;  2I58 A;  1USY E;  3RYA A;  3TTM A;  4PFT A;  1I6Q A;  2X26 A;  3M3F A;  3KOT A;  1B5H A;  1L5T A;  2OCU A;  1FQF A;  3OEM A;  4GIZ A;  2HAU A;  3TFL A;  3B6T A;  4F3B A;  4OZ9 A;  4XTC Q;  1B46 A;  4R73 A;  2F35 A;  5B70 A;  1BIY A;  1URS A;  3T22 A;  3UIF A;  3OEN A;  4Q8R A;  4AB5 A;  1T0K A;  2ZMB A;  4WED A;  2UYF A;  3G3K A;  3V89 B;  3OSR A;  3O29 A;  1PB8 A;  3R7X A;  2REJ A;  1Y20 A;  3DM0 A;  5HPQ A;  1ZLQ A;  4L17 A;  3VV5 A;  1HSE A;  3S9L C;  4QSD A;  3LSF B;  1BTJ A;  3RY3 A;  4OQO A;  2G93 A;  1Y4C A;  3FIR A;  4XXU A;  1Y3N A;  3TAJ A;  3W9W A;  4N07 A;  4RJZ A;  4F3G A;  1XC1 A;  1M5B A;  3IAZ A;  3TEP A;  3PV0 E;  1Y4T A;  4KHZ E;  2DE3 A;  1MXZ A;  1S7Y A;  3S9N C;  4NF4 A;  5AA2 A;  3GBB A;  4DIG A;  1PB7 A;  2Y7W A;  5I2K B;  2DWI A;  2QMW A;  5DEX A;  4R75 A;  5BWJ A;  2XHD A;  2XXR A;  1PEB A;  3T96 B;  3FXQ A;  4NF8 A;  4N6P A;  4NF6 B;  4R9F A;  3B7D A;  3MAM A;  2P2A A;  4IGT A;  3CFX A;  1ZTY A;  3P7I A;  2Q88 A;  2ZYO A;  4ZEK A;  2DXY A;  1B3E A;  4EF2 A;  3MP6 A;  1IUD A;  1NMU A;  2O84 X;  3MZ9 A;  3C4M A;  1B3H A;  5B7D A;  1SW2 A;  3Q29 A;  3DRI A;  5AE4 A;  2PVU A;  2QRY A;  3RUM A;  3GLB A;  4ZE9 A;  4DXB A;  4QFK A;  2RC7 A;  3G3H A;  3PU5 A;  3VFJ A;  4FEB A;  3BFU A;  3RQT A;  2QS3 A;  4R74 A;  2H9B A;  3HV1 A;  2DWH A;  4PQJ A;  1FCK A;  4F31 B;  3IJO B;  3PAM A;  1PDA A;  5I2N A;  1B0L A;  3G3G A;  4U22 A;  1B9J A;  3MUQ A;  4LON B;  3DRF A;  1XT8 A;  1FQB A;  1JQF A;  3H6V A;  3IR1 A;  2AL4 A;  3VLV A;  1MXU A;  5ITP A;  2B4L A;  4WKM A;  3TUS A;  4H6D A;  4DCY A;  2E0S A;  1B0H A;  4XKQ A;  4G8H A;  2NOO A;  1Z7N E;  5I58 B;  2VOZ A;  1VR5 A;  1B40 A;  2QJE A;  1VFD A;  1H44 A;  4F29 A;  1H43 A;  3LVU A;  4MFI A;  4IO3 A;  4YAH X;  4FAT A;  1YAE A;  4IO2 A;  4AQ4 A;  1OMP A;  3H06 B;  3UGW A;  3DRG A;  2X7Q A;  3I3V A;  3SDF A;  2HZK A;  3MC2 A;  4NTL A;  3VLU A;  4OEV A;  4F39 A;  4OFO A;  3B6W A;  4X48 A;  2I4C A;  3T9X B;  5AA2 B;  4G68 C;  5CRY A;  2VD3 A;  4ZDM A;  4JBZ A;  3OEL A;  3RYB A;  5DEX B;  3FZV A;  3MP8 A;  3H03 A;  1IEJ A;  2VP1 A;  1M5C A;  4NF5 B;  2X7P A;  3FAS A;  4H0W A;  1H45 A;  3EQ1 A;  1MPB A;  3Q27 A;  4QF9 A;  1OQH A;  4JSD A;  4JWY A;  4K3F A;  3GZG A;  1DPP A;  3TCH A;  1J1N A;  4F19 A;  4C0R A;  1ZU0 A;  3ZSF A;  3O9P A;  1JEV A;  1A7L A;  2H4I A;  5TPA A;  1MQD A;  3QAX A;  1DOT A;  3FXU A;  1LBB A;  1R9Q A;  2O6A A;  2QS1 A;  4LQ5 A;  2ZNT A;  5EHS A;  3PGF A;  4R9G A;  1GVC A;  4KQP A;  4KFQ A;  3K00 A;  4ELP A;  3KSJ A;  3RT8 A;  4R6K A;  4UA8 A;  4OXV A;  3MP1 A;  1DMB A;  3KN3 A;  1N84 A;  3N6T A;  2AL5 A;  4R6H A;  4R2F A;  4Z7E A;  4MF3 A;  2GH9 A;  2WKY A;  3HST A;  1SW5 A;  4OTE A;  3U8Q A;  3O6G A;  1XOC A;  1UIU A;  2F34 A;  4YKP A;  4GRK A;  2ZYK A;  4P0I A;  3PD9 A;  4KI0 E;  5FHO A;  1JEU A;  3FGS A;  1NH8 A;  3MVY A;  4YKI A;  5H8F B;  2OLB A;  3RLF E;  2VD2 A;  3IOV A;  4G8N A;  4RK9 A;  3I6V A;  5I57 A;  1SYH A;  5DTB A;  2NWJ A;  1N0T A;  1R6Z A;  4R6Y A;  3S9E A;  3H3G A;  4ESX A;  2P0S A;  3LSX A;  3BKI B;  3G3J A;  3MW0 A;  1ZKB A;  1A54 A;  4ECF A;  3KJ7 A;  3S2V A;  3VVE A;  3K02 A;  2OK2 A;  1B1H A;  4C1T A;  2UXA A;  4G4P A;  1SBP A;  4H67 A;  3CFL A;  1AOV A;  3FV1 A;  3TYH A;  2I0C A;  1SYI A;  1FQC A;  1DTG A;  1PBP A;  2F7C A;  2ALU A;  1URG A;  4EDP A;  4LZ5 A;  2VHA A;  3VVF A;  4M1V A;  3TTL A;  3QIM A;  4QFN A;  4F1V A;  4X1B A;  1LB8 A;  3ZKK A;  2GHA A;  3K4U A;  2QS4 A;  1WOD A;  4IO4 A;  1MDP 1;  4TLL B;  4P0G A;  4JWO A;  4DDD A;  2ONK E;  2RCA A;  2OBG A;  5TU0 A;  4EQ7 A;  4QRZ A;  1BKA A;  3THI A;  4ZEI A;  3C35 A;  5H8N A;  3IOT A;  4ZE8 A;  5I2K A;  4G68 B;  3PUV E;  1OVT A;  4U21 A;  1MY4 A;  1POY 1;  3PPR A;  2REG A;  4GFR A;  4F3S A;  2THI A;  1JNF A;  4ELR A;  4OFJ A;  4ELO A;  3VLW A;  2QMX A;  4LP2 B;  4QSE A;  1S50 A;  4H1X A;  3JV9 A;  2Y7R A;  1R9L A;  4U4S A;  4JDF A;  1XVY A;  2XX7 A;  3TQW A;  1M5E A;  4OES A;  2XXY A;  3SEU A;  4IY5 A;  3TTN A;  3FJM A;  3ILU B;  1PBQ A;  1MXY A;  4OFL A;  3TCF A;  3ZS6 A;  5I57 B;  5DT6 A;  4LZ8 A;  5AA4 B;  1R1N A;  3K6W A;  4U23 A;  4PFU A;  1MRP A;  2NXO A;  1DSN A;  3CI8 A;  3O6P A;  1ANF A;  5AA3 A;  3VXB A;  4BDO A;  1ZBM A;  4QFO A;  1RYX A;  1ELJ A;  1KWH A;  4OEN A;  5L9M A;  1SI0 A;  1SI1 A;  1NH7 A;  4JWX A;  3TPA A;  1D9Y A;  3R6U A;  2Q8J A;  3QYT A;  4OET A;  1NNF A;  4ZZE A;  1MXV A;  2R71 A;  4DZ1 A;  3Q25 A;  1Y9U A;  1B32 A;  1HSL A;  2XXP A;  4LUB A;  5JEI A;  4RA1 A;  1SW1 A;  3PUX E;  4PP0 A;  2F6P A;  5I58 A;  2YJP A;  1US5 A;  2OWT A;  2WOL A;  3U94 A;  1M5D A;  4GD5 A;  3IJX B;  1GR2 A;  2Y7I A;  4QHQ A;  2I3W A;  2Q2C A;  2H25 A;  3N26 A;  5A5X A;  3OSQ A;  4KPT A;  1B7H A;  3DRK A;  1N3X A;  2XXU A;  1FTO A;  2V93 A;  2I3V A;  1B52 A;  4YMA A;  2V3U A;  4FED A;  3KN7 A;  3F11 A;  1P1N A;  1QW0 A;  5H8N B;  4IO7 A;  2F36 A;  1A99 A;  1QUI A;  3IO4 A;  1B5J A;  3RTF B;  4F1U A;  4XKR A;  5L9S A;  3SER A;  2XX9 A;  2HZL A;  4YKK A;  2RKM A;  4M4G A;  4NF5 A;  1QJM A;  1SD3 A;  3KZG A;  2B4M A;  4YZZ A;  3EHT A;  1VFE A;  3PMX A;  1LLS A;  2QPQ A;  1UQW A;  1LCT A;  3I5O A;  2YPN A;  2B65 A;  3GBA A;  2P1S A;  4OVJ A;  4GWO A;  4X1D A;  5EYF A;  1N04 A;  4DLD A;  4PFY A;  2Q2A A;  1N3W A;  3MJN A;  4POX A;  3IO6 A;  2GFE A;  3ODB A;  4GL0 A;  1EZO A;  1EZ9 A;  2F78 A;  5H8S A;  4H5G A;  1FQD A;  4FIM A;  4OWD A;  4ZZA A;  3JYR A;  4NMY A;  1D4N A;  3QUJ A;  3MPK A;  3QXM A;  4E0X A;  1Y1M A;  4PE5 B;  3FVO A;  3Q28 A;  1CE2 A;  5H8H B;  4JXI A;  2CZL A;  1A40 A;  1P1U A;  4I8C A;  3TZA A;  3TKD A;  3V8X B;  2DXR A;  3O97 A;  1XVX A;  1IXI A;  1MY0 A;  3KJT A;  3K01 A;  2HAV A;  4AB6 A;  2ABH A;  3MZ1 A;  2Y7K A;  3R26 A;  5H8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...