1B4HA

Oligo-peptide binding protein complexed with lysyl-diaminobutyric acid-lysine
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGO-PEPTIDE BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 194
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b4hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b4hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b4hA02
4ELPA 3DP6A 4DZ1A 1JQFA 4XKPA 2R9JA 3LBSA 3MJNA 3OELA 5AA4A 2VD2A 4BDRA 1IIWA 2HFBA 4H1XA 1LB8A 1NH8A 4UACA 4GRKA 4THIA 3GBAA 2UYEA 4U23A 4R74A 2I4BA 4MH5A 3VXBA 5CC2A 3U1OA 4JBZA 4F1UA 4YAHX 1UQWA 1EU8A 2FYIA 3FIRA 3FVKA 4ZZEA 2XX9A 1DMBA 3IO4A 4QFLA 2DSFA 4Z0IA 3N94A 3VXCA 4FAJA 2QL3A 4R9GA 5TPAA 2P2AA 5CRYA 1QKBA 4U22A 3GZGA 4OFJA 1LCTA 2QS4A 2VD3A 2XD2A 1UTHA 1B6HA 4GL8A 2XXVA 3PUVE 1B3GA 1BIYA 2QS3A 3FATA 1SI1A 3PMVA 1A7LA 2WOLA 3R26A 2F7BA 4EF1A 3CI8A 4GIZA 1LFGA 1SW1A 1GR2A 3V5AA 2QRYA 2DP8A 3IORA 1P99A 2O6AA 2RCAA 5H8NB 2QS2A 4IO5A 1XC1A 1XT8A 4IB2A 3IX1A 4Z7EA 5HPQA 1N84A 4YZZA 2V3TA 4TOZA 3PMWA 1LB9A 4O3CA 5I2KA 4ELRA 1FW0A 4U4XA 4NF6A 3PPRA 1Y3PA 3UORA 2GHBA 2Q8JA 3KG2A 1B52A 4DCXA 4OXVA 2UVGA 2YLNA 2IA4A 4NF8A 2XX8A 1TT1A 2Q2CA 1Y3NA 1IXCA 3Q27A 4H5FA 2WOPA 3M3LA 3BBRA 2VGQA 3SEUA 1HSJA 2B3BA 4ND9A 1MY4A 3HO7A 4HTGA 2IEEA 3OEKA 5ELVA 3H03A 4JXIA 1L5TA 4R6KA 4EQBA 1N3WA 3QIMA 1LAGE 2ZNTA 3QYTA 4ZE9A 4GVOA 4LUBA 1MXWA 4QRZA 3FXUA 5HBCA 1OLAA 3DP4A 4ISUA 3TKDA 2DXRA 1MS7A 3UP9A 1WVJA 2M8CA 1FQDA 1SW2A 4E0WA 3OXNA 3FJ7A 3V89B 1B0LA 1POTA 1IXGA 1FQBA 2PVUA 3K6UA 1MPCA 1OLCA 1JNFA 2O7IA 2RC8A 3IR1A 4XKQA 3RUMA 4JWOA 4I62A 1LAFE 3GLBA 3OEMA 4LA9A 4F3GA 3VDFA 3C33A 4HCYA 4YKPA 5CMKA 1UTBB 4ELQA 3FVNA 2XXPA 3SESA 3E3KA 3E9XA 5J1DA 5I2NB 3S9NC 2H4IA 3MZBA 5AA2A 4ZE8A 4KCCA 1XVYA 4R9FA 3KEIA 5I58A 3FV2A 3K6XA 2E1SA 2V3UA 5EHMA 4X48A 1QUIA 3CIJA 2RCBA 5H8QB 5A5XA 3MVXA 4RNSA 4YKKA 3FTOA 3F11A 3PGFA 5K2YA 2OWSA 4NTLA 2HXWA 3C32A 4NE4A 3CRBA 3HV1A 1N04A 3DELB 3T93B 2Y7RA 4MLVA 2H98A 1CB6A 3PUYE 2HZLA 3B7DA 4F3PA 4OENA 3UK4A 4ZEFA 3VLVA 2F6GA 1SW5A 2O51A 4KYDA 3IB0A 1B3FA 5LOMA 3Q29A 3RTFB 2D21A 3UIFA 2V3QA 2XX7A 3FD3A 1KWHA 1B5JA 4G77A 5ITPA 3TZAA 4N07A 5ITOA 3U72A 1LSTA 2UVJA 4O3AA 1LLSA 5AA4B 3T9VA 1DSNA 1I6AA 1NNKA 2ABHA 3P7IA 3LC8A 1NNTA 4WEDA 3SKPA 2E0SA 5M2VA 3FV1A 5TU0A 3FXQA 4I9DA 3TDJA 3VLWA 1FQAA 5H8HA 4BLAA 1Y3QA 1A54A 2A5TB 5DVJA 3TTMA 1OIBA 1RYOA 5DYHA 3ZS6A 1LBCA 2QMWA 3WAFA 4LONB 3LSXA 3OO7A 3V8XB 2AL4A 5H8FB 1II5A 4KQPA 4OYVA 4X9TA 4PP0A 2NXOA 1R1NA 5FTHA 1AL3A 4ONYA 3H6UA 5CBSA 4QFNA 3DRJA 2ZYKA 5CMCA 2Y7WA 4PETA 4EUOA 3SEWA 2F7CA 1HSEA 3OD7A 1B7HA 2HCAA 4LVQA 4KD5A 3SERA 2HEUA 4F2OA 5CBRA 1PB8A 1URSA 1Y9UA 1ZLQA 3I3VA 1GGGA 3SEYA 4MBPA 1XS5A 1LFHA 4H0WA 3HPIA 1QUKA 3UA8A 3H6WA 4OHNA 5KDTB 1WDNA 5FTIA 3PD9A 1YAEA 2VOZA 3A3CA 5KCJB 2ZYMA 5AA1A 2XD3A 2Y7PA 1ZBMA 4GFRA 4G68C 4LQ2A 3M3KA 1MY1A 5EYFA 2X7QA 4NF5A 1MDQA 3SDFA 1P1QA 3K02A 3ODBA 4TLMB 4R6YA 3K6VA 2XXQA 4GL0A 1Y1ZA 5I56B 1MXXA 4FECA 2F97A 1N0TA 3G3GA 3S9LC 3TUSA 4GWOA 1Y1MA 2OZZA 4P0GA 1B9JA 1B46A 1PB9A 1LFIA 1BTJA 3M8UA 2O1MA 3H7MA 4XXUA 4BDLA 2I3VA 4GD5A 1ZMGA 3Q25A 1QVSA 2I49A 3TCFA 1B7UA 2F78A 4G2ZA 1H43A 1TXFA 3LSWA 1B5HA 2BJJX 3W9WA 3KJTA 1VE4A 4M1VA 3HN0A 2F6PA 3FASA 1QJMA 1JEUA 1IZ1A 3EHSA 1MM6A 4Q8RA 3PAMA 4OZ9A 3PPQA 2PYYA 1FCKA 4KCDA 1DPEA 2NVUB 2UVHA 2OBGA 2OJTA 4IY5A 4JSOA 2OCUA 4POXA 4ZEDA 1A8FA 1B1HA 4GXAA 2Q2AA 1MY3A 2F36A 4X1DA 2R6GE 2QSXA 4NWDA 4NF4B 5AA2B 4C1UA 1MH4A 4OWDA 4G68B 2F8DA 2YPNA 2THIA 1GVCA 3S2VA 4EXLA 3KN8A 1ELJA 4OFOA 4JWXA 2ZNSA 3QUFA 1MXYA 3I5OA 3R6UA 2NOOA 3LUYA 1H45A 5DEXA 1XHYA 4OTEA 5K2XA 4LZ5A 2QJEA 2DQVA 3K1PA 1M5EA 3K4UA 4IO3A 1JETA 1J1NA 1YTVA 5JK4A 5DVFA 1B3HA 3U92A 2Y7KA 3DM0A 4OFLA 3MVYA 1I69A 5L9MA 2XXXA 4PFUA 3TEPA 4RA1A 4QFPA 3RQTA 3VFJA 3KZGA 5TP9B 4JSDA 1IUDA 1B7ZA 3EHUA 2Y84A 1SBPA 3N6TA 2QS1A 4HS7A 3IJOB 5L9SA 1Z7NE 3K6WA 3B6TA 2WKYA 5I59B 3O6GA 1USYE 3MP6A 3CHGA 4WKMA 4ZZAA 3RGYA 1DTZA 1N76A 3G3KA 5KZTA 4FATA 3PD8A 4KI0E 1URDA 2ZNUA 4OETA 3C36A 1ANFA 3K1NA 4DXCA 2B3FA 2XXTA 3PPNA 3N6UA 4U1OA 1A8EA 3CG1A 3WAEA 4NMYA 4BDMA 2ZYNA 3RPWA 3MQ9A 1NMUA 3RTWB 3TYHA 2H99A 1B3LA 1R9LA 1OVTA 4RPNA 3R7XA 3H6VA 4QHQA 2B65A 3UGWA 3B6WA 3Q28A 4WEPA 1YCJA 2ESNA 3QUJA 3O6HA 1B4ZA 3QK6A 1FQFA 2Z23A 5H8SA 4QSCA 3U8QA 3N26A 4IO6A 4MF3A 4ESWA 3O6PA 4RPOA 4OMBA 4KFQA 4LP2B 3PUZE 1AIVA 3MAMA 2DE3A 1S7YA 1ZJLA 2I4CA 4AB5A 3HHFA 2I0BA 2GH9A 3GXAA 4H5GA 2Y7IA 5CI5A 1NNFA 4GF8A 3T66A 4L17A 4TQUQ 4IO4A 1TFDA 1Y20A 3RN8A 3C31A 1EH3A 4I1DA 1MY0A 4QF9A 2VHAA 3CFZA 4XKRA 1VR5A 3N5LA 4FEDA 3KOTA 3DRHA 2GFEA 2XXIA 5H8NA 2O7UA 4Q5TA 3K1MA 4F22A 4IY6A 3ZKKA 3BFTA 1T0KA 3PPPA 2LAOA 4OEVA 3VV5A 4U4SA 1Y4TA 2FA7A 1O64A 3DRFA 3TTKA 1SD3A 2RKMA 2I3WA 1D4NA 3RY3A 1O7TA 2UYFA 1PC3A 1QULA 3E4RA 1SVXB 1FTJA 3QSLA 3LR1A 2HQ0A 3IB1A 3G3JA 3JZJA 3SEVA 2Z22A 3LSFB 4ZEKA 5B70A 1B58A 2OLBA 2RC7A 2H25A 3IK6B 4ZECA 4PQJA 1VFEA 3TPAA 1PB7A 5DTBA 2DS9A 3M3FA 3I6VA 4QSEA 4JB7A 5ISUA 1ZIUA 5ICTA 4E0XA 5IKBA 4F1YA 3DRGA 2DE2A 1AMFA 1FQCA 1I6BA 2RC9A 5TPAB 5AA3A 1D3KA 4FORA 1PBQA 4ESXA 4M4GA 4QFOA 1UTHB 1MH3A 1PBPA 2XXUA 3MPLA 1ZU0A 3PPOA 3O29A 2Z8FA 4F3BA 4FJPA 3USDA 3MW0A 3SETA 1FQEA 4OESA 4RK9A 4TLLB 4XIGQ 1VSOA 4BDNA 2V84A 4YMBA 1EZOA 5DT6A 4X1BA 4DXBA 1B32A 2V93A 3GBBA 3TCGA 2F5XA 1A55A 1BKAA 1Z7ME 1UTBA 4F31B 4YB6A 4KPTA 2RF1A 3OSRA 3D4GA 2I0CA 4NEDA 5I2KB 5I2NA 4XKNA 1NL5A 2RINA 2F7AA 4NF6B 2XXRA 4NWCA 4U2RA 4MLQA 3G3IA 2VP1A 3JYRA 3CFLA 1UIVA 5AA2D 1ZTYA 4EQ7A 1B1XA 4K3FA 1ZKBA 5IAIA 3FVOA 4NF8B 5H8QA 1B3EA 4JWYA 4F1VA 3TFLA 3KSJA 3MWBA 4OQOA 2CMOA 1RYXA 3K00A 4ZEBA 3CR9A 1RKMA 4R73A 3KN3A 3DLNA 3DRIA 1YPNA 1GTKA 3RT8A 3T96B 3B6QA 2HAVA 1DPPA 2PT1A 1NFTA 4R2FA 3IJXB 3TTRA 3QXMA 5JTYA 5I57A 4EDPA 2I6EA 2YJPA 3UN6A 1MQGA 3W15C 1H3DA 3MVWA 3EF7A 4YKJA 4GLIA 3MBPA 5ICQA 1HSLA 5AE4A 1BP5A 3FJMA 3OMBA 3O97A 2ONKE 2UVIA 4YB5A 3HCQA 4DXUA 1JW1A 1PEBA 3FXRA 3A3UA 1MXUA 2Q89A 4JDFA 4R75A 3TTNA 4KYSA 1B0HA 2W7YA 2A5TA 2XXYA 3CVGA 4RK2A 5FHOA 2ONSA 5I58B 2B4MA 1SQYA 1SYIA 4G8HA 4DIGA 3O28A 4RXLA 5H8FA 1FTMA 4WXJA 2HZKA 4G4PA 5A5XB 3K01A 5CM6A 3BFUA 4R2BA 3CSGA 2DOJA 3FJGA 3H4ZA 4IGRA 1H76A 1P1WA 3FGSA 3ZKLA 4XTCQ 1O63A 1NKXA 4H6DA 1N7XA 2H5YA 3LSLA 1A40A 2G93A 4AQ4A 1MPBA 2H9BA 3MUQA 1NH7A 1VFDA 1SDXA 1EZ9A 1H44A 3PV0E 4P0IA 4F29A 2NWJA 3VLUA 1OQHA 3RYAA 4DDDA 1MQHA 3HSTA 1MDP1 1B05A 1IITA 4ELOA 1I6QA 2DVCA 4Q0CA 3MVZA 3K2DA 1PDAA 3FZVA 2PX1A 2B4LA 1M5BA 1S9TA 3MP8A 1IEJA 1R6ZA 4BDOA 5KDTA 3OSQA 1FTKA 3VVFA 1MG1A 5KCJA 1JVYA 4OERA 3KN7A 1BLFA 4DLDA 4FE8A 3OO9A 4IO2A 2I58A 4G8MA 4C0RA 3VE1B 2O69A 4R72A 5JEIA 3TTLA 3DRKA 4P11A 5H8HB 2R71A 1F9BA 1MXZA 1OQGA 1GV8A 3T9XB 5I56A 1MY2A 5EHSA 1R9QA 1MQIA 1MXVA 4MFIA 4POWA 3T9UA 3IOVA 4QSDA 2D3IA 4N6PA 1XOCA 4H67A 2DYXA 3TCHA 2DWHA 1A99A 3KGCA 1POY1 2DXYA 1MM7A 1TFAA 3IL1B 3MC2A 5FHMA 4OEUA 3T9HB 4EQ9A 3RLFE 4GOTA 4KHZE 1URGA 3FUZA 5B7DA 5CMMA 2CZLA 3KOSA 3SEXA 4PFTA 2G29A 2GHAA 2I48A 4F3SA 1M5CA 3EQ1A 2NUVA 3CSBA 4R6HA 4YICA 1AOVA 3ONMA 2Z8EA 3V83A 3ILUB 1Q1KA 2REJA 2AL5A 2OWTA 3H3GA 5BUUA 1P1NA 1US4A 3PU5A 4N13A 4HCWA 4IGTA 4PFWA 2PBWA 1P1UA 4RY1A 4NF4A 1QW0A 4ECFA 1ATGA 4G68A 4BDQA 2DVZA 1B51A 1NNPA 2P0SA 2XXWA 1MQDA 1P1OA 1DOTA 1JVXA 2DWIA 3PMXA 4LZ8A 4C1TA 2DE4A 1M5FA 2PT2A 2A5SA 3PUXE 3O6IA 3PUWE 3O9PA 1B4HA 4U21A 3OENA 4F39A 3BKIB 4NF5B 1B5IA 1TWYA 3IB2A 3TQWA 3D4CA 3THIA 1MQJA 3OO6A 4H65A 5CMBA 1JEVA 3KBRA 4PE5B 3JV9A 4EXKA 3FVGA 2ZMBA 1N3XA 1LCFA 2DWAA 2V25A 3A09A 3H6TA 3MZ1A 1M5DA 4F2QA 3MZ9A 4HW8A 1MPDA 2AYSA 5JTYB 5I57B 4YB7A 4ZS9A 5TP9A 2Q88A 1LGBC 2REGA 3RYBA 3Q26A 1FTLA 3AXFA 4RYAA 3TQLA 3K0VA 3S4UA 5I59A 4F19A 2Q9TA 3QAXA 5I84A 4H8IA 2ONRA 3C9HA 3HHGA 1IXIA 5FHNA 1OMPA 3TAJA 4LATA 4LZ7A 2P1SA 3ZSFA 3C34A 1LBBA 2HAUA 5F7VA 1S50A 1JW4A 2X7PA 4LQ5A 4DE8A 2F35A 1D9YA 1UIUA 3MPKA 3U93A 2DWJA 4ZEIA 3C35A 1USYH 2QPQA 2XHDA 4AB6A 3O66A 5BWJA 4QFKA 4FIMA 4IO7A 4O3BA 2D5WA 1SI0A 2ZYOA 4KR5A 1MRPA 3ILTB 4U1ZA 3VVDA 2ANJA 3IOUA 1SYHA 3EHTA 4Q30B 2FNCA 4RJZA 5DEXB 4H8JA 3S9MC 3O2AA 2F34A 1AH5A 4KYEA 3RT6B 2ZXTA 2OK2A 2XXHA 1N7WA 1IXHA 5F1QA 2UXAA 4ZDMA 4DCYA 2O68A 1IQ7A 4YKIA 4YU0A 3TELA 1Y4CA 4UA8A 2GRVA 3IO6A 4EF2A 3ECRA 2AIXA 1D9VA 4G8NA 1Q35A 4GXSB 3VVEA 3RNNA 3S9EA 3G3HA 3L6GA 3KJ7A 3IOWA 5L8DA 5HM4B 3G3FA 3E13X 1B40A 3H06B 4I8CA 1LAHE 1CE2A 4YMAA 5L9OA 3EPEA 3OO8A 4GQOA 2ALUA 1OVBA 2QMXA 3IOTA 2PMSA 1QUJA 1QKAA 1JW5A 4F18A 2O1LA 3TODA 2Z8DA 1LAXA 4PFYA 4OVJA 2KLFA 3T22A 2WOKA 3KSXA 3LVUA 3TMGA 1FTOA 1B2HA 3CG3A 2O84X 4FEBA 5DVIA 3IAZA 3KFMA 3EN3A 1EZPA 1SW4A 3C4MA 1WODA 2X26A 3CFXA 1XVXA 3G7WA 3W9VA 1DTGA 3OOAA 1US5A 3MP1A 3U94A 3DP8A 3L6HA
chains in the Genus database with same CATH superfamily
4ELPA 2XWIA 3DP6A 4DZ1A 1JQFA 4XKPA 2R9JA 3LBSA 3MJNA 5DW8A 3OELA 4N8YA 5AA4A 2VD2A 1QGXA 4BDRA 1IIWA 2HFBA 4H1XA 3D1RA 1LB8A 1NH8A 4UACA 4GRKA 4THIA 4P1EA 1NV0A 3GBAA 2UYEA 4U23A 4R74A 2I4BA 4MH5A 3VXBA 5CC2A 3U1OA 4JBZA 4F1UA 4YAHX 1UQWA 1EU8A 2FYIA 3FIRA 3FVKA 4ZZEA 2XX9A 3EKIA 1DMBA 3IO4A 4QFLA 5I7IA 2DSFA 2F3BA 4Z0IA 3N94A 5IZ3A 3VXCA 4FAJA 2QL3A 4R9GA 5TPAA 2P2AA 5CRYA 1QKBA 4I3EA 1Q9DA 4U22A 3GZGA 4OFJA 1LCTA 2QS4A 2VD3A 2XD2A 4QBAA 1LBVA 1UTHA 1B6HA 4GL8A 2XXVA 3PUVE 1B3GA 1BIYA 2QS3A 3FATA 1SI1A 3PMVA 1A7LA 2WOLA 3R26A 2F7BA 4EF1A 3CI8A 4GIZA 1LFGA 1SW1A 4PFRA 1GR2A 3V5AA 1FPKA 2QRYA 2DP8A 3IORA 1P99A 2O6AA 2RCAA 5H8NB 2QS2A 1FPBA 4IO5A 1XC1A 1XT8A 4IB2A 2P3NA 4OVSA 1RDZA 2HXRA 5EQ9A 3IX1A 4Z7EA 5HPQA 1N84A 4YZZA 4MAGA 2V3TA 4TOZA 3PMWA 1LB9A 4O3CA 4FBPA 4PBHA 5I2KA 4PBQA 4ELRA 1FW0A 4U4XA 4NF6A 1NUXA 3PPRA 1Y3PA 3UORA 2CEYA 2GHBA 2Q8JA 3KG2A 1B52A 4DCXA 4N6DA 4OXVA 2UVGA 2YLNA 5J16A 2IA4A 4NF8A 4P1LA 3T0JA 2XX8A 1TT1A 2ZZVA 2Q2CA 1Y3NA 1IXCA 3Q27A 4H5FA 2WOPA 3M3LA 3BBRA 2VGQA 3SEUA 1HSJA 2B3BA 4ND9A 5EQ8A 1MY4A 3HO7A 4HTGA 5LDZA 2IEEA 3BIGA 1NV5A 3OEKA 5ELVA 3H03A 4MIJA 4JXIA 1L5TA 4R6KA 4HE2A 4EQBA 1N3WA 3QIMA 1LAGE 1KA0A 2ZNTA 3SZPA 3QYTA 4ZE9A 4X04A 2HHMA 4GVOA 4LUBA 1MXWA 4QRZA 3FXUA 5HBCA 1OLAA 3DP4A 4ISUA 3TKDA 2DXRA 3GYYA 1MS7A 3UP9A 1WVJA 2M8CA 1FQDA 5EYHA 1SW2A 4E0WA 3OXNA 3FJ7A 3V89B 1B0LA 1POTA 1IXGA 1FQBA 2PVUA 3K6UA 1MPCA 1FPLA 1OLCA 1JNFA 3KBZA 2O7IA 4N17A 2RC8A 3IR1A 4X8RA 4XKQA 3RUMA 4JWOA 4I62A 1LAFE 4NHBA 1LEVA 3GLBA 3OEMA 4LA9A 4F3GA 3KC1A 2JJKA 1SPIA 3VDFA 3C33A 1FBFA 4HCYA 4YKPA 5CMKA 1UTBB 2OX3A 4ELQA 3FVNA 4HE0A 2XXPA 3SESA 3E3KA 3E9XA 5J1DA 5I2NB 4N4UA 3S9NC 2XWOA 2H4IA 3MZBA 5AA2A 4ZE8A 4PTKA 4KCCA 1XVYA 1FSAA 4R9FA 3KEIA 5I58A 3FV2A 3K6XA 2E1SA 2V3UA 5EHMA 4X48A 1QUIA 4NG7A 3CIJA 2RCBA 5H8QB 1DK4A 5A5XA 3MVXA 4RNSA 4YKKA 3FTOA 1NV7A 3F11A 3PGFA 5K2YA 2OWSA 2Q8MA 4NTLA 2HXWA 5A5LA 3C32A 4NE4A 1LBWA 3CRBA 3HV1A 1N04A 3DELB 3T93B 1EYIA 2Y7RA 4MLVA 2H98A 5I3SA 1CB6A 3PUYE 2HZLA 3B7DA 4F3PA 1G0HA 4OENA 3UK4A 1NV3A 4NAPA 3T1BA 4ZEFA 3VLVA 2F6GA 4DI4B 1SW5A 2O51A 4KYDA 3IB0A 1B3FA 5LOMA 3Q29A 3RTFB 2D21A 3UIFA 4MNIA 4NN3A 2V3QA 2XX7A 3FD3A 5IZ1A 1KWHA 4PAKA 1B5JA 3RYDA 4G77A 5ITPA 3TZAA 4N07A 5ITOA 3U72A 3IFAA 1LSTA 2UVJA 2VPNA 4O3AA 1LLSA 5AA4B 5T3JA 3T9VA 1DSNA 1I6AA 1NNKA 2ABHA 3P7IA 3LC8A 1NNTA 1FBHA 4WEDA 3SKPA 2E0SA 5M2VA 3FV1A 4OVRA 5TU0A 3FXQA 4I9DA 3TDJA 3VLWA 1FQAA 5H8HA 4BLAA 1Y3QA 1A54A 2A5TB 2WBDA 5DVJA 3LV0A 3RPLA 3TTMA 3QMFA 1OIBA 1RYOA 1FRPA 4O7IA 4O8MA 1KA1A 5DYHA 3ZS6A 1LBCA 2QMWA 3WAFA 4LONB 1FBDA 3LSXA 3OO7A 3V8XB 5ET5A 2AL4A 5H8FB 1II5A 4KQPA 4OYVA 5EQAA 2GQ1A 4X9TA 2KQZA 4PP0A 4PCDA 2NXOA 1R1NA 5FTHA 3LUZA 1AL3A 4ONYA 3H6UA 5CBSA 4QFNA 3DRJA 2ZYKA 3ISPA 5CMCA 4PGNA 2Y7WA 4PETA 4EUOA 3SEWA 2F7CA 1HSEA 3BIHA 3OD7A 1B7HA 2HCAA 4LVQA 4KD5A 3SERA 2HEUA 4F2OA 5CBRA 2Y5LA 1FBCA 1PB8A 1URSA 1Y9UA 2FIXA 1ZLQA 1NV2A 3I3VA 1GGGA 3SEYA 4MBPA 1XS5A 4PFBA 1LFHA 4H0WA 1IMFA 3HPIA 1QUKA 3UA8A 1VDWA 3H6WA 1NV6A 4OHNA 5KDTB 1WDNA 5FTIA 3PD9A 1YAEA 2BJIA 2VOZA 3A3CA 5KCJB 1EYJA 2ZYMA 5AA1A 2XD3A 2Y7PA 1ZBMA 3PTYA 4GFRA 4G68C 4LQ2A 3M3KA 1MY1A 4P56A 5EYFA 2X7QA 4PDHA 4NF5A 1MDQA 3SDFA 4DI3D 5ESYA 1P1QA 3K02A 3ODBA 4TLMB 4R6YA 3K6VA 2XXQA 4PFIA 4GL0A 1Y1ZA 5I56B 1MXXA 4GWYA 4FECA 2F97A 1N0TA 3G3GA 3S9LC 3TUSA 1YXIA 4GWOA 1Y1MA 2OZZA 2WYPA 4P0GA 1B9JA 1B46A 1PB9A 1LFIA 1BTJA 4QXDA 3M8UA 2O1MA 3H7MA 4N8GA 4XXUA 4BDLA 2I3VA 4GD5A 1FJ9A 1ZMGA 3Q25A 1QVSA 2I49A 3TCFA 1B7UA 2F78A 4G2ZA 4AS5A 1H43A 1TXFA 3LSWA 1B5HA 2BJJX 3W9WA 4PGPA 3KJTA 1VE4A 4M1VA 3HN0A 1K9ZA 2F6PA 3FASA 4H45A 1QJMA 1JEUA 1IZ1A 3EHSA 1MM6A 4Q8RA 3PAMA 4OZ9A 3PPQA 2PYYA 1FCKA 4KCDA 1DPEA 2NVUB 2UVHA 2OBGA 2OJTA 4IY5A 4JSOA 2OCUA 4POXA 4ZEDA 1A8FA 1B1HA 4GXAA 4MNCA 2Q2AA 1MY3A 2F36A 4X1DA 2R6GE 2QSXA 4NWDA 4NF4B 5AA2B 4C1UA 1MH4A 4NQ8A 4OWDA 4G68B 1G0IA 2F8DA 2YPNA 4MJOA 2THIA 4PAIA 2WEFA 1GVCA 3S2VA 2CZKA 4EXLA 1INPA 3KN8A 1ELJA 4OFOA 4JWXA 2ZNSA 3QUFA 1MXYA 4N15A 3I5OA 3R6UA 2NOOA 4O7MA 2DDKA 3LUYA 1H45A 2PFYA 5DEXA 1XHYA 1FPDA 4OTEA 5K2XA 4LZ5A 2QJEA 2DQVA 3K1PA 1M5EA 3K4UA 1FPJA 4IO3A 1JETA 4GWXA 1J1NA 1YTVA 5JK4A 5DVFA 1B3HA 3U92A 2Y7KA 3DM0A 4OFLA 1NV4A 3MVYA 4GWWA 5IGAA 1I69A 5L9MA 1FBEA 2XXXA 4PFUA 3TEPA 4RA1A 4QFPA 3RQTA 3VFJA 3KZGA 5TP9B 4JSDA 1IUDA 1B7ZA 3EHUA 2Y84A 1SBPA 3N6TA 2QS1A 5ET6A 4HS7A 3IJOB 5L9SA 1Z7NE 3K6WA 3B6TA 2WKYA 5I59B 3O6GA 1USYE 3MP6A 3CHGA 4G61A 4N81A 4WKMA 4ZZAA 3RGYA 1DTZA 1D9QA 1N76A 3G3KA 5KZTA 4GBVA 4FATA 3PD8A 4KI0E 1URDA 2ZNUA 4MEVA 4OETA 3C36A 1ANFA 3K1NA 4DXCA 2B3FA 2CZIA 2KR0A 2XXTA 4JVCA 3PPNA 3N6UA 4P9KA 4U1OA 2FBPA 1A8EA 3CG1A 3WAEA 4NMYA 4BDMA 2ZYNA 3RPWA 3MQ9A 1NMUA 3RTWB 3TYHA 2XWVA 2H99A 1B3LA 1R9LA 5ET8A 1OVTA 1NUWA 4RPNA 3R7XA 3H6VA 4QHQA 2B65A 3UGWA 3B6WA 3Q28A 4WEPA 1YCJA 2ESNA 3QUJA 3O6HA 1B4ZA 3QK6A 1FQFA 2Z23A 5H8SA 4QSCA 3U8QA 3N26A 4IO6A 4MF3A 4ESWA 3O6PA 4RPOA 4OMBA 2FVZA 4KFQA 3PUZE 4LP2B 1AIVA 3MAMA 2DE3A 1YZ0A 1S7YA 1ZJLA 2I4CA 4AB5A 3HHFA 2I0BA 2GH9A 3GXAA 4H5GA 2Y7IA 5CI5A 1NNFA 4GF8A 3T66A 4L17A 2V4CA 4TQUQ 4IO4A 1TFDA 1Y20A 3RN8A 3C31A 1EH3A 4I1DA 5IM2A 5EQ7A 1MY0A 4XF5A 4QF9A 2VHAA 3CFZA 4XKRA 1VR5A 3N5LA 4FEDA 3KOTA 2QVVA 4MX6A 3DRHA 2GFEA 2XXIA 5H8NA 2O7UA 4Q5TA 3K1MA 4F22A 4IY6A 4OA4A 3ZKKA 3BFTA 1T0KA 3PPPA 2LAOA 4N6KA 4OEVA 3VV5A 4U4SA 1Y4TA 4OVPA 2FA7A 1O64A 3DRFA 3TTKA 1SD3A 2RKMA 2I3WA 1D4NA 3RY3A 1O7TA 2UYFA 4JVIA 4GWUA 1PC3A 1QULA 3E4RA 1SVXB 1FTJA 3QSLA 3LR1A 2HQ0A 3IB1A 3G3JA 4AS4A 3JZJA 3SEVA 2Z22A 3LSFB 1LBXA 4ZEKA 2R8TA 5B70A 1B58A 2Q74A 2OLBA 2RC7A 2H25A 3NOHA 3IK6B 4N91A 4ZECA 4PQJA 1VFEA 3TPAA 4PC9A 1PB7A 5DTBA 2DS9A 3MSTA 3M3FA 3I6VA 4QSEA 4JB7A 5ISUA 1ZIUA 5ICTA 4E0XA 5IKBA 4F1YA 3DRGA 2DE2A 1AMFA 1FQCA 1I6BA 2RC9A 5ET7A 5IZ3B 5TPAB 5AA3A 1D3KA 4FORA 1PBQA 4GX3A 4ESXA 4M4GA 4QFOA 1UTHB 1MH3A 1PBPA 2XXUA 3MPLA 1ZU0A 4GBWA 3PPOA 3O29A 2Z8FA 4F3BA 5LTCA 4FJPA 3USDA 3MW0A 3SETA 2FIEA 1FQEA 4OESA 4RK9A 4TLLB 4XIGQ 1VSOA 4BDNA 2V84A 4YMBA 1EZOA 5DT6A 4X1BA 4DXBA 1B32A 4PDDA 5EYGA 2V93A 3GBBA 3TCGA 2F5XA 1A55A 1BKAA 4OANA 1FPIA 1DCUA 1Z7ME 1UTBA 4F31B 4YB6A 4KPTA 2RF1A 4P3LA 3OSRA 3D4GA 2I0CA 4NEDA 5I2KB 5I2NA 4XKNA 1NL5A 4PE3A 2RINA 2F7AA 4NF6B 2XXRA 4NWCA 4PAFA 4U2RA 2HPGA 4NGUA 3FBPA 4MLQA 3G3IA 2ZZXA 2VP1A 3JYRA 3CFLA 1UIVA 5AA2D 1ZTYA 4EQ7A 1B1XA 4K3FA 1ZKBA 5IAIA 3FVOA 4NF8B 5H8QA 1B3EA 4JWYA 4F1VA 3TFLA 3HFUA 3KSJA 3MWBA 2Y5KA 4OQOA 2CMOA 1KZ8A 1RYXA 3K00A 4ZEBA 3CR9A 2QVRA 4NF0A 1RKMA 4R73A 3KN3A 3DLNA 3DRIA 1YPNA 4HE1A 1GTKA 3RT8A 3T96B 3B6QA 2HAVA 4HXVA 1DPPA 1XI6A 2QFLA 2PT1A 1NFTA 4R2FA 3IJXB 3TTRA 3QXMA 2XA5A 5I57A 5JTYA 4EDPA 2I6EA 2YJPA 3UN6A 1MQGA 3W15C 1H3DA 3MVWA 3EF7A 4YKJA 4GLIA 3MBPA 5ICQA 1HSLA 5AE4A 1BP5A 3FJMA 3OMBA 3O97A 4IR8A 2ONKE 2UVIA 4YB5A 3HCQA 4DXUA 1JW1A 1PEBA 3FXBA 3FXRA 3A3UA 1MXUA 2Q89A 2FHYA 4JDFA 4R75A 3TTNA 4KYSA 1B0HA 2W7YA 2A5TA 2F3DA 2XXYA 3CVGA 4RK2A 5FHOA 2PFZA 1FBPA 2ONSA 5I58B 2B4MA 1SQYA 1SYIA 4G8HA 4DIGA 3O28A 4RXLA 5H8FA 1FTMA 4WXJA 2HZKA 4G4PA 5A5XB 3K01A 5CM6A 3BFUA 4R2BA 3CSGA 2DOJA 3FJGA 3H4ZA 4IGRA 1H76A 1P1WA 3FGSA 3ZKLA 4XTCQ 1O63A 1NKXA 4H6DA 1N7XA 2H5YA 3LSLA 1A40A 1IMEA 2G93A 4AQ4A 1MPBA 4P8BA 2H9BA 3MUQA 1NH7A 1VFDA 1SDXA 1FPGA 1EZ9A 1H44A 1BK4A 3PV0E 4P0IA 3A29A 4F29A 1IMAA 4PF6A 2NWJA 3MYUA 3VLUA 1OQHA 2XXKA 3RYAA 4I40A 4DDDA 1MQHA 3HSTA 1MDP1 1B05A 1IITA 4ELOA 1I6QA 2DVCA 4Q0CA 3MVZA 3K2DA 1PDAA 3FZVA 2PX1A 2B4LA 1M5BA 1S9TA 3MP8A 1IEJA 1R6ZA 4OVTA 4BDOA 5KDTA 4LN5A 3OSQA 1FTKA 3VVFA 1MG1A 4OVQA 5KCJA 1JVYA 4XEQA 4OERA 3KN7A 1BLFA 4DLDA 1FBGA 4FE8A 2WBBA 3OO9A 4IO2A 2I58A 4G8MA 3ROJA 4C0RA 3VE1B 2O69A 4R72A 5JEIA 1JP4A 4JVDA 3TTLA 3DRKA 4P11A 5H8HB 2R71A 1F9BA 1MXZA 1OQGA 4MMPA 1GV8A 3T9XB 5I56A 3RPLB 1MY2A 5EHSA 1R9QA 1MQIA 1MXVA 4MFIA 4NX1A 4POWA 5F24A 3T9UA 3IOVA 4QSDA 2D3IA 4N6PA 4GWSA 1XOCA 4H67A 2DYXA 3TCHA 2DWHA 1A99A 3KGCA 1POY1 2DXYA 1MM7A 1TFAA 3IL1B 3MC2A 5FHMA 4OEUA 3IFCA 1FTAA 3T9HB 4EQ9A 3RLFE 2CZHA 4GOTA 2QVUA 4KHZE 1URGA 3FUZA 5B7DA 4MNPA 5CMMA 2CZLA 3KOSA 3SEXA 4PFTA 2G29A 2GHAA 2I48A 4F3SA 1M5CA 1IMBA 3EQ1A 1NUZA 2NUVA 3CSBA 4R6HA 4YICA 1AOVA 3ONMA 2Z8EA 3V83A 3ILUB 1Q1KA 2REJA 2AL5A 2OWTA 3H3GA 5BUUA 1P1NA 4PF8A 1US4A 3PU5A 4N13A 1AWBA 4HCWA 5I5PA 4IGTA 1RDYA 4PFWA 4P47A 2PBWA 1P1UA 4RY1A 4NF4A 1QW0A 4ECFA 1ATGA 4G68A 4BDQA 2DVZA 1B51A 1NNPA 2P0SA 2XXWA 1MQDA 1P1OA 1DOTA 1JVXA 2DWIA 3PMXA 4LZ8A 4C1TA 2DE4A 1M5FA 2PT2A 2A5SA 3PUXE 3O6IA 3PUWE 3O9PA 1B4HA 4U21A 4KXPA 3OENA 4F39A 5FBPA 3BKIB 3B8BA 4NF5B 1B5IA 1TWYA 3IB2A 3TQWA 3D4CA 3THIA 1MQJA 3OO6A 4H65A 5CMBA 1JEVA 1CNQA 3KBRA 4PE5B 3JV9A 4EXKA 3FVGA 2ZMBA 4H46A 2WYKA 1N3XA 1LCFA 2DWAA 2V25A 3A09A 4MHFA 1LBZA 3H6TA 3MZ1A 1M5DA 4F2QA 3MZ9A 4HW8A 3E78A 1MPDA 2L5VA 2AYSA 1EYKA 2WX9A 5JTYB 5I57B 2ZZWA 4YB7A 4ZS9A 5TP9A 4I3YA 2Q88A 1LGBC 2REGA 3RYBA 3Q26A 1FTLA 3AXFA 4RYAA 1K9YA 3TQLA 3K0VA 3S4UA 5I59A 4F19A 2Q9TA 1LBYA 3QAXA 5I84A 1NUYA 4H8IA 2ONRA 3C9HA 3HHGA 1IXIA 5FHNA 1OMPA 3TAJA 1NI9A 4LATA 4LZ7A 2P1SA 3ZSFA 3C34A 1LBBA 2HAUA 5F7VA 1S50A 1JW4A 2X7PA 1FJ6A 4LQ5A 4DE8A 2F35A 4MCOA 1D9YA 1UIUA 3MPKA 3U93A 2DWJA 4ZEIA 3C35A 4GWZA 1USYH 2QPQA 2XHDA 4AB6A 3O66A 5BWJA 4QFKA 4FIMA 4IO7A 4O3BA 2D5WA 1SI0A 2ZYOA 4KR5A 1MRPA 3ILTB 4U1ZA 3VVDA 2ANJA 3E79A 3IOUA 1SYHA 3EHTA 1YYZA 4Q30B 2FNCA 4RJZA 5DEXB 4H8JA 3S9MC 3O2AA 2F34A 1AH5A 4KYEA 3RT6B 1FPEA 2ZXTA 2OK2A 2P3VA 2XXHA 1N7WA 1IXHA 5F1QA 2UXAA 4ZDMA 4DCYA 2O68A 1IQ7A 2MKZA 4YKIA 4YU0A 3TELA 1Y4CA 3B50A 4UA8A 2GRVA 3IO6A 4XFEA 3U65A 4EF2A 3ECRA 4GX6A 2AIXA 1D9VA 4G8NA 1Q35A 4GXSB 3VVEA 3RNNA 3S9EA 2VPOA 3G3HA 4O94A 3L6GA 3KJ7A 3IOWA 5L8DA 5HM4B 2OWZA 3G3FA 3E13X 1B40A 3H06B 4I8CA 1LAHE 1CE2A 4YMAA 5L9OA 3EPEA 1FPFA 1NV1A 3OO8A 2VT5A 1DBZA 4GQOA 2ALUA 1OVBA 2QMXA 3IOTA 2PMSA 1QUJA 1QKAA 4UABA 1IMDA 1JW5A 4GX4A 5IZZA 4F18A 2O1LA 3TODA 2Z8DA 1LAXA 2CEXA 4PFYA 4OVJA 2KLFA 3T22A 2PCRA 2WOKA 3KSXA 3KC0A 3LVUA 3TMGA 1FTOA 1B2HA 3CG3A 2O84X 4FEBA 5DVIA 3IAZA 3KFMA 1IMCA 3EN3A 1EZPA 2XWKA 1SW4A 3C4MA 1WODA 2X26A 3CFXA 1XVXA 1RDXA 3G7WA 3W9VA 1DTGA 3OOAA 1US5A 3MP1A 3U94A 3DP8A 3L6HA
chains in the Genus database with same CATH topology
4ELPA 3DP6A 4DZ1A 1JQFA 4XKPA 2R9JA 3LBSA 3MJNA 3OELA 5AA4A 2VD2A 4BDRA 1IIWA 2HFBA 4H1XA 1LB8A 1NH8A 4UACA 4GRKA 4THIA 3GBAA 2UYEA 4U23A 4R74A 2I4BA 4MH5A 3VXBA 5CC2A 3U1OA 4JBZA 4F1UA 4YAHX 1UQWA 1EU8A 2FYIA 3FIRA 3FVKA 4ZZEA 2XX9A 1DMBA 3IO4A 4QFLA 2DSFA 4Z0IA 3N94A 3VXCA 4FAJA 2QL3A 4R9GA 5TPAA 2P2AA 5CRYA 1QKBA 4U22A 3GZGA 4OFJA 1LCTA 2QS4A 2VD3A 2XD2A 1UTHA 1B6HA 4GL8A 2XXVA 3PUVE 1B3GA 1BIYA 2QS3A 3FATA 1SI1A 3PMVA 1A7LA 2WOLA 3R26A 2F7BA 4EF1A 3CI8A 4GIZA 1LFGA 1SW1A 1GR2A 3V5AA 2QRYA 2DP8A 3IORA 1P99A 2O6AA 2RCAA 5H8NB 2QS2A 4IO5A 1XC1A 1XT8A 4IB2A 3IX1A 4Z7EA 5HPQA 1N84A 4YZZA 2V3TA 4TOZA 3PMWA 1LB9A 4O3CA 5I2KA 4ELRA 1FW0A 4U4XA 4NF6A 3PPRA 1Y3PA 3UORA 2GHBA 2Q8JA 3KG2A 1B52A 4DCXA 4OXVA 2UVGA 2YLNA 2IA4A 4NF8A 2XX8A 1TT1A 2Q2CA 1Y3NA 1IXCA 3Q27A 4H5FA 2WOPA 3M3LA 3BBRA 2VGQA 3SEUA 1HSJA 2B3BA 4ND9A 1MY4A 3HO7A 4HTGA 2IEEA 3OEKA 5ELVA 3H03A 4JXIA 1L5TA 4R6KA 4EQBA 1N3WA 3QIMA 1LAGE 2ZNTA 3QYTA 4ZE9A 4GVOA 4LUBA 1MXWA 4QRZA 3FXUA 5HBCA 1OLAA 3DP4A 4ISUA 3TKDA 2DXRA 1MS7A 3UP9A 1WVJA 2M8CA 1FQDA 1SW2A 4E0WA 3OXNA 3FJ7A 3V89B 1B0LA 1POTA 1IXGA 1FQBA 2PVUA 3K6UA 1MPCA 1OLCA 1JNFA 2O7IA 2RC8A 3IR1A 4XKQA 3RUMA 4JWOA 4I62A 1LAFE 3GLBA 3OEMA 4LA9A 4F3GA 3VDFA 3C33A 4HCYA 4YKPA 5CMKA 1UTBB 4ELQA 3FVNA 2XXPA 3SESA 3E3KA 3E9XA 5J1DA 5I2NB 3S9NC 2H4IA 3MZBA 5AA2A 4ZE8A 4KCCA 1XVYA 4R9FA 3KEIA 5I58A 3FV2A 3K6XA 2E1SA 2V3UA 5EHMA 4X48A 1QUIA 3CIJA 2RCBA 5H8QB 5A5XA 3MVXA 4RNSA 4YKKA 3FTOA 3F11A 3PGFA 5K2YA 2OWSA 4NTLA 2HXWA 3C32A 4NE4A 3CRBA 3HV1A 1N04A 3DELB 3T93B 2Y7RA 4MLVA 2H98A 1CB6A 3PUYE 2HZLA 3B7DA 4F3PA 4OENA 3UK4A 4ZEFA 3VLVA 2F6GA 1SW5A 2O51A 4KYDA 3IB0A 1B3FA 5LOMA 3Q29A 3RTFB 2D21A 3UIFA 2V3QA 2XX7A 3FD3A 1KWHA 1B5JA 4G77A 5ITPA 3TZAA 4N07A 5ITOA 3U72A 1LSTA 2UVJA 4O3AA 1LLSA 5AA4B 3T9VA 1DSNA 1I6AA 1NNKA 2ABHA 3P7IA 3LC8A 1NNTA 4WEDA 3SKPA 2E0SA 5M2VA 3FV1A 5TU0A 3FXQA 4I9DA 3TDJA 3VLWA 1FQAA 5H8HA 4BLAA 1Y3QA 1A54A 2A5TB 5DVJA 3TTMA 1OIBA 1RYOA 5DYHA 3ZS6A 1LBCA 2QMWA 3WAFA 4LONB 3LSXA 3OO7A 3V8XB 2AL4A 5H8FB 1II5A 4KQPA 4OYVA 4X9TA 4PP0A 2NXOA 1R1NA 5FTHA 1AL3A 4ONYA 3H6UA 5CBSA 4QFNA 3DRJA 2ZYKA 5CMCA 2Y7WA 4PETA 4EUOA 3SEWA 2F7CA 1HSEA 3OD7A 1B7HA 2HCAA 4LVQA 4KD5A 3SERA 2HEUA 4F2OA 5CBRA 1PB8A 1URSA 1Y9UA 1ZLQA 3I3VA 1GGGA 3SEYA 4MBPA 1XS5A 1LFHA 4H0WA 3HPIA 1QUKA 3UA8A 3H6WA 4OHNA 5KDTB 1WDNA 5FTIA 3PD9A 1YAEA 2VOZA 3A3CA 5KCJB 2ZYMA 5AA1A 2XD3A 2Y7PA 1ZBMA 4GFRA 4G68C 4LQ2A 3M3KA 1MY1A 5EYFA 2X7QA 4NF5A 1MDQA 3SDFA 1P1QA 3K02A 3ODBA 4TLMB 4R6YA 3K6VA 2XXQA 4GL0A 1Y1ZA 5I56B 1MXXA 4FECA 2F97A 1N0TA 3G3GA 3S9LC 3TUSA 4GWOA 1Y1MA 2OZZA 4P0GA 1B9JA 1B46A 1PB9A 1LFIA 1BTJA 3M8UA 2O1MA 3H7MA 4XXUA 4BDLA 2I3VA 4GD5A 1ZMGA 3Q25A 1QVSA 2I49A 3TCFA 1B7UA 2F78A 4G2ZA 1H43A 1TXFA 3LSWA 1B5HA 2BJJX 3W9WA 3KJTA 1VE4A 4M1VA 3HN0A 2F6PA 3FASA 1QJMA 1JEUA 1IZ1A 3EHSA 1MM6A 4Q8RA 3PAMA 4OZ9A 3PPQA 2PYYA 1FCKA 4KCDA 1DPEA 2NVUB 2UVHA 2OBGA 2OJTA 4IY5A 4JSOA 2OCUA 4POXA 4ZEDA 1A8FA 1B1HA 4GXAA 2Q2AA 1MY3A 2F36A 4X1DA 2R6GE 2QSXA 4NWDA 4NF4B 5AA2B 4C1UA 1MH4A 4OWDA 4G68B 2F8DA 2YPNA 2THIA 1GVCA 3S2VA 4EXLA 3KN8A 1ELJA 4OFOA 4JWXA 2ZNSA 3QUFA 1MXYA 3I5OA 3R6UA 2NOOA 3LUYA 1H45A 5DEXA 1XHYA 4OTEA 5K2XA 4LZ5A 2QJEA 2DQVA 3K1PA 1M5EA 3K4UA 4IO3A 1JETA 1J1NA 1YTVA 5JK4A 5DVFA 1B3HA 3U92A 2Y7KA 3DM0A 4OFLA 3MVYA 1I69A 5L9MA 2XXXA 4PFUA 3TEPA 4RA1A 4QFPA 3RQTA 3VFJA 3KZGA 5TP9B 4JSDA 1IUDA 1B7ZA 3EHUA 2Y84A 1SBPA 3N6TA 2QS1A 4HS7A 3IJOB 5L9SA 1Z7NE 3K6WA 3B6TA 2WKYA 5I59B 3O6GA 1USYE 3MP6A 3CHGA 4WKMA 4ZZAA 3RGYA 1DTZA 1N76A 3G3KA 5KZTA 4FATA 3PD8A 4KI0E 1URDA 2ZNUA 4OETA 3C36A 1ANFA 3K1NA 4DXCA 2B3FA 2XXTA 3PPNA 3N6UA 4U1OA 1A8EA 3CG1A 3WAEA 4NMYA 4BDMA 2ZYNA 3RPWA 3MQ9A 1NMUA 3RTWB 3TYHA 2H99A 1B3LA 1R9LA 1OVTA 4RPNA 3R7XA 3H6VA 4QHQA 2B65A 3UGWA 3B6WA 3Q28A 4WEPA 1YCJA 2ESNA 3QUJA 3O6HA 1B4ZA 3QK6A 1FQFA 2Z23A 5H8SA 4QSCA 3U8QA 3N26A 4IO6A 4MF3A 4ESWA 3O6PA 4RPOA 4OMBA 4KFQA 4LP2B 3PUZE 1AIVA 3MAMA 2DE3A 1S7YA 1ZJLA 2I4CA 4AB5A 3HHFA 2I0BA 2GH9A 3GXAA 4H5GA 2Y7IA 5CI5A 1NNFA 4GF8A 3T66A 4L17A 4TQUQ 4IO4A 1TFDA 1Y20A 3RN8A 3C31A 1EH3A 4I1DA 1MY0A 4QF9A 2VHAA 3CFZA 4XKRA 1VR5A 3N5LA 4FEDA 3KOTA 3DRHA 2GFEA 2XXIA 5H8NA 2O7UA 4Q5TA 3K1MA 4F22A 4IY6A 3ZKKA 3BFTA 1T0KA 3PPPA 2LAOA 4OEVA 3VV5A 4U4SA 1Y4TA 2FA7A 1O64A 3DRFA 3TTKA 1SD3A 2RKMA 2I3WA 1D4NA 3RY3A 1O7TA 2UYFA 1PC3A 1QULA 3E4RA 1SVXB 1FTJA 3QSLA 3LR1A 2HQ0A 3IB1A 3G3JA 3JZJA 3SEVA 2Z22A 3LSFB 4ZEKA 5B70A 1B58A 2OLBA 2RC7A 2H25A 3IK6B 4ZECA 4PQJA 1VFEA 3TPAA 1PB7A 5DTBA 2DS9A 3M3FA 3I6VA 4QSEA 4JB7A 5ISUA 1ZIUA 5ICTA 4E0XA 5IKBA 4F1YA 3DRGA 2DE2A 1AMFA 1FQCA 1I6BA 2RC9A 5TPAB 5AA3A 1D3KA 4FORA 1PBQA 4ESXA 4M4GA 4QFOA 1UTHB 1MH3A 1PBPA 2XXUA 3MPLA 1ZU0A 3PPOA 3O29A 2Z8FA 4F3BA 4FJPA 3USDA 3MW0A 3SETA 1FQEA 4OESA 4RK9A 4TLLB 4XIGQ 1VSOA 4BDNA 2V84A 4YMBA 1EZOA 5DT6A 4X1BA 4DXBA 1B32A 2V93A 3GBBA 3TCGA 2F5XA 1A55A 1BKAA 1Z7ME 1UTBA 4F31B 4YB6A 4KPTA 2RF1A 3OSRA 3D4GA 2I0CA 4NEDA 5I2KB 5I2NA 4XKNA 1NL5A 2RINA 2F7AA 4NF6B 2XXRA 4NWCA 4U2RA 4MLQA 3G3IA 2VP1A 3JYRA 3CFLA 1UIVA 5AA2D 1ZTYA 4EQ7A 1B1XA 4K3FA 1ZKBA 5IAIA 3FVOA 4NF8B 5H8QA 1B3EA 4JWYA 4F1VA 3TFLA 3KSJA 3MWBA 4OQOA 2CMOA 1RYXA 3K00A 4ZEBA 3CR9A 1RKMA 4R73A 3KN3A 3DLNA 3DRIA 1YPNA 1GTKA 3RT8A 3T96B 3B6QA 2HAVA 1DPPA 2PT1A 1NFTA 4R2FA 3IJXB 3TTRA 3QXMA 5JTYA 5I57A 4EDPA 2I6EA 2YJPA 3UN6A 1MQGA 3W15C 1H3DA 3MVWA 3EF7A 4YKJA 4GLIA 3MBPA 5ICQA 1HSLA 5AE4A 1BP5A 3FJMA 3OMBA 3O97A 2ONKE 2UVIA 4YB5A 3HCQA 4DXUA 1JW1A 1PEBA 3FXRA 3A3UA 1MXUA 2Q89A 4JDFA 4R75A 3TTNA 4KYSA 1B0HA 2W7YA 2A5TA 2XXYA 3CVGA 4RK2A 5FHOA 2ONSA 5I58B 2B4MA 1SQYA 1SYIA 4G8HA 4DIGA 3O28A 4RXLA 5H8FA 1FTMA 4WXJA 2HZKA 4G4PA 5A5XB 3K01A 5CM6A 3BFUA 4R2BA 3CSGA 2DOJA 3FJGA 3H4ZA 4IGRA 1H76A 1P1WA 3FGSA 3ZKLA 4XTCQ 1O63A 1NKXA 4H6DA 1N7XA 2H5YA 3LSLA 1A40A 2G93A 4AQ4A 1MPBA 2H9BA 3MUQA 1NH7A 1VFDA 1SDXA 1EZ9A 1H44A 3PV0E 4P0IA 4F29A 2NWJA 3VLUA 1OQHA 3RYAA 4DDDA 1MQHA 3HSTA 1MDP1 1B05A 1IITA 4ELOA 1I6QA 2DVCA 4Q0CA 3MVZA 3K2DA 1PDAA 3FZVA 2PX1A 2B4LA 1M5BA 1S9TA 3MP8A 1IEJA 1R6ZA 4BDOA 5KDTA 3OSQA 1FTKA 3VVFA 1MG1A 5KCJA 1JVYA 4OERA 3KN7A 1BLFA 4DLDA 4FE8A 3OO9A 4IO2A 2I58A 4G8MA 4C0RA 3VE1B 2O69A 4R72A 5JEIA 3TTLA 3DRKA 4P11A 5H8HB 2R71A 1F9BA 1MXZA 1OQGA 1GV8A 3T9XB 5I56A 1MY2A 5EHSA 1R9QA 1MQIA 1MXVA 4MFIA 4POWA 3T9UA 3IOVA 4QSDA 2D3IA 4N6PA 1XOCA 4H67A 2DYXA 3TCHA 2DWHA 1A99A 3KGCA 1POY1 2DXYA 1MM7A 1TFAA 3IL1B 3MC2A 5FHMA 4OEUA 3T9HB 4EQ9A 3RLFE 4GOTA 4KHZE 1URGA 3FUZA 5B7DA 5CMMA 2CZLA 3KOSA 3SEXA 4PFTA 2G29A 2GHAA 2I48A 4F3SA 1M5CA 3EQ1A 2NUVA 3CSBA 4R6HA 4YICA 1AOVA 3ONMA 2Z8EA 3V83A 3ILUB 1Q1KA 2REJA 2AL5A 2OWTA 3H3GA 5BUUA 1P1NA 1US4A 3PU5A 4N13A 4HCWA 4IGTA 4PFWA 2PBWA 1P1UA 4RY1A 4NF4A 1QW0A 4ECFA 1ATGA 4G68A 4BDQA 2DVZA 1B51A 1NNPA 2P0SA 2XXWA 1MQDA 1P1OA 1DOTA 1JVXA 2DWIA 3PMXA 4LZ8A 4C1TA 2DE4A 1M5FA 2PT2A 2A5SA 3PUXE 3O6IA 3PUWE 3O9PA 1B4HA 4U21A 3OENA 4F39A 3BKIB 4NF5B 1B5IA 1TWYA 3IB2A 3TQWA 3D4CA 3THIA 1MQJA 3OO6A 4H65A 5CMBA 1JEVA 3KBRA 4PE5B 3JV9A 4EXKA 3FVGA 2ZMBA 1N3XA 1LCFA 2DWAA 2V25A 3A09A 3H6TA 3MZ1A 1M5DA 4F2QA 3MZ9A 4HW8A 1MPDA 2AYSA 5JTYB 5I57B 4YB7A 4ZS9A 5TP9A 2Q88A 1LGBC 2REGA 3RYBA 3Q26A 1FTLA 3AXFA 4RYAA 3TQLA 3K0VA 3S4UA 5I59A 4F19A 2Q9TA 3QAXA 5I84A 4H8IA 2ONRA 3C9HA 3HHGA 1IXIA 5FHNA 1OMPA 3TAJA 4LATA 4LZ7A 2P1SA 3ZSFA 3C34A 1LBBA 2HAUA 5F7VA 1S50A 1JW4A 2X7PA 4LQ5A 4DE8A 2F35A 1D9YA 1UIUA 3MPKA 3U93A 2DWJA 4ZEIA 3C35A 1USYH 2QPQA 2XHDA 4AB6A 3O66A 5BWJA 4QFKA 4FIMA 4IO7A 4O3BA 2D5WA 1SI0A 2ZYOA 4KR5A 1MRPA 3ILTB 4U1ZA 3VVDA 2ANJA 3IOUA 1SYHA 3EHTA 4Q30B 2FNCA 4RJZA 5DEXB 4H8JA 3S9MC 3O2AA 2F34A 1AH5A 4KYEA 3RT6B 2ZXTA 2OK2A 2XXHA 1N7WA 1IXHA 5F1QA 2UXAA 4ZDMA 4DCYA 2O68A 1IQ7A 4YKIA 4YU0A 3TELA 1Y4CA 4UA8A 2GRVA 3IO6A 4EF2A 3ECRA 2AIXA 1D9VA 4G8NA 1Q35A 4GXSB 3VVEA 3RNNA 3S9EA 3G3HA 3L6GA 3KJ7A 3IOWA 5L8DA 5HM4B 3G3FA 3E13X 1B40A 3H06B 4I8CA 1LAHE 1CE2A 4YMAA 5L9OA 3EPEA 3OO8A 4GQOA 2ALUA 1OVBA 2QMXA 3IOTA 2PMSA 1QUJA 1QKAA 1JW5A 4F18A 2O1LA 3TODA 2Z8DA 1LAXA 4PFYA 4OVJA 2KLFA 3T22A 2WOKA 3KSXA 3LVUA 3TMGA 1FTOA 1B2HA 3CG3A 2O84X 4FEBA 5DVIA 3IAZA 3KFMA 3EN3A 1EZPA 1SW4A 3C4MA 1WODA 2X26A 3CFXA 1XVXA 3G7WA 3W9VA 1DTGA 3OOAA 1US5A 3MP1A 3U94A 3DP8A 3L6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELP A;  3DP6 A;  4DZ1 A;  1JQF A;  4XKP A;  2R9J A;  3LBS A;  3MJN A;  3OEL A;  5AA4 A;  2VD2 A;  4BDR A;  1IIW A;  2HFB A;  4H1X A;  1LB8 A;  1NH8 A;  4UAC A;  4GRK A;  4THI A;  3GBA A;  2UYE A;  4U23 A;  4R74 A;  2I4B A;  4MH5 A;  3VXB A;  5CC2 A;  3U1O A;  4JBZ A;  4F1U A;  4YAH X;  1UQW A;  1EU8 A;  2FYI A;  3FIR A;  3FVK A;  4ZZE A;  2XX9 A;  1DMB A;  3IO4 A;  4QFL A;  2DSF A;  4Z0I A;  3N94 A;  3VXC A;  4FAJ A;  2QL3 A;  4R9G A;  5TPA A;  2P2A A;  5CRY A;  1QKB A;  4U22 A;  3GZG A;  4OFJ A;  1LCT A;  2QS4 A;  2VD3 A;  2XD2 A;  1UTH A;  1B6H A;  4GL8 A;  2XXV A;  3PUV E;  1B3G A;  1BIY A;  2QS3 A;  3FAT A;  1SI1 A;  3PMV A;  1A7L A;  2WOL A;  3R26 A;  2F7B A;  4EF1 A;  3CI8 A;  4GIZ A;  1LFG A;  1SW1 A;  1GR2 A;  3V5A A;  2QRY A;  2DP8 A;  3IOR A;  1P99 A;  2O6A A;  2RCA A;  5H8N B;  2QS2 A;  4IO5 A;  1XC1 A;  1XT8 A;  4IB2 A;  3IX1 A;  4Z7E A;  5HPQ A;  1N84 A;  4YZZ A;  2V3T A;  4TOZ A;  3PMW A;  1LB9 A;  4O3C A;  5I2K A;  4ELR A;  1FW0 A;  4U4X A;  4NF6 A;  3PPR A;  1Y3P A;  3UOR A;  2GHB A;  2Q8J A;  3KG2 A;  1B52 A;  4DCX A;  4OXV A;  2UVG A;  2YLN A;  2IA4 A;  4NF8 A;  2XX8 A;  1TT1 A;  2Q2C A;  1Y3N A;  1IXC A;  3Q27 A;  4H5F A;  2WOP A;  3M3L A;  3BBR A;  2VGQ A;  3SEU A;  1HSJ A;  2B3B A;  4ND9 A;  1MY4 A;  3HO7 A;  4HTG A;  2IEE A;  3OEK A;  5ELV A;  3H03 A;  4JXI A;  1L5T A;  4R6K A;  4EQB A;  1N3W A;  3QIM A;  1LAG E;  2ZNT A;  3QYT A;  4ZE9 A;  4GVO A;  4LUB A;  1MXW A;  4QRZ A;  3FXU A;  5HBC A;  1OLA A;  3DP4 A;  4ISU A;  3TKD A;  2DXR A;  1MS7 A;  3UP9 A;  1WVJ A;  2M8C A;  1FQD A;  1SW2 A;  4E0W A;  3OXN A;  3FJ7 A;  3V89 B;  1B0L A;  1POT A;  1IXG A;  1FQB A;  2PVU A;  3K6U A;  1MPC A;  1OLC A;  1JNF A;  2O7I A;  2RC8 A;  3IR1 A;  4XKQ A;  3RUM A;  4JWO A;  4I62 A;  1LAF E;  3GLB A;  3OEM A;  4LA9 A;  4F3G A;  3VDF A;  3C33 A;  4HCY A;  4YKP A;  5CMK A;  1UTB B;  4ELQ A;  3FVN A;  2XXP A;  3SES A;  3E3K A;  3E9X A;  5J1D A;  5I2N B;  3S9N C;  2H4I A;  3MZB A;  5AA2 A;  4ZE8 A;  4KCC A;  1XVY A;  4R9F A;  3KEI A;  5I58 A;  3FV2 A;  3K6X A;  2E1S A;  2V3U A;  5EHM A;  4X48 A;  1QUI A;  3CIJ A;  2RCB A;  5H8Q B;  5A5X A;  3MVX A;  4RNS A;  4YKK A;  3FTO A;  3F11 A;  3PGF A;  5K2Y A;  2OWS A;  4NTL A;  2HXW A;  3C32 A;  4NE4 A;  3CRB A;  3HV1 A;  1N04 A;  3DEL B;  3T93 B;  2Y7R A;  4MLV A;  2H98 A;  1CB6 A;  3PUY E;  2HZL A;  3B7D A;  4F3P A;  4OEN A;  3UK4 A;  4ZEF A;  3VLV A;  2F6G A;  1SW5 A;  2O51 A;  4KYD A;  3IB0 A;  1B3F A;  5LOM A;  3Q29 A;  3RTF B;  2D21 A;  3UIF A;  2V3Q A;  2XX7 A;  3FD3 A;  1KWH A;  1B5J A;  4G77 A;  5ITP A;  3TZA A;  4N07 A;  5ITO A;  3U72 A;  1LST A;  2UVJ A;  4O3A A;  1LLS A;  5AA4 B;  3T9V A;  1DSN A;  1I6A A;  1NNK A;  2ABH A;  3P7I A;  3LC8 A;  1NNT A;  4WED A;  3SKP A;  2E0S A;  5M2V A;  3FV1 A;  5TU0 A;  3FXQ A;  4I9D A;  3TDJ A;  3VLW A;  1FQA A;  5H8H A;  4BLA A;  1Y3Q A;  1A54 A;  2A5T B;  5DVJ A;  3TTM A;  1OIB A;  1RYO A;  5DYH A;  3ZS6 A;  1LBC A;  2QMW A;  3WAF A;  4LON B;  3LSX A;  3OO7 A;  3V8X B;  2AL4 A;  5H8F B;  1II5 A;  4KQP A;  4OYV A;  4X9T A;  4PP0 A;  2NXO A;  1R1N A;  5FTH A;  1AL3 A;  4ONY A;  3H6U A;  5CBS A;  4QFN A;  3DRJ A;  2ZYK A;  5CMC A;  2Y7W A;  4PET A;  4EUO A;  3SEW A;  2F7C A;  1HSE A;  3OD7 A;  1B7H A;  2HCA A;  4LVQ A;  4KD5 A;  3SER A;  2HEU A;  4F2O A;  5CBR A;  1PB8 A;  1URS A;  1Y9U A;  1ZLQ A;  3I3V A;  1GGG A;  3SEY A;  4MBP A;  1XS5 A;  1LFH A;  4H0W A;  3HPI A;  1QUK A;  3UA8 A;  3H6W A;  4OHN A;  5KDT B;  1WDN A;  5FTI A;  3PD9 A;  1YAE A;  2VOZ A;  3A3C A;  5KCJ B;  2ZYM A;  5AA1 A;  2XD3 A;  2Y7P A;  1ZBM A;  4GFR A;  4G68 C;  4LQ2 A;  3M3K A;  1MY1 A;  5EYF A;  2X7Q A;  4NF5 A;  1MDQ A;  3SDF A;  1P1Q A;  3K02 A;  3ODB A;  4TLM B;  4R6Y A;  3K6V A;  2XXQ A;  4GL0 A;  1Y1Z A;  5I56 B;  1MXX A;  4FEC A;  2F97 A;  1N0T A;  3G3G A;  3S9L C;  3TUS A;  4GWO A;  1Y1M A;  2OZZ A;  4P0G A;  1B9J A;  1B46 A;  1PB9 A;  1LFI A;  1BTJ A;  3M8U A;  2O1M A;  3H7M A;  4XXU A;  4BDL A;  2I3V A;  4GD5 A;  1ZMG A;  3Q25 A;  1QVS A;  2I49 A;  3TCF A;  1B7U A;  2F78 A;  4G2Z A;  1H43 A;  1TXF A;  3LSW A;  1B5H A;  2BJJ X;  3W9W A;  3KJT A;  1VE4 A;  4M1V A;  3HN0 A;  2F6P A;  3FAS A;  1QJM A;  1JEU A;  1IZ1 A;  3EHS A;  1MM6 A;  4Q8R A;  3PAM A;  4OZ9 A;  3PPQ A;  2PYY A;  1FCK A;  4KCD A;  1DPE A;  2NVU B;  2UVH A;  2OBG A;  2OJT A;  4IY5 A;  4JSO A;  2OCU A;  4POX A;  4ZED A;  1A8F A;  1B1H A;  4GXA A;  2Q2A A;  1MY3 A;  2F36 A;  4X1D A;  2R6G E;  2QSX A;  4NWD A;  4NF4 B;  5AA2 B;  4C1U A;  1MH4 A;  4OWD A;  4G68 B;  2F8D A;  2YPN A;  2THI A;  1GVC A;  3S2V A;  4EXL A;  3KN8 A;  1ELJ A;  4OFO A;  4JWX A;  2ZNS A;  3QUF A;  1MXY A;  3I5O A;  3R6U A;  2NOO A;  3LUY A;  1H45 A;  5DEX A;  1XHY A;  4OTE A;  5K2X A;  4LZ5 A;  2QJE A;  2DQV A;  3K1P A;  1M5E A;  3K4U A;  4IO3 A;  1JET A;  1J1N A;  1YTV A;  5JK4 A;  5DVF A;  1B3H A;  3U92 A;  2Y7K A;  3DM0 A;  4OFL A;  3MVY A;  1I69 A;  5L9M A;  2XXX A;  4PFU A;  3TEP A;  4RA1 A;  4QFP A;  3RQT A;  3VFJ A;  3KZG A;  5TP9 B;  4JSD A;  1IUD A;  1B7Z A;  3EHU A;  2Y84 A;  1SBP A;  3N6T A;  2QS1 A;  4HS7 A;  3IJO B;  5L9S A;  1Z7N E;  3K6W A;  3B6T A;  2WKY A;  5I59 B;  3O6G A;  1USY E;  3MP6 A;  3CHG A;  4WKM A;  4ZZA A;  3RGY A;  1DTZ A;  1N76 A;  3G3K A;  5KZT A;  4FAT A;  3PD8 A;  4KI0 E;  1URD A;  2ZNU A;  4OET A;  3C36 A;  1ANF A;  3K1N A;  4DXC A;  2B3F A;  2XXT A;  3PPN A;  3N6U A;  4U1O A;  1A8E A;  3CG1 A;  3WAE A;  4NMY A;  4BDM A;  2ZYN A;  3RPW A;  3MQ9 A;  1NMU A;  3RTW B;  3TYH A;  2H99 A;  1B3L A;  1R9L A;  1OVT A;  4RPN A;  3R7X A;  3H6V A;  4QHQ A;  2B65 A;  3UGW A;  3B6W A;  3Q28 A;  4WEP A;  1YCJ A;  2ESN A;  3QUJ A;  3O6H A;  1B4Z A;  3QK6 A;  1FQF A;  2Z23 A;  5H8S A;  4QSC A;  3U8Q A;  3N26 A;  4IO6 A;  4MF3 A;  4ESW A;  3O6P A;  4RPO A;  4OMB A;  4KFQ A;  4LP2 B;  3PUZ E;  1AIV A;  3MAM A;  2DE3 A;  1S7Y A;  1ZJL A;  2I4C A;  4AB5 A;  3HHF A;  2I0B A;  2GH9 A;  3GXA A;  4H5G A;  2Y7I A;  5CI5 A;  1NNF A;  4GF8 A;  3T66 A;  4L17 A;  4TQU Q;  4IO4 A;  1TFD A;  1Y20 A;  3RN8 A;  3C31 A;  1EH3 A;  4I1D A;  1MY0 A;  4QF9 A;  2VHA A;  3CFZ A;  4XKR A;  1VR5 A;  3N5L A;  4FED A;  3KOT A;  3DRH A;  2GFE A;  2XXI A;  5H8N A;  2O7U A;  4Q5T A;  3K1M A;  4F22 A;  4IY6 A;  3ZKK A;  3BFT A;  1T0K A;  3PPP A;  2LAO A;  4OEV A;  3VV5 A;  4U4S A;  1Y4T A;  2FA7 A;  1O64 A;  3DRF A;  3TTK A;  1SD3 A;  2RKM A;  2I3W A;  1D4N A;  3RY3 A;  1O7T A;  2UYF A;  1PC3 A;  1QUL A;  3E4R A;  1SVX B;  1FTJ A;  3QSL A;  3LR1 A;  2HQ0 A;  3IB1 A;  3G3J A;  3JZJ A;  3SEV A;  2Z22 A;  3LSF B;  4ZEK A;  5B70 A;  1B58 A;  2OLB A;  2RC7 A;  2H25 A;  3IK6 B;  4ZEC A;  4PQJ A;  1VFE A;  3TPA A;  1PB7 A;  5DTB A;  2DS9 A;  3M3F A;  3I6V A;  4QSE A;  4JB7 A;  5ISU A;  1ZIU A;  5ICT A;  4E0X A;  5IKB A;  4F1Y A;  3DRG A;  2DE2 A;  1AMF A;  1FQC A;  1I6B A;  2RC9 A;  5TPA B;  5AA3 A;  1D3K A;  4FOR A;  1PBQ A;  4ESX A;  4M4G A;  4QFO A;  1UTH B;  1MH3 A;  1PBP A;  2XXU A;  3MPL A;  1ZU0 A;  3PPO A;  3O29 A;  2Z8F A;  4F3B A;  4FJP A;  3USD A;  3MW0 A;  3SET A;  1FQE A;  4OES A;  4RK9 A;  4TLL B;  4XIG Q;  1VSO A;  4BDN A;  2V84 A;  4YMB A;  1EZO A;  5DT6 A;  4X1B A;  4DXB A;  1B32 A;  2V93 A;  3GBB A;  3TCG A;  2F5X A;  1A55 A;  1BKA A;  1Z7M E;  1UTB A;  4F31 B;  4YB6 A;  4KPT A;  2RF1 A;  3OSR A;  3D4G A;  2I0C A;  4NED A;  5I2K B;  5I2N A;  4XKN A;  1NL5 A;  2RIN A;  2F7A A;  4NF6 B;  2XXR A;  4NWC A;  4U2R A;  4MLQ A;  3G3I A;  2VP1 A;  3JYR A;  3CFL A;  1UIV A;  5AA2 D;  1ZTY A;  4EQ7 A;  1B1X A;  4K3F A;  1ZKB A;  5IAI A;  3FVO A;  4NF8 B;  5H8Q A;  1B3E A;  4JWY A;  4F1V A;  3TFL A;  3KSJ A;  3MWB A;  4OQO A;  2CMO A;  1RYX A;  3K00 A;  4ZEB A;  3CR9 A;  1RKM A;  4R73 A;  3KN3 A;  3DLN A;  3DRI A;  1YPN A;  1GTK A;  3RT8 A;  3T96 B;  3B6Q A;  2HAV A;  1DPP A;  2PT1 A;  1NFT A;  4R2F A;  3IJX B;  3TTR A;  3QXM A;  5JTY A;  5I57 A;  4EDP A;  2I6E A;  2YJP A;  3UN6 A;  1MQG A;  3W15 C;  1H3D A;  3MVW A;  3EF7 A;  4YKJ A;  4GLI A;  3MBP A;  5ICQ A;  1HSL A;  5AE4 A;  1BP5 A;  3FJM A;  3OMB A;  3O97 A;  2ONK E;  2UVI A;  4YB5 A;  3HCQ A;  4DXU A;  1JW1 A;  1PEB A;  3FXR A;  3A3U A;  1MXU A;  2Q89 A;  4JDF A;  4R75 A;  3TTN A;  4KYS A;  1B0H A;  2W7Y A;  2A5T A;  2XXY A;  3CVG A;  4RK2 A;  5FHO A;  2ONS A;  5I58 B;  2B4M A;  1SQY A;  1SYI A;  4G8H A;  4DIG A;  3O28 A;  4RXL A;  5H8F A;  1FTM A;  4WXJ A;  2HZK A;  4G4P A;  5A5X B;  3K01 A;  5CM6 A;  3BFU A;  4R2B A;  3CSG A;  2DOJ A;  3FJG A;  3H4Z A;  4IGR A;  1H76 A;  1P1W A;  3FGS A;  3ZKL A;  4XTC Q;  1O63 A;  1NKX A;  4H6D A;  1N7X A;  2H5Y A;  3LSL A;  1A40 A;  2G93 A;  4AQ4 A;  1MPB A;  2H9B A;  3MUQ A;  1NH7 A;  1VFD A;  1SDX A;  1EZ9 A;  1H44 A;  3PV0 E;  4P0I A;  4F29 A;  2NWJ A;  3VLU A;  1OQH A;  3RYA A;  4DDD A;  1MQH A;  3HST A;  1MDP 1;  1B05 A;  1IIT A;  4ELO A;  1I6Q A;  2DVC A;  4Q0C A;  3MVZ A;  3K2D A;  1PDA A;  3FZV A;  2PX1 A;  2B4L A;  1M5B A;  1S9T A;  3MP8 A;  1IEJ A;  1R6Z A;  4BDO A;  5KDT A;  3OSQ A;  1FTK A;  3VVF A;  1MG1 A;  5KCJ A;  1JVY A;  4OER A;  3KN7 A;  1BLF A;  4DLD A;  4FE8 A;  3OO9 A;  4IO2 A;  2I58 A;  4G8M A;  4C0R A;  3VE1 B;  2O69 A;  4R72 A;  5JEI A;  3TTL A;  3DRK A;  4P11 A;  5H8H B;  2R71 A;  1F9B A;  1MXZ A;  1OQG A;  1GV8 A;  3T9X B;  5I56 A;  1MY2 A;  5EHS A;  1R9Q A;  1MQI A;  1MXV A;  4MFI A;  4POW A;  3T9U A;  3IOV A;  4QSD A;  2D3I A;  4N6P A;  1XOC A;  4H67 A;  2DYX A;  3TCH A;  2DWH A;  1A99 A;  3KGC A;  1POY 1;  2DXY A;  1MM7 A;  1TFA A;  3IL1 B;  3MC2 A;  5FHM A;  4OEU A;  3T9H B;  4EQ9 A;  3RLF E;  4GOT A;  4KHZ E;  1URG A;  3FUZ A;  5B7D A;  5CMM A;  2CZL A;  3KOS A;  3SEX A;  4PFT A;  2G29 A;  2GHA A;  2I48 A;  4F3S A;  1M5C A;  3EQ1 A;  2NUV A;  3CSB A;  4R6H A;  4YIC A;  1AOV A;  3ONM A;  2Z8E A;  3V83 A;  3ILU B;  1Q1K A;  2REJ A;  2AL5 A;  2OWT A;  3H3G A;  5BUU A;  1P1N A;  1US4 A;  3PU5 A;  4N13 A;  4HCW A;  4IGT A;  4PFW A;  2PBW A;  1P1U A;  4RY1 A;  4NF4 A;  1QW0 A;  4ECF A;  1ATG A;  4G68 A;  4BDQ A;  2DVZ A;  1B51 A;  1NNP A;  2P0S A;  2XXW A;  1MQD A;  1P1O A;  1DOT A;  1JVX A;  2DWI A;  3PMX A;  4LZ8 A;  4C1T A;  2DE4 A;  1M5F A;  2PT2 A;  2A5S A;  3PUX E;  3O6I A;  3PUW E;  3O9P A;  1B4H A;  4U21 A;  3OEN A;  4F39 A;  3BKI B;  4NF5 B;  1B5I A;  1TWY A;  3IB2 A;  3TQW A;  3D4C A;  3THI A;  1MQJ A;  3OO6 A;  4H65 A;  5CMB A;  1JEV A;  3KBR A;  4PE5 B;  3JV9 A;  4EXK A;  3FVG A;  2ZMB A;  1N3X A;  1LCF A;  2DWA A;  2V25 A;  3A09 A;  3H6T A;  3MZ1 A;  1M5D A;  4F2Q A;  3MZ9 A;  4HW8 A;  1MPD A;  2AYS A;  5JTY B;  5I57 B;  4YB7 A;  4ZS9 A;  5TP9 A;  2Q88 A;  1LGB C;  2REG A;  3RYB A;  3Q26 A;  1FTL A;  3AXF A;  4RYA A;  3TQL A;  3K0V A;  3S4U A;  5I59 A;  4F19 A;  2Q9T A;  3QAX A;  5I84 A;  4H8I A;  2ONR A;  3C9H A;  3HHG A;  1IXI A;  5FHN A;  1OMP A;  3TAJ A;  4LAT A;  4LZ7 A;  2P1S A;  3ZSF A;  3C34 A;  1LBB A;  2HAU A;  5F7V A;  1S50 A;  1JW4 A;  2X7P A;  4LQ5 A;  4DE8 A;  2F35 A;  1D9Y A;  1UIU A;  3MPK A;  3U93 A;  2DWJ A;  4ZEI A;  3C35 A;  1USY H;  2QPQ A;  2XHD A;  4AB6 A;  3O66 A;  5BWJ A;  4QFK A;  4FIM A;  4IO7 A;  4O3B A;  2D5W A;  1SI0 A;  2ZYO A;  4KR5 A;  1MRP A;  3ILT B;  4U1Z A;  3VVD A;  2ANJ A;  3IOU A;  1SYH A;  3EHT A;  4Q30 B;  2FNC A;  4RJZ A;  5DEX B;  4H8J A;  3S9M C;  3O2A A;  2F34 A;  1AH5 A;  4KYE A;  3RT6 B;  2ZXT A;  2OK2 A;  2XXH A;  1N7W A;  1IXH A;  5F1Q A;  2UXA A;  4ZDM A;  4DCY A;  2O68 A;  1IQ7 A;  4YKI A;  4YU0 A;  3TEL A;  1Y4C A;  4UA8 A;  2GRV A;  3IO6 A;  4EF2 A;  3ECR A;  2AIX A;  1D9V A;  4G8N A;  1Q35 A;  4GXS B;  3VVE A;  3RNN A;  3S9E A;  3G3H A;  3L6G A;  3KJ7 A;  3IOW A;  5L8D A;  5HM4 B;  3G3F A;  3E13 X;  1B40 A;  3H06 B;  4I8C A;  1LAH E;  1CE2 A;  4YMA A;  5L9O A;  3EPE A;  3OO8 A;  4GQO A;  2ALU A;  1OVB A;  2QMX A;  3IOT A;  2PMS A;  1QUJ A;  1QKA A;  1JW5 A;  4F18 A;  2O1L A;  3TOD A;  2Z8D A;  1LAX A;  4PFY A;  4OVJ A;  2KLF A;  3T22 A;  2WOK A;  3KSX A;  3LVU A;  3TMG A;  1FTO A;  1B2H A;  3CG3 A;  2O84 X;  4FEB A;  5DVI A;  3IAZ A;  3KFM A;  3EN3 A;  1EZP A;  1SW4 A;  3C4M A;  1WOD A;  2X26 A;  3CFX A;  1XVX A;  3G7W A;  3W9V A;  1DTG A;  3OOA A;  1US5 A;  3MP1 A;  3U94 A;  3DP8 A;  3L6H A; 
#chains in the Genus database with same CATH topology
 4ELP A;  2XWI A;  3DP6 A;  4DZ1 A;  1JQF A;  4XKP A;  2R9J A;  3LBS A;  3MJN A;  5DW8 A;  3OEL A;  4N8Y A;  5AA4 A;  2VD2 A;  1QGX A;  4BDR A;  1IIW A;  2HFB A;  4H1X A;  3D1R A;  1LB8 A;  1NH8 A;  4UAC A;  4GRK A;  4THI A;  4P1E A;  1NV0 A;  3GBA A;  2UYE A;  4U23 A;  4R74 A;  2I4B A;  4MH5 A;  3VXB A;  5CC2 A;  3U1O A;  4JBZ A;  4F1U A;  4YAH X;  1UQW A;  1EU8 A;  2FYI A;  3FIR A;  3FVK A;  4ZZE A;  2XX9 A;  3EKI A;  1DMB A;  3IO4 A;  4QFL A;  5I7I A;  2DSF A;  2F3B A;  4Z0I A;  3N94 A;  5IZ3 A;  3VXC A;  4FAJ A;  2QL3 A;  4R9G A;  5TPA A;  2P2A A;  5CRY A;  1QKB A;  4I3E A;  1Q9D A;  4U22 A;  3GZG A;  4OFJ A;  1LCT A;  2QS4 A;  2VD3 A;  2XD2 A;  4QBA A;  1LBV A;  1UTH A;  1B6H A;  4GL8 A;  2XXV A;  3PUV E;  1B3G A;  1BIY A;  2QS3 A;  3FAT A;  1SI1 A;  3PMV A;  1A7L A;  2WOL A;  3R26 A;  2F7B A;  4EF1 A;  3CI8 A;  4GIZ A;  1LFG A;  1SW1 A;  4PFR A;  1GR2 A;  3V5A A;  1FPK A;  2QRY A;  2DP8 A;  3IOR A;  1P99 A;  2O6A A;  2RCA A;  5H8N B;  2QS2 A;  1FPB A;  4IO5 A;  1XC1 A;  1XT8 A;  4IB2 A;  2P3N A;  4OVS A;  1RDZ A;  2HXR A;  5EQ9 A;  3IX1 A;  4Z7E A;  5HPQ A;  1N84 A;  4YZZ A;  4MAG A;  2V3T A;  4TOZ A;  3PMW A;  1LB9 A;  4O3C A;  4FBP A;  4PBH A;  5I2K A;  4PBQ A;  4ELR A;  1FW0 A;  4U4X A;  4NF6 A;  1NUX A;  3PPR A;  1Y3P A;  3UOR A;  2CEY A;  2GHB A;  2Q8J A;  3KG2 A;  1B52 A;  4DCX A;  4N6D A;  4OXV A;  2UVG A;  2YLN A;  5J16 A;  2IA4 A;  4NF8 A;  4P1L A;  3T0J A;  2XX8 A;  1TT1 A;  2ZZV A;  2Q2C A;  1Y3N A;  1IXC A;  3Q27 A;  4H5F A;  2WOP A;  3M3L A;  3BBR A;  2VGQ A;  3SEU A;  1HSJ A;  2B3B A;  4ND9 A;  5EQ8 A;  1MY4 A;  3HO7 A;  4HTG A;  5LDZ A;  2IEE A;  3BIG A;  1NV5 A;  3OEK A;  5ELV A;  3H03 A;  4MIJ A;  4JXI A;  1L5T A;  4R6K A;  4HE2 A;  4EQB A;  1N3W A;  3QIM A;  1LAG E;  1KA0 A;  2ZNT A;  3SZP A;  3QYT A;  4ZE9 A;  4X04 A;  2HHM A;  4GVO A;  4LUB A;  1MXW A;  4QRZ A;  3FXU A;  5HBC A;  1OLA A;  3DP4 A;  4ISU A;  3TKD A;  2DXR A;  3GYY A;  1MS7 A;  3UP9 A;  1WVJ A;  2M8C A;  1FQD A;  5EYH A;  1SW2 A;  4E0W A;  3OXN A;  3FJ7 A;  3V89 B;  1B0L A;  1POT A;  1IXG A;  1FQB A;  2PVU A;  3K6U A;  1MPC A;  1FPL A;  1OLC A;  1JNF A;  3KBZ A;  2O7I A;  4N17 A;  2RC8 A;  3IR1 A;  4X8R A;  4XKQ A;  3RUM A;  4JWO A;  4I62 A;  1LAF E;  4NHB A;  1LEV A;  3GLB A;  3OEM A;  4LA9 A;  4F3G A;  3KC1 A;  2JJK A;  1SPI A;  3VDF A;  3C33 A;  1FBF A;  4HCY A;  4YKP A;  5CMK A;  1UTB B;  2OX3 A;  4ELQ A;  3FVN A;  4HE0 A;  2XXP A;  3SES A;  3E3K A;  3E9X A;  5J1D A;  5I2N B;  4N4U A;  3S9N C;  2XWO A;  2H4I A;  3MZB A;  5AA2 A;  4ZE8 A;  4PTK A;  4KCC A;  1XVY A;  1FSA A;  4R9F A;  3KEI A;  5I58 A;  3FV2 A;  3K6X A;  2E1S A;  2V3U A;  5EHM A;  4X48 A;  1QUI A;  4NG7 A;  3CIJ A;  2RCB A;  5H8Q B;  1DK4 A;  5A5X A;  3MVX A;  4RNS A;  4YKK A;  3FTO A;  1NV7 A;  3F11 A;  3PGF A;  5K2Y A;  2OWS A;  2Q8M A;  4NTL A;  2HXW A;  5A5L A;  3C32 A;  4NE4 A;  1LBW A;  3CRB A;  3HV1 A;  1N04 A;  3DEL B;  3T93 B;  1EYI A;  2Y7R A;  4MLV A;  2H98 A;  5I3S A;  1CB6 A;  3PUY E;  2HZL A;  3B7D A;  4F3P A;  1G0H A;  4OEN A;  3UK4 A;  1NV3 A;  4NAP A;  3T1B A;  4ZEF A;  3VLV A;  2F6G A;  4DI4 B;  1SW5 A;  2O51 A;  4KYD A;  3IB0 A;  1B3F A;  5LOM A;  3Q29 A;  3RTF B;  2D21 A;  3UIF A;  4MNI A;  4NN3 A;  2V3Q A;  2XX7 A;  3FD3 A;  5IZ1 A;  1KWH A;  4PAK A;  1B5J A;  3RYD A;  4G77 A;  5ITP A;  3TZA A;  4N07 A;  5ITO A;  3U72 A;  3IFA A;  1LST A;  2UVJ A;  2VPN A;  4O3A A;  1LLS A;  5AA4 B;  5T3J A;  3T9V A;  1DSN A;  1I6A A;  1NNK A;  2ABH A;  3P7I A;  3LC8 A;  1NNT A;  1FBH A;  4WED A;  3SKP A;  2E0S A;  5M2V A;  3FV1 A;  4OVR A;  5TU0 A;  3FXQ A;  4I9D A;  3TDJ A;  3VLW A;  1FQA A;  5H8H A;  4BLA A;  1Y3Q A;  1A54 A;  2A5T B;  2WBD A;  5DVJ A;  3LV0 A;  3RPL A;  3TTM A;  3QMF A;  1OIB A;  1RYO A;  1FRP A;  4O7I A;  4O8M A;  1KA1 A;  5DYH A;  3ZS6 A;  1LBC A;  2QMW A;  3WAF A;  4LON B;  1FBD A;  3LSX A;  3OO7 A;  3V8X B;  5ET5 A;  2AL4 A;  5H8F B;  1II5 A;  4KQP A;  4OYV A;  5EQA A;  2GQ1 A;  4X9T A;  2KQZ A;  4PP0 A;  4PCD A;  2NXO A;  1R1N A;  5FTH A;  3LUZ A;  1AL3 A;  4ONY A;  3H6U A;  5CBS A;  4QFN A;  3DRJ A;  2ZYK A;  3ISP A;  5CMC A;  4PGN A;  2Y7W A;  4PET A;  4EUO A;  3SEW A;  2F7C A;  1HSE A;  3BIH A;  3OD7 A;  1B7H A;  2HCA A;  4LVQ A;  4KD5 A;  3SER A;  2HEU A;  4F2O A;  5CBR A;  2Y5L A;  1FBC A;  1PB8 A;  1URS A;  1Y9U A;  2FIX A;  1ZLQ A;  1NV2 A;  3I3V A;  1GGG A;  3SEY A;  4MBP A;  1XS5 A;  4PFB A;  1LFH A;  4H0W A;  1IMF A;  3HPI A;  1QUK A;  3UA8 A;  1VDW A;  3H6W A;  1NV6 A;  4OHN A;  5KDT B;  1WDN A;  5FTI A;  3PD9 A;  1YAE A;  2BJI A;  2VOZ A;  3A3C A;  5KCJ B;  1EYJ A;  2ZYM A;  5AA1 A;  2XD3 A;  2Y7P A;  1ZBM A;  3PTY A;  4GFR A;  4G68 C;  4LQ2 A;  3M3K A;  1MY1 A;  4P56 A;  5EYF A;  2X7Q A;  4PDH A;  4NF5 A;  1MDQ A;  3SDF A;  4DI3 D;  5ESY A;  1P1Q A;  3K02 A;  3ODB A;  4TLM B;  4R6Y A;  3K6V A;  2XXQ A;  4PFI A;  4GL0 A;  1Y1Z A;  5I56 B;  1MXX A;  4GWY A;  4FEC A;  2F97 A;  1N0T A;  3G3G A;  3S9L C;  3TUS A;  1YXI A;  4GWO A;  1Y1M A;  2OZZ A;  2WYP A;  4P0G A;  1B9J A;  1B46 A;  1PB9 A;  1LFI A;  1BTJ A;  4QXD A;  3M8U A;  2O1M A;  3H7M A;  4N8G A;  4XXU A;  4BDL A;  2I3V A;  4GD5 A;  1FJ9 A;  1ZMG A;  3Q25 A;  1QVS A;  2I49 A;  3TCF A;  1B7U A;  2F78 A;  4G2Z A;  4AS5 A;  1H43 A;  1TXF A;  3LSW A;  1B5H A;  2BJJ X;  3W9W A;  4PGP A;  3KJT A;  1VE4 A;  4M1V A;  3HN0 A;  1K9Z A;  2F6P A;  3FAS A;  4H45 A;  1QJM A;  1JEU A;  1IZ1 A;  3EHS A;  1MM6 A;  4Q8R A;  3PAM A;  4OZ9 A;  3PPQ A;  2PYY A;  1FCK A;  4KCD A;  1DPE A;  2NVU B;  2UVH A;  2OBG A;  2OJT A;  4IY5 A;  4JSO A;  2OCU A;  4POX A;  4ZED A;  1A8F A;  1B1H A;  4GXA A;  4MNC A;  2Q2A A;  1MY3 A;  2F36 A;  4X1D A;  2R6G E;  2QSX A;  4NWD A;  4NF4 B;  5AA2 B;  4C1U A;  1MH4 A;  4NQ8 A;  4OWD A;  4G68 B;  1G0I A;  2F8D A;  2YPN A;  4MJO A;  2THI A;  4PAI A;  2WEF A;  1GVC A;  3S2V A;  2CZK A;  4EXL A;  1INP A;  3KN8 A;  1ELJ A;  4OFO A;  4JWX A;  2ZNS A;  3QUF A;  1MXY A;  4N15 A;  3I5O A;  3R6U A;  2NOO A;  4O7M A;  2DDK A;  3LUY A;  1H45 A;  2PFY A;  5DEX A;  1XHY A;  1FPD A;  4OTE A;  5K2X A;  4LZ5 A;  2QJE A;  2DQV A;  3K1P A;  1M5E A;  3K4U A;  1FPJ A;  4IO3 A;  1JET A;  4GWX A;  1J1N A;  1YTV A;  5JK4 A;  5DVF A;  1B3H A;  3U92 A;  2Y7K A;  3DM0 A;  4OFL A;  1NV4 A;  3MVY A;  4GWW A;  5IGA A;  1I69 A;  5L9M A;  1FBE A;  2XXX A;  4PFU A;  3TEP A;  4RA1 A;  4QFP A;  3RQT A;  3VFJ A;  3KZG A;  5TP9 B;  4JSD A;  1IUD A;  1B7Z A;  3EHU A;  2Y84 A;  1SBP A;  3N6T A;  2QS1 A;  5ET6 A;  4HS7 A;  3IJO B;  5L9S A;  1Z7N E;  3K6W A;  3B6T A;  2WKY A;  5I59 B;  3O6G A;  1USY E;  3MP6 A;  3CHG A;  4G61 A;  4N81 A;  4WKM A;  4ZZA A;  3RGY A;  1DTZ A;  1D9Q A;  1N76 A;  3G3K A;  5KZT A;  4GBV A;  4FAT A;  3PD8 A;  4KI0 E;  1URD A;  2ZNU A;  4MEV A;  4OET A;  3C36 A;  1ANF A;  3K1N A;  4DXC A;  2B3F A;  2CZI A;  2KR0 A;  2XXT A;  4JVC A;  3PPN A;  3N6U A;  4P9K A;  4U1O A;  2FBP A;  1A8E A;  3CG1 A;  3WAE A;  4NMY A;  4BDM A;  2ZYN A;  3RPW A;  3MQ9 A;  1NMU A;  3RTW B;  3TYH A;  2XWV A;  2H99 A;  1B3L A;  1R9L A;  5ET8 A;  1OVT A;  1NUW A;  4RPN A;  3R7X A;  3H6V A;  4QHQ A;  2B65 A;  3UGW A;  3B6W A;  3Q28 A;  4WEP A;  1YCJ A;  2ESN A;  3QUJ A;  3O6H A;  1B4Z A;  3QK6 A;  1FQF A;  2Z23 A;  5H8S A;  4QSC A;  3U8Q A;  3N26 A;  4IO6 A;  4MF3 A;  4ESW A;  3O6P A;  4RPO A;  4OMB A;  2FVZ A;  4KFQ A;  3PUZ E;  4LP2 B;  1AIV A;  3MAM A;  2DE3 A;  1YZ0 A;  1S7Y A;  1ZJL A;  2I4C A;  4AB5 A;  3HHF A;  2I0B A;  2GH9 A;  3GXA A;  4H5G A;  2Y7I A;  5CI5 A;  1NNF A;  4GF8 A;  3T66 A;  4L17 A;  2V4C A;  4TQU Q;  4IO4 A;  1TFD A;  1Y20 A;  3RN8 A;  3C31 A;  1EH3 A;  4I1D A;  5IM2 A;  5EQ7 A;  1MY0 A;  4XF5 A;  4QF9 A;  2VHA A;  3CFZ A;  4XKR A;  1VR5 A;  3N5L A;  4FED A;  3KOT A;  2QVV A;  4MX6 A;  3DRH A;  2GFE A;  2XXI A;  5H8N A;  2O7U A;  4Q5T A;  3K1M A;  4F22 A;  4IY6 A;  4OA4 A;  3ZKK A;  3BFT A;  1T0K A;  3PPP A;  2LAO A;  4N6K A;  4OEV A;  3VV5 A;  4U4S A;  1Y4T A;  4OVP A;  2FA7 A;  1O64 A;  3DRF A;  3TTK A;  1SD3 A;  2RKM A;  2I3W A;  1D4N A;  3RY3 A;  1O7T A;  2UYF A;  4JVI A;  4GWU A;  1PC3 A;  1QUL A;  3E4R A;  1SVX B;  1FTJ A;  3QSL A;  3LR1 A;  2HQ0 A;  3IB1 A;  3G3J A;  4AS4 A;  3JZJ A;  3SEV A;  2Z22 A;  3LSF B;  1LBX A;  4ZEK A;  2R8T A;  5B70 A;  1B58 A;  2Q74 A;  2OLB A;  2RC7 A;  2H25 A;  3NOH A;  3IK6 B;  4N91 A;  4ZEC A;  4PQJ A;  1VFE A;  3TPA A;  4PC9 A;  1PB7 A;  5DTB A;  2DS9 A;  3MST A;  3M3F A;  3I6V A;  4QSE A;  4JB7 A;  5ISU A;  1ZIU A;  5ICT A;  4E0X A;  5IKB A;  4F1Y A;  3DRG A;  2DE2 A;  1AMF A;  1FQC A;  1I6B A;  2RC9 A;  5ET7 A;  5IZ3 B;  5TPA B;  5AA3 A;  1D3K A;  4FOR A;  1PBQ A;  4GX3 A;  4ESX A;  4M4G A;  4QFO A;  1UTH B;  1MH3 A;  1PBP A;  2XXU A;  3MPL A;  1ZU0 A;  4GBW A;  3PPO A;  3O29 A;  2Z8F A;  4F3B A;  5LTC A;  4FJP A;  3USD A;  3MW0 A;  3SET A;  2FIE A;  1FQE A;  4OES A;  4RK9 A;  4TLL B;  4XIG Q;  1VSO A;  4BDN A;  2V84 A;  4YMB A;  1EZO A;  5DT6 A;  4X1B A;  4DXB A;  1B32 A;  4PDD A;  5EYG A;  2V93 A;  3GBB A;  3TCG A;  2F5X A;  1A55 A;  1BKA A;  4OAN A;  1FPI A;  1DCU A;  1Z7M E;  1UTB A;  4F31 B;  4YB6 A;  4KPT A;  2RF1 A;  4P3L A;  3OSR A;  3D4G A;  2I0C A;  4NED A;  5I2K B;  5I2N A;  4XKN A;  1NL5 A;  4PE3 A;  2RIN A;  2F7A A;  4NF6 B;  2XXR A;  4NWC A;  4PAF A;  4U2R A;  2HPG A;  4NGU A;  3FBP A;  4MLQ A;  3G3I A;  2ZZX A;  2VP1 A;  3JYR A;  3CFL A;  1UIV A;  5AA2 D;  1ZTY A;  4EQ7 A;  1B1X A;  4K3F A;  1ZKB A;  5IAI A;  3FVO A;  4NF8 B;  5H8Q A;  1B3E A;  4JWY A;  4F1V A;  3TFL A;  3HFU A;  3KSJ A;  3MWB A;  2Y5K A;  4OQO A;  2CMO A;  1KZ8 A;  1RYX A;  3K00 A;  4ZEB A;  3CR9 A;  2QVR A;  4NF0 A;  1RKM A;  4R73 A;  3KN3 A;  3DLN A;  3DRI A;  1YPN A;  4HE1 A;  1GTK A;  3RT8 A;  3T96 B;  3B6Q A;  2HAV A;  4HXV A;  1DPP A;  1XI6 A;  2QFL A;  2PT1 A;  1NFT A;  4R2F A;  3IJX B;  3TTR A;  3QXM A;  2XA5 A;  5I57 A;  5JTY A;  4EDP A;  2I6E A;  2YJP A;  3UN6 A;  1MQG A;  3W15 C;  1H3D A;  3MVW A;  3EF7 A;  4YKJ A;  4GLI A;  3MBP A;  5ICQ A;  1HSL A;  5AE4 A;  1BP5 A;  3FJM A;  3OMB A;  3O97 A;  4IR8 A;  2ONK E;  2UVI A;  4YB5 A;  3HCQ A;  4DXU A;  1JW1 A;  1PEB A;  3FXB A;  3FXR A;  3A3U A;  1MXU A;  2Q89 A;  2FHY A;  4JDF A;  4R75 A;  3TTN A;  4KYS A;  1B0H A;  2W7Y A;  2A5T A;  2F3D A;  2XXY A;  3CVG A;  4RK2 A;  5FHO A;  2PFZ A;  1FBP A;  2ONS A;  5I58 B;  2B4M A;  1SQY A;  1SYI A;  4G8H A;  4DIG A;  3O28 A;  4RXL A;  5H8F A;  1FTM A;  4WXJ A;  2HZK A;  4G4P A;  5A5X B;  3K01 A;  5CM6 A;  3BFU A;  4R2B A;  3CSG A;  2DOJ A;  3FJG A;  3H4Z A;  4IGR A;  1H76 A;  1P1W A;  3FGS A;  3ZKL A;  4XTC Q;  1O63 A;  1NKX A;  4H6D A;  1N7X A;  2H5Y A;  3LSL A;  1A40 A;  1IME A;  2G93 A;  4AQ4 A;  1MPB A;  4P8B A;  2H9B A;  3MUQ A;  1NH7 A;  1VFD A;  1SDX A;  1FPG A;  1EZ9 A;  1H44 A;  1BK4 A;  3PV0 E;  4P0I A;  3A29 A;  4F29 A;  1IMA A;  4PF6 A;  2NWJ A;  3MYU A;  3VLU A;  1OQH A;  2XXK A;  3RYA A;  4I40 A;  4DDD A;  1MQH A;  3HST A;  1MDP 1;  1B05 A;  1IIT A;  4ELO A;  1I6Q A;  2DVC A;  4Q0C A;  3MVZ A;  3K2D A;  1PDA A;  3FZV A;  2PX1 A;  2B4L A;  1M5B A;  1S9T A;  3MP8 A;  1IEJ A;  1R6Z A;  4OVT A;  4BDO A;  5KDT A;  4LN5 A;  3OSQ A;  1FTK A;  3VVF A;  1MG1 A;  4OVQ A;  5KCJ A;  1JVY A;  4XEQ A;  4OER A;  3KN7 A;  1BLF A;  4DLD A;  1FBG A;  4FE8 A;  2WBB A;  3OO9 A;  4IO2 A;  2I58 A;  4G8M A;  3ROJ A;  4C0R A;  3VE1 B;  2O69 A;  4R72 A;  5JEI A;  1JP4 A;  4JVD A;  3TTL A;  3DRK A;  4P11 A;  5H8H B;  2R71 A;  1F9B A;  1MXZ A;  1OQG A;  4MMP A;  1GV8 A;  3T9X B;  5I56 A;  3RPL B;  1MY2 A;  5EHS A;  1R9Q A;  1MQI A;  1MXV A;  4MFI A;  4NX1 A;  4POW A;  5F24 A;  3T9U A;  3IOV A;  4QSD A;  2D3I A;  4N6P A;  4GWS A;  1XOC A;  4H67 A;  2DYX A;  3TCH A;  2DWH A;  1A99 A;  3KGC A;  1POY 1;  2DXY A;  1MM7 A;  1TFA A;  3IL1 B;  3MC2 A;  5FHM A;  4OEU A;  3IFC A;  1FTA A;  3T9H B;  4EQ9 A;  3RLF E;  2CZH A;  4GOT A;  2QVU A;  4KHZ E;  1URG A;  3FUZ A;  5B7D A;  4MNP A;  5CMM A;  2CZL A;  3KOS A;  3SEX A;  4PFT A;  2G29 A;  2GHA A;  2I48 A;  4F3S A;  1M5C A;  1IMB A;  3EQ1 A;  1NUZ A;  2NUV A;  3CSB A;  4R6H A;  4YIC A;  1AOV A;  3ONM A;  2Z8E A;  3V83 A;  3ILU B;  1Q1K A;  2REJ A;  2AL5 A;  2OWT A;  3H3G A;  5BUU A;  1P1N A;  4PF8 A;  1US4 A;  3PU5 A;  4N13 A;  1AWB A;  4HCW A;  5I5P A;  4IGT A;  1RDY A;  4PFW A;  4P47 A;  2PBW A;  1P1U A;  4RY1 A;  4NF4 A;  1QW0 A;  4ECF A;  1ATG A;  4G68 A;  4BDQ A;  2DVZ A;  1B51 A;  1NNP A;  2P0S A;  2XXW A;  1MQD A;  1P1O A;  1DOT A;  1JVX A;  2DWI A;  3PMX A;  4LZ8 A;  4C1T A;  2DE4 A;  1M5F A;  2PT2 A;  2A5S A;  3PUX E;  3O6I A;  3PUW E;  3O9P A;  1B4H A;  4U21 A;  4KXP A;  3OEN A;  4F39 A;  5FBP A;  3BKI B;  3B8B A;  4NF5 B;  1B5I A;  1TWY A;  3IB2 A;  3TQW A;  3D4C A;  3THI A;  1MQJ A;  3OO6 A;  4H65 A;  5CMB A;  1JEV A;  1CNQ A;  3KBR A;  4PE5 B;  3JV9 A;  4EXK A;  3FVG A;  2ZMB A;  4H46 A;  2WYK A;  1N3X A;  1LCF A;  2DWA A;  2V25 A;  3A09 A;  4MHF A;  1LBZ A;  3H6T A;  3MZ1 A;  1M5D A;  4F2Q A;  3MZ9 A;  4HW8 A;  3E78 A;  1MPD A;  2L5V A;  2AYS A;  1EYK A;  2WX9 A;  5JTY B;  5I57 B;  2ZZW A;  4YB7 A;  4ZS9 A;  5TP9 A;  4I3Y A;  2Q88 A;  1LGB C;  2REG A;  3RYB A;  3Q26 A;  1FTL A;  3AXF A;  4RYA A;  1K9Y A;  3TQL A;  3K0V A;  3S4U A;  5I59 A;  4F19 A;  2Q9T A;  1LBY A;  3QAX A;  5I84 A;  1NUY A;  4H8I A;  2ONR A;  3C9H A;  3HHG A;  1IXI A;  5FHN A;  1OMP A;  3TAJ A;  1NI9 A;  4LAT A;  4LZ7 A;  2P1S A;  3ZSF A;  3C34 A;  1LBB A;  2HAU A;  5F7V A;  1S50 A;  1JW4 A;  2X7P A;  1FJ6 A;  4LQ5 A;  4DE8 A;  2F35 A;  4MCO A;  1D9Y A;  1UIU A;  3MPK A;  3U93 A;  2DWJ A;  4ZEI A;  3C35 A;  4GWZ A;  1USY H;  2QPQ A;  2XHD A;  4AB6 A;  3O66 A;  5BWJ A;  4QFK A;  4FIM A;  4IO7 A;  4O3B A;  2D5W A;  1SI0 A;  2ZYO A;  4KR5 A;  1MRP A;  3ILT B;  4U1Z A;  3VVD A;  2ANJ A;  3E79 A;  3IOU A;  1SYH A;  3EHT A;  1YYZ A;  4Q30 B;  2FNC A;  4RJZ A;  5DEX B;  4H8J A;  3S9M C;  3O2A A;  2F34 A;  1AH5 A;  4KYE A;  3RT6 B;  1FPE A;  2ZXT A;  2OK2 A;  2P3V A;  2XXH A;  1N7W A;  1IXH A;  5F1Q A;  2UXA A;  4ZDM A;  4DCY A;  2O68 A;  1IQ7 A;  2MKZ A;  4YKI A;  4YU0 A;  3TEL A;  1Y4C A;  3B50 A;  4UA8 A;  2GRV A;  3IO6 A;  4XFE A;  3U65 A;  4EF2 A;  3ECR A;  4GX6 A;  2AIX A;  1D9V A;  4G8N A;  1Q35 A;  4GXS B;  3VVE A;  3RNN A;  3S9E A;  2VPO A;  3G3H A;  4O94 A;  3L6G A;  3KJ7 A;  3IOW A;  5L8D A;  5HM4 B;  2OWZ A;  3G3F A;  3E13 X;  1B40 A;  3H06 B;  4I8C A;  1LAH E;  1CE2 A;  4YMA A;  5L9O A;  3EPE A;  1FPF A;  1NV1 A;  3OO8 A;  2VT5 A;  1DBZ A;  4GQO A;  2ALU A;  1OVB A;  2QMX A;  3IOT A;  2PMS A;  1QUJ A;  1QKA A;  4UAB A;  1IMD A;  1JW5 A;  4GX4 A;  5IZZ A;  4F18 A;  2O1L A;  3TOD A;  2Z8D A;  1LAX A;  2CEX A;  4PFY A;  4OVJ A;  2KLF A;  3T22 A;  2PCR A;  2WOK A;  3KSX A;  3KC0 A;  3LVU A;  3TMG A;  1FTO A;  1B2H A;  3CG3 A;  2O84 X;  4FEB A;  5DVI A;  3IAZ A;  3KFM A;  1IMC A;  3EN3 A;  1EZP A;  2XWK A;  1SW4 A;  3C4M A;  1WOD A;  2X26 A;  3CFX A;  1XVX A;  1RDX A;  3G7W A;  3W9V A;  1DTG A;  3OOA A;  1US5 A;  3MP1 A;  3U94 A;  3DP8 A;  3L6H A; 
#chains in the Genus database with same CATH homology
 4ELP A;  3DP6 A;  4DZ1 A;  1JQF A;  4XKP A;  2R9J A;  3LBS A;  3MJN A;  3OEL A;  5AA4 A;  2VD2 A;  4BDR A;  1IIW A;  2HFB A;  4H1X A;  1LB8 A;  1NH8 A;  4UAC A;  4GRK A;  4THI A;  3GBA A;  2UYE A;  4U23 A;  4R74 A;  2I4B A;  4MH5 A;  3VXB A;  5CC2 A;  3U1O A;  4JBZ A;  4F1U A;  4YAH X;  1UQW A;  1EU8 A;  2FYI A;  3FIR A;  3FVK A;  4ZZE A;  2XX9 A;  1DMB A;  3IO4 A;  4QFL A;  2DSF A;  4Z0I A;  3N94 A;  3VXC A;  4FAJ A;  2QL3 A;  4R9G A;  5TPA A;  2P2A A;  5CRY A;  1QKB A;  4U22 A;  3GZG A;  4OFJ A;  1LCT A;  2QS4 A;  2VD3 A;  2XD2 A;  1UTH A;  1B6H A;  4GL8 A;  2XXV A;  3PUV E;  1B3G A;  1BIY A;  2QS3 A;  3FAT A;  1SI1 A;  3PMV A;  1A7L A;  2WOL A;  3R26 A;  2F7B A;  4EF1 A;  3CI8 A;  4GIZ A;  1LFG A;  1SW1 A;  1GR2 A;  3V5A A;  2QRY A;  2DP8 A;  3IOR A;  1P99 A;  2O6A A;  2RCA A;  5H8N B;  2QS2 A;  4IO5 A;  1XC1 A;  1XT8 A;  4IB2 A;  3IX1 A;  4Z7E A;  5HPQ A;  1N84 A;  4YZZ A;  2V3T A;  4TOZ A;  3PMW A;  1LB9 A;  4O3C A;  5I2K A;  4ELR A;  1FW0 A;  4U4X A;  4NF6 A;  3PPR A;  1Y3P A;  3UOR A;  2GHB A;  2Q8J A;  3KG2 A;  1B52 A;  4DCX A;  4OXV A;  2UVG A;  2YLN A;  2IA4 A;  4NF8 A;  2XX8 A;  1TT1 A;  2Q2C A;  1Y3N A;  1IXC A;  3Q27 A;  4H5F A;  2WOP A;  3M3L A;  3BBR A;  2VGQ A;  3SEU A;  1HSJ A;  2B3B A;  4ND9 A;  1MY4 A;  3HO7 A;  4HTG A;  2IEE A;  3OEK A;  5ELV A;  3H03 A;  4JXI A;  1L5T A;  4R6K A;  4EQB A;  1N3W A;  3QIM A;  1LAG E;  2ZNT A;  3QYT A;  4ZE9 A;  4GVO A;  4LUB A;  1MXW A;  4QRZ A;  3FXU A;  5HBC A;  1OLA A;  3DP4 A;  4ISU A;  3TKD A;  2DXR A;  1MS7 A;  3UP9 A;  1WVJ A;  2M8C A;  1FQD A;  1SW2 A;  4E0W A;  3OXN A;  3FJ7 A;  3V89 B;  1B0L A;  1POT A;  1IXG A;  1FQB A;  2PVU A;  3K6U A;  1MPC A;  1OLC A;  1JNF A;  2O7I A;  2RC8 A;  3IR1 A;  4XKQ A;  3RUM A;  4JWO A;  4I62 A;  1LAF E;  3GLB A;  3OEM A;  4LA9 A;  4F3G A;  3VDF A;  3C33 A;  4HCY A;  4YKP A;  5CMK A;  1UTB B;  4ELQ A;  3FVN A;  2XXP A;  3SES A;  3E3K A;  3E9X A;  5J1D A;  5I2N B;  3S9N C;  2H4I A;  3MZB A;  5AA2 A;  4ZE8 A;  4KCC A;  1XVY A;  4R9F A;  3KEI A;  5I58 A;  3FV2 A;  3K6X A;  2E1S A;  2V3U A;  5EHM A;  4X48 A;  1QUI A;  3CIJ A;  2RCB A;  5H8Q B;  5A5X A;  3MVX A;  4RNS A;  4YKK A;  3FTO A;  3F11 A;  3PGF A;  5K2Y A;  2OWS A;  4NTL A;  2HXW A;  3C32 A;  4NE4 A;  3CRB A;  3HV1 A;  1N04 A;  3DEL B;  3T93 B;  2Y7R A;  4MLV A;  2H98 A;  1CB6 A;  3PUY E;  2HZL A;  3B7D A;  4F3P A;  4OEN A;  3UK4 A;  4ZEF A;  3VLV A;  2F6G A;  1SW5 A;  2O51 A;  4KYD A;  3IB0 A;  1B3F A;  5LOM A;  3Q29 A;  3RTF B;  2D21 A;  3UIF A;  2V3Q A;  2XX7 A;  3FD3 A;  1KWH A;  1B5J A;  4G77 A;  5ITP A;  3TZA A;  4N07 A;  5ITO A;  3U72 A;  1LST A;  2UVJ A;  4O3A A;  1LLS A;  5AA4 B;  3T9V A;  1DSN A;  1I6A A;  1NNK A;  2ABH A;  3P7I A;  3LC8 A;  1NNT A;  4WED A;  3SKP A;  2E0S A;  5M2V A;  3FV1 A;  5TU0 A;  3FXQ A;  4I9D A;  3TDJ A;  3VLW A;  1FQA A;  5H8H A;  4BLA A;  1Y3Q A;  1A54 A;  2A5T B;  5DVJ A;  3TTM A;  1OIB A;  1RYO A;  5DYH A;  3ZS6 A;  1LBC A;  2QMW A;  3WAF A;  4LON B;  3LSX A;  3OO7 A;  3V8X B;  2AL4 A;  5H8F B;  1II5 A;  4KQP A;  4OYV A;  4X9T A;  4PP0 A;  2NXO A;  1R1N A;  5FTH A;  1AL3 A;  4ONY A;  3H6U A;  5CBS A;  4QFN A;  3DRJ A;  2ZYK A;  5CMC A;  2Y7W A;  4PET A;  4EUO A;  3SEW A;  2F7C A;  1HSE A;  3OD7 A;  1B7H A;  2HCA A;  4LVQ A;  4KD5 A;  3SER A;  2HEU A;  4F2O A;  5CBR A;  1PB8 A;  1URS A;  1Y9U A;  1ZLQ A;  3I3V A;  1GGG A;  3SEY A;  4MBP A;  1XS5 A;  1LFH A;  4H0W A;  3HPI A;  1QUK A;  3UA8 A;  3H6W A;  4OHN A;  5KDT B;  1WDN A;  5FTI A;  3PD9 A;  1YAE A;  2VOZ A;  3A3C A;  5KCJ B;  2ZYM A;  5AA1 A;  2XD3 A;  2Y7P A;  1ZBM A;  4GFR A;  4G68 C;  4LQ2 A;  3M3K A;  1MY1 A;  5EYF A;  2X7Q A;  4NF5 A;  1MDQ A;  3SDF A;  1P1Q A;  3K02 A;  3ODB A;  4TLM B;  4R6Y A;  3K6V A;  2XXQ A;  4GL0 A;  1Y1Z A;  5I56 B;  1MXX A;  4FEC A;  2F97 A;  1N0T A;  3G3G A;  3S9L C;  3TUS A;  4GWO A;  1Y1M A;  2OZZ A;  4P0G A;  1B9J A;  1B46 A;  1PB9 A;  1LFI A;  1BTJ A;  3M8U A;  2O1M A;  3H7M A;  4XXU A;  4BDL A;  2I3V A;  4GD5 A;  1ZMG A;  3Q25 A;  1QVS A;  2I49 A;  3TCF A;  1B7U A;  2F78 A;  4G2Z A;  1H43 A;  1TXF A;  3LSW A;  1B5H A;  2BJJ X;  3W9W A;  3KJT A;  1VE4 A;  4M1V A;  3HN0 A;  2F6P A;  3FAS A;  1QJM A;  1JEU A;  1IZ1 A;  3EHS A;  1MM6 A;  4Q8R A;  3PAM A;  4OZ9 A;  3PPQ A;  2PYY A;  1FCK A;  4KCD A;  1DPE A;  2NVU B;  2UVH A;  2OBG A;  2OJT A;  4IY5 A;  4JSO A;  2OCU A;  4POX A;  4ZED A;  1A8F A;  1B1H A;  4GXA A;  2Q2A A;  1MY3 A;  2F36 A;  4X1D A;  2R6G E;  2QSX A;  4NWD A;  4NF4 B;  5AA2 B;  4C1U A;  1MH4 A;  4OWD A;  4G68 B;  2F8D A;  2YPN A;  2THI A;  1GVC A;  3S2V A;  4EXL A;  3KN8 A;  1ELJ A;  4OFO A;  4JWX A;  2ZNS A;  3QUF A;  1MXY A;  3I5O A;  3R6U A;  2NOO A;  3LUY A;  1H45 A;  5DEX A;  1XHY A;  4OTE A;  5K2X A;  4LZ5 A;  2QJE A;  2DQV A;  3K1P A;  1M5E A;  3K4U A;  4IO3 A;  1JET A;  1J1N A;  1YTV A;  5JK4 A;  5DVF A;  1B3H A;  3U92 A;  2Y7K A;  3DM0 A;  4OFL A;  3MVY A;  1I69 A;  5L9M A;  2XXX A;  4PFU A;  3TEP A;  4RA1 A;  4QFP A;  3RQT A;  3VFJ A;  3KZG A;  5TP9 B;  4JSD A;  1IUD A;  1B7Z A;  3EHU A;  2Y84 A;  1SBP A;  3N6T A;  2QS1 A;  4HS7 A;  3IJO B;  5L9S A;  1Z7N E;  3K6W A;  3B6T A;  2WKY A;  5I59 B;  3O6G A;  1USY E;  3MP6 A;  3CHG A;  4WKM A;  4ZZA A;  3RGY A;  1DTZ A;  1N76 A;  3G3K A;  5KZT A;  4FAT A;  3PD8 A;  4KI0 E;  1URD A;  2ZNU A;  4OET A;  3C36 A;  1ANF A;  3K1N A;  4DXC A;  2B3F A;  2XXT A;  3PPN A;  3N6U A;  4U1O A;  1A8E A;  3CG1 A;  3WAE A;  4NMY A;  4BDM A;  2ZYN A;  3RPW A;  3MQ9 A;  1NMU A;  3RTW B;  3TYH A;  2H99 A;  1B3L A;  1R9L A;  1OVT A;  4RPN A;  3R7X A;  3H6V A;  4QHQ A;  2B65 A;  3UGW A;  3B6W A;  3Q28 A;  4WEP A;  1YCJ A;  2ESN A;  3QUJ A;  3O6H A;  1B4Z A;  3QK6 A;  1FQF A;  2Z23 A;  5H8S A;  4QSC A;  3U8Q A;  3N26 A;  4IO6 A;  4MF3 A;  4ESW A;  3O6P A;  4RPO A;  4OMB A;  4KFQ A;  4LP2 B;  3PUZ E;  1AIV A;  3MAM A;  2DE3 A;  1S7Y A;  1ZJL A;  2I4C A;  4AB5 A;  3HHF A;  2I0B A;  2GH9 A;  3GXA A;  4H5G A;  2Y7I A;  5CI5 A;  1NNF A;  4GF8 A;  3T66 A;  4L17 A;  4TQU Q;  4IO4 A;  1TFD A;  1Y20 A;  3RN8 A;  3C31 A;  1EH3 A;  4I1D A;  1MY0 A;  4QF9 A;  2VHA A;  3CFZ A;  4XKR A;  1VR5 A;  3N5L A;  4FED A;  3KOT A;  3DRH A;  2GFE A;  2XXI A;  5H8N A;  2O7U A;  4Q5T A;  3K1M A;  4F22 A;  4IY6 A;  3ZKK A;  3BFT A;  1T0K A;  3PPP A;  2LAO A;  4OEV A;  3VV5 A;  4U4S A;  1Y4T A;  2FA7 A;  1O64 A;  3DRF A;  3TTK A;  1SD3 A;  2RKM A;  2I3W A;  1D4N A;  3RY3 A;  1O7T A;  2UYF A;  1PC3 A;  1QUL A;  3E4R A;  1SVX B;  1FTJ A;  3QSL A;  3LR1 A;  2HQ0 A;  3IB1 A;  3G3J A;  3JZJ A;  3SEV A;  2Z22 A;  3LSF B;  4ZEK A;  5B70 A;  1B58 A;  2OLB A;  2RC7 A;  2H25 A;  3IK6 B;  4ZEC A;  4PQJ A;  1VFE A;  3TPA A;  1PB7 A;  5DTB A;  2DS9 A;  3M3F A;  3I6V A;  4QSE A;  4JB7 A;  5ISU A;  1ZIU A;  5ICT A;  4E0X A;  5IKB A;  4F1Y A;  3DRG A;  2DE2 A;  1AMF A;  1FQC A;  1I6B A;  2RC9 A;  5TPA B;  5AA3 A;  1D3K A;  4FOR A;  1PBQ A;  4ESX A;  4M4G A;  4QFO A;  1UTH B;  1MH3 A;  1PBP A;  2XXU A;  3MPL A;  1ZU0 A;  3PPO A;  3O29 A;  2Z8F A;  4F3B A;  4FJP A;  3USD A;  3MW0 A;  3SET A;  1FQE A;  4OES A;  4RK9 A;  4TLL B;  4XIG Q;  1VSO A;  4BDN A;  2V84 A;  4YMB A;  1EZO A;  5DT6 A;  4X1B A;  4DXB A;  1B32 A;  2V93 A;  3GBB A;  3TCG A;  2F5X A;  1A55 A;  1BKA A;  1Z7M E;  1UTB A;  4F31 B;  4YB6 A;  4KPT A;  2RF1 A;  3OSR A;  3D4G A;  2I0C A;  4NED A;  5I2K B;  5I2N A;  4XKN A;  1NL5 A;  2RIN A;  2F7A A;  4NF6 B;  2XXR A;  4NWC A;  4U2R A;  4MLQ A;  3G3I A;  2VP1 A;  3JYR A;  3CFL A;  1UIV A;  5AA2 D;  1ZTY A;  4EQ7 A;  1B1X A;  4K3F A;  1ZKB A;  5IAI A;  3FVO A;  4NF8 B;  5H8Q A;  1B3E A;  4JWY A;  4F1V A;  3TFL A;  3KSJ A;  3MWB A;  4OQO A;  2CMO A;  1RYX A;  3K00 A;  4ZEB A;  3CR9 A;  1RKM A;  4R73 A;  3KN3 A;  3DLN A;  3DRI A;  1YPN A;  1GTK A;  3RT8 A;  3T96 B;  3B6Q A;  2HAV A;  1DPP A;  2PT1 A;  1NFT A;  4R2F A;  3IJX B;  3TTR A;  3QXM A;  5JTY A;  5I57 A;  4EDP A;  2I6E A;  2YJP A;  3UN6 A;  1MQG A;  3W15 C;  1H3D A;  3MVW A;  3EF7 A;  4YKJ A;  4GLI A;  3MBP A;  5ICQ A;  1HSL A;  5AE4 A;  1BP5 A;  3FJM A;  3OMB A;  3O97 A;  2ONK E;  2UVI A;  4YB5 A;  3HCQ A;  4DXU A;  1JW1 A;  1PEB A;  3FXR A;  3A3U A;  1MXU A;  2Q89 A;  4JDF A;  4R75 A;  3TTN A;  4KYS A;  1B0H A;  2W7Y A;  2A5T A;  2XXY A;  3CVG A;  4RK2 A;  5FHO A;  2ONS A;  5I58 B;  2B4M A;  1SQY A;  1SYI A;  4G8H A;  4DIG A;  3O28 A;  4RXL A;  5H8F A;  1FTM A;  4WXJ A;  2HZK A;  4G4P A;  5A5X B;  3K01 A;  5CM6 A;  3BFU A;  4R2B A;  3CSG A;  2DOJ A;  3FJG A;  3H4Z A;  4IGR A;  1H76 A;  1P1W A;  3FGS A;  3ZKL A;  4XTC Q;  1O63 A;  1NKX A;  4H6D A;  1N7X A;  2H5Y A;  3LSL A;  1A40 A;  2G93 A;  4AQ4 A;  1MPB A;  2H9B A;  3MUQ A;  1NH7 A;  1VFD A;  1SDX A;  1EZ9 A;  1H44 A;  3PV0 E;  4P0I A;  4F29 A;  2NWJ A;  3VLU A;  1OQH A;  3RYA A;  4DDD A;  1MQH A;  3HST A;  1MDP 1;  1B05 A;  1IIT A;  4ELO A;  1I6Q A;  2DVC A;  4Q0C A;  3MVZ A;  3K2D A;  1PDA A;  3FZV A;  2PX1 A;  2B4L A;  1M5B A;  1S9T A;  3MP8 A;  1IEJ A;  1R6Z A;  4BDO A;  5KDT A;  3OSQ A;  1FTK A;  3VVF A;  1MG1 A;  5KCJ A;  1JVY A;  4OER A;  3KN7 A;  1BLF A;  4DLD A;  4FE8 A;  3OO9 A;  4IO2 A;  2I58 A;  4G8M A;  4C0R A;  3VE1 B;  2O69 A;  4R72 A;  5JEI A;  3TTL A;  3DRK A;  4P11 A;  5H8H B;  2R71 A;  1F9B A;  1MXZ A;  1OQG A;  1GV8 A;  3T9X B;  5I56 A;  1MY2 A;  5EHS A;  1R9Q A;  1MQI A;  1MXV A;  4MFI A;  4POW A;  3T9U A;  3IOV A;  4QSD A;  2D3I A;  4N6P A;  1XOC A;  4H67 A;  2DYX A;  3TCH A;  2DWH A;  1A99 A;  3KGC A;  1POY 1;  2DXY A;  1MM7 A;  1TFA A;  3IL1 B;  3MC2 A;  5FHM A;  4OEU A;  3T9H B;  4EQ9 A;  3RLF E;  4GOT A;  4KHZ E;  1URG A;  3FUZ A;  5B7D A;  5CMM A;  2CZL A;  3KOS A;  3SEX A;  4PFT A;  2G29 A;  2GHA A;  2I48 A;  4F3S A;  1M5C A;  3EQ1 A;  2NUV A;  3CSB A;  4R6H A;  4YIC A;  1AOV A;  3ONM A;  2Z8E A;  3V83 A;  3ILU B;  1Q1K A;  2REJ A;  2AL5 A;  2OWT A;  3H3G A;  5BUU A;  1P1N A;  1US4 A;  3PU5 A;  4N13 A;  4HCW A;  4IGT A;  4PFW A;  2PBW A;  1P1U A;  4RY1 A;  4NF4 A;  1QW0 A;  4ECF A;  1ATG A;  4G68 A;  4BDQ A;  2DVZ A;  1B51 A;  1NNP A;  2P0S A;  2XXW A;  1MQD A;  1P1O A;  1DOT A;  1JVX A;  2DWI A;  3PMX A;  4LZ8 A;  4C1T A;  2DE4 A;  1M5F A;  2PT2 A;  2A5S A;  3PUX E;  3O6I A;  3PUW E;  3O9P A;  1B4H A;  4U21 A;  3OEN A;  4F39 A;  3BKI B;  4NF5 B;  1B5I A;  1TWY A;  3IB2 A;  3TQW A;  3D4C A;  3THI A;  1MQJ A;  3OO6 A;  4H65 A;  5CMB A;  1JEV A;  3KBR A;  4PE5 B;  3JV9 A;  4EXK A;  3FVG A;  2ZMB A;  1N3X A;  1LCF A;  2DWA A;  2V25 A;  3A09 A;  3H6T A;  3MZ1 A;  1M5D A;  4F2Q A;  3MZ9 A;  4HW8 A;  1MPD A;  2AYS A;  5JTY B;  5I57 B;  4YB7 A;  4ZS9 A;  5TP9 A;  2Q88 A;  1LGB C;  2REG A;  3RYB A;  3Q26 A;  1FTL A;  3AXF A;  4RYA A;  3TQL A;  3K0V A;  3S4U A;  5I59 A;  4F19 A;  2Q9T A;  3QAX A;  5I84 A;  4H8I A;  2ONR A;  3C9H A;  3HHG A;  1IXI A;  5FHN A;  1OMP A;  3TAJ A;  4LAT A;  4LZ7 A;  2P1S A;  3ZSF A;  3C34 A;  1LBB A;  2HAU A;  5F7V A;  1S50 A;  1JW4 A;  2X7P A;  4LQ5 A;  4DE8 A;  2F35 A;  1D9Y A;  1UIU A;  3MPK A;  3U93 A;  2DWJ A;  4ZEI A;  3C35 A;  1USY H;  2QPQ A;  2XHD A;  4AB6 A;  3O66 A;  5BWJ A;  4QFK A;  4FIM A;  4IO7 A;  4O3B A;  2D5W A;  1SI0 A;  2ZYO A;  4KR5 A;  1MRP A;  3ILT B;  4U1Z A;  3VVD A;  2ANJ A;  3IOU A;  1SYH A;  3EHT A;  4Q30 B;  2FNC A;  4RJZ A;  5DEX B;  4H8J A;  3S9M C;  3O2A A;  2F34 A;  1AH5 A;  4KYE A;  3RT6 B;  2ZXT A;  2OK2 A;  2XXH A;  1N7W A;  1IXH A;  5F1Q A;  2UXA A;  4ZDM A;  4DCY A;  2O68 A;  1IQ7 A;  4YKI A;  4YU0 A;  3TEL A;  1Y4C A;  4UA8 A;  2GRV A;  3IO6 A;  4EF2 A;  3ECR A;  2AIX A;  1D9V A;  4G8N A;  1Q35 A;  4GXS B;  3VVE A;  3RNN A;  3S9E A;  3G3H A;  3L6G A;  3KJ7 A;  3IOW A;  5L8D A;  5HM4 B;  3G3F A;  3E13 X;  1B40 A;  3H06 B;  4I8C A;  1LAH E;  1CE2 A;  4YMA A;  5L9O A;  3EPE A;  3OO8 A;  4GQO A;  2ALU A;  1OVB A;  2QMX A;  3IOT A;  2PMS A;  1QUJ A;  1QKA A;  1JW5 A;  4F18 A;  2O1L A;  3TOD A;  2Z8D A;  1LAX A;  4PFY A;  4OVJ A;  2KLF A;  3T22 A;  2WOK A;  3KSX A;  3LVU A;  3TMG A;  1FTO A;  1B2H A;  3CG3 A;  2O84 X;  4FEB A;  5DVI A;  3IAZ A;  3KFM A;  3EN3 A;  1EZP A;  1SW4 A;  3C4M A;  1WOD A;  2X26 A;  3CFX A;  1XVX A;  3G7W A;  3W9V A;  1DTG A;  3OOA A;  1US5 A;  3MP1 A;  3U94 A;  3DP8 A;  3L6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...