1B4HA

Oligo-peptide binding protein complexed with lysyl-diaminobutyric acid-lysine
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PERIPLASMIC OLIGO-PEPTIDE BINDING PROTEIN
total genus 194
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b4hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b4hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b4hA02
1MG1A 2WKYA 2O84X 3T9VA 1PB7A 2Y7PA 2H98A 3FATA 3Q27A 4R74A 1AIVA 2V3QA 3T66A 4LZ5A 2I3VA 3V8XB 4KQPA 5H8HA 5I58B 3FV2A 3H6WA 4KD5A 3OELA 2G29A 2H99A 4MFIA 1DMBA 3CSGA 3TZAA 4EDPA 3EPEA 3SEUA 5DTBA 1WODA 1MY3A 2F7BA 4RY1A 4ZS9A 2FYIA 2OWSA 3R7XA 2KLFA 3K6UA 1QKBA 1TFDA 5AA1A 2F7AA 1B3HA 1FTKA 3B7DA 4FEDA 4YICA 4F1VA 2P1SA 1RYXA 2DQVA 3HHFA 3OOAA 4YU0A 2V93A 4Q30B 4XTCQ 2HXWA 3PUVE 3U94A 1BP5A 3CSBA 1I6QA 4X9TA 4R6YA 1JW5A 1LAGE 2HQ0A 1J1NA 3G3GA 2H5YA 1PC3A 3MPKA 1PBPA 2XXPA 4IO2A 1SW4A 1VE4A 4GXSB 4OTEA 5AA2B 3PUWE 4RK2A 3DM0A 2REGA 3QYTA 4NTLA 4MH5A 1GGGA 2VGQA 2XHDA 3L6HA 2GHAA 1JVXA 1USYH 4G68C 3RN8A 2DYXA 1URSA 1B2HA 2VP1A 2RC8A 2XXYA 3GLBA 3HPIA 4U1ZA 4GD5A 4NF5A 4O3BA 3TELA 5FHOA 3FXRA 3DRJA 2DOJA 2GHBA 4IO7A 3Q26A 2UVJA 3FGSA 1TT1A 3C36A 3GZGA 3MWBA 1OQHA 2HFBA 3LC8A 5AA4A 4GXAA 2QPQA 3E13X 4DE8A 3RLFE 2REJA 4KHZE 1LLSA 4E0XA 3IK6B 3FTOA 2O7IA 1IITA 3I3VA 4YB7A 3S2VA 1SD3A 2X7PA 2O51A 4N13A 4KCCA 4QHQA 5ITPA 2DSFA 3SETA 3OO6A 1Z7ME 3L6GA 3JYRA 5TPAA 2OWTA 4RXLA 2A5TB 2V25A 3MP6A 3USDA 4MBPA 1LFGA 5KCJB 2I4BA 4PQJA 1MXVA 1S9TA 1OLAA 3PPPA 2A5SA 4PE5B 5ELVA 4RPOA 1Z7NE 4AQ4A 4RNSA 1A99A 3O2AA 3IR1A 5CMCA 1IXIA 3IB0A 3LVUA 4IGTA 3SDFA 3K6WA 4G68A 4NWDA 1D9YA 4QRZA 5DVFA 2Y7KA 1FQFA 1MQDA 3W9WA 5J1DA 3PUYE 3I6VA 1URGA 5H8NA 1FQEA 4U21A 1B40A 1OVTA 1FTMA 2FNCA 3OXNA 2VD2A 4M4GA 4EQ9A 5EHMA 1D4NA 3RTWB 1MXWA 1R1NA 3B6QA 3PU5A 3C34A 5HBCA 3ZKLA 4R72A 4GLIA 5CMBA 3D4CA 1ZKBA 1DPEA 4KI0E 1MQHA 1MQGA 2Q9TA 2QRYA 1MY4A 3KSJA 1CB6A 3FUZA 3PD8A 3TCGA 3DRGA 1B05A 1D3KA 1YPNA 2O1LA 1AL3A 2Q2AA 4GRKA 3T96B 3TAJA 3VXBA 3MPLA 3RNNA 1UTBA 3K2DA 3VLVA 4G77A 3JV9A 4R6KA 1MY1A 5L8DA 1GTKA 3VV5A 3ECRA 4U2RA 4F2QA 1FCKA 3OSRA 5IKBA 5FTIA 3CVGA 2I0BA 4F3BA 4LZ8A 4NE4A 4C1TA 1PBQA 3FVKA 3VVFA 4EXKA 1EZPA 1B4HA 3HV1A 3PPNA 4RK9A 1FQCA 4OVJA 1O63A 2Y7RA 3DP8A 4IO6A 4ELPA 1MQJA 1MPDA 2AIXA 1H44A 4HCYA 3SERA 4JB7A 3E3KA 4OFLA 2XXRA 3E9XA 1FTOA 3G7WA 3BBRA 3C33A 3FVOA 4DIGA 3S9NC 1MM7A 2YLNA 3G3KA 3Q28A 1EZ9A 5DEXB 1P1NA 1FQDA 4WEPA 2PMSA 2ZNSA 4KCDA 3VDFA 3K1NA 1SVXB 2E0SA 2HZKA 2ONSA 3H06B 3PD9A 4LQ5A 5TU0A 1QKAA 1CE2A 1LCFA 5BUUA 1VR5A 1MDP1 2I4CA 2RC9A 4MLQA 4PETA 4YKIA 1B51A 1ZLQA 4YB6A 1B0HA 3TTMA 3O97A 2B4MA 1NNPA 3H3GA 4DXUA 1LAXA 3G3IA 3MW0A 2AYSA 2WOLA 1LB9A 1B5JA 1LBBA 5I56B 4QSDA 5JTYA 4ELQA 1N7XA 2QS2A 3KN8A 3O28A 4ESXA 3FIRA 2G93A 4ZZAA 3R6UA 4OEUA 1ANFA 1QULA 1RKMA 4GF8A 2R71A 3KJTA 1QUKA 4H8JA 4NF8A 1NNTA 3O6HA 4LONB 3B6WA 2HZLA 1S50A 4P0IA 4RPNA 3S9EA 4H5FA 5FTHA 4F2OA 4ONYA 3QXMA 4Q0CA 4YKJA 5DVJA 2Q88A 1MDQA 3TQLA 3ZSFA 2VD3A 4QFPA 2YPNA 3DLNA 3GBBA 3MJNA 1N3XA 3LR1A 5JEIA 2XXQA 4O3CA 1IXGA 4ZDMA 5EHSA 2O6AA 3LSFB 2QMWA 1DTGA 3TDJA 1NNKA 1B3EA 3K6XA 4IY5A 4R75A 1P1OA 3B6TA 3CIJA 4EQ7A 3FXQA 4F18A 4YMAA 1B7UA 3FV1A 3JZJA 3ZKKA 2O69A 3TCFA 2Y7IA 2DVCA 5DVIA 3VXCA 2NXOA 5ISUA 3BFTA 3LSXA 3SKPA 4OXVA 2HCAA 4ISUA 4P11A 3TTNA 1B7ZA 3M8UA 1H43A 4JWOA 3K6VA 2O68A 5AA2A 3I5OA 1ATGA 2B3FA 5TP9B 3IJOB 2DWAA 3KJ7A 2F6GA 2XXXA 1GR2A 1II5A 3CR9A 3HO7A 4H67A 1YAEA 1R9LA 3VLUA 4KYEA 5H8QA 4C1UA 3KN3A 3PPRA 3FXUA 3QK6A 3VE1B 3TEPA 3E4RA 4ZEKA 4FECA 1NFTA 4JDFA 1UIUA 3RYBA 5CBSA 4G8HA 2FA7A 2P0SA 4OQOA 4ZECA 5A5XA 3MAMA 4OHNA 3MVWA 4ZEIA 1VFDA 3C32A 4Z7EA 1IXCA 1MY0A 3ONMA 3OEKA 1SW2A 1XVXA 3MZBA 5I2KA 3QSLA 4QFOA 5ITOA 4XKQA 1Y4TA 1PB9A 5CRYA 4WEDA 1IEJA 3VVDA 5JK4A 3A09A 2E1SA 4LATA 3MVYA 1JQFA 2OCUA 5B7DA 3Q29A 1OIBA 3H4ZA 1M5CA 2I58A 2NVUB 4ZZEA 3N26A 1USYE 2A5TA 2AL5A 2IEEA 2XD2A 4ZE8A 1LGBC 1Y4CA 4F39A 4F3GA 1LB8A 3ZS6A 3EQ1A 1P1WA 2XXIA 2ZMBA 5CMKA 4H5GA 5KDTB 2DE4A 3IORA 5K2YA 1PEBA 2DXRA 3SESA 2V84A 5L9MA 4NF5B 1YCJA 3RGYA 1MH4A 1Y3QA 3IX1A 1ELJA 3O6GA 4OYVA 2ZNTA 4R73A 1PDAA 3ILUB 5H8SA 4OFOA 4BDOA 4DZ1A 4ZEDA 4R2BA 5I2NA 3MVZA 1S7YA 3VVEA 2UYEA 5L9SA 1B52A 4DCYA 2OJTA 3WAEA 3K1MA 3OD7A 4ZEBA 3PMVA 3BKIB 5FHMA 3K00A 4LQ2A 3VLWA 3FJGA 5I59A 4G8MA 3C9HA 4AB5A 4R6HA 2PT1A 2QL3A 4G2ZA 3CI8A 1A54A 3T9XB 1B4ZA 3HCQA 4HW8A 1M5EA 3RQTA 2XXWA 5K2XA 2CZLA 4H1XA 1B3FA 1QUIA 1TXFA 1B5HA 1SW5A 1SQYA 2B4LA 4U4SA 4R9FA 4TQUQ 5CI5A 3W9VA 3RYAA 4BDMA 1KWHA 2Q2CA 4IY6A 5LOMA 4TOZA 1JEVA 4QFKA 2DXYA 1MS7A 2F6PA 3W15C 5AA3A 4GOTA 3MVXA 4IO5A 4QSCA 5M2VA 2Z23A 3VFJA 4DLDA 3UGWA 4GWOA 1HSEA 4R9GA 3O6PA 2XD3A 2UXAA 3M3KA 2RKMA 4OMBA 3P7IA 1JW4A 1B5IA 1JW1A 1QJMA 1I6BA 2UVIA 4M1VA 1QUJA 1Y20A 2NUVA 2CMOA 4KFQA 5DEXA 4POWA 4H65A 4LUBA 3T93B 1XS5A 1NH8A 3UIFA 1Q35A 4F3PA 4F1UA 4IO3A 4X1DA 2ONRA 1UTBB 2PT2A 4KYSA 4WKMA 4FATA 1UIVA 1M5FA 5AA4B 1T0KA 1US5A 2I3WA 1LSTA 4GQOA 2PVUA 2RCBA 4G8NA 4JXIA 2QJEA 1PB8A 3GXAA 4L17A 2IA4A 1JEUA 3H6VA 2RF1A 1MRPA 1N3WA 3KBRA 4N07A 3DRKA 4N6PA 4QSEA 3IOUA 5I56A 2Z8DA 4YB5A 4YAHX 2VHAA 2OLBA 3SEVA 3CRBA 4BDQA 3FJMA 5ICQA 3PUXE 1JVYA 2DP8A 2F7CA 4I1DA 4FEBA 2Q8JA 1M5DA 5KCJA 4NEDA 4PFTA 4EF2A 1F9BA 2NOOA 4MLVA 4F19A 1EZOA 3TTLA 1LAFE 3HSTA 1Y3NA 2DE3A 4NF6B 2QS4A 4U4XA 5F7VA 2D3IA 3H6TA 3K0VA 4K3FA 3RT8A 5H8HB 2XXUA 4YKPA 5I58A 4JSDA 3C35A 3IB1A 3S9LC 5HM4B 4LZ7A 1IQ7A 2DVZA 2F97A 3CG3A 4G4PA 2PBWA 1URDA 2OZZA 4TLLB 3OO8A 4JSOA 4IGRA 4KPTA 4GFRA 1TWYA 3ODBA 1SI1A 1IXHA 1H76A 1B7HA 3MZ9A 3TKDA 3KN7A 1DTZA 1N0TA 1JETA 1B1XA 3EF7A 3U93A 2Y7WA 5CC2A 1SW1A 3A3UA 3G3HA 4HCWA 4MF3A 5JTYB 4BDLA 4AB6A 2M8CA 1MPCA 1SDXA 3HN0A 3RPWA 4LP2B 4GIZA 3AXFA 5I2NB 2O7UA 4NF8B 2ZXTA 1WDNA 1B46A 3TUSA 2ZYMA 1DPPA 1QW0A 2QS3A 2B65A 3IOWA 3S4UA 4I8CA 2F78A 3IOVA 1GV8A 3OEMA 2DWJA 3U92A 4Q8RA 3FJ7A 3DRIA 5H8FA 1P99A 3IL1B 2HAVA 3O66A 1MY2A 5AA2D 4DCXA 4WXJA 4EF1A 3Q25A 1AH5A 3KGCA 2THIA 4PP0A 3S9MC 3T22A 1NNFA 3FD3A 1Q1KA 3IOTA 3PMXA 5FHNA 3FVNA 3G3FA 1B1HA 3OO9A 2D5WA 1ZU0A 3HHGA 1I69A 2ANJA 3KG2A 4ELRA 3KOSA 5I84A 2W7YA 2GFEA 3F11A 4FJPA 4OFJA 2R9JA 3OMBA 2D21A 3UORA 3FVGA 2WOKA 3TQWA 1LFHA 4HS7A 4NMYA 1FW0A 2UVGA 5TP9A 1YTVA 3TCHA 3K01A 2ZNUA 3TFLA 1JNFA 4EXLA 4OEVA 1N76A 1BLFA 3T9UA 1UTHA 1VFEA 4NF4B 2XX8A 2ALUA 1BTJA 3SEXA 1B9JA 4PFUA 1Y3PA 3PPOA 3V83A 5BWJA 4TLMB 3RY3A 3QIMA 1O7TA 1SBPA 2H25A 4F29A 1MQIA 1XC1A 3PV0E 2QMXA 4U22A 1ZJLA 3TTRA 2O1MA 2F36A 1FQAA 3KFMA 1SYIA 4G68B 3N94A 3K4UA 3V89B 4KYDA 4RYAA 2DWIA 4EUOA 2I6EA 1NL5A 2LAOA 1NH7A 1DSNA 1US4A 5HPQA 3UK4A 4ND9A 4NWCA 2Z8EA 4F31B 5CM6A 1QVSA 2I48A 3A3CA 3TYHA 2F5XA 3UP9A 2Q89A 1XOCA 3T9HB 4DXBA 2XXVA 4XKNA 3PMWA 4I62A 4H6DA 2X26A 3MBPA 3O6IA 3EHUA 3IO6A 3KZGA 2B3BA 3LUYA 1IUDA 5DT6A 1L5TA 2P2AA 4ELOA 3OENA 3TODA 1LAHE 2V3UA 4FIMA 3SEYA 4GVOA 2QS1A 1DOTA 2YJPA 1HSLA 1MXUA 2I49A 2GRVA 2DE2A 2UYFA 1IIWA 1XT8A 1FTLA 1TFAA 4Z0IA 1OMPA 1P1UA 1B0LA 4ECFA 3DRHA 1OVBA 3M3FA 1Y1MA 1FQBA 4P0GA 1GVCA 3RUMA 3U72A 4BLAA 2DS9A 5I57B 3THIA 3ILTB 4ZEFA 4ESWA 3GBAA 3K1PA 1MH3A 2DWHA 1IZ1A 4IO4A 4QF9A 1B3GA 1N84A 2XXTA 5I2KB 5CBRA 3G3JA 2PX1A 2ZYKA 1SYHA 4XIGQ 4OENA 1ZTYA 1ZBMA 2ESNA 5DYHA 3KSXA 4QFLA 1LFIA 4FE8A 5B70A 1A8FA 1BKAA 1EH3A 1NKXA 4PFWA 3QUJA 3C4MA 2WOPA 1POY1 1Y9UA 2RINA 3CHGA 5F1QA 2ABHA 3IB2A 2ZYOA 3UA8A 3U8QA 1D9VA 2UVHA 3RT6B 2OBGA 2VOZA 3PGFA 4LVQA 5TPAB 1N04A 4H0WA 4UA8A 3FZVA 5L9OA 1B3LA 3IO4A 2H9BA 3SEWA 3O29A 1OLCA 1H3DA 2ONKE 3CFZA 3MUQA 4OERA 2XX9A 2Y84A 1H45A 3FASA 4Q5TA 3TPAA 4GL0A 1A8EA 4RA1A 3D4GA 1P1QA 1B58A 4FORA 2BJJX 4FAJA 2GH9A 4DXCA 3TTKA 1A55A 1ZIUA 4XKPA 1NMUA 3N6UA 4OZ9A 4XXUA 1B6HA 1UTHB 4NF4A 5EYFA 3PPQA 4X1BA 3N6TA 1LBCA 2OK2A 4F22A 1A40A 5I59B 3K02A 4BDRA 3IAZA 4POXA 5ICTA 4THIA 4U23A 1I6AA 1MM6A 1ZMGA 2R6GE 1N7WA 1UQWA 3MP8A 4EQBA 4YMBA 3LBSA 3H6UA 2F35A 3EHTA 4C0RA 1M5BA 1MPBA 1A7LA 4YZZA 1FTJA 1EU8A 2F34A 3M3LA 4XKRA 4BDNA 1LCTA 1R9QA 4NF6A 5H8FB 4HTGA 2AL4A 5CMMA 4O3AA 3IJXB 3U1OA 4F3SA 4KR5A 1R6ZA 4OETA 4OWDA 1HSJA 3DP6A 4DDDA 1AOVA 3WAFA 2PYYA 4E0WA 5H8QB 3DELB 3N5LA 4JBZA 4X48A 3CFLA 1MXYA 2Z8FA 3V5AA 3MP1A 3O9PA 3LSLA 3LSWA 1RYOA 1VSOA 3MZ1A 4I9DA 5KZTA 4RJZA 5AE4A 4YKKA 3MQ9A 1AMFA 1MXXA 3H7MA 5A5XB 2QSXA 3EHSA 3MC2A 3PUZE 4OESA 1XHYA 2XX7A 2HEUA 2I0CA 3C31A 3UN6A 2ZYNA 2NWJA 4GL8A 2X7QA 4PFYA 4R2FA 3TMGA 4IB2A 3BFUA 1XVYA 3QUFA 4LA9A 3OSQA 2F8DA 3QAXA 1BIYA 2RCAA 4F1YA 3DRFA 2XXHA 3KOTA 4ZE9A 3H03A 3EN3A 3PAMA 1O64A 1B32A 2H4IA 2V3TA 3CG1A 3KEIA 3RTFB 5H8NB 1Y1ZA 3R26A 2Z22A 3CFXA 4JWYA 5I57A 4QFNA 5IAIA 4UACA 1MXZA 5KDTA 2HAUA 4U1OA 3OO7A 1POTA 2RC7A 1SI0A 1WVJA 1OQGA 3DP4A 4H8IA 4JWXA
chains in the Genus database with same CATH superfamily
2O84X 1PB7A 3V8XB 5H8HA 2FVZA 4KD5A 3OELA 2H99A 4QBAA 1DMBA 1NI9A 3SEUA 1MY3A 2F7BA 2FYIA 1TFDA 2VPOA 2F7AA 3B7DA 1RYXA 2DQVA 3HHFA 4Q30B 2HXWA 3PUVE 1BP5A 4R6YA 3G3GA 1PBPA 2XXPA 1VE4A 3DM0A 2REGA 3QYTA 1USYH 4OVQA 2VP1A 2RC8A 2VPNA 2QFLA 3TELA 3Q26A 4OVPA 3LC8A 4GXAA 3RLFE 4E0XA 1LLSA 1IITA 3S2VA 1SD3A 5F24A 3SETA 2V25A 3MP6A 5ELVA 1S9TA 4PE5B 1VDWA 1Z7NE 4AQ4A 3IR1A 1IXIA 5ET7A 4QRZA 4PBQA 4EQ9A 1D4NA 4GLIA 1FPBA 4KI0E 1MQHA 4P0GA 3PU5A 1MY4A 3FUZA 2O1LA 2Q2AA 4GRKA 3TAJA 3VXBA 3MPLA 1UTBA 4GX6A 4GWWA 4LZ8A 4MJOA 4NQ8A 3HV1A 4RK9A 4OVJA 4ELPA 3DP8A 1FBCA 2F3BA 2AIXA 3SERA 4OFLA 3G7WA 3C33A 4DIGA 4GWXA 3VDFA 1QKAA 1Q9DA 1MDP1 4MLQA 1ZLQA 2B4MA 4DXUA 3G3IA 3MW0A 5I56B 2ZZWA 4QSDA 4ELQA 3KN8A 4ZZAA 4R73A 4OEUA 1RKMA 2R71A 4GF8A 4GBWA 5LDZA 1NNTA 4LONB 4X8RA 4RPNA 4H5FA 4PAIA 4Q0CA 1MDQA 2VD3A 1N3XA 2XXQA 4PFIA 3GYYA 5IZZA 3TDJA 1DK4A 3K6XA 5EQ9A 4N8YA 2O69A 5DVIA 2NXOA 3MYUA 4OXVA 1H43A 5AA2A 5TP9B 1FJ6A 2F6GA 2XXXA 1NV5A 1R9LA 5I5PA 4KYEA 4C1UA 3KN3A 3PPRA 2R8TA 2OX3A 3TEPA 3E4RA 4ZEKA 4G8HA 5A5XA 4OHNA 1IXCA 3OEKA 4GWZA 5CRYA 1FPGA 1PB9A 4LATA 2OCUA 4PTKA 1OIBA 2A5TA 2AL5A 2XD2A 1LGBC 4F3GA 3ZS6A 3EQ1A 4H5GA 2DE4A 5K2YA 3RGYA 1YCJA 3IX1A 5EQ8A 3WAEA 4P9KA 2CZHA 5FHMA 3VLWA 4G2ZA 3CI8A 1A54A 1M5EA 5K2XA 2XXWA 3A29A 4H1XA 1QUIA 1TXFA 1FBHA 4TQUQ 4PE3A 4MIJA 4NN3A 2Q2CA 5LOMA 4TOZA 2DXYA 2F6PA 2Y5KA 4GOTA 4IO5A 4MAGA 3UGWA 1HSEA 3O6PA 2XD3A 3M3KA 2RKMA 1JW4A 1QUJA 1Y20A 2NUVA 4KFQA 1NH8A 4IO3A 2ONRA 1UTBB 2PT2A 2P3NA 4FATA 1UIVA 1M5FA 1US5A 4JVIA 4L17A 2QJEA 3GXAA 4NX1A 4TLLB 3H6VA 2RF1A 2Z8DA 4YB5A 3SEVA 3FJMA 3PUXE 1JVYA 2DP8A 5KCJA 4PFTA 1EZOA 1LAFE 3HSTA 4GWYA 1Y3NA 4NF6B 2QS4A 2D3IA 3RT8A 5H8HB 2XXUA 4YKPA 3IB1A 3S9LC 2F97A 4G4PA 3ODBA 2Y5LA 1B1XA 4I3EA 4MF3A 1EYJA 1MPCA 2O7UA 4NF8B 2ZXTA 4I8CA 3IOVA 3OEMA 2DWJA 3U92A 2FIXA 5H8FA 3O66A 4EF1A 3Q25A 3KGCA 1LBYA 2THIA 3BIGA 3HHGA 2W7YA 3UORA 4OEVA 1FTAA 2HXRA 4O7MA 1B9JA 1Y3PA 3V83A 1O7TA 1EYKA 3KFMA 1SYIA 2XWOA 1DSNA 4MEVA 5HPQA 3UK4A 4F31B 5CM6A 1QVSA 2I48A 4MHFA 3A3CA 3TYHA 2WYPA 1XOCA 4I62A 2X26A 3IO6A 4NG7A 1L5TA 4ELOA 2WX9A 1DOTA 1FPLA 2DE2A 2UYFA 1IIWA 4Z0IA 4ECFA 1P1UA 3T0JA 1FQBA 4BLAA 2XXTA 3G3JA 1ZBMA 4QFLA 4FE8A 5B70A 3EKIA 3QUJA 1POY1 3IB2A 3CHGA 1K9YA 3RT6B 1N04A 2XWKA 3RYDA 1FRPA 3MUQA 1P1QA 1B6HA 4F22A 1A40A 1FPFA 5I59B 5ICTA 1UQWA 4PFBA 3LBSA 4OVSA 2F34A 1EU8A 4XKRA 4BDNA 3B50A 5CMMA 4F3SA 1R6ZA 4DDDA 3WAFA 3DELB 3N5LA 3CFLA 2Z8FA 5AE4A 1MXXA 5A5XB 2XX7A 3UN6A 4QXDA 2ZYNA 2NWJA 4PGNA 4R2FA 4PFYA 3HFUA 3OSQA 1BIYA 2RCAA 3DRFA 2XXHA 3KOTA 4ZE9A 4PF6A 2V3TA 3CG1A 3R26A 4QFNA 5I3SA 5KDTA 1OQGA 4YKIA 1IMEA 4H8IA 2WKYA 1FBFA 2Y7PA 4R74A 1AIVA 2I3VA 4N6DA 4KQPA 1IMDA 3FV2A 2G29A 4OA4A 4EDPA 3EPEA 5DTBA 2Q74A 3R7XA 1QKBA 5AA1A 2WBBA 1FTKA 2P3VA 4F1VA 3OOAA 4YU0A 1IMFA 2V93A 3CSBA 1I6QA 4X9TA 1LAGE 2HQ0A 1SW4A 5IZ3B 3PUWE 3IFCA 4HXVA 1JVXA 4P56A 4G68C 4PDDA 3GLBA 2HPGA 4U1ZA 4GD5A 4NF5A 5FHOA 2GHBA 2UVJA 3MWBA 3C36A 3E13X 1AWBA 2O7IA 3I3VA 4YB7A 4N13A 4KCCA 5ITPA 2DSFA 3NOHA 1Z7ME 3JYRA 5KCJB 2I4BA 1MXVA 4RPOA 1A99A 5CMCA 4F1UA 3IB0A 3LVUA 4IGTA 4G68A 1D9YA 1MQDA 2VD2A 5EHMA 3B6QA 5CMBA 3FBPA 2QVVA 1MQGA 2L5VA 1CB6A 3TCGA 1YPNA 1AL3A 4G77A 4R6KA 5L8DA 4U2RA 4F2QA 3OSRA 5FTIA 3CVGA 4F3BA 2GQ1A 3VVFA 1B4HA 1FQCA 2Y7RA 4HCYA 3E9XA 1FTOA 3S9NC 3G3KA 1P1NA 1FQDA 2ONSA 1NUWA 2I4CA 1B51A 4YB6A 1B0HA 3TTMA 4N81A 1LAXA 2WOLA 1LB9A 1B5JA 1LBBA 2G93A 1ANFA 4H8JA 1EZPA 1S50A 5FTHA 4ONYA 3QXMA 5DVJA 2Q88A 3ZSFA 3DLNA 3GBBA 4O3CA 1IXGA 4ZDMA 2O6AA 1NV6A 3LSFB 4R75A 1P1OA 4EQ7A 1FBEA 3FV1A 3JZJA 3ZKKA 3TCFA 3VXCA 5ISUA 2HCAA 1B7ZA 4JWOA 3K6VA 3IJOB 1FBPA 1GR2A 1II5A 3E79A 3HO7A 2CEXA 3FXUA 3VE1B 4JDFA 3RYBA 4OQOA 1VFDA 3C32A 1SW2A 1XVXA 3QSLA 4QFOA 3VVDA 5JK4A 3MVYA 1JQFA 2MKZA 3Q29A 3H4ZA 1M5CA 4ZE8A 1Y4CA 4P1LA 3SESA 2DXRA 1Y3QA 3ILUB 4OFOA 2V4CA 1S7YA 3VVEA 2OJTA 3OD7A 2FHYA 3BKIB 3K00A 4LQ2A 5I59A 4G8MA 1K9ZA 1FJ9A 4PCDA 3RQTA 2CZLA 4PAFA 2JJKA 4IY6A 1MS7A 4QSCA 5J16A 1QJMA 4M1VA 2CMOA 4POWA 4H65A 3T93B 1Q35A 4X1DA 4WKMA 1JP4A 1INPA 2I3WA 1LSTA 2RCBA 4U1OA 2IA4A 1JEUA 1MRPA 4QSEA 1FSAA 2VHAA 3CRBA 4BDQA 5ICQA 4I1DA 4FEBA 4EF2A 4F19A 4GX4A 5F7VA 4N17A 1G0IA 3H6TA 5I58A 2Q8MA 5HM4B 2DVZA 3LV0A 3OO8A 4XF5A 1SI1A 1IXHA 3TKDA 1DTZA 1N0TA 3U93A 5CC2A 1SW1A 3A3UA 3KBZA 5JTYB 4AB6A 3RPWA 4LP2B 3AXFA 2PFZA 2ZYMA 1DPPA 1QW0A 2QS3A 2B65A 3IOWA 1GV8A 4Q8RA 4MNIA 1P99A 4OVRA 5AA2D 2F3DA 4PBHA 4PP0A 3S9MC 3FD3A 2KQZA 1Q1KA 3IOTA 5FHNA 1B1HA 3OO9A 4MX6A 1ZU0A 3FXBA 2XWIA 4FJPA 3OMBA 3FVGA 4HS7A 4NMYA 5ESYA 3K01A 2ZNUA 3TFLA 4EXLA 1BLFA 3T9UA 1VFEA 4NF4B 4TLMB 1SBPA 1MQIA 1XC1A 4NHBA 2O1MA 1FQAA 2DWIA 2I6EA 1NL5A 2LAOA 1US4A 4ND9A 4NWCA 4DXBA 4XKNA 5I7IA 3EHUA 3LUYA 2P2AA 4GBVA 2V3UA 2QS1A 2YJPA 2I49A 1MXUA 2GRVA 1XT8A 1FTLA 1OMPA 4AS4A 5ET6A 3DRHA 1GVCA 3U72A 3THIA 4ZEFA 3K1PA 1IZ1A 4IO4A 1B3GA 1N84A 4LN5A 5CBRA 1SYHA 1ZTYA 1RDYA 4MCOA 1A8FA 1BKAA 4PFWA 1IMCA 3UA8A 2ABHA 2ZYOA 4MMPA 3U8QA 3PGFA 4LVQA 5TPAB 3IO4A 3SEWA 1H3DA 2ONKE 4Q5TA 3TPAA 1B58A 2GH9A 3TTKA 3N6UA 4OZ9A 1IMBA 1LBCA 3ISPA 4HE2A 3K02A 4THIA 4MNPA 1I6AA 1MM6A 3H6UA 1M5BA 1A7LA 3M3LA 1R9QA 3IJXB 1AOVA 4OETA 4OWDA 3V5AA 2VT5A 1LBVA 3O9PA 4I9DA 5KZTA 4RJZA 4YKKA 1AMFA 3H7MA 3PUZE 5A5LA 2HEUA 2I0CA 4GL8A 2X7QA 3BFUA 4LA9A 4F1YA 3PAMA 3RTFB 1B32A 5H8NB 5I57A 4UACA 3OO7A 1POTA 1SI0A 1WVJA 3T9VA 2H98A 4LZ5A 3H6WA 4MFIA 3CSGA 1WODA 4RY1A 4O7IA 4ZS9A 4DI4B 4FBPA 3K6UA 2P1SA 3U94A 5ET8A 1JW5A 1FPDA 4PC9A 1LBZA 4OTEA 5AA2B 4RK2A 4NTLA 3L6HA 3QMFA 2GHAA 2DYXA 3HPIA 3D1RA 4O3BA 2DOJA 4IO7A 3FGSA 3GZGA 1OQHA 5AA4A 2REJA 4KHZE 5DW8A 5EYGA 2X7PA 4X04A 2FBPA 2O51A 5TPAA 2OWTA 4RXLA 2A5TB 4GX3A 3USDA 1LFGA 3PPPA 1OLAA 2A5SA 4RNSA 4NWDA 2Y7KA 1FQFA 5J1DA 3I6VA 1FQEA 1B40A 1FTMA 2FNCA 3OXNA 4I3YA 3RTWB 3C34A 3ZKLA 4R72A 3D4CA 1DPEA 2Q9TA 2QRYA 2OWZA 3RPLA 3T96B 3DRGA 1B05A 4H46A 1FPIA 3K2DA 3JV9A 4PAKA 3PTYA 1MY1A 3SZPA 3VV5A 3ECRA 4JVCA 5IKBA 1PBQA 3FVKA 4EXKA 3PPNA 1MQJA 1H44A 4JB7A 3E3KA 2XXRA 2YLNA 3Q28A 1EZ9A 5DEXB 2PMSA 2ZNSA 1SVXB 2HZKA 5TU0A 3PD9A 1CE2A 1LCFA 3IFAA 4P47A 2QS2A 4ESXA 3FIRA 3R6UA 3KJTA 1QULA 4NF8A 3O6HA 4P0IA 3B6WA 3TQLA 2YPNA 2QMWA 1NNKA 1B3EA 4IY5A 3FXQA 4YMAA 2DVCA 3LSXA 3SKPA 4P11A 4P3LA 2O68A 3I5OA 2B3FA 2DWAA 3KJ7A 4H67A 3CR9A 1NV4A 2WYKA 4GWUA 1UIUA 5CBSA 3MAMA 3MVWA 4Z7EA 3ONMA 3MZBA 4XKQA 1Y4TA 4WEDA 1IEJA 3A09A 2E1SA 5B7DA 4ZZEA 1USYE 2IEEA 4F39A 1P1WA 2XXIA 2ZMBA 5KDTB 1PEBA 2V84A 1ELJA 3O6GA 4OYVA 1PDAA 5H8SA 3B8BA 4DZ1A 4ZEDA 5L9SA 3MVZA 3K1MA 4ZEBA 3FJGA 3C9HA 4R6HA 2PT1A 3HCQA 5EQAA 1SW5A 1SQYA 4U4SA 4R9FA 3RYAA 1KWHA 1JEVA 4QFKA 5M2VA 3MVXA 2ZZXA 4MNCA 2Z23A 3LUZA 3VFJA 4DLDA 4R9GA 3P7IA 1B5IA 1JW1A 1I6BA 2UVIA 1BK4A 5DEXA 4LUBA 1XS5A 4GQOA 4N8GA 4JXIA 1PB8A 3W9WA 3KBRA 4N07A 1NV3A 5I56A 4YAHX 1M5DA 4NEDA 4MLVA 2NOOA 5IM2A 4K3FA 4JSDA 3C35A 1D9QA 1IQ7A 3CG3A 1URDA 2OZZA 4OANA 4JSOA 1TWYA 1B7HA 3MZ9A 3EF7A 2Y7WA 4AS5A 4HCWA 4PFRA 1NUXA 2M8CA 1SDXA 3HN0A 5I2NB 4GIZA 2QVUA 3TUSA 4N91A 3DRIA 2HAVA 1MY2A 2ZZVA 2D5WA 1I69A 4ELRA 1IMAA 3KOSA 1LFHA 2WOKA 1RDZA 2UVGA 5TP9A 1YTVA 1JNFA 1UTHA 2XX8A 2ALUA 3SEXA 3RY3A 3QIMA 2H25A 4F29A 2QMXA 4PGPA 4U22A 2F36A 3N94A 4NGUA 4KYDA 1NH7A 2Z8EA 2Q89A 3PMWA 4H6DA 3O6IA 3MBPA 3KZGA 1NV0A 1IUDA 3OENA 3TODA 1LAHE 4FIMA 3SEYA 4GVOA 1HSLA 1TFAA 3ROJA 1B0LA 1OVBA 3M3FA 1Y1MA 1NV2A 5I57B 3ILTB 3GBAA 1MH3A 5I2KB 2ZYKA 1KA0A 2ESNA 5EYHA 3T1BA 3KSXA 1LFIA 4NAPA 2RINA 1Y9UA 5F1QA 2UVHA 2VOZA 2XWVA 3FZVA 1OLCA 3CFZA 2Y84A 3FASA 3D4GA 4FORA 4FAJA 4DXCA 1A55A 1ZIUA 1NMUA 2HHMA 4XXUA 5EYFA 4NF4A 3PPQA 4X1BA 4U23A 4YMBA 1N7WA 2F35A 4C0RA 1MPBA 4YZZA 1LCTA 4NF6A 5H8FB 1NUZA 4O3AA 3U1OA 4KR5A 1HSJA 4E0WA 4X48A 1MXYA 3MP1A 3MZ1A 3LSWA 1VSOA 3MQ9A 2QSXA 4OESA 1XHYA 4N15A 4IB2A 3QUFA 3QAXA 3EN3A 3KEIA 1Y1ZA 5IAIA 3CFXA 4JWYA 1MXZA 5ET5A 3DP4A 3RPLB 1G0HA 1MG1A 3FATA 3Q27A 2V3QA 3T66A 5I58B 3TZAA 2OWSA 4PDHA 2KLFA 4YICA 1B3HA 4JVDA 4FEDA 4XTCQ 1J1NA 2H5YA 1PC3A 3MPKA 4IO2A 4GWSA 4GXSB 5EQ7A 4MH5A 1GGGA 2VGQA 2XHDA 3RN8A 1URSA 1B2HA 2XXYA 1T0KA 3FXRA 3DRJA 1TT1A 2HFBA 2QPQA 4DE8A 1RDXA 3IK6B 3FTOA 2PFYA 1XI6A 4QHQA 3OO6A 3L6GA 4IR8A 4MBPA 4PQJA 3O2AA 3SDFA 3K6WA 5DVFA 3PUYE 4HE0A 1URGA 5H8NA 4U21A 1OVTA 1FPEA 4M4GA 1MXWA 1R1NA 5HBCA 1LBWA 1DCUA 1ZKBA 3PD8A 2DDKA 5ITOA 3KSJA 1D3KA 3RNNA 3VLVA 1GTKA 1FCKA 2I0BA 4NE4A 4C1TA 4KXPA 3U65A 1O63A 4IO6A 1MPDA 3BBRA 3FVOA 1MM7A 4WEPA 5T3JA 4KCDA 3K1NA 2E0SA 3H06B 4LQ5A 5BUUA 1VR5A 2RC9A 4PETA 3O97A 1NNPA 3H3GA 2AYSA 1QGXA 5JTYA 1N7XA 3O28A 1QUKA 4G61A 2WBDA 2HZLA 3S9EA 4F2OA 4H45A 4O8MA 4YKJA 2XXKA 4QFPA 3MJNA 3LR1A 5JEIA 5EHSA 1DTGA 3B6TA 3CIJA 4F18A 1B7UA 2KR0A 2Y7IA 3BFTA 4ISUA 3TTNA 3M8UA 1ATGA 1FPJA 1NUYA 1YAEA 3VLUA 5H8QA 1DBZA 3QK6A 4FECA 1NFTA 2FA7A 4HE1A 2P0SA 4ZECA 4ZEIA 1MY0A 1SPIA 5I2KA 5IZ3A 2I58A 2NVUB 3N26A 2BJIA 1LB8A 1EYIA 5CMKA 3IORA 5L9MA 4NF5B 1MH4A 2ZNTA 4BDOA 1YXIA 1YZ0A 5I2NA 4R2BA 2UYEA 1B52A 4DCYA 1NV1A 3PMVA 4AB5A 2QL3A 3T9XB 1B4ZA 4HW8A 1LBXA 1B3FA 1B5HA 2B4LA 5CI5A 3W9VA 4BDMA 4I40A 3W15C 5AA3A 4GWOA 2UXAA 4OMBA 3UIFA 4F3PA 4KYSA 4PF8A 5AA4B 2FIEA 2PVUA 4G8NA 3KC1A 4N6PA 1N3WA 3DRKA 2CEYA 3IOUA 2OLBA 4DI3D 2F7CA 2Q8JA 1F9BA 3TTLA 2DE3A 4OVTA 4U4XA 3K0VA 4LZ7A 2PBWA 4IGRA 4KPTA 4GFRA 1H76A 3KN7A 4O94A 1JETA 3G3HA 4BDLA 1WDNA 1B46A 5IGAA 3S4UA 2F78A 2CZKA 3FJ7A 3IL1B 4DCXA 4WXJA 4N4UA 1AH5A 1YYZA 2PCRA 3T22A 1NNFA 2CZIA 3PMXA 3FVNA 3G3FA 2ANJA 3KG2A 5I84A 2GFEA 3F11A 4OFJA 2R9JA 2D21A 3TQWA 1FW0A 3TCHA 5IZ1A 1N76A 1BTJA 4PFUA 3PPOA 5BWJA 4UABA 3PV0E 1ZJLA 3TTRA 4G68B 2QVRA 1LEVA 3K4UA 3V89B 4RYAA 4EUOA 4XEQA 2F5XA 3UP9A 3T9HB 2XXVA 2B3BA 5DT6A 1CNQA 4P1EA 3BIHA 4XFEA 2XA5A 5FBPA 3RUMA 2DS9A 4ESWA 2DWHA 4QF9A 2PX1A 4XIGQ 4OENA 5DYHA 1EH3A 1NKXA 4NF0A 3C4MA 2WOPA 1D9VA 2OBGA 4H0WA 4UA8A 5L9OA 1B3LA 2H9BA 3O29A 4OERA 2XX9A 1H45A 4GL0A 1A8EA 4RA1A 2WEFA 2BJJX 4XKPA 1UTHB 3N6TA 2OK2A 4BDRA 3IAZA 4POXA 1FBDA 1FPKA 1ZMGA 2R6GE 3MP8A 4EQBA 1NV7A 3EHTA 1FTJA 4HTGA 2AL4A 4P8BA 3KC0A 3DP6A 2PYYA 5H8QB 3E78A 4JBZA 4N6KA 3LSLA 1RYOA 1KA1A 1KZ8A 1FBGA 3MSTA 3MC2A 3EHSA 3C31A 3TMGA 1XVYA 2F8DA 5LTCA 3H03A 1O64A 2H4IA 2Z22A 2HAUA 2RC7A 4JWXA
chains in the Genus database with same CATH topology
1MG1A 2WKYA 2O84X 3T9VA 1PB7A 2Y7PA 2H98A 3FATA 3Q27A 4R74A 1AIVA 2V3QA 3T66A 4LZ5A 2I3VA 3V8XB 4KQPA 5H8HA 5I58B 3FV2A 3H6WA 4KD5A 3OELA 2G29A 2H99A 4MFIA 1DMBA 3CSGA 3TZAA 4EDPA 3EPEA 3SEUA 5DTBA 1WODA 1MY3A 2F7BA 4RY1A 4ZS9A 2FYIA 2OWSA 3R7XA 2KLFA 3K6UA 1QKBA 1TFDA 5AA1A 2F7AA 1B3HA 1FTKA 3B7DA 4FEDA 4YICA 4F1VA 2P1SA 1RYXA 2DQVA 3HHFA 3OOAA 4YU0A 2V93A 4Q30B 4XTCQ 2HXWA 3PUVE 3U94A 1BP5A 3CSBA 1I6QA 4X9TA 4R6YA 1JW5A 1LAGE 2HQ0A 1J1NA 3G3GA 2H5YA 1PC3A 3MPKA 1PBPA 2XXPA 4IO2A 1SW4A 1VE4A 4GXSB 4OTEA 5AA2B 3PUWE 4RK2A 3DM0A 2REGA 3QYTA 4NTLA 4MH5A 1GGGA 2VGQA 2XHDA 3L6HA 2GHAA 1JVXA 1USYH 4G68C 3RN8A 2DYXA 1URSA 1B2HA 2VP1A 2RC8A 2XXYA 3GLBA 3HPIA 4U1ZA 4GD5A 4NF5A 4O3BA 3TELA 5FHOA 3FXRA 3DRJA 2DOJA 2GHBA 4IO7A 3Q26A 2UVJA 3FGSA 1TT1A 3C36A 3GZGA 3MWBA 1OQHA 2HFBA 3LC8A 5AA4A 4GXAA 2QPQA 3E13X 4DE8A 3RLFE 2REJA 4KHZE 1LLSA 4E0XA 3IK6B 3FTOA 2O7IA 1IITA 3I3VA 4YB7A 3S2VA 1SD3A 2X7PA 2O51A 4N13A 4KCCA 4QHQA 5ITPA 2DSFA 3SETA 3OO6A 1Z7ME 3L6GA 3JYRA 5TPAA 2OWTA 4RXLA 2A5TB 2V25A 3MP6A 3USDA 4MBPA 1LFGA 5KCJB 2I4BA 4PQJA 1MXVA 1S9TA 1OLAA 3PPPA 2A5SA 4PE5B 5ELVA 4RPOA 1Z7NE 4AQ4A 4RNSA 1A99A 3O2AA 3IR1A 5CMCA 1IXIA 3IB0A 3LVUA 4IGTA 3SDFA 3K6WA 4G68A 4NWDA 1D9YA 4QRZA 5DVFA 2Y7KA 1FQFA 1MQDA 3W9WA 5J1DA 3PUYE 3I6VA 1URGA 5H8NA 1FQEA 4U21A 1B40A 1OVTA 1FTMA 2FNCA 3OXNA 2VD2A 4M4GA 4EQ9A 5EHMA 1D4NA 3RTWB 1MXWA 1R1NA 3B6QA 3PU5A 3C34A 5HBCA 3ZKLA 4R72A 4GLIA 5CMBA 3D4CA 1ZKBA 1DPEA 4KI0E 1MQHA 1MQGA 2Q9TA 2QRYA 1MY4A 3KSJA 1CB6A 3FUZA 3PD8A 3TCGA 3DRGA 1B05A 1D3KA 1YPNA 2O1LA 1AL3A 2Q2AA 4GRKA 3T96B 3TAJA 3VXBA 3MPLA 3RNNA 1UTBA 3K2DA 3VLVA 4G77A 3JV9A 4R6KA 1MY1A 5L8DA 1GTKA 3VV5A 3ECRA 4U2RA 4F2QA 1FCKA 3OSRA 5IKBA 5FTIA 3CVGA 2I0BA 4F3BA 4LZ8A 4NE4A 4C1TA 1PBQA 3FVKA 3VVFA 4EXKA 1EZPA 1B4HA 3HV1A 3PPNA 4RK9A 1FQCA 4OVJA 1O63A 2Y7RA 3DP8A 4IO6A 4ELPA 1MQJA 1MPDA 2AIXA 1H44A 4HCYA 3SERA 4JB7A 3E3KA 4OFLA 2XXRA 3E9XA 1FTOA 3G7WA 3BBRA 3C33A 3FVOA 4DIGA 3S9NC 1MM7A 2YLNA 3G3KA 3Q28A 1EZ9A 5DEXB 1P1NA 1FQDA 4WEPA 2PMSA 2ZNSA 4KCDA 3VDFA 3K1NA 1SVXB 2E0SA 2HZKA 2ONSA 3H06B 3PD9A 4LQ5A 5TU0A 1QKAA 1CE2A 1LCFA 5BUUA 1VR5A 1MDP1 2I4CA 2RC9A 4MLQA 4PETA 4YKIA 1B51A 1ZLQA 4YB6A 1B0HA 3TTMA 3O97A 2B4MA 1NNPA 3H3GA 4DXUA 1LAXA 3G3IA 3MW0A 2AYSA 2WOLA 1LB9A 1B5JA 1LBBA 5I56B 4QSDA 5JTYA 4ELQA 1N7XA 2QS2A 3KN8A 3O28A 4ESXA 3FIRA 2G93A 4ZZAA 3R6UA 4OEUA 1ANFA 1QULA 1RKMA 4GF8A 2R71A 3KJTA 1QUKA 4H8JA 4NF8A 1NNTA 3O6HA 4LONB 3B6WA 2HZLA 1S50A 4P0IA 4RPNA 3S9EA 4H5FA 5FTHA 4F2OA 4ONYA 3QXMA 4Q0CA 4YKJA 5DVJA 2Q88A 1MDQA 3TQLA 3ZSFA 2VD3A 4QFPA 2YPNA 3DLNA 3GBBA 3MJNA 1N3XA 3LR1A 5JEIA 2XXQA 4O3CA 1IXGA 4ZDMA 5EHSA 2O6AA 3LSFB 2QMWA 1DTGA 3TDJA 1NNKA 1B3EA 3K6XA 4IY5A 4R75A 1P1OA 3B6TA 3CIJA 4EQ7A 3FXQA 4F18A 4YMAA 1B7UA 3FV1A 3JZJA 3ZKKA 2O69A 3TCFA 2Y7IA 2DVCA 5DVIA 3VXCA 2NXOA 5ISUA 3BFTA 3LSXA 3SKPA 4OXVA 2HCAA 4ISUA 4P11A 3TTNA 1B7ZA 3M8UA 1H43A 4JWOA 3K6VA 2O68A 5AA2A 3I5OA 1ATGA 2B3FA 5TP9B 3IJOB 2DWAA 3KJ7A 2F6GA 2XXXA 1GR2A 1II5A 3CR9A 3HO7A 4H67A 1YAEA 1R9LA 3VLUA 4KYEA 5H8QA 4C1UA 3KN3A 3PPRA 3FXUA 3QK6A 3VE1B 3TEPA 3E4RA 4ZEKA 4FECA 1NFTA 4JDFA 1UIUA 3RYBA 5CBSA 4G8HA 2FA7A 2P0SA 4OQOA 4ZECA 5A5XA 3MAMA 4OHNA 3MVWA 4ZEIA 1VFDA 3C32A 4Z7EA 1IXCA 1MY0A 3ONMA 3OEKA 1SW2A 1XVXA 3MZBA 5I2KA 3QSLA 4QFOA 5ITOA 4XKQA 1Y4TA 1PB9A 5CRYA 4WEDA 1IEJA 3VVDA 5JK4A 3A09A 2E1SA 4LATA 3MVYA 1JQFA 2OCUA 5B7DA 3Q29A 1OIBA 3H4ZA 1M5CA 2I58A 2NVUB 4ZZEA 3N26A 1USYE 2A5TA 2AL5A 2IEEA 2XD2A 4ZE8A 1LGBC 1Y4CA 4F39A 4F3GA 1LB8A 3ZS6A 3EQ1A 1P1WA 2XXIA 2ZMBA 5CMKA 4H5GA 5KDTB 2DE4A 3IORA 5K2YA 1PEBA 2DXRA 3SESA 2V84A 5L9MA 4NF5B 1YCJA 3RGYA 1MH4A 1Y3QA 3IX1A 1ELJA 3O6GA 4OYVA 2ZNTA 4R73A 1PDAA 3ILUB 5H8SA 4OFOA 4BDOA 4DZ1A 4ZEDA 4R2BA 5I2NA 3MVZA 1S7YA 3VVEA 2UYEA 5L9SA 1B52A 4DCYA 2OJTA 3WAEA 3K1MA 3OD7A 4ZEBA 3PMVA 3BKIB 5FHMA 3K00A 4LQ2A 3VLWA 3FJGA 5I59A 4G8MA 3C9HA 4AB5A 4R6HA 2PT1A 2QL3A 4G2ZA 3CI8A 1A54A 3T9XB 1B4ZA 3HCQA 4HW8A 1M5EA 3RQTA 2XXWA 5K2XA 2CZLA 4H1XA 1B3FA 1QUIA 1TXFA 1B5HA 1SW5A 1SQYA 2B4LA 4U4SA 4R9FA 4TQUQ 5CI5A 3W9VA 3RYAA 4BDMA 1KWHA 2Q2CA 4IY6A 5LOMA 4TOZA 1JEVA 4QFKA 2DXYA 1MS7A 2F6PA 3W15C 5AA3A 4GOTA 3MVXA 4IO5A 4QSCA 5M2VA 2Z23A 3VFJA 4DLDA 3UGWA 4GWOA 1HSEA 4R9GA 3O6PA 2XD3A 2UXAA 3M3KA 2RKMA 4OMBA 3P7IA 1JW4A 1B5IA 1JW1A 1QJMA 1I6BA 2UVIA 4M1VA 1QUJA 1Y20A 2NUVA 2CMOA 4KFQA 5DEXA 4POWA 4H65A 4LUBA 3T93B 1XS5A 1NH8A 3UIFA 1Q35A 4F3PA 4F1UA 4IO3A 4X1DA 2ONRA 1UTBB 2PT2A 4KYSA 4WKMA 4FATA 1UIVA 1M5FA 5AA4B 1T0KA 1US5A 2I3WA 1LSTA 4GQOA 2PVUA 2RCBA 4G8NA 4JXIA 2QJEA 1PB8A 3GXAA 4L17A 2IA4A 1JEUA 3H6VA 2RF1A 1MRPA 1N3WA 3KBRA 4N07A 3DRKA 4N6PA 4QSEA 3IOUA 5I56A 2Z8DA 4YB5A 4YAHX 2VHAA 2OLBA 3SEVA 3CRBA 4BDQA 3FJMA 5ICQA 3PUXE 1JVYA 2DP8A 2F7CA 4I1DA 4FEBA 2Q8JA 1M5DA 5KCJA 4NEDA 4PFTA 4EF2A 1F9BA 2NOOA 4MLVA 4F19A 1EZOA 3TTLA 1LAFE 3HSTA 1Y3NA 2DE3A 4NF6B 2QS4A 4U4XA 5F7VA 2D3IA 3H6TA 3K0VA 4K3FA 3RT8A 5H8HB 2XXUA 4YKPA 5I58A 4JSDA 3C35A 3IB1A 3S9LC 5HM4B 4LZ7A 1IQ7A 2DVZA 2F97A 3CG3A 4G4PA 2PBWA 1URDA 2OZZA 4TLLB 3OO8A 4JSOA 4IGRA 4KPTA 4GFRA 1TWYA 3ODBA 1SI1A 1IXHA 1H76A 1B7HA 3MZ9A 3TKDA 3KN7A 1DTZA 1N0TA 1JETA 1B1XA 3EF7A 3U93A 2Y7WA 5CC2A 1SW1A 3A3UA 3G3HA 4HCWA 4MF3A 5JTYB 4BDLA 4AB6A 2M8CA 1MPCA 1SDXA 3HN0A 3RPWA 4LP2B 4GIZA 3AXFA 5I2NB 2O7UA 4NF8B 2ZXTA 1WDNA 1B46A 3TUSA 2ZYMA 1DPPA 1QW0A 2QS3A 2B65A 3IOWA 3S4UA 4I8CA 2F78A 3IOVA 1GV8A 3OEMA 2DWJA 3U92A 4Q8RA 3FJ7A 3DRIA 5H8FA 1P99A 3IL1B 2HAVA 3O66A 1MY2A 5AA2D 4DCXA 4WXJA 4EF1A 3Q25A 1AH5A 3KGCA 2THIA 4PP0A 3S9MC 3T22A 1NNFA 3FD3A 1Q1KA 3IOTA 3PMXA 5FHNA 3FVNA 3G3FA 1B1HA 3OO9A 2D5WA 1ZU0A 3HHGA 1I69A 2ANJA 3KG2A 4ELRA 3KOSA 5I84A 2W7YA 2GFEA 3F11A 4FJPA 4OFJA 2R9JA 3OMBA 2D21A 3UORA 3FVGA 2WOKA 3TQWA 1LFHA 4HS7A 4NMYA 1FW0A 2UVGA 5TP9A 1YTVA 3TCHA 3K01A 2ZNUA 3TFLA 1JNFA 4EXLA 4OEVA 1N76A 1BLFA 3T9UA 1UTHA 1VFEA 4NF4B 2XX8A 2ALUA 1BTJA 3SEXA 1B9JA 4PFUA 1Y3PA 3PPOA 3V83A 5BWJA 4TLMB 3RY3A 3QIMA 1O7TA 1SBPA 2H25A 4F29A 1MQIA 1XC1A 3PV0E 2QMXA 4U22A 1ZJLA 3TTRA 2O1MA 2F36A 1FQAA 3KFMA 1SYIA 4G68B 3N94A 3K4UA 3V89B 4KYDA 4RYAA 2DWIA 4EUOA 2I6EA 1NL5A 2LAOA 1NH7A 1DSNA 1US4A 5HPQA 3UK4A 4ND9A 4NWCA 2Z8EA 4F31B 5CM6A 1QVSA 2I48A 3A3CA 3TYHA 2F5XA 3UP9A 2Q89A 1XOCA 3T9HB 4DXBA 2XXVA 4XKNA 3PMWA 4I62A 4H6DA 2X26A 3MBPA 3O6IA 3EHUA 3IO6A 3KZGA 2B3BA 3LUYA 1IUDA 5DT6A 1L5TA 2P2AA 4ELOA 3OENA 3TODA 1LAHE 2V3UA 4FIMA 3SEYA 4GVOA 2QS1A 1DOTA 2YJPA 1HSLA 1MXUA 2I49A 2GRVA 2DE2A 2UYFA 1IIWA 1XT8A 1FTLA 1TFAA 4Z0IA 1OMPA 1P1UA 1B0LA 4ECFA 3DRHA 1OVBA 3M3FA 1Y1MA 1FQBA 4P0GA 1GVCA 3RUMA 3U72A 4BLAA 2DS9A 5I57B 3THIA 3ILTB 4ZEFA 4ESWA 3GBAA 3K1PA 1MH3A 2DWHA 1IZ1A 4IO4A 4QF9A 1B3GA 1N84A 2XXTA 5I2KB 5CBRA 3G3JA 2PX1A 2ZYKA 1SYHA 4XIGQ 4OENA 1ZTYA 1ZBMA 2ESNA 5DYHA 3KSXA 4QFLA 1LFIA 4FE8A 5B70A 1A8FA 1BKAA 1EH3A 1NKXA 4PFWA 3QUJA 3C4MA 2WOPA 1POY1 1Y9UA 2RINA 3CHGA 5F1QA 2ABHA 3IB2A 2ZYOA 3UA8A 3U8QA 1D9VA 2UVHA 3RT6B 2OBGA 2VOZA 3PGFA 4LVQA 5TPAB 1N04A 4H0WA 4UA8A 3FZVA 5L9OA 1B3LA 3IO4A 2H9BA 3SEWA 3O29A 1OLCA 1H3DA 2ONKE 3CFZA 3MUQA 4OERA 2XX9A 2Y84A 1H45A 3FASA 4Q5TA 3TPAA 4GL0A 1A8EA 4RA1A 3D4GA 1P1QA 1B58A 4FORA 2BJJX 4FAJA 2GH9A 4DXCA 3TTKA 1A55A 1ZIUA 4XKPA 1NMUA 3N6UA 4OZ9A 4XXUA 1B6HA 1UTHB 4NF4A 5EYFA 3PPQA 4X1BA 3N6TA 1LBCA 2OK2A 4F22A 1A40A 5I59B 3K02A 4BDRA 3IAZA 4POXA 5ICTA 4THIA 4U23A 1I6AA 1MM6A 1ZMGA 2R6GE 1N7WA 1UQWA 3MP8A 4EQBA 4YMBA 3LBSA 3H6UA 2F35A 3EHTA 4C0RA 1M5BA 1MPBA 1A7LA 4YZZA 1FTJA 1EU8A 2F34A 3M3LA 4XKRA 4BDNA 1LCTA 1R9QA 4NF6A 5H8FB 4HTGA 2AL4A 5CMMA 4O3AA 3IJXB 3U1OA 4F3SA 4KR5A 1R6ZA 4OETA 4OWDA 1HSJA 3DP6A 4DDDA 1AOVA 3WAFA 2PYYA 4E0WA 5H8QB 3DELB 3N5LA 4JBZA 4X48A 3CFLA 1MXYA 2Z8FA 3V5AA 3MP1A 3O9PA 3LSLA 3LSWA 1RYOA 1VSOA 3MZ1A 4I9DA 5KZTA 4RJZA 5AE4A 4YKKA 3MQ9A 1AMFA 1MXXA 3H7MA 5A5XB 2QSXA 3EHSA 3MC2A 3PUZE 4OESA 1XHYA 2XX7A 2HEUA 2I0CA 3C31A 3UN6A 2ZYNA 2NWJA 4GL8A 2X7QA 4PFYA 4R2FA 3TMGA 4IB2A 3BFUA 1XVYA 3QUFA 4LA9A 3OSQA 2F8DA 3QAXA 1BIYA 2RCAA 4F1YA 3DRFA 2XXHA 3KOTA 4ZE9A 3H03A 3EN3A 3PAMA 1O64A 1B32A 2H4IA 2V3TA 3CG1A 3KEIA 3RTFB 5H8NB 1Y1ZA 3R26A 2Z22A 3CFXA 4JWYA 5I57A 4QFNA 5IAIA 4UACA 1MXZA 5KDTA 2HAUA 4U1OA 3OO7A 1POTA 2RC7A 1SI0A 1WVJA 1OQGA 3DP4A 4H8IA 4JWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG1 A;  2WKY A;  2O84 X;  3T9V A;  1PB7 A;  2Y7P A;  2H98 A;  3FAT A;  3Q27 A;  4R74 A;  1AIV A;  2V3Q A;  3T66 A;  4LZ5 A;  2I3V A;  3V8X B;  4KQP A;  5H8H A;  5I58 B;  3FV2 A;  3H6W A;  4KD5 A;  3OEL A;  2G29 A;  2H99 A;  4MFI A;  1DMB A;  3CSG A;  3TZA A;  4EDP A;  3EPE A;  3SEU A;  5DTB A;  1WOD A;  1MY3 A;  2F7B A;  4RY1 A;  4ZS9 A;  2FYI A;  2OWS A;  3R7X A;  2KLF A;  3K6U A;  1QKB A;  1TFD A;  5AA1 A;  2F7A A;  1B3H A;  1FTK A;  3B7D A;  4FED A;  4YIC A;  4F1V A;  2P1S A;  1RYX A;  2DQV A;  3HHF A;  3OOA A;  4YU0 A;  2V93 A;  4Q30 B;  4XTC Q;  2HXW A;  3PUV E;  3U94 A;  1BP5 A;  3CSB A;  1I6Q A;  4X9T A;  4R6Y A;  1JW5 A;  1LAG E;  2HQ0 A;  1J1N A;  3G3G A;  2H5Y A;  1PC3 A;  3MPK A;  1PBP A;  2XXP A;  4IO2 A;  1SW4 A;  1VE4 A;  4GXS B;  4OTE A;  5AA2 B;  3PUW E;  4RK2 A;  3DM0 A;  2REG A;  3QYT A;  4NTL A;  4MH5 A;  1GGG A;  2VGQ A;  2XHD A;  3L6H A;  2GHA A;  1JVX A;  1USY H;  4G68 C;  3RN8 A;  2DYX A;  1URS A;  1B2H A;  2VP1 A;  2RC8 A;  2XXY A;  3GLB A;  3HPI A;  4U1Z A;  4GD5 A;  4NF5 A;  4O3B A;  3TEL A;  5FHO A;  3FXR A;  3DRJ A;  2DOJ A;  2GHB A;  4IO7 A;  3Q26 A;  2UVJ A;  3FGS A;  1TT1 A;  3C36 A;  3GZG A;  3MWB A;  1OQH A;  2HFB A;  3LC8 A;  5AA4 A;  4GXA A;  2QPQ A;  3E13 X;  4DE8 A;  3RLF E;  2REJ A;  4KHZ E;  1LLS A;  4E0X A;  3IK6 B;  3FTO A;  2O7I A;  1IIT A;  3I3V A;  4YB7 A;  3S2V A;  1SD3 A;  2X7P A;  2O51 A;  4N13 A;  4KCC A;  4QHQ A;  5ITP A;  2DSF A;  3SET A;  3OO6 A;  1Z7M E;  3L6G A;  3JYR A;  5TPA A;  2OWT A;  4RXL A;  2A5T B;  2V25 A;  3MP6 A;  3USD A;  4MBP A;  1LFG A;  5KCJ B;  2I4B A;  4PQJ A;  1MXV A;  1S9T A;  1OLA A;  3PPP A;  2A5S A;  4PE5 B;  5ELV A;  4RPO A;  1Z7N E;  4AQ4 A;  4RNS A;  1A99 A;  3O2A A;  3IR1 A;  5CMC A;  1IXI A;  3IB0 A;  3LVU A;  4IGT A;  3SDF A;  3K6W A;  4G68 A;  4NWD A;  1D9Y A;  4QRZ A;  5DVF A;  2Y7K A;  1FQF A;  1MQD A;  3W9W A;  5J1D A;  3PUY E;  3I6V A;  1URG A;  5H8N A;  1FQE A;  4U21 A;  1B40 A;  1OVT A;  1FTM A;  2FNC A;  3OXN A;  2VD2 A;  4M4G A;  4EQ9 A;  5EHM A;  1D4N A;  3RTW B;  1MXW A;  1R1N A;  3B6Q A;  3PU5 A;  3C34 A;  5HBC A;  3ZKL A;  4R72 A;  4GLI A;  5CMB A;  3D4C A;  1ZKB A;  1DPE A;  4KI0 E;  1MQH A;  1MQG A;  2Q9T A;  2QRY A;  1MY4 A;  3KSJ A;  1CB6 A;  3FUZ A;  3PD8 A;  3TCG A;  3DRG A;  1B05 A;  1D3K A;  1YPN A;  2O1L A;  1AL3 A;  2Q2A A;  4GRK A;  3T96 B;  3TAJ A;  3VXB A;  3MPL A;  3RNN A;  1UTB A;  3K2D A;  3VLV A;  4G77 A;  3JV9 A;  4R6K A;  1MY1 A;  5L8D A;  1GTK A;  3VV5 A;  3ECR A;  4U2R A;  4F2Q A;  1FCK A;  3OSR A;  5IKB A;  5FTI A;  3CVG A;  2I0B A;  4F3B A;  4LZ8 A;  4NE4 A;  4C1T A;  1PBQ A;  3FVK A;  3VVF A;  4EXK A;  1EZP A;  1B4H A;  3HV1 A;  3PPN A;  4RK9 A;  1FQC A;  4OVJ A;  1O63 A;  2Y7R A;  3DP8 A;  4IO6 A;  4ELP A;  1MQJ A;  1MPD A;  2AIX A;  1H44 A;  4HCY A;  3SER A;  4JB7 A;  3E3K A;  4OFL A;  2XXR A;  3E9X A;  1FTO A;  3G7W A;  3BBR A;  3C33 A;  3FVO A;  4DIG A;  3S9N C;  1MM7 A;  2YLN A;  3G3K A;  3Q28 A;  1EZ9 A;  5DEX B;  1P1N A;  1FQD A;  4WEP A;  2PMS A;  2ZNS A;  4KCD A;  3VDF A;  3K1N A;  1SVX B;  2E0S A;  2HZK A;  2ONS A;  3H06 B;  3PD9 A;  4LQ5 A;  5TU0 A;  1QKA A;  1CE2 A;  1LCF A;  5BUU A;  1VR5 A;  1MDP 1;  2I4C A;  2RC9 A;  4MLQ A;  4PET A;  4YKI A;  1B51 A;  1ZLQ A;  4YB6 A;  1B0H A;  3TTM A;  3O97 A;  2B4M A;  1NNP A;  3H3G A;  4DXU A;  1LAX A;  3G3I A;  3MW0 A;  2AYS A;  2WOL A;  1LB9 A;  1B5J A;  1LBB A;  5I56 B;  4QSD A;  5JTY A;  4ELQ A;  1N7X A;  2QS2 A;  3KN8 A;  3O28 A;  4ESX A;  3FIR A;  2G93 A;  4ZZA A;  3R6U A;  4OEU A;  1ANF A;  1QUL A;  1RKM A;  4GF8 A;  2R71 A;  3KJT A;  1QUK A;  4H8J A;  4NF8 A;  1NNT A;  3O6H A;  4LON B;  3B6W A;  2HZL A;  1S50 A;  4P0I A;  4RPN A;  3S9E A;  4H5F A;  5FTH A;  4F2O A;  4ONY A;  3QXM A;  4Q0C A;  4YKJ A;  5DVJ A;  2Q88 A;  1MDQ A;  3TQL A;  3ZSF A;  2VD3 A;  4QFP A;  2YPN A;  3DLN A;  3GBB A;  3MJN A;  1N3X A;  3LR1 A;  5JEI A;  2XXQ A;  4O3C A;  1IXG A;  4ZDM A;  5EHS A;  2O6A A;  3LSF B;  2QMW A;  1DTG A;  3TDJ A;  1NNK A;  1B3E A;  3K6X A;  4IY5 A;  4R75 A;  1P1O A;  3B6T A;  3CIJ A;  4EQ7 A;  3FXQ A;  4F18 A;  4YMA A;  1B7U A;  3FV1 A;  3JZJ A;  3ZKK A;  2O69 A;  3TCF A;  2Y7I A;  2DVC A;  5DVI A;  3VXC A;  2NXO A;  5ISU A;  3BFT A;  3LSX A;  3SKP A;  4OXV A;  2HCA A;  4ISU A;  4P11 A;  3TTN A;  1B7Z A;  3M8U A;  1H43 A;  4JWO A;  3K6V A;  2O68 A;  5AA2 A;  3I5O A;  1ATG A;  2B3F A;  5TP9 B;  3IJO B;  2DWA A;  3KJ7 A;  2F6G A;  2XXX A;  1GR2 A;  1II5 A;  3CR9 A;  3HO7 A;  4H67 A;  1YAE A;  1R9L A;  3VLU A;  4KYE A;  5H8Q A;  4C1U A;  3KN3 A;  3PPR A;  3FXU A;  3QK6 A;  3VE1 B;  3TEP A;  3E4R A;  4ZEK A;  4FEC A;  1NFT A;  4JDF A;  1UIU A;  3RYB A;  5CBS A;  4G8H A;  2FA7 A;  2P0S A;  4OQO A;  4ZEC A;  5A5X A;  3MAM A;  4OHN A;  3MVW A;  4ZEI A;  1VFD A;  3C32 A;  4Z7E A;  1IXC A;  1MY0 A;  3ONM A;  3OEK A;  1SW2 A;  1XVX A;  3MZB A;  5I2K A;  3QSL A;  4QFO A;  5ITO A;  4XKQ A;  1Y4T A;  1PB9 A;  5CRY A;  4WED A;  1IEJ A;  3VVD A;  5JK4 A;  3A09 A;  2E1S A;  4LAT A;  3MVY A;  1JQF A;  2OCU A;  5B7D A;  3Q29 A;  1OIB A;  3H4Z A;  1M5C A;  2I58 A;  2NVU B;  4ZZE A;  3N26 A;  1USY E;  2A5T A;  2AL5 A;  2IEE A;  2XD2 A;  4ZE8 A;  1LGB C;  1Y4C A;  4F39 A;  4F3G A;  1LB8 A;  3ZS6 A;  3EQ1 A;  1P1W A;  2XXI A;  2ZMB A;  5CMK A;  4H5G A;  5KDT B;  2DE4 A;  3IOR A;  5K2Y A;  1PEB A;  2DXR A;  3SES A;  2V84 A;  5L9M A;  4NF5 B;  1YCJ A;  3RGY A;  1MH4 A;  1Y3Q A;  3IX1 A;  1ELJ A;  3O6G A;  4OYV A;  2ZNT A;  4R73 A;  1PDA A;  3ILU B;  5H8S A;  4OFO A;  4BDO A;  4DZ1 A;  4ZED A;  4R2B A;  5I2N A;  3MVZ A;  1S7Y A;  3VVE A;  2UYE A;  5L9S A;  1B52 A;  4DCY A;  2OJT A;  3WAE A;  3K1M A;  3OD7 A;  4ZEB A;  3PMV A;  3BKI B;  5FHM A;  3K00 A;  4LQ2 A;  3VLW A;  3FJG A;  5I59 A;  4G8M A;  3C9H A;  4AB5 A;  4R6H A;  2PT1 A;  2QL3 A;  4G2Z A;  3CI8 A;  1A54 A;  3T9X B;  1B4Z A;  3HCQ A;  4HW8 A;  1M5E A;  3RQT A;  2XXW A;  5K2X A;  2CZL A;  4H1X A;  1B3F A;  1QUI A;  1TXF A;  1B5H A;  1SW5 A;  1SQY A;  2B4L A;  4U4S A;  4R9F A;  4TQU Q;  5CI5 A;  3W9V A;  3RYA A;  4BDM A;  1KWH A;  2Q2C A;  4IY6 A;  5LOM A;  4TOZ A;  1JEV A;  4QFK A;  2DXY A;  1MS7 A;  2F6P A;  3W15 C;  5AA3 A;  4GOT A;  3MVX A;  4IO5 A;  4QSC A;  5M2V A;  2Z23 A;  3VFJ A;  4DLD A;  3UGW A;  4GWO A;  1HSE A;  4R9G A;  3O6P A;  2XD3 A;  2UXA A;  3M3K A;  2RKM A;  4OMB A;  3P7I A;  1JW4 A;  1B5I A;  1JW1 A;  1QJM A;  1I6B A;  2UVI A;  4M1V A;  1QUJ A;  1Y20 A;  2NUV A;  2CMO A;  4KFQ A;  5DEX A;  4POW A;  4H65 A;  4LUB A;  3T93 B;  1XS5 A;  1NH8 A;  3UIF A;  1Q35 A;  4F3P A;  4F1U A;  4IO3 A;  4X1D A;  2ONR A;  1UTB B;  2PT2 A;  4KYS A;  4WKM A;  4FAT A;  1UIV A;  1M5F A;  5AA4 B;  1T0K A;  1US5 A;  2I3W A;  1LST A;  4GQO A;  2PVU A;  2RCB A;  4G8N A;  4JXI A;  2QJE A;  1PB8 A;  3GXA A;  4L17 A;  2IA4 A;  1JEU A;  3H6V A;  2RF1 A;  1MRP A;  1N3W A;  3KBR A;  4N07 A;  3DRK A;  4N6P A;  4QSE A;  3IOU A;  5I56 A;  2Z8D A;  4YB5 A;  4YAH X;  2VHA A;  2OLB A;  3SEV A;  3CRB A;  4BDQ A;  3FJM A;  5ICQ A;  3PUX E;  1JVY A;  2DP8 A;  2F7C A;  4I1D A;  4FEB A;  2Q8J A;  1M5D A;  5KCJ A;  4NED A;  4PFT A;  4EF2 A;  1F9B A;  2NOO A;  4MLV A;  4F19 A;  1EZO A;  3TTL A;  1LAF E;  3HST A;  1Y3N A;  2DE3 A;  4NF6 B;  2QS4 A;  4U4X A;  5F7V A;  2D3I A;  3H6T A;  3K0V A;  4K3F A;  3RT8 A;  5H8H B;  2XXU A;  4YKP A;  5I58 A;  4JSD A;  3C35 A;  3IB1 A;  3S9L C;  5HM4 B;  4LZ7 A;  1IQ7 A;  2DVZ A;  2F97 A;  3CG3 A;  4G4P A;  2PBW A;  1URD A;  2OZZ A;  4TLL B;  3OO8 A;  4JSO A;  4IGR A;  4KPT A;  4GFR A;  1TWY A;  3ODB A;  1SI1 A;  1IXH A;  1H76 A;  1B7H A;  3MZ9 A;  3TKD A;  3KN7 A;  1DTZ A;  1N0T A;  1JET A;  1B1X A;  3EF7 A;  3U93 A;  2Y7W A;  5CC2 A;  1SW1 A;  3A3U A;  3G3H A;  4HCW A;  4MF3 A;  5JTY B;  4BDL A;  4AB6 A;  2M8C A;  1MPC A;  1SDX A;  3HN0 A;  3RPW A;  4LP2 B;  4GIZ A;  3AXF A;  5I2N B;  2O7U A;  4NF8 B;  2ZXT A;  1WDN A;  1B46 A;  3TUS A;  2ZYM A;  1DPP A;  1QW0 A;  2QS3 A;  2B65 A;  3IOW A;  3S4U A;  4I8C A;  2F78 A;  3IOV A;  1GV8 A;  3OEM A;  2DWJ A;  3U92 A;  4Q8R A;  3FJ7 A;  3DRI A;  5H8F A;  1P99 A;  3IL1 B;  2HAV A;  3O66 A;  1MY2 A;  5AA2 D;  4DCX A;  4WXJ A;  4EF1 A;  3Q25 A;  1AH5 A;  3KGC A;  2THI A;  4PP0 A;  3S9M C;  3T22 A;  1NNF A;  3FD3 A;  1Q1K A;  3IOT A;  3PMX A;  5FHN A;  3FVN A;  3G3F A;  1B1H A;  3OO9 A;  2D5W A;  1ZU0 A;  3HHG A;  1I69 A;  2ANJ A;  3KG2 A;  4ELR A;  3KOS A;  5I84 A;  2W7Y A;  2GFE A;  3F11 A;  4FJP A;  4OFJ A;  2R9J A;  3OMB A;  2D21 A;  3UOR A;  3FVG A;  2WOK A;  3TQW A;  1LFH A;  4HS7 A;  4NMY A;  1FW0 A;  2UVG A;  5TP9 A;  1YTV A;  3TCH A;  3K01 A;  2ZNU A;  3TFL A;  1JNF A;  4EXL A;  4OEV A;  1N76 A;  1BLF A;  3T9U A;  1UTH A;  1VFE A;  4NF4 B;  2XX8 A;  2ALU A;  1BTJ A;  3SEX A;  1B9J A;  4PFU A;  1Y3P A;  3PPO A;  3V83 A;  5BWJ A;  4TLM B;  3RY3 A;  3QIM A;  1O7T A;  1SBP A;  2H25 A;  4F29 A;  1MQI A;  1XC1 A;  3PV0 E;  2QMX A;  4U22 A;  1ZJL A;  3TTR A;  2O1M A;  2F36 A;  1FQA A;  3KFM A;  1SYI A;  4G68 B;  3N94 A;  3K4U A;  3V89 B;  4KYD A;  4RYA A;  2DWI A;  4EUO A;  2I6E A;  1NL5 A;  2LAO A;  1NH7 A;  1DSN A;  1US4 A;  5HPQ A;  3UK4 A;  4ND9 A;  4NWC A;  2Z8E A;  4F31 B;  5CM6 A;  1QVS A;  2I48 A;  3A3C A;  3TYH A;  2F5X A;  3UP9 A;  2Q89 A;  1XOC A;  3T9H B;  4DXB A;  2XXV A;  4XKN A;  3PMW A;  4I62 A;  4H6D A;  2X26 A;  3MBP A;  3O6I A;  3EHU A;  3IO6 A;  3KZG A;  2B3B A;  3LUY A;  1IUD A;  5DT6 A;  1L5T A;  2P2A A;  4ELO A;  3OEN A;  3TOD A;  1LAH E;  2V3U A;  4FIM A;  3SEY A;  4GVO A;  2QS1 A;  1DOT A;  2YJP A;  1HSL A;  1MXU A;  2I49 A;  2GRV A;  2DE2 A;  2UYF A;  1IIW A;  1XT8 A;  1FTL A;  1TFA A;  4Z0I A;  1OMP A;  1P1U A;  1B0L A;  4ECF A;  3DRH A;  1OVB A;  3M3F A;  1Y1M A;  1FQB A;  4P0G A;  1GVC A;  3RUM A;  3U72 A;  4BLA A;  2DS9 A;  5I57 B;  3THI A;  3ILT B;  4ZEF A;  4ESW A;  3GBA A;  3K1P A;  1MH3 A;  2DWH A;  1IZ1 A;  4IO4 A;  4QF9 A;  1B3G A;  1N84 A;  2XXT A;  5I2K B;  5CBR A;  3G3J A;  2PX1 A;  2ZYK A;  1SYH A;  4XIG Q;  4OEN A;  1ZTY A;  1ZBM A;  2ESN A;  5DYH A;  3KSX A;  4QFL A;  1LFI A;  4FE8 A;  5B70 A;  1A8F A;  1BKA A;  1EH3 A;  1NKX A;  4PFW A;  3QUJ A;  3C4M A;  2WOP A;  1POY 1;  1Y9U A;  2RIN A;  3CHG A;  5F1Q A;  2ABH A;  3IB2 A;  2ZYO A;  3UA8 A;  3U8Q A;  1D9V A;  2UVH A;  3RT6 B;  2OBG A;  2VOZ A;  3PGF A;  4LVQ A;  5TPA B;  1N04 A;  4H0W A;  4UA8 A;  3FZV A;  5L9O A;  1B3L A;  3IO4 A;  2H9B A;  3SEW A;  3O29 A;  1OLC A;  1H3D A;  2ONK E;  3CFZ A;  3MUQ A;  4OER A;  2XX9 A;  2Y84 A;  1H45 A;  3FAS A;  4Q5T A;  3TPA A;  4GL0 A;  1A8E A;  4RA1 A;  3D4G A;  1P1Q A;  1B58 A;  4FOR A;  2BJJ X;  4FAJ A;  2GH9 A;  4DXC A;  3TTK A;  1A55 A;  1ZIU A;  4XKP A;  1NMU A;  3N6U A;  4OZ9 A;  4XXU A;  1B6H A;  1UTH B;  4NF4 A;  5EYF A;  3PPQ A;  4X1B A;  3N6T A;  1LBC A;  2OK2 A;  4F22 A;  1A40 A;  5I59 B;  3K02 A;  4BDR A;  3IAZ A;  4POX A;  5ICT A;  4THI A;  4U23 A;  1I6A A;  1MM6 A;  1ZMG A;  2R6G E;  1N7W A;  1UQW A;  3MP8 A;  4EQB A;  4YMB A;  3LBS A;  3H6U A;  2F35 A;  3EHT A;  4C0R A;  1M5B A;  1MPB A;  1A7L A;  4YZZ A;  1FTJ A;  1EU8 A;  2F34 A;  3M3L A;  4XKR A;  4BDN A;  1LCT A;  1R9Q A;  4NF6 A;  5H8F B;  4HTG A;  2AL4 A;  5CMM A;  4O3A A;  3IJX B;  3U1O A;  4F3S A;  4KR5 A;  1R6Z A;  4OET A;  4OWD A;  1HSJ A;  3DP6 A;  4DDD A;  1AOV A;  3WAF A;  2PYY A;  4E0W A;  5H8Q B;  3DEL B;  3N5L A;  4JBZ A;  4X48 A;  3CFL A;  1MXY A;  2Z8F A;  3V5A A;  3MP1 A;  3O9P A;  3LSL A;  3LSW A;  1RYO A;  1VSO A;  3MZ1 A;  4I9D A;  5KZT A;  4RJZ A;  5AE4 A;  4YKK A;  3MQ9 A;  1AMF A;  1MXX A;  3H7M A;  5A5X B;  2QSX A;  3EHS A;  3MC2 A;  3PUZ E;  4OES A;  1XHY A;  2XX7 A;  2HEU A;  2I0C A;  3C31 A;  3UN6 A;  2ZYN A;  2NWJ A;  4GL8 A;  2X7Q A;  4PFY A;  4R2F A;  3TMG A;  4IB2 A;  3BFU A;  1XVY A;  3QUF A;  4LA9 A;  3OSQ A;  2F8D A;  3QAX A;  1BIY A;  2RCA A;  4F1Y A;  3DRF A;  2XXH A;  3KOT A;  4ZE9 A;  3H03 A;  3EN3 A;  3PAM A;  1O64 A;  1B32 A;  2H4I A;  2V3T A;  3CG1 A;  3KEI A;  3RTF B;  5H8N B;  1Y1Z A;  3R26 A;  2Z22 A;  3CFX A;  4JWY A;  5I57 A;  4QFN A;  5IAI A;  4UAC A;  1MXZ A;  5KDT A;  2HAU A;  4U1O A;  3OO7 A;  1POT A;  2RC7 A;  1SI0 A;  1WVJ A;  1OQG A;  3DP4 A;  4H8I A;  4JWX A; 
#chains in the Genus database with same CATH topology
 2O84 X;  1PB7 A;  3V8X B;  5H8H A;  2FVZ A;  4KD5 A;  3OEL A;  2H99 A;  4QBA A;  1DMB A;  1NI9 A;  3SEU A;  1MY3 A;  2F7B A;  2FYI A;  1TFD A;  2VPO A;  2F7A A;  3B7D A;  1RYX A;  2DQV A;  3HHF A;  4Q30 B;  2HXW A;  3PUV E;  1BP5 A;  4R6Y A;  3G3G A;  1PBP A;  2XXP A;  1VE4 A;  3DM0 A;  2REG A;  3QYT A;  1USY H;  4OVQ A;  2VP1 A;  2RC8 A;  2VPN A;  2QFL A;  3TEL A;  3Q26 A;  4OVP A;  3LC8 A;  4GXA A;  3RLF E;  4E0X A;  1LLS A;  1IIT A;  3S2V A;  1SD3 A;  5F24 A;  3SET A;  2V25 A;  3MP6 A;  5ELV A;  1S9T A;  4PE5 B;  1VDW A;  1Z7N E;  4AQ4 A;  3IR1 A;  1IXI A;  5ET7 A;  4QRZ A;  4PBQ A;  4EQ9 A;  1D4N A;  4GLI A;  1FPB A;  4KI0 E;  1MQH A;  4P0G A;  3PU5 A;  1MY4 A;  3FUZ A;  2O1L A;  2Q2A A;  4GRK A;  3TAJ A;  3VXB A;  3MPL A;  1UTB A;  4GX6 A;  4GWW A;  4LZ8 A;  4MJO A;  4NQ8 A;  3HV1 A;  4RK9 A;  4OVJ A;  4ELP A;  3DP8 A;  1FBC A;  2F3B A;  2AIX A;  3SER A;  4OFL A;  3G7W A;  3C33 A;  4DIG A;  4GWX A;  3VDF A;  1QKA A;  1Q9D A;  1MDP 1;  4MLQ A;  1ZLQ A;  2B4M A;  4DXU A;  3G3I A;  3MW0 A;  5I56 B;  2ZZW A;  4QSD A;  4ELQ A;  3KN8 A;  4ZZA A;  4R73 A;  4OEU A;  1RKM A;  2R71 A;  4GF8 A;  4GBW A;  5LDZ A;  1NNT A;  4LON B;  4X8R A;  4RPN A;  4H5F A;  4PAI A;  4Q0C A;  1MDQ A;  2VD3 A;  1N3X A;  2XXQ A;  4PFI A;  3GYY A;  5IZZ A;  3TDJ A;  1DK4 A;  3K6X A;  5EQ9 A;  4N8Y A;  2O69 A;  5DVI A;  2NXO A;  3MYU A;  4OXV A;  1H43 A;  5AA2 A;  5TP9 B;  1FJ6 A;  2F6G A;  2XXX A;  1NV5 A;  1R9L A;  5I5P A;  4KYE A;  4C1U A;  3KN3 A;  3PPR A;  2R8T A;  2OX3 A;  3TEP A;  3E4R A;  4ZEK A;  4G8H A;  5A5X A;  4OHN A;  1IXC A;  3OEK A;  4GWZ A;  5CRY A;  1FPG A;  1PB9 A;  4LAT A;  2OCU A;  4PTK A;  1OIB A;  2A5T A;  2AL5 A;  2XD2 A;  1LGB C;  4F3G A;  3ZS6 A;  3EQ1 A;  4H5G A;  2DE4 A;  5K2Y A;  3RGY A;  1YCJ A;  3IX1 A;  5EQ8 A;  3WAE A;  4P9K A;  2CZH A;  5FHM A;  3VLW A;  4G2Z A;  3CI8 A;  1A54 A;  1M5E A;  5K2X A;  2XXW A;  3A29 A;  4H1X A;  1QUI A;  1TXF A;  1FBH A;  4TQU Q;  4PE3 A;  4MIJ A;  4NN3 A;  2Q2C A;  5LOM A;  4TOZ A;  2DXY A;  2F6P A;  2Y5K A;  4GOT A;  4IO5 A;  4MAG A;  3UGW A;  1HSE A;  3O6P A;  2XD3 A;  3M3K A;  2RKM A;  1JW4 A;  1QUJ A;  1Y20 A;  2NUV A;  4KFQ A;  1NH8 A;  4IO3 A;  2ONR A;  1UTB B;  2PT2 A;  2P3N A;  4FAT A;  1UIV A;  1M5F A;  1US5 A;  4JVI A;  4L17 A;  2QJE A;  3GXA A;  4NX1 A;  4TLL B;  3H6V A;  2RF1 A;  2Z8D A;  4YB5 A;  3SEV A;  3FJM A;  3PUX E;  1JVY A;  2DP8 A;  5KCJ A;  4PFT A;  1EZO A;  1LAF E;  3HST A;  4GWY A;  1Y3N A;  4NF6 B;  2QS4 A;  2D3I A;  3RT8 A;  5H8H B;  2XXU A;  4YKP A;  3IB1 A;  3S9L C;  2F97 A;  4G4P A;  3ODB A;  2Y5L A;  1B1X A;  4I3E A;  4MF3 A;  1EYJ A;  1MPC A;  2O7U A;  4NF8 B;  2ZXT A;  4I8C A;  3IOV A;  3OEM A;  2DWJ A;  3U92 A;  2FIX A;  5H8F A;  3O66 A;  4EF1 A;  3Q25 A;  3KGC A;  1LBY A;  2THI A;  3BIG A;  3HHG A;  2W7Y A;  3UOR A;  4OEV A;  1FTA A;  2HXR A;  4O7M A;  1B9J A;  1Y3P A;  3V83 A;  1O7T A;  1EYK A;  3KFM A;  1SYI A;  2XWO A;  1DSN A;  4MEV A;  5HPQ A;  3UK4 A;  4F31 B;  5CM6 A;  1QVS A;  2I48 A;  4MHF A;  3A3C A;  3TYH A;  2WYP A;  1XOC A;  4I62 A;  2X26 A;  3IO6 A;  4NG7 A;  1L5T A;  4ELO A;  2WX9 A;  1DOT A;  1FPL A;  2DE2 A;  2UYF A;  1IIW A;  4Z0I A;  4ECF A;  1P1U A;  3T0J A;  1FQB A;  4BLA A;  2XXT A;  3G3J A;  1ZBM A;  4QFL A;  4FE8 A;  5B70 A;  3EKI A;  3QUJ A;  1POY 1;  3IB2 A;  3CHG A;  1K9Y A;  3RT6 B;  1N04 A;  2XWK A;  3RYD A;  1FRP A;  3MUQ A;  1P1Q A;  1B6H A;  4F22 A;  1A40 A;  1FPF A;  5I59 B;  5ICT A;  1UQW A;  4PFB A;  3LBS A;  4OVS A;  2F34 A;  1EU8 A;  4XKR A;  4BDN A;  3B50 A;  5CMM A;  4F3S A;  1R6Z A;  4DDD A;  3WAF A;  3DEL B;  3N5L A;  3CFL A;  2Z8F A;  5AE4 A;  1MXX A;  5A5X B;  2XX7 A;  3UN6 A;  4QXD A;  2ZYN A;  2NWJ A;  4PGN A;  4R2F A;  4PFY A;  3HFU A;  3OSQ A;  1BIY A;  2RCA A;  3DRF A;  2XXH A;  3KOT A;  4ZE9 A;  4PF6 A;  2V3T A;  3CG1 A;  3R26 A;  4QFN A;  5I3S A;  5KDT A;  1OQG A;  4YKI A;  1IME A;  4H8I A;  2WKY A;  1FBF A;  2Y7P A;  4R74 A;  1AIV A;  2I3V A;  4N6D A;  4KQP A;  1IMD A;  3FV2 A;  2G29 A;  4OA4 A;  4EDP A;  3EPE A;  5DTB A;  2Q74 A;  3R7X A;  1QKB A;  5AA1 A;  2WBB A;  1FTK A;  2P3V A;  4F1V A;  3OOA A;  4YU0 A;  1IMF A;  2V93 A;  3CSB A;  1I6Q A;  4X9T A;  1LAG E;  2HQ0 A;  1SW4 A;  5IZ3 B;  3PUW E;  3IFC A;  4HXV A;  1JVX A;  4P56 A;  4G68 C;  4PDD A;  3GLB A;  2HPG A;  4U1Z A;  4GD5 A;  4NF5 A;  5FHO A;  2GHB A;  2UVJ A;  3MWB A;  3C36 A;  3E13 X;  1AWB A;  2O7I A;  3I3V A;  4YB7 A;  4N13 A;  4KCC A;  5ITP A;  2DSF A;  3NOH A;  1Z7M E;  3JYR A;  5KCJ B;  2I4B A;  1MXV A;  4RPO A;  1A99 A;  5CMC A;  4F1U A;  3IB0 A;  3LVU A;  4IGT A;  4G68 A;  1D9Y A;  1MQD A;  2VD2 A;  5EHM A;  3B6Q A;  5CMB A;  3FBP A;  2QVV A;  1MQG A;  2L5V A;  1CB6 A;  3TCG A;  1YPN A;  1AL3 A;  4G77 A;  4R6K A;  5L8D A;  4U2R A;  4F2Q A;  3OSR A;  5FTI A;  3CVG A;  4F3B A;  2GQ1 A;  3VVF A;  1B4H A;  1FQC A;  2Y7R A;  4HCY A;  3E9X A;  1FTO A;  3S9N C;  3G3K A;  1P1N A;  1FQD A;  2ONS A;  1NUW A;  2I4C A;  1B51 A;  4YB6 A;  1B0H A;  3TTM A;  4N81 A;  1LAX A;  2WOL A;  1LB9 A;  1B5J A;  1LBB A;  2G93 A;  1ANF A;  4H8J A;  1EZP A;  1S50 A;  5FTH A;  4ONY A;  3QXM A;  5DVJ A;  2Q88 A;  3ZSF A;  3DLN A;  3GBB A;  4O3C A;  1IXG A;  4ZDM A;  2O6A A;  1NV6 A;  3LSF B;  4R75 A;  1P1O A;  4EQ7 A;  1FBE A;  3FV1 A;  3JZJ A;  3ZKK A;  3TCF A;  3VXC A;  5ISU A;  2HCA A;  1B7Z A;  4JWO A;  3K6V A;  3IJO B;  1FBP A;  1GR2 A;  1II5 A;  3E79 A;  3HO7 A;  2CEX A;  3FXU A;  3VE1 B;  4JDF A;  3RYB A;  4OQO A;  1VFD A;  3C32 A;  1SW2 A;  1XVX A;  3QSL A;  4QFO A;  3VVD A;  5JK4 A;  3MVY A;  1JQF A;  2MKZ A;  3Q29 A;  3H4Z A;  1M5C A;  4ZE8 A;  1Y4C A;  4P1L A;  3SES A;  2DXR A;  1Y3Q A;  3ILU B;  4OFO A;  2V4C A;  1S7Y A;  3VVE A;  2OJT A;  3OD7 A;  2FHY A;  3BKI B;  3K00 A;  4LQ2 A;  5I59 A;  4G8M A;  1K9Z A;  1FJ9 A;  4PCD A;  3RQT A;  2CZL A;  4PAF A;  2JJK A;  4IY6 A;  1MS7 A;  4QSC A;  5J16 A;  1QJM A;  4M1V A;  2CMO A;  4POW A;  4H65 A;  3T93 B;  1Q35 A;  4X1D A;  4WKM A;  1JP4 A;  1INP A;  2I3W A;  1LST A;  2RCB A;  4U1O A;  2IA4 A;  1JEU A;  1MRP A;  4QSE A;  1FSA A;  2VHA A;  3CRB A;  4BDQ A;  5ICQ A;  4I1D A;  4FEB A;  4EF2 A;  4F19 A;  4GX4 A;  5F7V A;  4N17 A;  1G0I A;  3H6T A;  5I58 A;  2Q8M A;  5HM4 B;  2DVZ A;  3LV0 A;  3OO8 A;  4XF5 A;  1SI1 A;  1IXH A;  3TKD A;  1DTZ A;  1N0T A;  3U93 A;  5CC2 A;  1SW1 A;  3A3U A;  3KBZ A;  5JTY B;  4AB6 A;  3RPW A;  4LP2 B;  3AXF A;  2PFZ A;  2ZYM A;  1DPP A;  1QW0 A;  2QS3 A;  2B65 A;  3IOW A;  1GV8 A;  4Q8R A;  4MNI A;  1P99 A;  4OVR A;  5AA2 D;  2F3D A;  4PBH A;  4PP0 A;  3S9M C;  3FD3 A;  2KQZ A;  1Q1K A;  3IOT A;  5FHN A;  1B1H A;  3OO9 A;  4MX6 A;  1ZU0 A;  3FXB A;  2XWI A;  4FJP A;  3OMB A;  3FVG A;  4HS7 A;  4NMY A;  5ESY A;  3K01 A;  2ZNU A;  3TFL A;  4EXL A;  1BLF A;  3T9U A;  1VFE A;  4NF4 B;  4TLM B;  1SBP A;  1MQI A;  1XC1 A;  4NHB A;  2O1M A;  1FQA A;  2DWI A;  2I6E A;  1NL5 A;  2LAO A;  1US4 A;  4ND9 A;  4NWC A;  4DXB A;  4XKN A;  5I7I A;  3EHU A;  3LUY A;  2P2A A;  4GBV A;  2V3U A;  2QS1 A;  2YJP A;  2I49 A;  1MXU A;  2GRV A;  1XT8 A;  1FTL A;  1OMP A;  4AS4 A;  5ET6 A;  3DRH A;  1GVC A;  3U72 A;  3THI A;  4ZEF A;  3K1P A;  1IZ1 A;  4IO4 A;  1B3G A;  1N84 A;  4LN5 A;  5CBR A;  1SYH A;  1ZTY A;  1RDY A;  4MCO A;  1A8F A;  1BKA A;  4PFW A;  1IMC A;  3UA8 A;  2ABH A;  2ZYO A;  4MMP A;  3U8Q A;  3PGF A;  4LVQ A;  5TPA B;  3IO4 A;  3SEW A;  1H3D A;  2ONK E;  4Q5T A;  3TPA A;  1B58 A;  2GH9 A;  3TTK A;  3N6U A;  4OZ9 A;  1IMB A;  1LBC A;  3ISP A;  4HE2 A;  3K02 A;  4THI A;  4MNP A;  1I6A A;  1MM6 A;  3H6U A;  1M5B A;  1A7L A;  3M3L A;  1R9Q A;  3IJX B;  1AOV A;  4OET A;  4OWD A;  3V5A A;  2VT5 A;  1LBV A;  3O9P A;  4I9D A;  5KZT A;  4RJZ A;  4YKK A;  1AMF A;  3H7M A;  3PUZ E;  5A5L A;  2HEU A;  2I0C A;  4GL8 A;  2X7Q A;  3BFU A;  4LA9 A;  4F1Y A;  3PAM A;  3RTF B;  1B32 A;  5H8N B;  5I57 A;  4UAC A;  3OO7 A;  1POT A;  1SI0 A;  1WVJ A;  3T9V A;  2H98 A;  4LZ5 A;  3H6W A;  4MFI A;  3CSG A;  1WOD A;  4RY1 A;  4O7I A;  4ZS9 A;  4DI4 B;  4FBP A;  3K6U A;  2P1S A;  3U94 A;  5ET8 A;  1JW5 A;  1FPD A;  4PC9 A;  1LBZ A;  4OTE A;  5AA2 B;  4RK2 A;  4NTL A;  3L6H A;  3QMF A;  2GHA A;  2DYX A;  3HPI A;  3D1R A;  4O3B A;  2DOJ A;  4IO7 A;  3FGS A;  3GZG A;  1OQH A;  5AA4 A;  2REJ A;  4KHZ E;  5DW8 A;  5EYG A;  2X7P A;  4X04 A;  2FBP A;  2O51 A;  5TPA A;  2OWT A;  4RXL A;  2A5T B;  4GX3 A;  3USD A;  1LFG A;  3PPP A;  1OLA A;  2A5S A;  4RNS A;  4NWD A;  2Y7K A;  1FQF A;  5J1D A;  3I6V A;  1FQE A;  1B40 A;  1FTM A;  2FNC A;  3OXN A;  4I3Y A;  3RTW B;  3C34 A;  3ZKL A;  4R72 A;  3D4C A;  1DPE A;  2Q9T A;  2QRY A;  2OWZ A;  3RPL A;  3T96 B;  3DRG A;  1B05 A;  4H46 A;  1FPI A;  3K2D A;  3JV9 A;  4PAK A;  3PTY A;  1MY1 A;  3SZP A;  3VV5 A;  3ECR A;  4JVC A;  5IKB A;  1PBQ A;  3FVK A;  4EXK A;  3PPN A;  1MQJ A;  1H44 A;  4JB7 A;  3E3K A;  2XXR A;  2YLN A;  3Q28 A;  1EZ9 A;  5DEX B;  2PMS A;  2ZNS A;  1SVX B;  2HZK A;  5TU0 A;  3PD9 A;  1CE2 A;  1LCF A;  3IFA A;  4P47 A;  2QS2 A;  4ESX A;  3FIR A;  3R6U A;  3KJT A;  1QUL A;  4NF8 A;  3O6H A;  4P0I A;  3B6W A;  3TQL A;  2YPN A;  2QMW A;  1NNK A;  1B3E A;  4IY5 A;  3FXQ A;  4YMA A;  2DVC A;  3LSX A;  3SKP A;  4P11 A;  4P3L A;  2O68 A;  3I5O A;  2B3F A;  2DWA A;  3KJ7 A;  4H67 A;  3CR9 A;  1NV4 A;  2WYK A;  4GWU A;  1UIU A;  5CBS A;  3MAM A;  3MVW A;  4Z7E A;  3ONM A;  3MZB A;  4XKQ A;  1Y4T A;  4WED A;  1IEJ A;  3A09 A;  2E1S A;  5B7D A;  4ZZE A;  1USY E;  2IEE A;  4F39 A;  1P1W A;  2XXI A;  2ZMB A;  5KDT B;  1PEB A;  2V84 A;  1ELJ A;  3O6G A;  4OYV A;  1PDA A;  5H8S A;  3B8B A;  4DZ1 A;  4ZED A;  5L9S A;  3MVZ A;  3K1M A;  4ZEB A;  3FJG A;  3C9H A;  4R6H A;  2PT1 A;  3HCQ A;  5EQA A;  1SW5 A;  1SQY A;  4U4S A;  4R9F A;  3RYA A;  1KWH A;  1JEV A;  4QFK A;  5M2V A;  3MVX A;  2ZZX A;  4MNC A;  2Z23 A;  3LUZ A;  3VFJ A;  4DLD A;  4R9G A;  3P7I A;  1B5I A;  1JW1 A;  1I6B A;  2UVI A;  1BK4 A;  5DEX A;  4LUB A;  1XS5 A;  4GQO A;  4N8G A;  4JXI A;  1PB8 A;  3W9W A;  3KBR A;  4N07 A;  1NV3 A;  5I56 A;  4YAH X;  1M5D A;  4NED A;  4MLV A;  2NOO A;  5IM2 A;  4K3F A;  4JSD A;  3C35 A;  1D9Q A;  1IQ7 A;  3CG3 A;  1URD A;  2OZZ A;  4OAN A;  4JSO A;  1TWY A;  1B7H A;  3MZ9 A;  3EF7 A;  2Y7W A;  4AS5 A;  4HCW A;  4PFR A;  1NUX A;  2M8C A;  1SDX A;  3HN0 A;  5I2N B;  4GIZ A;  2QVU A;  3TUS A;  4N91 A;  3DRI A;  2HAV A;  1MY2 A;  2ZZV A;  2D5W A;  1I69 A;  4ELR A;  1IMA A;  3KOS A;  1LFH A;  2WOK A;  1RDZ A;  2UVG A;  5TP9 A;  1YTV A;  1JNF A;  1UTH A;  2XX8 A;  2ALU A;  3SEX A;  3RY3 A;  3QIM A;  2H25 A;  4F29 A;  2QMX A;  4PGP A;  4U22 A;  2F36 A;  3N94 A;  4NGU A;  4KYD A;  1NH7 A;  2Z8E A;  2Q89 A;  3PMW A;  4H6D A;  3O6I A;  3MBP A;  3KZG A;  1NV0 A;  1IUD A;  3OEN A;  3TOD A;  1LAH E;  4FIM A;  3SEY A;  4GVO A;  1HSL A;  1TFA A;  3ROJ A;  1B0L A;  1OVB A;  3M3F A;  1Y1M A;  1NV2 A;  5I57 B;  3ILT B;  3GBA A;  1MH3 A;  5I2K B;  2ZYK A;  1KA0 A;  2ESN A;  5EYH A;  3T1B A;  3KSX A;  1LFI A;  4NAP A;  2RIN A;  1Y9U A;  5F1Q A;  2UVH A;  2VOZ A;  2XWV A;  3FZV A;  1OLC A;  3CFZ A;  2Y84 A;  3FAS A;  3D4G A;  4FOR A;  4FAJ A;  4DXC A;  1A55 A;  1ZIU A;  1NMU A;  2HHM A;  4XXU A;  5EYF A;  4NF4 A;  3PPQ A;  4X1B A;  4U23 A;  4YMB A;  1N7W A;  2F35 A;  4C0R A;  1MPB A;  4YZZ A;  1LCT A;  4NF6 A;  5H8F B;  1NUZ A;  4O3A A;  3U1O A;  4KR5 A;  1HSJ A;  4E0W A;  4X48 A;  1MXY A;  3MP1 A;  3MZ1 A;  3LSW A;  1VSO A;  3MQ9 A;  2QSX A;  4OES A;  1XHY A;  4N15 A;  4IB2 A;  3QUF A;  3QAX A;  3EN3 A;  3KEI A;  1Y1Z A;  5IAI A;  3CFX A;  4JWY A;  1MXZ A;  5ET5 A;  3DP4 A;  3RPL B;  1G0H A;  1MG1 A;  3FAT A;  3Q27 A;  2V3Q A;  3T66 A;  5I58 B;  3TZA A;  2OWS A;  4PDH A;  2KLF A;  4YIC A;  1B3H A;  4JVD A;  4FED A;  4XTC Q;  1J1N A;  2H5Y A;  1PC3 A;  3MPK A;  4IO2 A;  4GWS A;  4GXS B;  5EQ7 A;  4MH5 A;  1GGG A;  2VGQ A;  2XHD A;  3RN8 A;  1URS A;  1B2H A;  2XXY A;  1T0K A;  3FXR A;  3DRJ A;  1TT1 A;  2HFB A;  2QPQ A;  4DE8 A;  1RDX A;  3IK6 B;  3FTO A;  2PFY A;  1XI6 A;  4QHQ A;  3OO6 A;  3L6G A;  4IR8 A;  4MBP A;  4PQJ A;  3O2A A;  3SDF A;  3K6W A;  5DVF A;  3PUY E;  4HE0 A;  1URG A;  5H8N A;  4U21 A;  1OVT A;  1FPE A;  4M4G A;  1MXW A;  1R1N A;  5HBC A;  1LBW A;  1DCU A;  1ZKB A;  3PD8 A;  2DDK A;  5ITO A;  3KSJ A;  1D3K A;  3RNN A;  3VLV A;  1GTK A;  1FCK A;  2I0B A;  4NE4 A;  4C1T A;  4KXP A;  3U65 A;  1O63 A;  4IO6 A;  1MPD A;  3BBR A;  3FVO A;  1MM7 A;  4WEP A;  5T3J A;  4KCD A;  3K1N A;  2E0S A;  3H06 B;  4LQ5 A;  5BUU A;  1VR5 A;  2RC9 A;  4PET A;  3O97 A;  1NNP A;  3H3G A;  2AYS A;  1QGX A;  5JTY A;  1N7X A;  3O28 A;  1QUK A;  4G61 A;  2WBD A;  2HZL A;  3S9E A;  4F2O A;  4H45 A;  4O8M A;  4YKJ A;  2XXK A;  4QFP A;  3MJN A;  3LR1 A;  5JEI A;  5EHS A;  1DTG A;  3B6T A;  3CIJ A;  4F18 A;  1B7U A;  2KR0 A;  2Y7I A;  3BFT A;  4ISU A;  3TTN A;  3M8U A;  1ATG A;  1FPJ A;  1NUY A;  1YAE A;  3VLU A;  5H8Q A;  1DBZ A;  3QK6 A;  4FEC A;  1NFT A;  2FA7 A;  4HE1 A;  2P0S A;  4ZEC A;  4ZEI A;  1MY0 A;  1SPI A;  5I2K A;  5IZ3 A;  2I58 A;  2NVU B;  3N26 A;  2BJI A;  1LB8 A;  1EYI A;  5CMK A;  3IOR A;  5L9M A;  4NF5 B;  1MH4 A;  2ZNT A;  4BDO A;  1YXI A;  1YZ0 A;  5I2N A;  4R2B A;  2UYE A;  1B52 A;  4DCY A;  1NV1 A;  3PMV A;  4AB5 A;  2QL3 A;  3T9X B;  1B4Z A;  4HW8 A;  1LBX A;  1B3F A;  1B5H A;  2B4L A;  5CI5 A;  3W9V A;  4BDM A;  4I40 A;  3W15 C;  5AA3 A;  4GWO A;  2UXA A;  4OMB A;  3UIF A;  4F3P A;  4KYS A;  4PF8 A;  5AA4 B;  2FIE A;  2PVU A;  4G8N A;  3KC1 A;  4N6P A;  1N3W A;  3DRK A;  2CEY A;  3IOU A;  2OLB A;  4DI3 D;  2F7C A;  2Q8J A;  1F9B A;  3TTL A;  2DE3 A;  4OVT A;  4U4X A;  3K0V A;  4LZ7 A;  2PBW A;  4IGR A;  4KPT A;  4GFR A;  1H76 A;  3KN7 A;  4O94 A;  1JET A;  3G3H A;  4BDL A;  1WDN A;  1B46 A;  5IGA A;  3S4U A;  2F78 A;  2CZK A;  3FJ7 A;  3IL1 B;  4DCX A;  4WXJ A;  4N4U A;  1AH5 A;  1YYZ A;  2PCR A;  3T22 A;  1NNF A;  2CZI A;  3PMX A;  3FVN A;  3G3F A;  2ANJ A;  3KG2 A;  5I84 A;  2GFE A;  3F11 A;  4OFJ A;  2R9J A;  2D21 A;  3TQW A;  1FW0 A;  3TCH A;  5IZ1 A;  1N76 A;  1BTJ A;  4PFU A;  3PPO A;  5BWJ A;  4UAB A;  3PV0 E;  1ZJL A;  3TTR A;  4G68 B;  2QVR A;  1LEV A;  3K4U A;  3V89 B;  4RYA A;  4EUO A;  4XEQ A;  2F5X A;  3UP9 A;  3T9H B;  2XXV A;  2B3B A;  5DT6 A;  1CNQ A;  4P1E A;  3BIH A;  4XFE A;  2XA5 A;  5FBP A;  3RUM A;  2DS9 A;  4ESW A;  2DWH A;  4QF9 A;  2PX1 A;  4XIG Q;  4OEN A;  5DYH A;  1EH3 A;  1NKX A;  4NF0 A;  3C4M A;  2WOP A;  1D9V A;  2OBG A;  4H0W A;  4UA8 A;  5L9O A;  1B3L A;  2H9B A;  3O29 A;  4OER A;  2XX9 A;  1H45 A;  4GL0 A;  1A8E A;  4RA1 A;  2WEF A;  2BJJ X;  4XKP A;  1UTH B;  3N6T A;  2OK2 A;  4BDR A;  3IAZ A;  4POX A;  1FBD A;  1FPK A;  1ZMG A;  2R6G E;  3MP8 A;  4EQB A;  1NV7 A;  3EHT A;  1FTJ A;  4HTG A;  2AL4 A;  4P8B A;  3KC0 A;  3DP6 A;  2PYY A;  5H8Q B;  3E78 A;  4JBZ A;  4N6K A;  3LSL A;  1RYO A;  1KA1 A;  1KZ8 A;  1FBG A;  3MST A;  3MC2 A;  3EHS A;  3C31 A;  3TMG A;  1XVY A;  2F8D A;  5LTC A;  3H03 A;  1O64 A;  2H4I A;  2Z22 A;  2HAU A;  2RC7 A;  4JWX A; 
#chains in the Genus database with same CATH homology
 1MG1 A;  2WKY A;  2O84 X;  3T9V A;  1PB7 A;  2Y7P A;  2H98 A;  3FAT A;  3Q27 A;  4R74 A;  1AIV A;  2V3Q A;  3T66 A;  4LZ5 A;  2I3V A;  3V8X B;  4KQP A;  5H8H A;  5I58 B;  3FV2 A;  3H6W A;  4KD5 A;  3OEL A;  2G29 A;  2H99 A;  4MFI A;  1DMB A;  3CSG A;  3TZA A;  4EDP A;  3EPE A;  3SEU A;  5DTB A;  1WOD A;  1MY3 A;  2F7B A;  4RY1 A;  4ZS9 A;  2FYI A;  2OWS A;  3R7X A;  2KLF A;  3K6U A;  1QKB A;  1TFD A;  5AA1 A;  2F7A A;  1B3H A;  1FTK A;  3B7D A;  4FED A;  4YIC A;  4F1V A;  2P1S A;  1RYX A;  2DQV A;  3HHF A;  3OOA A;  4YU0 A;  2V93 A;  4Q30 B;  4XTC Q;  2HXW A;  3PUV E;  3U94 A;  1BP5 A;  3CSB A;  1I6Q A;  4X9T A;  4R6Y A;  1JW5 A;  1LAG E;  2HQ0 A;  1J1N A;  3G3G A;  2H5Y A;  1PC3 A;  3MPK A;  1PBP A;  2XXP A;  4IO2 A;  1SW4 A;  1VE4 A;  4GXS B;  4OTE A;  5AA2 B;  3PUW E;  4RK2 A;  3DM0 A;  2REG A;  3QYT A;  4NTL A;  4MH5 A;  1GGG A;  2VGQ A;  2XHD A;  3L6H A;  2GHA A;  1JVX A;  1USY H;  4G68 C;  3RN8 A;  2DYX A;  1URS A;  1B2H A;  2VP1 A;  2RC8 A;  2XXY A;  3GLB A;  3HPI A;  4U1Z A;  4GD5 A;  4NF5 A;  4O3B A;  3TEL A;  5FHO A;  3FXR A;  3DRJ A;  2DOJ A;  2GHB A;  4IO7 A;  3Q26 A;  2UVJ A;  3FGS A;  1TT1 A;  3C36 A;  3GZG A;  3MWB A;  1OQH A;  2HFB A;  3LC8 A;  5AA4 A;  4GXA A;  2QPQ A;  3E13 X;  4DE8 A;  3RLF E;  2REJ A;  4KHZ E;  1LLS A;  4E0X A;  3IK6 B;  3FTO A;  2O7I A;  1IIT A;  3I3V A;  4YB7 A;  3S2V A;  1SD3 A;  2X7P A;  2O51 A;  4N13 A;  4KCC A;  4QHQ A;  5ITP A;  2DSF A;  3SET A;  3OO6 A;  1Z7M E;  3L6G A;  3JYR A;  5TPA A;  2OWT A;  4RXL A;  2A5T B;  2V25 A;  3MP6 A;  3USD A;  4MBP A;  1LFG A;  5KCJ B;  2I4B A;  4PQJ A;  1MXV A;  1S9T A;  1OLA A;  3PPP A;  2A5S A;  4PE5 B;  5ELV A;  4RPO A;  1Z7N E;  4AQ4 A;  4RNS A;  1A99 A;  3O2A A;  3IR1 A;  5CMC A;  1IXI A;  3IB0 A;  3LVU A;  4IGT A;  3SDF A;  3K6W A;  4G68 A;  4NWD A;  1D9Y A;  4QRZ A;  5DVF A;  2Y7K A;  1FQF A;  1MQD A;  3W9W A;  5J1D A;  3PUY E;  3I6V A;  1URG A;  5H8N A;  1FQE A;  4U21 A;  1B40 A;  1OVT A;  1FTM A;  2FNC A;  3OXN A;  2VD2 A;  4M4G A;  4EQ9 A;  5EHM A;  1D4N A;  3RTW B;  1MXW A;  1R1N A;  3B6Q A;  3PU5 A;  3C34 A;  5HBC A;  3ZKL A;  4R72 A;  4GLI A;  5CMB A;  3D4C A;  1ZKB A;  1DPE A;  4KI0 E;  1MQH A;  1MQG A;  2Q9T A;  2QRY A;  1MY4 A;  3KSJ A;  1CB6 A;  3FUZ A;  3PD8 A;  3TCG A;  3DRG A;  1B05 A;  1D3K A;  1YPN A;  2O1L A;  1AL3 A;  2Q2A A;  4GRK A;  3T96 B;  3TAJ A;  3VXB A;  3MPL A;  3RNN A;  1UTB A;  3K2D A;  3VLV A;  4G77 A;  3JV9 A;  4R6K A;  1MY1 A;  5L8D A;  1GTK A;  3VV5 A;  3ECR A;  4U2R A;  4F2Q A;  1FCK A;  3OSR A;  5IKB A;  5FTI A;  3CVG A;  2I0B A;  4F3B A;  4LZ8 A;  4NE4 A;  4C1T A;  1PBQ A;  3FVK A;  3VVF A;  4EXK A;  1EZP A;  1B4H A;  3HV1 A;  3PPN A;  4RK9 A;  1FQC A;  4OVJ A;  1O63 A;  2Y7R A;  3DP8 A;  4IO6 A;  4ELP A;  1MQJ A;  1MPD A;  2AIX A;  1H44 A;  4HCY A;  3SER A;  4JB7 A;  3E3K A;  4OFL A;  2XXR A;  3E9X A;  1FTO A;  3G7W A;  3BBR A;  3C33 A;  3FVO A;  4DIG A;  3S9N C;  1MM7 A;  2YLN A;  3G3K A;  3Q28 A;  1EZ9 A;  5DEX B;  1P1N A;  1FQD A;  4WEP A;  2PMS A;  2ZNS A;  4KCD A;  3VDF A;  3K1N A;  1SVX B;  2E0S A;  2HZK A;  2ONS A;  3H06 B;  3PD9 A;  4LQ5 A;  5TU0 A;  1QKA A;  1CE2 A;  1LCF A;  5BUU A;  1VR5 A;  1MDP 1;  2I4C A;  2RC9 A;  4MLQ A;  4PET A;  4YKI A;  1B51 A;  1ZLQ A;  4YB6 A;  1B0H A;  3TTM A;  3O97 A;  2B4M A;  1NNP A;  3H3G A;  4DXU A;  1LAX A;  3G3I A;  3MW0 A;  2AYS A;  2WOL A;  1LB9 A;  1B5J A;  1LBB A;  5I56 B;  4QSD A;  5JTY A;  4ELQ A;  1N7X A;  2QS2 A;  3KN8 A;  3O28 A;  4ESX A;  3FIR A;  2G93 A;  4ZZA A;  3R6U A;  4OEU A;  1ANF A;  1QUL A;  1RKM A;  4GF8 A;  2R71 A;  3KJT A;  1QUK A;  4H8J A;  4NF8 A;  1NNT A;  3O6H A;  4LON B;  3B6W A;  2HZL A;  1S50 A;  4P0I A;  4RPN A;  3S9E A;  4H5F A;  5FTH A;  4F2O A;  4ONY A;  3QXM A;  4Q0C A;  4YKJ A;  5DVJ A;  2Q88 A;  1MDQ A;  3TQL A;  3ZSF A;  2VD3 A;  4QFP A;  2YPN A;  3DLN A;  3GBB A;  3MJN A;  1N3X A;  3LR1 A;  5JEI A;  2XXQ A;  4O3C A;  1IXG A;  4ZDM A;  5EHS A;  2O6A A;  3LSF B;  2QMW A;  1DTG A;  3TDJ A;  1NNK A;  1B3E A;  3K6X A;  4IY5 A;  4R75 A;  1P1O A;  3B6T A;  3CIJ A;  4EQ7 A;  3FXQ A;  4F18 A;  4YMA A;  1B7U A;  3FV1 A;  3JZJ A;  3ZKK A;  2O69 A;  3TCF A;  2Y7I A;  2DVC A;  5DVI A;  3VXC A;  2NXO A;  5ISU A;  3BFT A;  3LSX A;  3SKP A;  4OXV A;  2HCA A;  4ISU A;  4P11 A;  3TTN A;  1B7Z A;  3M8U A;  1H43 A;  4JWO A;  3K6V A;  2O68 A;  5AA2 A;  3I5O A;  1ATG A;  2B3F A;  5TP9 B;  3IJO B;  2DWA A;  3KJ7 A;  2F6G A;  2XXX A;  1GR2 A;  1II5 A;  3CR9 A;  3HO7 A;  4H67 A;  1YAE A;  1R9L A;  3VLU A;  4KYE A;  5H8Q A;  4C1U A;  3KN3 A;  3PPR A;  3FXU A;  3QK6 A;  3VE1 B;  3TEP A;  3E4R A;  4ZEK A;  4FEC A;  1NFT A;  4JDF A;  1UIU A;  3RYB A;  5CBS A;  4G8H A;  2FA7 A;  2P0S A;  4OQO A;  4ZEC A;  5A5X A;  3MAM A;  4OHN A;  3MVW A;  4ZEI A;  1VFD A;  3C32 A;  4Z7E A;  1IXC A;  1MY0 A;  3ONM A;  3OEK A;  1SW2 A;  1XVX A;  3MZB A;  5I2K A;  3QSL A;  4QFO A;  5ITO A;  4XKQ A;  1Y4T A;  1PB9 A;  5CRY A;  4WED A;  1IEJ A;  3VVD A;  5JK4 A;  3A09 A;  2E1S A;  4LAT A;  3MVY A;  1JQF A;  2OCU A;  5B7D A;  3Q29 A;  1OIB A;  3H4Z A;  1M5C A;  2I58 A;  2NVU B;  4ZZE A;  3N26 A;  1USY E;  2A5T A;  2AL5 A;  2IEE A;  2XD2 A;  4ZE8 A;  1LGB C;  1Y4C A;  4F39 A;  4F3G A;  1LB8 A;  3ZS6 A;  3EQ1 A;  1P1W A;  2XXI A;  2ZMB A;  5CMK A;  4H5G A;  5KDT B;  2DE4 A;  3IOR A;  5K2Y A;  1PEB A;  2DXR A;  3SES A;  2V84 A;  5L9M A;  4NF5 B;  1YCJ A;  3RGY A;  1MH4 A;  1Y3Q A;  3IX1 A;  1ELJ A;  3O6G A;  4OYV A;  2ZNT A;  4R73 A;  1PDA A;  3ILU B;  5H8S A;  4OFO A;  4BDO A;  4DZ1 A;  4ZED A;  4R2B A;  5I2N A;  3MVZ A;  1S7Y A;  3VVE A;  2UYE A;  5L9S A;  1B52 A;  4DCY A;  2OJT A;  3WAE A;  3K1M A;  3OD7 A;  4ZEB A;  3PMV A;  3BKI B;  5FHM A;  3K00 A;  4LQ2 A;  3VLW A;  3FJG A;  5I59 A;  4G8M A;  3C9H A;  4AB5 A;  4R6H A;  2PT1 A;  2QL3 A;  4G2Z A;  3CI8 A;  1A54 A;  3T9X B;  1B4Z A;  3HCQ A;  4HW8 A;  1M5E A;  3RQT A;  2XXW A;  5K2X A;  2CZL A;  4H1X A;  1B3F A;  1QUI A;  1TXF A;  1B5H A;  1SW5 A;  1SQY A;  2B4L A;  4U4S A;  4R9F A;  4TQU Q;  5CI5 A;  3W9V A;  3RYA A;  4BDM A;  1KWH A;  2Q2C A;  4IY6 A;  5LOM A;  4TOZ A;  1JEV A;  4QFK A;  2DXY A;  1MS7 A;  2F6P A;  3W15 C;  5AA3 A;  4GOT A;  3MVX A;  4IO5 A;  4QSC A;  5M2V A;  2Z23 A;  3VFJ A;  4DLD A;  3UGW A;  4GWO A;  1HSE A;  4R9G A;  3O6P A;  2XD3 A;  2UXA A;  3M3K A;  2RKM A;  4OMB A;  3P7I A;  1JW4 A;  1B5I A;  1JW1 A;  1QJM A;  1I6B A;  2UVI A;  4M1V A;  1QUJ A;  1Y20 A;  2NUV A;  2CMO A;  4KFQ A;  5DEX A;  4POW A;  4H65 A;  4LUB A;  3T93 B;  1XS5 A;  1NH8 A;  3UIF A;  1Q35 A;  4F3P A;  4F1U A;  4IO3 A;  4X1D A;  2ONR A;  1UTB B;  2PT2 A;  4KYS A;  4WKM A;  4FAT A;  1UIV A;  1M5F A;  5AA4 B;  1T0K A;  1US5 A;  2I3W A;  1LST A;  4GQO A;  2PVU A;  2RCB A;  4G8N A;  4JXI A;  2QJE A;  1PB8 A;  3GXA A;  4L17 A;  2IA4 A;  1JEU A;  3H6V A;  2RF1 A;  1MRP A;  1N3W A;  3KBR A;  4N07 A;  3DRK A;  4N6P A;  4QSE A;  3IOU A;  5I56 A;  2Z8D A;  4YB5 A;  4YAH X;  2VHA A;  2OLB A;  3SEV A;  3CRB A;  4BDQ A;  3FJM A;  5ICQ A;  3PUX E;  1JVY A;  2DP8 A;  2F7C A;  4I1D A;  4FEB A;  2Q8J A;  1M5D A;  5KCJ A;  4NED A;  4PFT A;  4EF2 A;  1F9B A;  2NOO A;  4MLV A;  4F19 A;  1EZO A;  3TTL A;  1LAF E;  3HST A;  1Y3N A;  2DE3 A;  4NF6 B;  2QS4 A;  4U4X A;  5F7V A;  2D3I A;  3H6T A;  3K0V A;  4K3F A;  3RT8 A;  5H8H B;  2XXU A;  4YKP A;  5I58 A;  4JSD A;  3C35 A;  3IB1 A;  3S9L C;  5HM4 B;  4LZ7 A;  1IQ7 A;  2DVZ A;  2F97 A;  3CG3 A;  4G4P A;  2PBW A;  1URD A;  2OZZ A;  4TLL B;  3OO8 A;  4JSO A;  4IGR A;  4KPT A;  4GFR A;  1TWY A;  3ODB A;  1SI1 A;  1IXH A;  1H76 A;  1B7H A;  3MZ9 A;  3TKD A;  3KN7 A;  1DTZ A;  1N0T A;  1JET A;  1B1X A;  3EF7 A;  3U93 A;  2Y7W A;  5CC2 A;  1SW1 A;  3A3U A;  3G3H A;  4HCW A;  4MF3 A;  5JTY B;  4BDL A;  4AB6 A;  2M8C A;  1MPC A;  1SDX A;  3HN0 A;  3RPW A;  4LP2 B;  4GIZ A;  3AXF A;  5I2N B;  2O7U A;  4NF8 B;  2ZXT A;  1WDN A;  1B46 A;  3TUS A;  2ZYM A;  1DPP A;  1QW0 A;  2QS3 A;  2B65 A;  3IOW A;  3S4U A;  4I8C A;  2F78 A;  3IOV A;  1GV8 A;  3OEM A;  2DWJ A;  3U92 A;  4Q8R A;  3FJ7 A;  3DRI A;  5H8F A;  1P99 A;  3IL1 B;  2HAV A;  3O66 A;  1MY2 A;  5AA2 D;  4DCX A;  4WXJ A;  4EF1 A;  3Q25 A;  1AH5 A;  3KGC A;  2THI A;  4PP0 A;  3S9M C;  3T22 A;  1NNF A;  3FD3 A;  1Q1K A;  3IOT A;  3PMX A;  5FHN A;  3FVN A;  3G3F A;  1B1H A;  3OO9 A;  2D5W A;  1ZU0 A;  3HHG A;  1I69 A;  2ANJ A;  3KG2 A;  4ELR A;  3KOS A;  5I84 A;  2W7Y A;  2GFE A;  3F11 A;  4FJP A;  4OFJ A;  2R9J A;  3OMB A;  2D21 A;  3UOR A;  3FVG A;  2WOK A;  3TQW A;  1LFH A;  4HS7 A;  4NMY A;  1FW0 A;  2UVG A;  5TP9 A;  1YTV A;  3TCH A;  3K01 A;  2ZNU A;  3TFL A;  1JNF A;  4EXL A;  4OEV A;  1N76 A;  1BLF A;  3T9U A;  1UTH A;  1VFE A;  4NF4 B;  2XX8 A;  2ALU A;  1BTJ A;  3SEX A;  1B9J A;  4PFU A;  1Y3P A;  3PPO A;  3V83 A;  5BWJ A;  4TLM B;  3RY3 A;  3QIM A;  1O7T A;  1SBP A;  2H25 A;  4F29 A;  1MQI A;  1XC1 A;  3PV0 E;  2QMX A;  4U22 A;  1ZJL A;  3TTR A;  2O1M A;  2F36 A;  1FQA A;  3KFM A;  1SYI A;  4G68 B;  3N94 A;  3K4U A;  3V89 B;  4KYD A;  4RYA A;  2DWI A;  4EUO A;  2I6E A;  1NL5 A;  2LAO A;  1NH7 A;  1DSN A;  1US4 A;  5HPQ A;  3UK4 A;  4ND9 A;  4NWC A;  2Z8E A;  4F31 B;  5CM6 A;  1QVS A;  2I48 A;  3A3C A;  3TYH A;  2F5X A;  3UP9 A;  2Q89 A;  1XOC A;  3T9H B;  4DXB A;  2XXV A;  4XKN A;  3PMW A;  4I62 A;  4H6D A;  2X26 A;  3MBP A;  3O6I A;  3EHU A;  3IO6 A;  3KZG A;  2B3B A;  3LUY A;  1IUD A;  5DT6 A;  1L5T A;  2P2A A;  4ELO A;  3OEN A;  3TOD A;  1LAH E;  2V3U A;  4FIM A;  3SEY A;  4GVO A;  2QS1 A;  1DOT A;  2YJP A;  1HSL A;  1MXU A;  2I49 A;  2GRV A;  2DE2 A;  2UYF A;  1IIW A;  1XT8 A;  1FTL A;  1TFA A;  4Z0I A;  1OMP A;  1P1U A;  1B0L A;  4ECF A;  3DRH A;  1OVB A;  3M3F A;  1Y1M A;  1FQB A;  4P0G A;  1GVC A;  3RUM A;  3U72 A;  4BLA A;  2DS9 A;  5I57 B;  3THI A;  3ILT B;  4ZEF A;  4ESW A;  3GBA A;  3K1P A;  1MH3 A;  2DWH A;  1IZ1 A;  4IO4 A;  4QF9 A;  1B3G A;  1N84 A;  2XXT A;  5I2K B;  5CBR A;  3G3J A;  2PX1 A;  2ZYK A;  1SYH A;  4XIG Q;  4OEN A;  1ZTY A;  1ZBM A;  2ESN A;  5DYH A;  3KSX A;  4QFL A;  1LFI A;  4FE8 A;  5B70 A;  1A8F A;  1BKA A;  1EH3 A;  1NKX A;  4PFW A;  3QUJ A;  3C4M A;  2WOP A;  1POY 1;  1Y9U A;  2RIN A;  3CHG A;  5F1Q A;  2ABH A;  3IB2 A;  2ZYO A;  3UA8 A;  3U8Q A;  1D9V A;  2UVH A;  3RT6 B;  2OBG A;  2VOZ A;  3PGF A;  4LVQ A;  5TPA B;  1N04 A;  4H0W A;  4UA8 A;  3FZV A;  5L9O A;  1B3L A;  3IO4 A;  2H9B A;  3SEW A;  3O29 A;  1OLC A;  1H3D A;  2ONK E;  3CFZ A;  3MUQ A;  4OER A;  2XX9 A;  2Y84 A;  1H45 A;  3FAS A;  4Q5T A;  3TPA A;  4GL0 A;  1A8E A;  4RA1 A;  3D4G A;  1P1Q A;  1B58 A;  4FOR A;  2BJJ X;  4FAJ A;  2GH9 A;  4DXC A;  3TTK A;  1A55 A;  1ZIU A;  4XKP A;  1NMU A;  3N6U A;  4OZ9 A;  4XXU A;  1B6H A;  1UTH B;  4NF4 A;  5EYF A;  3PPQ A;  4X1B A;  3N6T A;  1LBC A;  2OK2 A;  4F22 A;  1A40 A;  5I59 B;  3K02 A;  4BDR A;  3IAZ A;  4POX A;  5ICT A;  4THI A;  4U23 A;  1I6A A;  1MM6 A;  1ZMG A;  2R6G E;  1N7W A;  1UQW A;  3MP8 A;  4EQB A;  4YMB A;  3LBS A;  3H6U A;  2F35 A;  3EHT A;  4C0R A;  1M5B A;  1MPB A;  1A7L A;  4YZZ A;  1FTJ A;  1EU8 A;  2F34 A;  3M3L A;  4XKR A;  4BDN A;  1LCT A;  1R9Q A;  4NF6 A;  5H8F B;  4HTG A;  2AL4 A;  5CMM A;  4O3A A;  3IJX B;  3U1O A;  4F3S A;  4KR5 A;  1R6Z A;  4OET A;  4OWD A;  1HSJ A;  3DP6 A;  4DDD A;  1AOV A;  3WAF A;  2PYY A;  4E0W A;  5H8Q B;  3DEL B;  3N5L A;  4JBZ A;  4X48 A;  3CFL A;  1MXY A;  2Z8F A;  3V5A A;  3MP1 A;  3O9P A;  3LSL A;  3LSW A;  1RYO A;  1VSO A;  3MZ1 A;  4I9D A;  5KZT A;  4RJZ A;  5AE4 A;  4YKK A;  3MQ9 A;  1AMF A;  1MXX A;  3H7M A;  5A5X B;  2QSX A;  3EHS A;  3MC2 A;  3PUZ E;  4OES A;  1XHY A;  2XX7 A;  2HEU A;  2I0C A;  3C31 A;  3UN6 A;  2ZYN A;  2NWJ A;  4GL8 A;  2X7Q A;  4PFY A;  4R2F A;  3TMG A;  4IB2 A;  3BFU A;  1XVY A;  3QUF A;  4LA9 A;  3OSQ A;  2F8D A;  3QAX A;  1BIY A;  2RCA A;  4F1Y A;  3DRF A;  2XXH A;  3KOT A;  4ZE9 A;  3H03 A;  3EN3 A;  3PAM A;  1O64 A;  1B32 A;  2H4I A;  2V3T A;  3CG1 A;  3KEI A;  3RTF B;  5H8N B;  1Y1Z A;  3R26 A;  2Z22 A;  3CFX A;  4JWY A;  5I57 A;  4QFN A;  5IAI A;  4UAC A;  1MXZ A;  5KDT A;  2HAU A;  4U1O A;  3OO7 A;  1POT A;  2RC7 A;  1SI0 A;  1WVJ A;  1OQG A;  3DP4 A;  4H8I A;  4JWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...