1B4JH

Comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
220
structure length
220
Chain Sequence
EVQLQQPGADLVMPGAPVKLSCLASGYIFTSSWINWVKQRPGRGLEWIGRIDPSDGEVHYNQDFKDKATLTVDKSSSTAYIQLNSLTSEDSAVYYCARGFLPWFADWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY
publication title Comparison of the three-dimensional structures of a humanized and a chimeric Fab of an anti-gamma-interferon antibody.
pubmed doi rcsb
molecule tags Antibody engineering
total genus 33
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1998-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b4jH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b4jH02
3IKCB 5I8EB 1CD1B 3QQ9D 4M7LL 5EZIH 1J0JA 1GYAA 4RGMC 5C0DB 4PRHD 2P8LB 3A6OA 4OM1L 3GRWL 1FQ9C 4UT7L 1CF8H 4XVUD 5FUOL 1I85A 3T65A 1KCRH 3VXQB 1NCNA 1XZ0A 4W4OA 3O0RH 5E5UB 3O3UN 3P0VL 4KQ3H 3UMTA 4KRLB 2Q76A 1T21A 5I8OL 4ZAKD 4PJ9D 2G9HA 2JK5B 5C0CE 5JA8B 5KG9B 2HH0H 2R0KL 1FZKA 3FQRA 2OQJB 1S7VB 3FQXA 5J06A 1NBYA 3MUGA 5EWIL 3ARYA 4HAGA 4X7EC 5EFIA 3MFGB 3MRNA 2FLRT 3VGAC 2WSKA 3MRJA 4HLZG 5HHNA 5DC0A 3VI4E 2BSTB 1IGTA 1E27B 5GGVL 3ARWA 1QRND 1VSCA 4DZ8B 4RGOH 3LB6C 1OGTB 1A6ZA 3W39B 3U7WH 1DN0A 4YNYB 4Z78A 4X5WA 4MA1B 2A1WH 1MLBB 5C07D 4HIEA 3MOQA 4FXLA 4LKXB 4W81A 1CE1L 5GXBB 5ITFA 4JREC 4HS3A 2IQ9H 3GSQA 4O5LL 5EULV 4ZO9A 5BCAA 4LBEB 1FAIH 1UQSA 3SDCB 3SEPA 3OR7A 4PJ5A 1G6RH 1NAKH 1PKQE 1YDPB 4P5TD 5SWQB 4R0LA 4LIQH 1RZKL 4QRQB 1L7IL 4U05A 1WFOA 2HT2D 3GSVB 2P42B 2GITA 3L9RA 4ERSH 5HHQA 2D7OA 1FFNA 4FXGA 1DLHB 3D69A 1YPZF 4LLWA 4GRMB 2K7PA 3V79C 5SX4H 3WFCH 4PV9B 3CNKA 5FAAA 1UKTA 2E27L 3DHMA 5BV7L 2NY5H 1KB5L 5GRUH 4WCYH 4HT1L 3WHE1 2YR3A 3ROOB 1U8QB 1SEBB 4F7EA 4RMSA 3ZSTA 1SY6A 3TFKC 1EK3A 2YBRA 1RFDH 4CVZA 2B1HL 2H32H 5DMIL 2DQEH 2MCG1 4U1GC 2R2EB 3QG7L 2IPTL 2EDNA 2W0FB 3UAJC 2X4SB 3CPLB 1VKXA 3BISA 5EUOF 3PL6A 3F12B 3WLBA 3MR9B 4PJGB 3FAXA 3NCBB 3TWCL 4CN6A 3RVXC 4MSWA 5K9QG 2ZG3A 1RD6A 4OGXL 2Y7QB 2YD3A 4C56A 2QLVB 1MHPH 4POUB 5ESVA 2J6EA 5I17B 3PDDA 4YHNA 3LQAL 4U1MA 5FB8B 3DGCR 5MEQB 3HRZA 2B2XL 4N0CC 3QDGD 2BX5A 5DA0B 1EV2E 1JFQL 1DBBL 2A38A 2AJUL 4ZTOL 3QIBC 2FR4A 3QPXL 1PJ9A 5GIRA 1T3FB 2F19H 3CFDB 3MRQB 5FM8A 5GGQH 5D7LA 3PQYA 1S7QA 3BWUC 4DKFH 3RIFK 5KS9B 3NIGF 3GMRB 1YPZE 4NN6C 4LSVH 4P2CG 1WFTA 4PBWD 4J4PA 3RPIB 3ZYJA 3R06B 4QO1A 1NC4A 4WV1A 3T77A 3F65A 3KNBA 4NP4L 1CD9B 2DJ4A 4M93C 5KOMC 1AO7A 2UZYB 5KSVA 2VR9A 1MJJA 4NC1E 2ZOKA 1QR4A 3HE7A 2YRLA 5E8NA 1LWRA 3VXRE 2F74B 3DX7B 1VFBA 4U1LA 3MJGX 3IDNA 5EUOE 3F7QA 1BVKA 3V5KB 2HYMA 3Q6FB 2V5RA 1E28A 3SGKC 3RPKA 5FGRA 1CU4H 4IHOB 2P47B 3BPOC 2CK0H 3O8XB 2NNAA 2H2SD 4HIJB 3ULVL 4LLMA 4KKBD 1KBGL 5F9OH 2MKWA 3ULSA 4A2LA 3OB0K 4XH2A 5FGBA 1WBZB 3MACH 1PX3A 2EDTA 3IFOB 3O6MH 4ZFGH 2OR8A 4FFYH 5I1KH 3X3GH 4NYLA 1IAOA 5D7SL 4X9BA 3QNXB 1RV6X 4WTXA 5FDWA 3OKKB 1R5VA 1D6EA 2X40A 3RX8A 2Y5TB 5MERA 2YPKA 2QKIB 4HUVA 5HD8D 3KHOA 1J1PH 5B39B 3AS3A 4YDIL 5L2JB 5HYQB 1HE7A 3BPNB 1FNGB 4G8EA 1FGNL 4M4RA 1JZ6A 2ZNWA 3GO1H 3AC0A 2F5BH 3DROA 1P6FA 2BK8A 5CJOL 3VFTB 2IWGA 3HR5A 1ITCA 4ZOBA 1I1AA 4TRPH 4FTVD 5DHVA 1CFSA 1B2WL 1EBAA 5HGBA 4HWBA 1Y0LB 3GSXB 3OF6A 4Q9CA 1NBVH 1P4IH 1KLGB 1RUPL 3GUTA 3MRLB 1DSFH 4GKSA 4Y4HB 1FVDA 4HW6A 4S2SA 4Y5VC 3WDJA 4KHXL 3T2NH 3G9VA 2DJSA 3KYNB 4K9EL 5LXGH 5LBSH 5H37H 5GISH 1G6RB 2C3XA 2VLRD 4PG2A 2IBZX 3MV7A 3G5XA 3SCMA 2IEPA 4M6NH 4N8VG 4YK4C 4P9MH 3V0VB 3LOWA 3B9VA 3S37X 1GIGH 3MZGB 4BM7A 4XC1L 5LWYL 3GJFK 1WBXA 3VXME 3RGVD 4MA1C 4JQIL 5CEXA 3PGDB 1V8HA 5JDSB 3C8HA 4J6RH 4ORZC 2BY0A 2CPCA 5DJ2A 2XFXB 5TPWH 3FQUA 5JQ6L 2HT4D 4ZS7H 5A2IH 3TBTA 3CX5K 3SDCC 5EU6E 1IBGH 5FYKL 3WUWA 1DQLH 2OLDA 5BZWA 5DZLA 1GOFA 3EGSB 5TE4H 2XV6B 4DKEL 2H32B 2ADFL 1FL6A 4JFPA 4HPYH 3C6SA 5CD5D 1FHGA 1TVBA 1FVCA 2MCPH 2P5EB 1IEAB 2PTVA 3I3EA 4KWUA 5I1LA 1QLFA 3FZUC 3DXAB 1I9EA 4TPRL 3VFRA 1S5HA 1NDGA 3QUKB 2O5XL 5I0DA 2BHUA 5EZLA 2ED9A 2VDOH 4M7JL 3SJVD 3AREC 1J1XL 4AL8H 4I5BB 3V4UL 3BKJH 2VXSL 5A43C 4NDMB 5EN2B 3QI9A 5TGBB 4UOW0 1MFDL 4AENB 3LQAC 3FO2B 4U1NB 1YMMB 2HKFH 3SOBL 1G6VK 4MNGB 1ZTXL 5ISZB 3I75B 5JHLH 2X1XR 4JO4L 2IADB 4XMKL 5TH2B 5D5MB 3OX8A 2AK4B 5K9JH 4NWUL 1R3LB 3HE6A 4O2EB 3RJQB 1RMFH 1ZSDA 5E8PA 2VUOA 3RNKB 4CU7A 1NFDA 1RZJL 2V5TA 2AK1H 1IM9D 3MRPA 1F3RB 4M5ZH 1FDLH 4GW1B 3LS4L 3VWKD 3B2UC 4RRPA 2I5YL 1LGVA 4DK3A 1U8HB 5IK3B 4BA8A 1ZS8B 4X4XA 1JZ3A 3B4NA 2JJUA 3MXVH 1J11A 3H7BA 5C08E 1AR1C 1T66C 3HN3A 3LD8B 1OPGL 2HJLB 5EZOL 2EDQA 4JG0H 5F71A 3TC9A 1MRDL 3QISA 4CMMB 4F9LA 1RJYA 4PD4J 4JQVA 4GG6A 4M62L 1A4KB 1DVFB 5IG7A 1S9VA 2W9DH 1MCRA 1AXSA 1RHFA 2IPKA 4I4WA 1I7TA 3FCTA 3S34L 2NXZC 1MHCA 3X12A 1AE6L 1OT2A 5D2LA 3MYZA 2BHZA 5J6GB 2EXYC 4CMHB 1DFBH 1YJDH 2BFVL 4XCFH 4AG4L 4LLQB 3NCYS 6CGTA 3P4MB 1YUHA 2OMBA 3PJSB 3RWFA 2QTEA 3O4LE 5I8KL 5GS0H 3LSOB 5IVXB 3WIIH 3TN0A 3PE9A 1MELA 4X99A 1N4XL 3ESVF 5D7KE 1A6WH 3H0TA 4BKLB 3IJHA 3VFUA 2NLJB 4K8RH 4XP4H 3OAUH 1HDMA 3SQOH 4HH8A 1CGTA 2DLFH 3OKMB 2QBWA 1EEZA 1S7RB 1U3HD 1ZE3C 2DKMA 2K9UA 2SEBB 1UJ3C 4HCRH 4DAGL 2DDQL 2EECA 1FO0A 1LVEA 2F54A 1EX0A 4LCWD 4D0DA 4X9HA 3QCVH 4HULB 1A3RH 2BVOA 5D1ZD 2Q76B 5CLTA 1T21B 5HHOA 2H45A 4PRNA 4OFIA 5GZND 3K46A 1GZPA 2PXYC 4GOSA 4K9EC 3FQRB 4IS6A 1MPAL 4U33A 1HHJA 5EA0H 4PRHE 1OAKH 4QOKD 1EMTH 1NBYB 3MUGB 3CGTA 5EFIB 4I0PC 4A6YA 5D9SA 4XMLH 2FZ3A 1A7OH 2HRLA 3ULUH 4TULL 1CFQB 1LO3H 1XEDA 2VR5A 4RMRA 2YD8A 3B83A 2R29L 4X8JB 5DHVH 2YPLB 1C08A 4MMZC 2B4CL 4ZUUA 4HWBH 3GSWB 3GHEH 1A6ZB 1RJZA 1AI1H 1DN0B 4Z78B 1RJCA 1E6OL 2FD6H 3WFEH 1JGUL 4Y4KC 1WT5A 1I9RH 4QHMA 4C57C 4ZD3H 2HJFA 2VSCA 4BUGA 4HIEB 8FABA 4HHAB 4C4KT 3RP1A 3GSQB 4MHHG 3U7YL 4UQ2A 1L0QA 1PSKH 1UQSB 3OR7B 4PJ5B 1TNMA 1WITA 2E6PA 1QRNE 2UYLB 1GZQA 4ZUWA 5J56B 4OTXL 5HI3C 3O2DL 2WP3O 1IL1A 2MHAA 2EDDA 3O9WD 5L7XL 1XAUA 1RK1B 4KVNH 5C07E 5HHQB 1SJHA 4FXGB 5GSVA 3QHZL 1G9NL 5I1GL 4LLWB 2B20A 3RWJA 1JGVL 3B5GA 1OY3B 2YOCA 3AM8A 1ZLSL 4Y1AA 4KJPD 3KR3H 1VGKB 3QQ4B 2FL5A 4ODUA 1N0XH 4BSVA 1PEZA 4F7EB 1QSEB 1MCKA 3QULB 2XRAL 2OM5A 5D1QA 4OV6F 4AH2B 2HMIC 5L9DL 1PQZA 4JHWL 3S37L 2AEPL 4PJBB 1HSAA 3LKQA 1FC1A 5TF1L 5EOCL 3WLBB 3IFLH 2LTQB 2YPVH 5IBLC 1FPTL 4JAMA 2J8UB 4HJGA 3JV4B 5I66A 3BUTA 5EBWB 5FV2A 5E9DB 1GGIL 5FYJU 2GTZB 4C56B 3B9DA 5ESVB 5DXWA 1GSMA 1WIOA 2GJ6D 3HRZB 2FO4B 2VDRH 3KYKL 4Z6AT 3VRIA 1EUUA 1XCQB 3I50H 2WK2A 1JIBA 5GIRB 4NUJB 3ESUF 2NR6D 1X9QA 1VFUA 5EOCJ 3VXUD 2FCBA 2R1XA 3JVGA 3PQYB 2DQGL 1A22B 2WBJD 2OTUA 4HH9A 2BDNL 3MUY1 3GRWA 4FQIL 2EYRA 3KWWA 3T77B 3KNBB 4UAOB 3DSFL 3QDJB 3QDGE 3N50A 2J5LB 2PKDA 5T1KA 4Q9RH 5IIEB 3NA9H 4QRSA 5E6IA 4I9WD 2ZOKB 3JZ7A 2VDNH 1M71B 4JZJC 1JZ8A 1VFBB 4KQ4H 1N6QL 3BH9B 1YEEH 3IDNB 2D7TL 4WY7L 4G7VH 4L9LA 1E28B 4ELKB 3MCKA 4G6JL 5CGYC 2GUOA 3MXWH 2UUDH 5IT2L 1HZHL 5CZKA 4GBXC 3ULSB 1S7TA 4OIIH 5J11B 3RAJL 5L2KB 4O2FB 2HA1A 2AEQH 3QUZB 4D9LL 3BVNB 4PJHA 2QADC 2DQTH 4OGAC 3V0WH 5EBMA 1CBVH 4NYLB 1VACA 2B5IC 3KXFB 3WSQL 3HUJA 5BS0A 5FECA 4UNVA 3DV4B 5FDWB 3TM6A 1R5VB 1D6EB 4HUWA 4LRNH 3RUGB 2DQDH 3WJLC 3O6FA 4PGCB 1TZHA 2YPKB 4HUVB 4Z18A 3BAEL 3F7PC 3WXWH 5D70L 2DL9A 2XPGA 2M8XA 3UYOD 4K3DL 2HKHL 4KI5C 4G9FD 4F37K 4KJYA 3DROB 4YFDB 2VXVL 3GFUA 4PGZA 2N4IA 2XWTA 4PJCE 5AZEH 2XWBB 3DYOA 5D7IA 5DHVB 3QIWD 4IBLT 3NTCL 4LGSB 4D0CA 5KSAD 2X4OB 3LQZA 2IBZY 5IEHA 4TUJA 4UB0L 5IB2A 2NY6C 3DI3B 4LSTL 4LHQB 2DYPD 5F1IA 5I6XC 3QNZA 1VCAA 4OZHE 4XNMA 2JB6B 1BF2A 4GKSB 5CJXA 1ZA3B 2W0KA 4ONOA 4S2SB 3BUYA 2ZCHL 3HNVH 4PJEA 3GBMH 2AV7A 2QQKL 5I16A 3GI9L 5CZXC 2VH5L 4JLRB 5JOFB 4FTVE 1ZANL 1UM6L 2D7NA 4N9GA 5D96C 3DX8A 1OGAD 4HS8L 3UTTE 1A6PA 3G5XB 4NUGL 4HFWA 5DEGA 3OGCA 3SCMB 5DR5H 5IVNA 3ROLB 2CDFB 1AKJB 1MRCL 4XP6L 4P2RA 5DSCB 4TSAH 3GIZL 4LMQE 1WBXB 2UZIL 5CEXB 2CRIA 1A7RL 4PLNC 4QXTB 2CKBL 4PLKC 3BDYL 3IDXL 3TBTB 1RUKL 2RCSH 1G9NC 3WHE0 2VLRE 2UY7A 2LV4A 4GMSL 3QCUH 4EBQH 3N9GH 5HDBE 1YN6A 2YD7A 1JMZA 4JFOA 3F7RA 1FL6B 1HQ4B 1KIRA 3C6SB 4OQTH 4KRMB 3OZ9H 4UIKL 1MAML 1H8OA 1QLFB 2DTML 2W91A 4HKBA 2DF3A 2WUBH 5ID1B 4G8GD 5MP6H 5DGRA 4M6MH 5DD1L 5C7XH 3VRLF 4HKJB 5FOJA 4X7CC 5KJRH 3PWPE 3DARA 2KL6A 3PV7A 4NHCL 1QA9A 4MNHA 1F4WL 2AXJA 5DRNB 4IRJB 4PLJC 4BZ2H 5ICZA 2QQNL 1IAKA 5JW5A 5C0JB 5CIPA 3IDIA 5ILTH 1N2RA 4Q97A 1A8JH 3OX8B 4HKXB 1ZGLM 1CFTB 1A0QH 3HE6B 3NAAH 3SJVE 4MCYA 1ZSDB 5E8PB 1AH1A 3NCJL 1NFDB 4K7PX 1ZHBA 1H5BB 4ZS6D 3JUZA 4MVBD 1ZLVK 4GLRI 2Y1VA 4F8QA 4YDJB 1QSFD 3PWVB 5DHYB 2HP4A 1LK2A 2AV1A 2DQHH 5HHXL 1F2QA 4PJIF 2YEZB 4X4XB 4MQ7B 4OI9A 1UXWA 4Y16B 3H7BB 3F62A 4B7LA 2I27N 3D9AL 5CCKH 3WS3B 3BMWA 1E4XH 1R3JA 4KMTH 3WN5A 3EBAA 2OMNA 1J10A 4E41D 3VGHA 4P23C 3B9KB 3TNMA 4AEEA 1XCTB 4JPKH 2X1PA 4GG6B 3VRLE 4GQPH 1CDUA 1KTRL 3EOAB 5LG1A 1EEYA 1AXSB 2W1NA 1UJ3A 4I4WB 1I7TB 3FCTB 1B6DA 1MHCB 3X12B 2XY2A 2LVCA 12E8L 1QG3A 4X9GA 4DVBA 2YMXL 5D2LB 43CAA 3PV6A 2D9CA 5K93A 1EXUB 4IOFC 4UT7H 4LNRA 5GS1C 1ND0A 3AB0C 3PP4H 3BPLB 5FUOH 2HWZL 4I0KA 1YUHB 3BH8A 1A9EB 1KC5L 3RWFB 1DL7H 3LB6D 1YYLL 1AJ7L 4YE4L 1U8NA 1FBIH 3QUML 1ULVA 25C8H 4GRWF 1SHMA 2ED7A 5B39G 4JFFD 5J11C 3EFDL 5K9KB 1XMWA 3H0TB 4XNUL 3IJHB 4LL9A 3S5LA 2XZCH 4BQ9A 1JNJA 3HNTH 1KPRA 5DZNA 3CXHJ 2V2XA 4X6BA 4RSVA 1QR1A 1C7TA 1T0MA 3HZYB 8CGTA 2OK0H 5T3XD 4NQCD 1QBAA 4RGND 3MLZH 4PP2A 4JKLA 4ZYKA 2MKLC 1QQDA 1OOAA 3EJZC 1EEZB 4ALAH 4Y4KA 3NFNA 4PRPD 2VTFA 3FQNA 3W0WA 2D0FA 1OAXH 3JWDH 4D0DB 4Y2DB 2OP4L 2B7DT 3C09B 4G3YH 1CE1H 4NM8L 1V7ML 2BVOB 1B4RA 4O5LH 3SN6N 1VGEL 4PRNB 5BRZD 2XY1A 3TFKD 1FLTX 1NEZA 1CFVH 1FJ1A 4Y19D 4G6MH 5C9JB 3IXTA 4IS6B 3C08H 3RFZC 3UAJD 2Y6SC 5GSRA 1RZKH 3V6BR 5CJ5A 4HEPG 2BOBB 4ODBD 2IPUG 2COQA 5D9SB 5M7QA 2GK0B 4GRWE 3V52L 4WIQA 3RVXD 1F4AA 4QRPD 5CFHA 3HPLA 1DE4A 2E27H 3GHBL 5HTSA 4UOJA 5BV7H 1RJZB 3A67L 5C3LD 5F9JB 4OFYD 3V8OA 3CFJB 4NKDA 3ARGA 4QOKE 5ACLA 2HJFB 3MC0A 3QIBD 2B1HH 5DMIH 8FABB 4NKOB 5B4MC 2IPTH 1OF2A 4WU7A 4D9QE 1OAUH 3QFDA 4UQ2B 1JNHA 5DEFB 4ZSOE 5JW4N 1IILE 1ADQL 5HYJA 2CDGB 5GS2D 4P49A 1BM3L 4S10A 3G5ZB 4JY5L 5DMKA 2BVPA 3I3DA 1GZQB 2VZVA 2AJZA 3UROR 1Y6MR 2VISB 1URLA 1QNZL 3TPKA 4OGXH 5BW7A 4WUUD 1U2HA 1SJHB 1XGRA 1C8PA 4EEEA 3UYPA 4FQLH 2B2XH 3GMQB 4NWTL 5KW9L 4Y1AB 1JFQH 5DYOA 1DBBH 4MGXA 3RIAK 1TCMA 1XH3A 3QPXH 4ODUB 4BSVB 1UWGL 3U1SL 5CP7A 1ACYL 1JTTA 2DWDA 2A9NL 5D1QB 2IH3A 1PZ5A 1PQZB 5AG9A 4X7TB 1IAII 1D6VL 1K5NB 1EDQA 5LAXA 5L0QC 3LZFH 1A7QL 4MXQC 3LKQB 2QSCL 2VLME 4IRJC 1OTSC 3MV9B 4K3HA 4JAMB 2GSIA 3I9GL 4JZJA 3DRQA 3C8KB 5JOEA 1RHHA 4HJGB 4LFHD 1CLCA 5IFHL 2DLGA 4LKCB 4L9DA 3GI8L 1MNUL 5D1XC 4WFED 2XN9A 1JN6B 1CFBA 3QSKB 2NW2A 2P8PA 1H5BC 2A74A 3N1PC 4HIIA 4IJ3C 2FJHA 3MLYL 3ULVH 3VFWB 1ZXQA 2R1XB 2CUIA 2FB4H 2OTUB 2F58H 4R9HA 3JUYA 3GM8A 1T6VN 3L3HA 1AGBB 2FO1A 4YWGH 1D7FA 2EYRB 3KWWB 3WD5H 1QFUH 5DD5L 4P57A 5EU3A 3WJLA 3RVTC 4ZFOB 1IKNC 1T5WA 4M7KL 5DQ9A 4KKNA 2X9WA 4QRSB 2BSSA 2G60L 2YRPA 3VXUE 3F6IA 1U58A 4K7FA 3HRPA 4JFED 4QHNA 4YDIH 1IGCL 3O3EA 2CRZA 5BO1H 1FGNH 3MCKB 3TVMC 1OTTD 3DO7A 4O58H 4KTYA 2WIIB 1NAML 4YIQA 4FQHA 3KYMB 3OV6A 1JHLH 1H3PL 3ZDZF 3R4DA 4PJ8A 5HI4D 5H94B 4I9WE 1MCBA 4KTEH 4G9DA 4LLUA 3CMOL 1ZVHA 4NO0D 2V9RA 1XGQA 4YLQT 4PUBL 3D2UB 5F88A 4DFHA 1RUPH 3TJHC 4RBPK 1KSRA 4ZO7A 1DLFL 1HHHA 3SDCD 2FATL 5BS0B 4IIQC 3GMOA 4OD1H 4L3CB 5H37G 1A14L 2UWEF 2OL3L 1KTLA 2ZP0T 4YFLF 3O6FB 3HC0A 2VLKD 5GZOC 2IMNA 3EKCA 3ARPA 1MEXL 4PG9A 3EOYG 3RWIB 1CLZH 3VGGA 2XPGB 3O2DA 1MLCA 3FZUD 5MHSD 3CD4A 4YHLL 4KTDL 1NCTA 4KJYB 3LN4A 4ZO8A 5LWYH 1HSBA 3STZB 3PG2A 1ZGLP 4Y2DC 3U9UA 3RTQC 1CI5A 3FONA 1RZ8A 3MGTA 1DUYA 1EJOL 2CKNA 1C5BL 4D0CB 2UV3A 3ARED 5BV7B 3LQZB 5IEHB 4TUJB 5IB2B 5F1IB 4LQFL 3TA3A 4OLWL 5B38A 1MQ8A 1VADB 4LEXL 3VCLA 1H0DB 2YA1A 2R23B 2JCCE 3T0XA 4G9FE 3ZDZE 3BUYB 3SO5A 1VEMA 1RIHL 1KEGL 1H3TA 1F90H 3MV8A 2AV7B 2P5WD 1UM4L 1LD9B 2Z8WC 2OXGA 5F7DA 1HNFA 4ISVA 3G6JA 4TPRH 1G0XA 5FUCE 1MJ7L 1LP9F 3H9YA 4Y5XC 1LMKA 3DOSA 4M7JH 2UWEE 3V4UH 2W92A 3B2UD 1UH2A 4JFHD 4U31A 5I1DA 1CXIA 2AGJL 4Y4FA 1CCZA 3MMEA 1AR1D 1D9KC 1T66D 2NW3B 3SOBH 4PTUA 1ZTXH 1OGAE 4JO4H 2H8PB 1K85A 1YN6B 1SBSL 3FO0L 4YZFF 1KIRB 2N56A 2X05A 4OV5A 5T1LD 5JA9A 4WO4A 1FYTA 2NXZD 5T3ZL 2X4UA 2B8OT 2GT9A 3PABA 4NFBA 4HKBB 5K9OB 4X98A 1FLRL 2EXYD 4IDLA 2I5YH 1ZOXA 3M17A 3HLAA 1V7NL 1QA9B 5C2BL 2R2HB 4MNHB 3O8XD 3HI1A 4RMUA 4NRYA 2KKQA 4K7PY 1OP3H 4OFPA 5FA4B 5TJWK 5ICZB 1EJ6A 2VUYA 5JW5B 1QFHA 2IG2L 2ZOLA 3ARDA 4XC3L 3F58L 1OP5H 4G8GE 4XXDB 2WZPD 2VWEE 5L88L 1AHWA 3NCMA 1EFXB 1CDGA 2VL5A 3ZKXC 1BD2A 4DN3L 3VI3F 5GGSA 4B0MM 1UT9A 4MCYB 4YR6A 4EI5B 1LNUB 3MBEC 1ZHBB 4B50A 3C6LB 4OT1L 4AG4H 1CZ8L 4JHBA 1YC8A 4GRLA 4PJXA 4QCIA 5CJBA 1GC1L 1U8MA 2AV1B 4YZFE 1KTDB 1F45A 5JDJA 1CL7L 1UXWB 2OR9L 4WENB 3S4SA 4UIMA 1R3JB 3MPCA 3WN5B 2D7MA 4TNWF 1PLGH 5F96H 5DS8A 3TNMB 5CHNA 4JKKA 3C60A 3MYJA 2PXYD 3J7HA 2ESVD 3L7FA 1EEYB 3U6RA 1QSFE 3UTSD 3WIHA 3AXLB 35C8L 5TQ2H 4OCXL 4G80B 5B3NA 2ICEB 5INDB 1N5YL 3VFPA 2X89A 2XQYK 3ORJA 2V2WA 4I0PD 3VDCA 4DAGH 3PV6B 4GAFB 2P1YA 2DLEA 4Y4HD 2V6HA 1GRWA 2DM7A 2QQLL 1AD0A 2DN7A 2G75A 3VD4A 3RBGA 5E2TH 4WHDA 3HAEA 1WWAX 3KJ4B 2YK1H 5KZCD 4LLDA 4BZ1L 4AIOA 1U8NB 3VI3E 2VLJE 1A7PL 5HGDA 3HG1A 3STBA 2R2BA 3GMNB 5FYKD 4NKIH 1CDYA 3HS0A 2VQ1A 4ZG1A 1J18A 2VN7A 5IGXH 3E2HB 1KPRB 3BD5A 1EVTC 2V2XB 1FFPA 1QSZA 1UWEL 1VESA 4X6BB 1QR1B 1T0MB 2BNUA 1JVKA 1S5IH 4QHUA 5IV2B 3INUL 4MNQE 4PP2B 4JO1H 4ZYKB 2MWCA 2CKBA 5HI3D 4TULH 5IHZA 2NY0B 1ZVYA 1A9BA 2R29H 3BXNA 3REVA 2B4CH 3V2AR 4JFFE 4XP1H 2GCYA 2R4SL 1EERB 3NFNB 1EVUA 1Q1JH 1E6OH 3I6LD 4HWEH 3FQNB 1XIWC 2P5ED 4RQQB 2X4RB 1W0YT 3O41B 4PJ7F 3MA7A 3RA7L 3GMLB 4Z77B 1UJTA 1KJ2L 2EH7L 4KJWC 2A9MH 3QDMD 5HI5C 5T3XE 4NQCE 2AKRA 3ZKMC 3GGWB 3QXUA 4RGNE 1J0KA 4BK4A 5DT1H 1CDHA 3KGRA 2BRQA 4PB0L 2HMID 2BNRE 5I8CA 3FOMA 4UTAL 2X1WL 1CN4A 3KDMA 5TQ0H 3O2DH 4KI1A 1D5BB 3VWJC 2I25N 4XNQA 5D72L 2IALB 4PRPE 4X6DA 3AUVA 4U6XB 5IBLD 4NKMA 1Y18A 3DRTA 1YMMD 3DTXA 5ISZD 4RIRA 3BGFB 3HPLB 3P3YA 1DE4B 1KUMA 5BRZE 5JIIA 5IF0B 5ID0A 4JPWL 4Y19E 1MI5A 4M00A 1UB6A 2IQAA 4M1CC 4XI5C 4NKDB 3ARGB 4LASL 1S7SA 5IEKA 5F7FA 2EC8A 5EPMA 3BD4A 4JHWH 1PG7X 4MWFA 1CDCA 4JJHA 3QFJB 4WU7B 3QFDB 4MAYC 4MXWH 3ARTA 5HYJB 4BH8A 5AWNH 1CXKA 3L3KA 4QRPE 2NY4B 2CLVA 2ICWI 1NFIA 3I6KA 1QFWM 3T04D 1FPTH 3FOLB 1GOGA 1BBDH 4M9PA 4Q2ZA 5D1XA 4PJ7E 3D48R 1MCPL 3EUUA 2DTSA 2X6MA 1IQDB 2BVYA 5B22A 3KLSA 4QHLB 2RHEA 2HRPH 1BZQK 3VDBA 1S9KC 1NKRA 3DJ9A 2IGFL 4U0RC 3QXDA 4AEFA 1H3XA 1Z9OA 5LVEA 2GTWA 5KSBA 2IAMB 3IJYB 1I9IH 4KZEL 2GFBA 1XH3B 3NIFF 1MCOL 5CP7B 2ATKA 1YNKH 3BP4B 1N5AA 1TZGH 2XG4A 2QR0B 2BDNH 3T4YA 2DBLL 4WUUE 3C2AL 1BBJA 4FQIH 4GBXD 3MGAA 3CAFA 3CFCH 3SGEI 5IVZA 3WO4B 4RRPG 4GXUN 4KXZI 3TZVA 3DRQB 1HINH 1RHHB 2AJXL 3QUMA 4NN7B 4OGAD 4H88H 4HXAL 3SDDA 1A7NL 4YBQC 3UZQA 4OD3L 3TVMA 4KRPC 3KPMA 5EO0A 2UVFA 3TO4C 4CJ0A 3ARFA 2BVTA 3T0EA 4WY7H 3C8DA 2FHFA 2X4TB 2XN9B 4EI5C 5J1AB 2P8PB 4G6JH 5IROA 4I3RL 4P5MA 4HIIB 2FJHB 1WUNT 2Y5EA 5IT2H 1KCUL 3QRGL 1HZHH 3L3IA 1GXEA 3RAJH 4KI5D 2Z31B 4Y5YC 3OJ2C 2ADJA 1QPXA 4L4TA 4GW5B 3L3HB 2AW2A 3MJ6A 4D9LH 1G7MA 4ZOCA 4WFEE 5EU3B 3BZEA 1NANI 4LCCB 4EZMA 5DQ9B 2H9GB 1ZHNA 4QRRB 4EN3A 1R5WA 2VAAA 3CH1B 1KXQE 4TNVK 5IVOA 4F33A 3IDYC 4DGIL 4QHNB 2CXGA 2VXQL 3L1OL 4NQTA 3O3EB 2DICA 3NABH 2EYTB 5D70H 4ZXBA 4IOIB 4K3DH 2HKHH 3CK0H 5CZXD 5KVFH 3DO7B 5FM5M 2DIAA 4M4PA 4BQCA 1NGYB 1VPOL 5DJ6B 4U1HA 4YIQB 2BNQB 1S78C 3TNNB 2YPLD 2ENYA 5FKPB 1I8MA 2VXVH 2BHYA 3G5YA 3D39A 4JDVA 3WIHH 4PJ8B 1B90A 1A3LL 3V7MA 1OAQL 5H35A 4DGVH 3NTCH 4R6UA 2NX5B 2A6IB 4G9DB 4MB5A 2Q8BH 4LLUB 4JFEE 4UB0H 1XGQB 1ED3A 4NSKB 4LMQI 5F88B 4LPXA 4NO3A 2CLZB 4PLKD 4YUEH 2CIKB 1KTKE 1P1ZA 3Q0HA 4NN5B 1NGQL 1PYWB 5D4QA 3GMOB 4BH7A 2LU7A 1K8DA 1KGCD 1ADQA 3HC0B 3GI9H 3BYTA 4H5SA 3RY5A 5GJTL 1ZANH 3HCVB 2XTJC 4Y5XA 4QRTA 1JHKH 4HS8H 4PJGF 5SWZB 1TJIL 5DUML 5JO5A 5HHMD 3BSZL 4LSQL 1MLCB 3VGEA 1EAPA 3IETB 4GS7B 2FX7L 4HK0A 2Y25A 1MRCH 3LN4B 2JIXD 1YEIL 3TBYB 4NZUH 1RVFH 5E4IA 3VXOB 3N1FC 3GK8H 1DUYB 3DMMC 2WWKT 1MFAL 4MA8L 4PRIA 1FRGL 2VLKE 1QSED 4NZRL 3WYRA 2XWJA 3X3FL 2PYEB 3R0MA 4X6CA 3H9SD 4GMSH 1WAAF 4NC1C 4NQSB 3TA3B 4CVXA 4PLJD 5KS9F 2WANA 1HN1A 3NGBB 4LVOC 5MHSE 1RURH 4N0UA 2N7AA 5C6TL 3MV8B 1E4WL 1CQYA 2PYFB 5F7DB 5EO1B 4R26L 3K8LA 4XCEA 3VD7A 5E9DD 4ZPVA 4TUOA 1DUZB 1X5IA 5E03A 2J88H 1A64A 2JB5H 3KG5A 1MIMH 4NHCH 1QVOA 4O2CA 1BPVA 1JI1A 4XNYH 4HF5L 5E2JA 4Z76A 3FB7A 4LU5L 4Z7WB 2VB5A 4LLVB 4PJGE 4XGZB 5FGSA 3HPJA 2AVGA 4Y4FB 2VL4A 3MMEB 1HKLL 1T0PB 1RUML 4DCQA 1VA9A 4P23D 3NVQA 1XF4B 2Q87A 2D03L 1CGUA 1PFCA 2FJFA 3CSBA 5DD0H 2E7BA 5JPNA 4OV5B 5JZ7C 2NCMA 5IMMB 3EOTH 3QDJD 1BX2A 3KJ6L 1I75A 4WO4B 3LKOA 2X4UB 2GT9B 3VFSA 4S1DC 4S1SL 1TVHA 3LHPL 4R90H 1WAAE 1GJIA 1P4LA 1ZT4B 1DBAL 1Q72L 1P2CA 1HYRC 3HLAB 4IOFD 3KS0H 3PHQB 3CVIL 1KIUA 1MFCH 4P5KA 1WZLA 3CZFB 2PNDA 1FE8L 5EBGA 3HI1B 4EDWL 4NRYB 1UCTA 2B1AH 5C0BB 1DBJL 3CMGA 5IHLB 2IANB 4FN0A 2IBGA 2KQNA 1NAMA 4U49A 4Z7QE 2VO5A 1RIVH 5L2KD 3ARBA 4PREA 1GOHA 3ARDB 4Y88A 1A1OB 3TYGH 3QUZD 5FYJH 1AHWB 4NN7C 2VL5B 1BD2B 1I8LC 5GGSB 5ABDE 3OKEB 4JJ5A 4YR6B 2OI9B 5DDHA 3QUYC 1IGFL 2ERJB 4KDTC 2GY5A 5DFTA 3PNWB 4NOBA 1XGUB 2HWZH 4QCIB 5I2IA 3H3KA 4OZ4A 1N3NA 3EYOA 1U8MB 4FFVD 4KUCD 4EVNB 1Q94A 2OL3A 4YE4H 4C83A 2XXCB 3QUMH 1SYVB 3EO9H 3FFCA 3S4SB 3MCLL 1ZAGA 3EFDH 4I2XE 2Z31C 4UIMB 2A6KA 3MA9H 4XNUH 3ZHLA 1ETZB 1WISA 1LO0L 5CKGA 5DS8B 1I4FB 4HJJH 2QQQA 3O45B 4XBGA 1JPTL 3MLRH 5IJVA 5I1CL 4LCCC 2ICCA 4PGBB 1J9CT 2Y6SD 3RWCA 4NQXA 2A77H 2LU4A 1MAKA 2D0GA 4FXKB 4JM4L 4PJDB 5BMFL 2EO1A 3TP4A 5IJKC 3N1QC 5JIKA 5ESQA 3BEVB 4WDIA 3DV6A 2V7HA 2OP4H 2ESVE 3MNZA 3LS5L 3F7YB 3S8WA 5HGDB 3UJJL 2R2BB 5IHUL 4KROB 1AKJD 3BZFA 4AT6A 2VQ1B 2X09A 1X5FA 3IU4L 4NQEA 1PD6A 3M07A 4U4BA 1FFPB 1NKOA 4F57L 4KAQL 1NLDL 2L7JA 3CXDL 2BNUB 1A7BA 5T5FH 1DBKH 2Q1EA 2FX9L 3TBVA 1L9NA 2M2DA 3EZJB 2VZTA 1PEWA 1GPOL 4D2NA 4WWKB 5I73B 4L29B 4NQDA 4LIQE 1A9BB 2FEDC 4KPHL 5E95B 3REVB 2NY3B 4YHPB 3U4BL 5FGCE 4UTBH 2IFFH 5D5MF 5CAYB 3S97C 1IAMA 2C1PB 1BP3B 3B9AA 3CFKA 4MAYA 3Q1SL 3MA7B 4OJFH 4CVUA 4M6OL 4FG6C 1JRHH 5F93C 1BFTA 2VZSA 4AQ1B 3S3SA 5K9QI 3JTSA 2UY6A 4JY5H 4YQXH 2DI7A 5AEAA 4F2MA 5I8CB 4WRLA 3QHFL 4MXQD 1RUAL 4KY1L 3PP3H 4KH2A 3I6LE 4KGJA 4IRJD 1QNZH 2P5EE 3RDTC 1LO5A 1J8HD 1MVFA 1Y18B 4UINL 4H0HB 3DRTB 4FZEH 5JR1L 3ARXA 3QDME 4RIRB 5TFSH 5KVGL 3U7AA 2X4NA 4NWTH 3KPTA 1A4JB 5C0CA 4OI8A 1HXYA 5ID0B 2O61A 4DEPC 1UWGH 3GBNH 4RAUA 32C2B 2ICWJ 1KJ3H 5JQHC 1TQCB 5IEKB 1S7SB 2A9NH 3L3DA 5J12C 1NGPH 2NYYC 1IGIL 3P73A 4MWFB 1IM3B 4XCCL 5J13B 1DBMH 1A7QH 4OCRL 3OKNA 2R0LL 1YMME 5ISZE 2QSCH 4HDIB 1T22A 2XT1B 3STLA 2CLVB 4WW2B 4AZ8A 2AK4E 4P59H 4KK9C 1MY5A 1UA6L 5T1DL 5IVXF 3IYLW 3B9KD 3RVTD 5T33L 2FH8A 1MFNA 1UFUA 4DOHB 4OLZL 2GTWB 5KSBB 4JB9L 4Y5YA 5JUEH 2DM2A 5F7EL 1PKQA 3TCXA 1S3KL 2ATKB 1LEGB 3D18B 1N5AB 3G04A 3IAGC 2HT3D 1GGBH 1G9ML 1X5ZA 3JWOL 4P2OA 1UACL 3T4YB 3WNMA 4XPFH 3O81A 1I7ZA 1BBJB 3MFFB 2Z92A 3WKML 1UGNA 1S7WB 4Q6IC 1NBZB 5C0RH 5DD5H 5DVLA 5IVZB 4R3SB 4EJ1C 3QUMB 4ZAKC 2G60H 4PJ9C 3SDDB 5TDOA 3KPMB 5DWUL 1FG9C 3ARFB 1NDMB 3T0EB 1IGCH 5CEYB 5A16A 2BERA 4P46C 1T7VA 4L8CA 3ZT5A 5GZOD 4K7PH 4P5MB 1CWVA 5IKCB 4G6FB 2OTWA 4UU9A 5IVXE 4ZFFA 2Z8RA 4LSPH 4MZ2A 1AXTL 3L3IB 1DR9A 4JKMA 1IC7L 1NMAL 4U1KA 1H3PH 4LLYA 4WUKL 5I1JH 2YWZA 1ZHKA 5CJQL 4Z7NE 4BUHA 1I3GL 3QJHA 4L4TB 1AQDA 1G7MB 4Y2DD 1MFBH 3RL1A 3RTQD 3V4VL 4PUBH 1LK3L 3MTRA 3RKDC 1DZBA 1L7TL 3MV11 3LDBC 3BZEB 2HFEA 1DLFH 3HZKB 1KJ2A 1G7QB 4X4ZA 2FATH 2NY7L 3TO2A 4EN3B 5FEBA 3VJ6A 1R5WB 2OL3H 1S9YA 3P9MA 1U8IB 1Q9WA 4X7DC 5FCUL 4F33B 2DKUA 4MQTB 3S5LG 4I0CC 4LNVA 4OGYH 4R4BB 1BJMA 5C6WH 3UTQA 2J1KA 4C4KO 4TQEH 3SY0B 4JFZH 2J4WL 3NCFB 2VDKH 3SKNB 1X5AA 3EDJA 4YHLH 3DMMA 4UT6H 2C26A 1MVUA 2A6JB 4YBHA 4O4YH 1QYGH 4WNQB 1U92A 4FQ1H 3SE9L 3VG9C 4U0QB 3D39B 3FQWB 4JDVB 5FO9A 3HMXL 1U8PA 5IESL 3UDWC 5H35B 4XNZB 3VXRA 3A6CL 4CJ1A 2FX8H 4NKQB 4NO2A 3IKKA 5EUOA 3TBSB 4NO3B 2VZOA 4LQFH 4YFLI 2Q8AL 5E08L 1NUFA 5IM7A 3CUPA 4LEXH 4YH6A 2BCKA 1D9KD 5JORB 4KHTL 4PJBF 5J9PA 2WLYA 2YPLE 4LHUA 1WFUA 1K8DB 3BEWB 1NEZG 3WIFB 4H5SB 4DUVA 1DJSA 4QRTB 5JO5B 3FT2A 1TMCB 2J8UF 1GGUA 2NY3C 2VR4A 1EAPB 3LN5A 5IBUB 1YNLL 4HK0B 3T09A 5GGRY 3V6OC 3T1WA 4JN2B 4LEOB 4Q6YA 4NNXA 2HVJA 1W8OA 4PJ5E 2B0SH 4ODTH 5E2WL 4KKLC 2ZPKH 3WEXA 4ESKA 5EZJB 5C0FA 3MJ7A 2AGJH 4HC1H 4JDTL 2XWJB 4PRDA 5JIHA 3IGAA 5HDOA 1F3JA 4HEME 1A6VL 4P3CL 4QNPF 2EEDA 4TUKH 2DOCA 1C5DA 3QEQD 4BFEA 3Q48A 1Z9LA 3MV9D 2R8SH 1NC2A 1KEML 3ZT7A 4HD9A 3VRJA 2C3HA 4XCEB 3UEZA 1BOYA 1FLRH 1QSEE 1I1FA 3MBED 2X4QB 4WTZA 5JOPD 4OD2B 1A1MA 4NT6B 2YUWA 3D0VA 4PJBE 1KLUB 5DUBB 4WJ5A 5C2BH 1P84K 4O2CB 5FOBB 3DHJA 3FB7B 4OZGB 5J13C 3HPJB 5D71L 4Z7VE 2J8UE 4XPAL 2H2SC 1B0RA 1B6UA 4Y0GA 3CFBB 2IFGA 3RVVD 2KQMA 5E9DE 2X4PB 4DCQB 1ZT7B 5L88H 1DQML 2FJFB 5FHAH 7FABH 1KN4L 2MQ0A 4QRUA 5JPNB 1MRFL 5F1NA 3VXMA 3BRFA 4JPVL 3H3PL 1BX2B 3VXTB 4LSUH 4JHAL 1FFOA 5JMOC 5D7JC 3LKOB 4EOWH 2JJVA 3VFSB 1BIIA 1UCBH 1C12A 5EIVA 5B8CA 2QV2A 1UWXH 1P4LB 4QNPE 4PB9L 5EU6A 1GC1H 1J8KA 3TYFA 3QQ3A 2H6PB 4LCUA 4M7ZB 3RUGF 3IRZA 5I74B 2DQCL 1CL7H 5JXAL 2GEEA 4KUCF 4D9RD 4OLUL 3RNQA 5BOPA 4LDEB 3QDJE 1OT1A 5E99L 4FOMA 3ARBB 5CZVL 5DJAA 3ULUF 1BGXL 5FV1L 3N1MC 2F8VA 2VDML 3D2UD 4PJAE 1N5YH 2EDYA 1NCAH 2VMFA 43C9A 1KPVA 2FBJL 4M1DL 5DDHB 4EIZC 3Q6GL 4ZTPL 2QQLH 2L4OA 1C16A 3A6BL 2ADGB 5I2IB 3SKJL 3EYOB 1F97A 4WFHE 1OWWA 1Q94B 2OL3B 4FZ8L 4RMVA 5B3JE 5L2KE 3PWLA 3V6FA 2XIDA 1XIWD 3FFCB 5HHPA 3QG6A 2A6KB 4PGDB 3QDHA 3SO3B 4KJWD 2W60A 5HI5D 5FKAB 3ZKMD 2H41A 2FDBP 1IARB 3KXFE 4M03A 1U6AL 3U9PL 1EEUA 4AEIL 1IEBA 1SM3H 1V3LA 2VRAA 4AQOA 4XBGB 3RUGE 5IJVB 1QD0A 4LVNB 3RWCB 2CXKA 4NQXB 1SYSA 4K2UL 3VWJD 1FZJA 1F4XL 5LGHL 3DETC 1PVHA 2HFFB 5C08A 1R24B 3MLSL 4DQOL 3LEXA 2AJYL 4K71B 4IRZL 4MHHI 3O6LH 4MZ3A 3LPWA 4WDIB 3CDGB 3ULUE 3HTLX 5A2JH 1HIML 3BW9B 3RA7H 3DX9A 5CD5C 2AEWA 1KJ2H 2EH7H 1HHIA 3MNZB 3VW3L 5KVEH 3VFVB 3KPRD 4LF3A 4M1CD 4XI5D 4TSBH 3QIUA 3F7VA 4M5YL 5E2VL 4H8WL 3BZFB 4PB0H 3N1GC 4X0KA 4PRBA 3RDTA 3FO1A 1K6QH 2FH6A 5CWSB 3O3DA 3SGJA 1TXKA 3EYVA 5D72H 4X6EB 1AIFA 3WJJC 4XPHH 3BP5A 4MD4B 3QEGL 3O4LA 4K55A 4XWGH 4Y89A 1F5WA 2HVKA 2ZUQC 4X4ME 5DJCA 4NQDB 2AAVA 1DEEA 4YHIA 1C7SA 5T5NG 3OTTA 4FQJH 1A2YA 4W6YB 1AY1L 1ES0B 3C9NB 5GQBA 1JGLL 4P3DA 1QFOA 4GKZA 4LASH 5F3BA 4JKPL 2V5SA 3SPVA 1PW3A 1OSZB 1NFDF 3CC5B 3AAZB 3OAZK 3OKLB 4KVCH 4YXKL 1RUQH 3ALWA 3TH2T 3JTSB 3MOBH 2BY3A 4G8FA 4F7PB 5HHVL 4L3EA 1FNLA 3U83A 3CLFH 1EZVX 3PGFL 4JPIA 5KVDL 3HZVB 4QTIL 4XAKE 4WW1A 5JHDB 5A3IC 3HMWL 5DRZA 1P7QA 1LO5B 2M26A 3NN8B 3P2TA 1JMXA 2XXMB 3MRRA 5IWLA 3TT3L 4L4VB 1KJVB 4HMEA 3NPSB 4YBQD 4GG6F 1NCDH 2BC4A 1F2XK 1E6JH 1UC6A 1EFXD 3TO4D 1HXYB 2O61B 1MCCA 4RAUB 1MCOH 1T83C 3UTPD 4HQQL 1YEGH 4EI5D 4PRHA 3C6LD 4Q6IA 2JE8A 3P73B 1I1YA 2PCPB 1MCSA 3HC3L 3MV01 2CSPA 5D2LF 1L0XA 1J8HE 1FCGA 2DBLH 5GGTA 3C2AH 1XGYH 4ZAKA 1T22B 3STLB 4MJIB 4PJ9A 4UMGA 5H2BA 2X7LA 1IVLA 3O6KL 1M1SA 4I13B 1SBBA 3KPQA 5IR1A 4RFEA 5I1AA 5ANMB 4WU5A 2V7NA 2BOCA 1J05A 4QYOA 4R2GB 3ZSSA 2NY1B 5MI0B 4KRNA 4PRAA 1INEL 3IS1X 1MCWM 4KMLB 1OB1A 2D2OA 3X13A 1BQUA 2Q7NA 2VQUA 2ZWLT 2JJTC 4OCSH 4I3RH 3LIZL 5EORH 1T2JA 1PKQB 4RA3A 1H15A 5C09D 1QRNA 4OZFA 4KK6C 4HUUA 3D25A 3G04B 3K2UH 2ITCA 4FQ2H 4IDJH 4XCYB 4YPGA 3V8CA 5BXFA 4M7ZC 4RMWA 4P2OB 1AR2A 4W6XB 5I74C 1S78D 5C07A 4GG6E 4APQB 2LE9A 2PO6C 3TIDA 3WFDL 3ELAT 4Z0BL 3MRMA 4D94A 1CFNA 4I18A 4NZTL 1Q9OB 4OZIE 4P5TA 4FABH 1ORQB 3NZHH 3MLXL 3S4SG 3T8XB 5GZNC 1DQTA 1SVZA 3BZ4A 3NFPA 5EU4A 3K8MA 3L1OH 1P9MA 2NPLX 1NGWB 1RZ7L 1OSPL 1FVEA 5ENWB 4RX4D 2OTWB 1BQLH 2XTJD 3QCTL 4U6YA 2NY0D 5E2UH 1VPOH 1ZV5A 3UDWA 4ZFFB 2VIRA 3Q5TA 2IH1A 1OQOA 1T1YA 4NNPL 3LKSA 1Z3GL 5D6DC 1BIHA 5INCA 3MJ8A 3VD3A 4ONGH 3RL1B 4M8QA 1BFOA 1G1CA 3CU7A 5J89A 3H9ZA 2E7LA 2RR3A 1TVDA 1B4JH 1KJ2B 1YEHH 4D8PA 1T2QL 1R5IA 3V9FA 1R3IL 3VJ6B 4PPTA 3QR2A 3KPSB 3P9MB 2ICWA 2LFGA 3HHRB 3CLEH 2HFGH 2ZNXA 3ZMRA 1Q9WB 5GJTH 1X5YA 5F9DC 1OW0A 4CVWA 4ZDHB 1TJIH 5GHWL 3BSZH 1TQBC 2P8MA 4H8WC 2VDPL 2FX7H 3MLVL 3TCLA 3F6LA 3PHOA 3QDGA 2NTSP 4ZODA 3H9HA 3L5HA 4H1LA 1J0ZA 1GGCL 3HZMB 3OBAA 4LVHC 3CDFA 5FO9B 3BE1H 1U8PB 3D3VB 2Q7YA 1MH5A 3D5OF 4NZRH 2YXFA 4KJPC 4OM0L 1AFVL 4JO3L 4NO2B 2XKUA 5D2NB 1ZGLB 1FL5B 3X14A 4QF1A 5AUMA 3CH8A 3QFJD 4HZLA 3GMMA 5IM7B 4DN4H 4AY0A 3PGCB 3B9EA 2NY4D 2Z4QA 5C6TH 5ALCL 1E4WH 3QO0A 3ZE1E 3MBXH 1SEQH 5C0GB 3VXPB 1R3KA 4RAVA 4R26H 5JZ7D 3FN9A 3TT1H 3FT2B 2APFA 1FN4B 1WTGT 3LN5B 4QHKI 3WS6A 2VN4A 1E4JA 5IB5A 4XBEL 3HI6L 1MJUH 5JW4M 4S1DD 5GPRA 2DLTA 1VEOA 3HB3D 3M1BA 2IAMD 1S7XA 2FSEA 4NNXB 5ADPL 4CADA 1INDL 1MHHB 1S9WB 4YHYB 5A2FA 1QLRA 3WEXB 3L95A 3MLPA 5C0FB 3OJMB 2AJSH 4UQ3B 4BZYA 2JJWA 5JW4Q 1CVRA 2R0ZL 4G5ZL 4PRDB 1HKLH 3EYSH 3UPCA 3IGAB 1UG9A 3D85B 5C8JB 1F3JB 1ZHLA 2D03H 2WBJC 4HZAA 1RZIA 5I30H 4L3AA 1M4KA 3FRPA 4G8IA 4YAQA 4FRWA 4NGHH 4OBRA 3KJ6H 4Y1AE 3FMGH 4PJCA 1NBQA 2H1PH 1C5CH 3LHPH 5FHBH 4OF7A 2XQBL 1Q72H 1PX4A 4WVRA 4XVSL 3SDAB 3QUYD 3BKMH 3B2VL 3SBWC 4UZGA 5A1AA 3CVIH 2P43B 4OZHA 5LCVH 1JYWA 1T1ZA 4WJ5B 1QACA 4LPVA 4EDWH 3QEQE 5I1EH 3MV9E 1PG7H 1DBJH 4M3KB 4GQ9H 3PXJA 3G6DH 4FTVA 4NRXA 1KELH 2Z31D 4AIZA 1B0RB 3IFNL 3S88H 4HPOH 2WUCL 3UTTA 4FMKA 5JOPE 5LGJB 1QEWB 1YYMH 4R4FL 1BOGA 4NHUA 4QRUB 3VXMB 4NIKB 1G7LA 3QWOB 2CIIA 3MSPA 5GGTH 1IGFH 3BQUB 4Z9KB 4QRRD 2BSRA 4U6HA 1C12B 5B8CB 5I75C 1IGYA 4R8WL 3CIQA 1BEYH 1F6AB 5EU6B 2E9JA 2VLRA 3TYFB 1T6WA 3QQ3B 4LCUB 3QUXB 1LQSR 3U4EB 5CBAA 1N0LA 3DVGA 5C0AD 5E4EC 3RNQB 1QBML 3RGVA 1YY8A 2KPNA 2BNQD 5T3XL 4JKWA 3KLAA 4FA8A 4U2YA 5I1HL 2VXUL 1JPTH 1KENL 3RVUC 3HMXA 2CQVA 4Q0XH 2NX5D 4OZFH 5JW3L 2DD8L 4Y2OA 5SWSB 4XTRD 3ZTNL 1KPVB 3BI9X 4D9RE 5BOZG 3O2VL 3VGBA 1C16B 1A6TB 5F9AC 4RDQG 1G7PA 2FEDD 5J4MA 1KPUB 4G43B 3ILPA 1V3KA 5BVJA 2A2QT 3GIVA 5ERWB 2E7CA 1B0WA 1WCQA 3LS5H 1U9KA 5SWZD 1X5JA 1UEMA 4PFEA 2E6QA 4Z7UB 3V6FB 5HHPB 3LH2L 5IQ9A 3QG6B 3SJVA 2A83B 2Q6WA 2W60B 2PR4L 5KVMC 1A6UH 1YNTB 5SX4I 5DURD 2G5BA 3BKCL 5BS0E 3MRIA 1M7IA 1OAYL 2FX9H 1T4KB 4L5FH 2PYED 5F72S 1IC5L 1GPOH 1SYSB 3GEWB 4DW2L 5J1SC 1KJMA 3P4OA 1ONQA 1T1XA 3KPLB 2F8XC 2FGWL 1JWSB 2R56L 3OB0H 5C71A 3LEXB 1JNLH 3QDAA 3VFGL 1IM9A 1YQVH 3WFZA 3KPPA 3DVFA 3HFMH 5MENB 4M6OH 3IFPB 4TTDC 2R15A 1J12A 1E0OB 4LF3B 3CVHL 3VWKA 5HGHB 3QIUB 3F7VB 3WDIA 3CCHA 4M43H 1G84A 1F11A 4PRBB 5IBUG 1HQRA 3FO1B 4JQXA 2VWEC 1CDJA 5DI8B 3O3DB 1RUAH 4NPYA 3OXSB 3BP5B 4ODXB 4WEBL 1BZ9A 2C7UA 4LLAA 5AYUL 1M7XA 4P4KC 3O4LB 4XVJH 5J7CC 1QBLL 4GUPB 3TV3L 4JZNA 4K3EL 4GW4A 1UYWL 2HVKB 3O2WH 5JR1H 3IJSA 5DJCB 4IEFB 1T83A 3L3GB 3KPRE 4MA3B 4NJAH 1NLBL 3ULVF 3G08A 2EC9U 3R1GH 1FNSL 1XF5A 5I15H 1A2YB 4LGRB 2V2TB 3QQNA 3IB4A 4KKCC 2R0WL 4GKZB 3H3BC 1MREH 1XT5A 1CXEA 3P0GB 3SPVB 3FJTA 4LQ1A 2I60H 3ALXA 4XCCH 5FO8B 2NY2B 5IFJA 4M6AA 1NL0H 5KN5A 4KXZH 3I6GA 3W9DA 3RWEB 3GSOA 4L3EB 5I71B 1IKFL 2O5YL 3PWNA 1BECA 5C0BD 3L3OB 5GJSL 5DJDA 1UXSA 1P7QB 2DB8A 2IAND 4PP1C 4KFZC 1N6UA 1TTGA 4MB3A 3VXSD 4Y8DC 1DP0A 3GJFH 1T0NB 3IAPA 3P11H 2BC4B 4QT5A 5F7EH 1U3HA 4K23H 1F4YH 2Q86A 3W2DH 4LCYB 2A0LC 4L8BB 3V5DA 4P46D 5FYKU 5C9KA 2HJKA 3C5SA 3RWGA 4JRXB 1F42A 3JWOH 5E7FA 4LCWA 4OLEA 2DI9A 3L5JA 2OZ4H 2QL1A 3PDOA 4MDIA 3ULVE 4HS6A 1H3UA 3U48A 5D1ZA 4JM2B 1MCIA 3OR6A 1HH6A 3WXVL 4MD5A 5DRXA 4FMFA 3KPQB 5IR1B 3EHBD 4XWOC 4BFIA 3RKDD 3ZYZA 5F89A 2V7NB 3UTPE 2BOCB 1J05B 3UJTL 4Z5RA 4QOKA 4PRAB 5DWUH 3X13B 4QY8A 1X4ZA 5ESAA 1K2DB 3MLUH 4ZSOA 2AABH 2RGSA 3BQUC 5F6IC 2RFXB 3E8UH 4X4YA 2BVQA 4I77H 1K4CA 4RGNC 4E0RA 1QRNB 4OZFB 1AXTH 2EKSA 3B3IA 5BZDA 1IC7H 3MRKA 2ITCB 4YPGB 3N0PB 4YXHL 1JYNA 5DQJA 2YSSA 4HKZA 1INQA 2MPAL 5KANG 5TDNB 2Z91A 4UV7H 3E6HA 2ZSVA 3TIDB 3T1FA 2EKJA 1L7TH 4F7MA 3DLQR 4JFQB 4QXUH 3K4DA 4TVPH 5IB1A 4I18B 2NZ9C 4F8TA 4P5TB 5C09E 3KVQA 1LO4H 2DL2A 4W4NA 3BYYA 4ETYA 4LDLB 1KN2L 5EIIA 2JJSA 5E1HB 5IMLA 3NFPB 5EU4B 5FCUH 2NTFB 3O9WA 4J8RA 1YEJL 1QKZH 1FIGL 3OKOB 4ENEC 4I3SH 1G0DA 4DKDC 2YA0A 2J4WH 1EEQA 4WWKD 4HIHA 4U6YB 4XNXL 4DUWA 4URTB 3MJ9H 1J5OL 2IH1B 3BHBB 2NY3D 2V17L 3LKSB 3MGOB 1S9XB 3HMXH 1JZ2A 5IESH 2CO6B 1YEKL 3MREB 1NFKA 4P4RA 3WFHA 2X44D 5GS3A 1W72H 3DECA 4M8QB 4F7TA 4KKLD 4L8SB 2Q8AH 5CINL 5E08H 4CW1A 5JPMA 4D8PB 1J1OH 2XTJE 2HLAA 2FYYA 2R4RH 5C3TA 3P0YH 2VXTL 3VFMB 3BIAX 1ZVSA 1QFWH 1F58L 5E6YA 3UP1A 5ETUA 1J0HA 3MODH 1L0YA 2GJ6A 4MA7L 4LPTA 15C8L 3PHOB 3QDGB 5KSUB 4H26A 4JO2L 4MB4A 4KDVA 3H9HB 1Z2KA 1JUFB 2I24N 1B88A 3QXVA 1X5HA 1FV1A 3P4NA 5E2WH 3RZCB 5HGAA 3VXUA 1MH5B 5F8QC 5EG6C 4JDTH 2WBJA 4YHZL 3SKOA 1BREA 1JWMB 4YC2C 3X14B 1KCVL 4QF1B 5AUMB 4P3CH 1A6VH 4HZLB 5ALBH 3GMMB 2EIBA 4QHKJ 1NCWL 4GH7B 2Z4QB 4Q74A 5GGVY 4LSRL 3QO0B 1KEMH 2I9LA 2VNCA 3H42L 4RAVB 4K94C 4DGYH 1IQWL 4YXLL 1YEDA 1HI6A 4ZMAT 1IC1A 3QA3B 5D7JD 2ZJSH 5IB5B 1AGEA 1E4KC 3RI5F 3QFJE 5GGRB 3EYFB 1UVQA 3M1BB 1OAZH 1S7XB 4DK6A 3BDXA 4PIRF 3TPUB 4KZDL 3VGDA 1T20B 1EGJL 5HYJE 4CADB 3GJFB 3HC4H 1QLRB 3NIGE 4X5XA 5FYJD 2OSLA 3MLWL 2NY2C 3TJEH 4M61A 4JZOA 2IF7A 1QOKA 1ZHLB 3O0RL 4R7DA 1TCRA 4KQ3L 4NQUA 5TE6H 1RZIB 1KN4H 4G8IB 4ONFH 2QSTA 1MRFH 5E56A 1Q9KA 1FH5H 2MQCA 1UH3A 4OLYH 2D31A 4PJCB 5IOPA 4FNLH 1FIEA 3UTTD 3CFIC 1TPXB 1I7RB 4N8VA 3BDBA 2F53D 4OZHB 1EHXA 3K3QA 4BYHA 5JXAH 3BP7A 2JCCA 4G9FA 4OLUH 4G6FD 4GXUM 4FQPA 2VYRE 4J3WA 1RK0B 2VC2H 1OTTC 1J87A 2DM4A 1DANT 4NRXB 3U7WL 5E99H 4AIZB 1JK8A 1FGVL 3QIWA 1D5XA 5DJ8B 3WL9B 3UO1H 5CZVH 2A1WL 5KSAA 1WCBB 1H3GA 5E8EA 4MD0B 5C0IB 5HI4C 2VAJA 2DYPA 2IQ9L 4NHUB 5DK0A 1O0VA 5KTEL 2UWEA 2DQIH 1G7LB 2FBJH 1U95A 1JPST 4IRSB 1ZKAA 1G6RL 3QNYA 1NAKL 1AGDA 3A6BH 5F6HI 3DETD 4LIQL 1IGYB 5MEPA 1NJ9A 2QSVA 5C0EB 1OGAA 1ZWIA 3C5ZB 1BMGA 5CBAB 3PWPD 4P2QB 2LABA 4WFGD 3RGVB 5HVWA 4EXKA 1QLEL 4P48A 2NY5L 3KLAB 1U6AH 4JR9H 3U9PH 4UDUB 1Y6KR 2AXFA 1LE5A 4QRRE 5GRJH 5SV4A 3M8OH 4UNUA 1RFDL 1CE6A 3C2SA 1KB9J 2DQEL 3VGFA 1G7HA 1F4XH 2I9TA 1W72B 1AGFA 4WFFE 5E94A 5C0AE 3WFBH 5T5NF 3HI5H 1P7HL 1SQ2N 2VZUA 5DK2A 3MNVB 2AJ3A 3H6JA 4YDKH 2BNQE 5CD3B 1G7PB 2EDKA 3G9AB 2Y36H 5BVJB 2WWKO 1HIMH 3EDDA 5IMKA 5F7KC 4G8GA 1MOEA 4AMKH 2NX5E 4DVRL 4M8VA 3UPRA 1SY6H 3BWAA 4RISH 2Q6WB 1FP5A 5ACMA 4XB8A 4LRIC 1XGTB 2G5BB 1AP2A 3B5HA 1WICA 2F19L 3MRIB 1QO3B 3SKMA 4XPTL 5GGQL 1M7IB 3ABZA 4PBVC 1I7UB 1JV5B 4Q7DA 4FQXB 5HDQL 4Z7WF 3ZE2F 4AM0A 5EC1A 5SWZE 1HK6A 2X70B 3DYMA 3TESA 5A3ID 1KJMB 3P4OB 1ONQB 1CICB 1DDHA 3NCYP 2J6EH 4GMTH 1PAMA 4NO5A 2HFTA 3FN0H 1WC7A 1K8IB 1QSFA 3JV6A 3P30L 2ZUUA 4P9HH 4YXKH 4ZFZA 3VWKB 1JPSH 5K33A 2PYEE 3CCHB 2AXHA 5HHVH 4C59B 2AI0H 4PJFB 1HQRB 2Z93A 4WHTA 1CU4L 2CK0L 1JGEA 4QTIH 5D6CA 3CX2A 4NPYB 4E41A 2YD6A 2F5AL 2ORBH 5JIPA 2E8ZA 3MV8E 2DQJL 1MF2H 3LKNA 3O8XC 4JZNB 2YD9A 1T7ZA 3IF1A 1MJ8L 3RU8H 2XA3A 4ORGA 1XF5B 4XZUB 4FFYL 5I1KL 3X3GL 1JWUA 4R96A 5JLZB 3UBXB 4D0BB 4Z7WE 3ZE2E 3HC3H 3NH7H 4GAGH 4KK6D 3FB8A 4RFNB 5DUPH 4J7RA 1JGDA 5KN5B 4OUUA 4YGVA 3GSOB 4JFFA 1YECH 4X9FA 5HXMA 2APVA 3PWNB 2PO6D 4GXVH 4GSDH 1K4DA 3BPNC 5DJDB 3T65B 1XZ0B 1UXSB 4OCMC 2Y07H 4TRPL 5DMYA 3U30B 4NQCA 1MCHA 2G9HB 4NNYA 1P4IL 3NA4A 2CLRA 2UZXB 4BSWA 4Q9QL 4QT5B 4S11A 5EC2A 1T1WA 1U3HB 1F3DJ 4X83A 5I18L 1FZKB 2X1QA 1DQQA 2Q86B 3U2SA 3V5DB 1DSFL 2B39A 3FQXB 1TPXC 5AG8A 3B8YA 3FRUA 4OGZA 1NPUA 2HJKB 4PRPA 3OG4B 5C0BE 5CUSL 3RWGB 3T2NL 5IQ7H 2CD0A 3MRNB 4PJDF 3MRJB 5A40E 5LBSL 4LCWB 5HHNB 4D9QD 4RWYL 4JFXA 2IANE 5GISL 4MDIB 4Y4HC 4XVTL 1IGTB 3VXSE 2VITA 2PETA 4Z0BH 5BRZA 4M6NL 4P9ML 2LQRA 4OCLC 4Y19A 1GIGL 4JRYD 4LP5A 4BFIB 4X5WB 1VHPA 3QEHA 5I9QB 3FT3A 3MOAL 4XP9L 2R1YA 1JPGA 4GG8A 5ITFB 4ZS7L 4KGLA 4HS3B 4UT9H 4QY8B 1OSPH 3OPZL 4ZSOB 5BVPH 1Q0YH 1IBGL 3GSRA 4IRSC 5M95B 3ZZ1A 3N85L 4QRPA 3QCTH 4X4YB 2BVQB 4N5EC 1K4CB 3RBSA 1UB5A 4E0RB 2EKSB 2NY5C 3B3IB 4R0LB 4S0TD 4WTWA 1OARH 3MRKB 4GFTB 4PJ7A 3CSPA 1M7DA 4OFYA 3UYRH 2YSSB 4HKZB 2GJZA 3VXNA 3L9RB 2GITB 1T04A 5HVHB 4C54A 3QIBA 1FFNB 3WLWC 3D69B 4OFVA 3X11A 2VLMD 3T1FB 3EYUH 5DHXB 3NBNA 5IB1B 4EUPA 1B0GA 5DMGD 4ZOAA 1ZLVH 2WQRA 3CVHA 2AQ2A 4O9HH 4PJDE 4AL8L 4XXCC 2YBRB 4CVZB 1YN7A 1KG0A 2G5RA 3O9WB 1BHGA 3BO8A 4IMLA 4YHML 4WUUA 1VKXB 5JXED 4CNIA 2VDPH 4MX7A 2K1MA 3PL6B 3UJIH 3MRCA 3ME0A 3IVKA 4DZBA 5JHLL 1JZ7A 1CLYL 4OBSA 1P5UA 3DBXA 1MHEA 5K9JL 3FFDA 3MLTA 1CXFA 4CBPA 4MSWB 2JKXA 4PTTA 3SGKA 3O4OB 4D3CL 2EO9A 1FDLL 3HNSL 4YHNB 4F7TB 4U1MB 5T1MA 4XX1G 4ZUTA 1JHTA 4CW1B 5JPMB 3V4PH 5D93B 1U8KA 5CSGA 1QP1A 2FR4B 2HLAB 5F7NC 5LQBL 1IGMH 4B7IA 2EIZA 5ALCH 5D7LB 1S7QB 1ZVSB 3VFNA 4WW2F 5JHDD 1E4KA 4KMQA 3V6OE 5ETUB 1FZMA 4X6FA 3LD8C 4LARL 1CICC 2W9DL 2GJ6B 4WV1B 1NC4B 3P9WB 3W11C 4L4VD 1FZOA 1KT2A 1DVFC 1AO7B 5ADPH 4OLXH 3IKCA 5I8EA 1AQKL 5KSVB 2VOTA 4F15B 4J23A 5HGAB 5KSBF 1MJJB 3HE7B 5E8NB 5C0DA 1YJDL 4MJ4A 4G5ZH 4U1LB 1FSKB 3SKOB 2EZ0D 4XCFL 4BFGA 1BVKB 3AGVA 1YEFL 4UV4L 4CMHC 4X80H 5GS0L 4HFUL 2NNAB 1IT9H 4LLMB 4MJID 1H8NA 3T0BA 1JNNH 4L8DA 1A6WL 3ECBA 4XH2B 2DLIA 2OQJA 2PTTA 2AERT 2RIKA 2VDLH 2XQBH 4K8RL 4XP4L 1YEDB 4JFEA 4XVSH 1HI6B 2V5YA 4Y5VA 5LKNA 3ARUA 3OAUL 3OJVC 5IB3A 1LEIA 1IAOB 2BSTA 1UVQB 2DLFL 2A73A 1NMCB 3K0WA 5KBNC 4WEMB 2E9IA 4HCRL 3AY4C 3LMJH 2AP2A 4DZ8A 4H0GA 2OSLB 4RFNC 5MERB 3W39A 4R7NA 2CK2A 1SJVA 4JZOB 4YNYA 3K80A 1A3QA 1CTOA 4G8EB 1CTNA 1MLBA 2CR6A 3OWEA 1RSFA 4NO0A 3PWJA 4LKXA 1A3RL 4R4FH 1OQXA 1F02I 5ACZA 4DOHE 2X9YA 1Q9KB 4HGKC 1TNNA 2KBGA 4LBEA 4W4OC 3HR5B 3RVUD 1P53A 1I1AB 3SDCA 4JEGB 3U30C 1CFSB 4V2BA 4F58L 1YDPA 5IOPB 4YBLB 5SWQA 5HGBB 5FYJE 4RDQF 2VLKA 5EA0L 4R8WH 1KB5A 1BAFH 1EMTL 4QRQA 1TTFA 2W59A 1FO0H 3R8QA 5DLMH 3GUTB 3GSVA 5C6PB 1NSNL 2JCCB 4G9FB 1HOCA 3ULUL 1FVDB 3PIQA 4AIXA 2VZ1A 1QBMH 4NJ9L 4UILL 1HWGB 5T3XH 1LE9A 1W0VA 4HXBH 1PY9A 1OM3H 2M1KA 2QHRH 1D5XB 4PY7A 2VXUH 1U8QA 4OZFG 2FD6L 3WFEL 3MV7B 3AREA 5F6HJ 5KSAB 4M02A 1G1YA 4ZD3L 2E5EA 5E8EB 5F1OB 5JW3H 2DD8H 4OLVH 1CGYA 2L7UA 2R2EA 5CBEA 2F53E 2W0FA 2X4SA 2AQ3A 3CPLA 2BP3A 4A6YH 1U95B 1JI2A 1A5FH 3O2VH 5DJ2B 3FQUB 3QNYB 1AGDB 4PJGA 2P5WA 3KPSD 4M7LT 4QLRA 3WUWB 1OGAB 1ZWIB 1UENA 5DC4B 2YKLL 5DMJB 5BZWB 1QBBA 2EDWA 4KVNL 5FYLH 5B21A 4JFPB 4TTDD 1TVBB 2PR4H 1FVCB 3CJJA 1KCSH 1NMBH 2EH8H 4UOW1 3K1KC 2CJUH 5HVHC 1OCWL 3KR3L 5I1LB 1T3FA 3D3VD 3MRQA 1WAAA 3VFRB 1S5HB 1ZA6A 1NDGB 1IC5H 4FFZH 5GRXG 3GMRA 1W0WA 3B5TA 4OIBA 5EZLB 2XZAH 1G7HB 2I9TB 4OCNC 3NZ8A 4J3XA 3RPIA 3LRSA 4P4KD 2ZUXA 3BZDA 3IFLL 5EOTA 3QI9B 4WFGE 3GM0A 2YPVL 2HTKC 2AJ3B 2DI8A 4JFDD 5DK2B 3NCEB 3QHTC 5T1LA 3S35X 4KJQD 3PL6C 2LTQC 4KKCD 4EUPH 5J1TC 3QWRD 5CMAA 5GGSY 3Q6FA 3MRPB 1I9JL 2ARJA 3O4OC 3P4LA 4IHOA 3O8XA 1YC7A 4HIJA 3BGMA 5A2LH 4F7CA 1MIEH 1EGJA 3RL2A 4K3EH 1UYWH 4OZGF 4AM0B 5EC1B 3D85D 3MQIA 1NLBH 3IFOA 4I2XA 1FNSH 4P0DA 1DDHB 4X7FC 1EO5A 2RBLA 2CRYA 1GGYA 4PP1D 1U3YA 2W9EL 4NO5B 1YJDC 2R0WH 4Q9RL 4V1DD 1RJYB 1WC7B 3NA9L 4J4PC 1RZFH 5IG7B 1S9VB 3OKKA 4WV1C 1MQKH 1QSFB 2VLJD 3JV6B 2IPKB 4UAOC 2Y5TA 2A0LD 2J5LC 4RBPH 4RGMB 5GS0C 2QKIA 4N8CL 1RI8A 3ZKSD 4KQ4L 3SDAD 3E1F1 1LEKA 5HYQA 4M7LH 1A21A 3HE7C 1WTLA 3IAQA 4OM1H 3GRWH 1FSKC 4E41B 4O51A 1PBYA 2OX5A 5JW4R 3FN3A 5GGUA 4K8RC 4GAYA 4MNQD 3MRDA 4YFEA 3P0VH 3LKNB 2PXYA 2ESVA 4XWOD 3UTSA 5I8OH 3TN0B 3IF1B 1Y0LA 2P46B 2W9LA 4X99B 3ZKQD 2R0KH 3VGAB 1CBVL 4I0PA 1V3MA 4GAJL 3ARRA 3VFUB 5DJXA 3QUZC 2GW5A 4Y4HA 3GNML 3BQUD 5EWIH 1KFAL 4R96B 1HDMB 3KYNA 4LRNL 3HA0A 4OZGE 2DQDL 4PJIE 3SGDI 3FB8B 1G6RA 2P4AB 1X5XA 5GGVH 1FNEA 3WXWL 4OUUB 2BNRD 3QUXD 2Z8VC 4UNTA 4JFFB 5CS7A 3V0VA 1FO0B 3WV0A 3WXVH 4FFVC 2XYCA 4JREB 2F54B 4DTGL 2EYSA 4J3TA 5JDSA 5ECJE 3VD9A 2XFXA 4G6AC 2NZ9D 4TVSa 4J2XA 2HG5A 4YDVA 5HHOB 4NCDA 2CH8A 3T0DA 2EXWC 3ULUC 5SWSD 1GZPB 4BSWB 1T1WB 3EGSA 4ENED 1HHJB 5CSBA 5IP4A 1VFOA 1L7IH 3FQTA 3FRUB 3HNVL 4PRPB 2P5EA 4A6YB 1IEAA 1ROWA 3WHXA 4DFIA 2FZ3B 2Z35A 4JFXB 3QDMA 3Q5YA 3EDKA 4FQCL 1C08B 5BRZB 1IFHL 4ZUUB 5DR5L 3ZLQC 2C4FT 4JANA 1RZGA 4E5XA 1KB5H 4HT1H 4TSAL 1OLLA 4PG2C 1Z6JT 4I5BA 4CGTA 3L7EA 4MXVF 4QHMB 2ZUTA 3SCMC 3FT3B 3AS0A 4NDMA 4YO0A 1YEJH 5TGBA 3QG7H 1FIGH 4TNWK 5L6YL 4AENA 2RCSL 3SDXA 4U1NA 1YMMA 5ISZA 2IADA 3QCUL 4XNXH 4EBQL 3N9GL 1CGXA 2AK4A 3FFCE 4ZUWB 3TWCH 1IL1B 4OQTL 1M7DB 2EDJA 2MHAB 4GT7A 1YEKH 3LKPA 4JRYE 3RNKA 3U0TA 4R4ND 3WO3B 1Z9MA 2OBGA 3LQAH 5GSVB 4NC2B 5MEND 3ILQC 1R6VA 3DPBA 3X11B 3RWJB 2WUBL 5MP6L 4M6ML 3QXWA 3OL2A 4KK5C 2AJUH 4ZTOH 2FL5B 1ZS8A 4EUPB 5KJRL 4NN6B 1P84J 4KUZL 4N1EA 2D3VA 2I07A 5DQDL 4I3GA 3JSSA 5IW1A 5DEZA 4BZ2L 4IMLB 4M93B 3ET9F 4CNIB 1A4KA 1HSAB 4MX7B 2RB8A 5DZOA 5ILTL 4MA7H 1CXHA 3Q5OA 3QI9C 3U36A 4NP4H 5C0NC 3ISWA 4MXVE 1A0QL 3MLTB 3REWA 5I66B 3NAAL 1NCCL 3DUUA 4PTTB 4TYUA 1H8SA 5AAMA 3HE6C 2X42A 4LLQA 5T1MB 3P4MA 4HBCL 4ZUTB 4GBXA 1JHTB 4MLSA 3VRIB 1U8KB 2NY2D 3LSOA 2DQHL 1RULL 1CXLA 3VI4F 5CIPH 1BQHA 4NQDE 3SDYL 2FECI 1KBGH 3GKZA 5M94B 3DIFA 3DSNA 5CCKL 4KMTL 1L4IA 3VFNB 3H42H 4HH9B 4Y16C 4JPKL 1TJHL 1FZMB 4X6FB 1G0YR 3PXHA 4AJ0A 1JF1A 2XTLA 3MO1A 3B9KC 5D7SH 4F9LC 1FZOB 5T1KB 3S35L 3L6FA 4KZDH 4JQVC 1KT2B 3OKMA 1EGJH 1S7RA 5E6IB 2FJGA 2SEBA 2P7TA 3MLWH 4FFWD 1PY4A 1WK0A 1KNOA 1EBPA 3MUHL 3PP4L 4JRXD 5JHDE 3KAAA 1FYHB 1TENA 4L9LB 5CGMA 1DL7L 1FL3A 2GUOB 4ZFOL 3LCYA 2HT3C 2ICES 3TEUA 3UBXG 4PV8A 1FBIL 2XG5A 3BPLC 2ID5A 25C8L 4JM2D 1U42A 4L4VE 2WBKA 5CJOH 4L8DB 6FABL 5DFVD 1S7TB 3CSYA 3ECBB 1B2WH 2WBWB 4Z0XA 1FORL 2PTTB 1IRAY 1ZLUK 2XZCL 3TN0C 5ICYA 3HNTL 5HJ3A 4NZJA 1RJLA 3KYOA 4PJHB 4JFEB 4Y5VB 2OK0L 4O00A 5IB3B 3WUZA 3CDCA 5EBMB 1LEIB 1VACB 3MLZL 2YUZA 4U1IA 3TLRA 4WWID 1BJ1J 2A73B 4OF6A 5AD0A 3HUJB 5FECB 1CFQA 3GB7A 4KHXH 4HG4K 3PHSA 3NACL 4MJIE 4X8JA 4ALAL 4HUWB 2YPLA 4K9EH 3ES6A 4YK4B 1TZHB 3GSWA 4R7NB 1FGVH 1OTUC 1WWBX 2MNUA 5ANME 3GBLA 1OAXL 3JWDL 3P40A 4NO0B 4J3UA 3PWJB 4G3YL 4HHAA 3JTTA 2LAAA 3GKWL 5ACZB 4XC1H 5KTEH 1EHAA 4L1HA 4JQIH 2XWTB 3C09C 1CFVL 5D7IB 5JQ6H 4G6ML 1T7WA 2IBBA 5FCSH 3C08L 5CEZD 2UYLA 2ZCKL 5GRWA 2VLKB 1EO8L 1KB5B 5GRYA 2AQ1A 1ZEAL 5FYKH 2MMXA 1K3IA 3QNZB 3V5HA 1PG7W 4ZNEE 1RK1A 1U93A 1L6XA 3GSUA 4XNMB 4DKEH 2ZG2A 2ADFH 1HOCB 2XNAA 1DN2A 3PIQB 4OFKA 2JIXA 4PJEB 1QLEH 5I16B 1LE9B 1W0VB 1VGKA 3QQ4A 3I3BA 5E00A 4N9GB 1CDBA 3DX8B 4PY7B 5FM4A 1ZMYA 3AREB 4OCYL 4POZC 1QSEA 3QULA 1FFQA 4HFWB 3MZTA 3OGCB 5DEGB 2O5XH 1P69B 4AH2A 2GJJA 3H9SA 3BESR 5CBEB 4P2RB 1UZ8A 2KUTA 4PJBA 1C1EL 2GY7B 1J1XH 1OAUL 1WT5C 2VXSH 3OQ3B 3W9EA 1U91A 3H2WA 1F4HA 2P5WB 4N9OB 1N6VA 4Z7VA 1MFDH 2J8UA 3JV4A 2IJ0C 5EBWA 3MX0A 3EJYC 5E9DA 4XMKH 2GTZA 3ZO0A 1PKOA 4I1NB 4UUJA 5F97E 4JFOB 4DVRH 4NWUH 3B6SA 4J3OC 1J7VR 4JE4B 4FQLL 2FO4A 1RZJH 1XCQA 2FHCA 4EIGB 4NUJA 1SJEA 3RZCD 3LS4H 4XPTH 3KPSE 2JELL 3AM8C 1SMAA 1ZA6B 5HDQH 1W0WB 1I8KA 4P23A 2DQFA 1GCFA 3LZFL 4YHOL 3NZ8B 3LRSB 5D1QC 1KXVC 1OPGH 5EOTB 5AZ2L 5EZOH 3QDJA 1MRDH 5T1LB 5IIEA 2NXZB 2VDQL 1IAKB 4M62H 2DS4A 3IU3A 5CIPB 3IDIB 3D3VE 1LP9E 1N2RB 3P30H 3DGGA 5CILL 4N8PA 1M71A 3S34H 5CMAB 4OKDA 4U6VL 2FNBA 1AE6H 3BH9A 4PJAA 5D2NE 4KC3B 5GS1A 1JF5A 4ELKA 2ARJB 3BGMB 2BFVH 2F5AH 5FDYA 4JFDE 4N90E 1CT8A 4F7CB 2DQJH 5DA4A 1H3VA 1II4E 3RHWK 2FB4L 1LK2B 3RL2B 5I8KH 5L2KA 4HCRA 2F58L 4O2FA 4B5EA 3QUZA 4TSCL 1G9EA 1CLOL 1MJ8H 3BVNA 4YWGL 3JVGC 3WMSA 1N4XH 4I2XB 5HY9A 1QFUL 3WD5L 3RVVC 3KXFA 4XRCA 2J2ZA 3WNPA 3DV4A 4QWWC 3ZKND 3RUGA 4K07A 1UJ3B 4PGCA 1EO7A 1F3DH 4G6KL 5F3HA 5E6IC 1LEKB 2OS7A 4DVBB 1GHFL 2HLFC 4AK1A 5BO1L 2DDQH 43CAB 4W70A 4O58L 4JN1L 5BJTA 4XAWL 4LNRB 1ND0B 4O51B 4ODSL 5GGUB 3QZWA 4L9LC 1U2CA 3BH8B 4GAYB 4HX1A 1JHLL 4V1DE 3MRDB 2XWBA 2PXYB 2ESVB 3UTSB 4OF3A 3IXAA 2X4OA 4KTEL 4JHZA 2ZG1A 4ODHL 4Q9QH 5I18H 4I0PB 3S5LB 1MPAH 5DJXB 2JB6A 1OL0A 1ZA3A 2YWYA 4IRSD 3OHXA 4OD1L 5CUSH 3EYQC 3JWDC 4TVPD 4N5ED 4RWYH 3ZE0F 4JLRA 2F9BT 5JOFA 5KZCB 1QQDB 4XVTH 3FKUS 4X4MA 4YPJA 3C5ZD 4OKVA 2J3SA 1FNEB 1LO2L 1CLZL 3QB7C 3O6FC 4Y4KB 5C92A 5FGCB 2EEAA 2Q3AA 2CDFA 3ROLA 1AKJA 3WLWD 4P2QD 5DSCA 2EYSB 4Z7UF 1RZKC 1V5JA 4FQQA 3W0WB 1JGUH 3MOAH 4QXTA 3P77A 4XP9H 2X5PA 4W68A 3DXAD 2GSGA 2HG5B 4YDVB 3OPZH 1U3ZA 3U7YH 1NEZB 1VB9A 5IBTL 3N85H 1FJ1B 3IXTB 3J8F7 5BV7C 1IMHC 5GSRB 4OTXH 5IFAL 1HQ4A 3FQTB 5EO9A 1F90L 4WI5A 4MAUL 5L7XH 3WHXB 2Z35B 5CJXC 2FIKA 4HGWA 2E3VA 3QHZH 1G9NH 3QDMB 4A2MA 5CKAA 5I1GH 5ID1A 1JGVH 1CQKA 2AK4D 3QO1A 1ZLSH 4HKJA 1P7KA 4NBZB 3WUWG 5DO2C 4JANB 5F7LB 1RZGB 5SWSE 4E5XB 3L7EB 2R2CA 3ZE0E 1D5IL 2XRAH 1IAIL 4QGYA 5DRNA 4YO0B 5F70A 5L9DH 3S37H 4IRJA 2CDEA 2AEPH 1KB9K 1J8HA 1OF2B 4YHMH 2ARWA 2OTPA 1JNHB 3SDXB 5JMRA 3VFOA 5C0JA 4FQXD 5TF1H 5EOCH 1CLYH 4CKVX 4HKXA 4Z7UE 2BVPB 2IPUK 5DMKB 2AJZB 1CFTA 1IZJA 1JL8A 1CICD 1X6NA 3WE6A 3IS0X 3LKPB 3U0TB 1GGIH 3W11D 1H5BA 1TIUA 3DURA 3SHSA 4D3CH 4UI2A 3HNSH 1XGRB 1DVFD 4JGUA 4YDJA 3PWVA 2EDFA 5DHYA 3TIEA 3KYKH 2WWMC 3L5WA 5DYOB 3IDJA 2FECL 2J8OA 2YEZA 5LQBH 3QXTA 4MQ7A 4Y16A 1NUNB 4XT1C 2I07B 3WS3A 2DQGH 2DWDB 2YZ8A 2IH3B 2X2YA 5IW1B 1PZ5B 3B9KA 2HN7A 2EE9A 1IKNA 1XCTA 2IMMA 5LAXB 4XX1E 4LARH 5MENE 5IMOA 4XCNA 3EOAA 3U36B 1NGZA 2CO7B 3DSFH 5L8JB 4PLOB 2GSIB 4JZJB 3ULVC 4S0SD 4OZIA 1BVLA 3E0GA 1AQKH 3REWB 4B53A 5SX5H 3QYCA 3BN3B 3DUUB 3IDMA 1IJ9A 1EXUA 1N6QH 1DQJA 2F15A 3VMNA 3IT8D 2D7TH 1YEFH 2HAZA 3S36X 1A9EA 3UC0L 2NW2B 4GBXB 4UV4H 2A74B 3C6LC 4N68A 2UVEA 4HFUH 1WIUA 1QFPA 1BQHB 3QXAA 3DIFB 2QADB 5K9KA 1PLGL 4XHQA 4JM2F 1KULA 1XF3A 5F96L 2B5IB 1HHKA 3WN5C 3HZYA 4IIQA 3NIFE 1JF1B 4P57B 3MO1B 4WI7A 5TQ2L 4UDTA 1T5WB 3L6FB 3WSQH