1B56A

Human recombinant epidermal fatty acid binding protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
b'TVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FATTY ACID BINDING PROTEIN
publication title Expression, purification, and crystal structure determination of recombinant human epidermal-type fatty acid binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 28
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1b56A00
2CZTA 5LJBA 3FMZA 2JOZA 1ZNKA 4AW8A 5HAEA 3NPOA 5D47A 1GXAA 1X8UA 5H9LA 3HK1A 1YWDA 4I9SA 3FLLA 5B27A 2ALLX 4YGZA 2AL0X 5F6ZA 1QY2A 4DQ3A 1CBRA 4D6BA 4ALBA 4GRJA 2L9CA 4EEJA 4I3CA 5H9KA 2OZQA 4OS0A 2WEXA 4OS8A 4GE1A 1ERBA 1I4UA 3B2LA 5B29A 2GC9A 5CE4A 3PH5A 3EBKA 1JBHA 2FS6A 2R74A 4XMDA 3RZYA 4AZPA 1ZNLA 2MO5A 2RD7C 5LJDA 3O22A 4MVKA 1YIVA 1JYDA 4YFPA 1EPBA 4UU3A 5BVTA 1OBUA 4YGGA 1KGLA 4ZHCA 1FENA 1MVGA 1S2PA 2WSJA 1XKIA 1ZNDA 4AZRA 2R73A 1BEBA 1MDCA 1EXSA 1FE3A 2NNEA 3ELXA 3F8AA 1BSOA 1ML7A 4YDAA 3I0AA 2WEWA 2ANSA 1OEEA 2G79A 5IO7A 1A2DA 1BBPA 3C76X 1CRBA 3KFHA 1QG5A 2FR3A 4IB7A 3PH6A 3APVA 1S44A 4GH7A 4PSQA 3BU9A 1QWDA 2K62A 3S26A 1DZJA 3BX8A 4BVMA 5EEDA 2Q9SA 1RLBE 5FENA 1SY1A 2L5PA 3PECA 1KQWA 2G78A 2AT5X 3D96A 2RCQA 5BVSA 4A60A 4ZFXA 5H9NA 1FDQA 5HA0A 1GT5A 1TXLA 2OVEA 1LKEA 1ICNA 3F9DA 3UEXA 3WXQA 3JSQA 4TKBA 5HWZA 3CBCA 4UU2A 5HCDC 3WBGA 1SXUA 4OS3A 4ORXA 3WJGA 1KT6A 4IAWA 3STKA 3NX2A 2RA6A 3KFFA 3IFBA 4YKOA 1I04A 4D6AA 1OBPA 3EYCA 1KT4A 3P6FA 1CBIA 4YH0A 3T1DA 5EPQA 1E02A 1E06A 2X46A 1PEEA 1HN2A 3FA7A 3NQ9A 1EQDA 3PP6A 4TNNA 4DQ4A 1YWAA 1LICA 1DZKA 5KIDA 2CBRA 4TKHA 4EFGA 5H8TA 4XMFA 2FT9A 1U17A 3RSWA 2FRSA 1HMTA 3K3LA 5LJGA 5LJEA 1QABE 1U18A 4NYQA 3P6GA 5LJCA 2PY1A 1X8NA 2HMBA 1ALBA 3HWFA 2KTDA 2LKKA 2XSTA 4ZR2A 2F73A 3U03A 1HBQA 1QY0A 1KQXA 3WJBA 5FAZA 1DF3A 3CR6A 3O2YA 2ASNX 5HBSA 4XMHA 4EDEA 2XKLA 5FFHA 4GNYA 2CBSA 3L4RA 2FR2A 3BLGA 2WQ9A 1IKEA 2EU7X 1QQSA 1KT7A 1BSYA 3UEVA 4GNWA 1LPJA 3MVFA 1GM6A 5D4AA 2ACPX 4TJZA 3NP1A 4MVLA 1OEKA 1T68X 4A8ZA 3U9PC 2OVAA 4QAEA 1PM1X 1GX9A 2FWVA 1A57A 1A18A 1TOUA 4HPDA 5F6BA 3EMMA 4ORSA 3CWKA 4LZVA 4IMNA 4QGXA 2CZUA 1GKAA 3ZUIA 2FTBA 1D2UA 1LIFA 5BVQA 5HZ8A 5KICA 1KZWA 4CK4A 2Q39A 4ZHGA 4R0BA 3VG6A 2QO4A 1AELA 1YP6A 1ACDA 1QFTA 2WUTA 1S7DA 4BQUA 2L68A 1BSQA 1LFOA 1FELA 5HA1A 4Y0SA 5HTEA 2JU8A 4OMWA 4HPCA 2QO6A 4XMGA 1G5WA 1IW2A 4QGVA 5HTDA 3IA8A 2NNDA 2MJIA 2K23A 3JS1A 3NQ3A 3UEUA 1DFVA 1NGLA 3P6EA 1VYGA 2W2AA 1SA8A 3DSZA 3NR3A 3VG5A 4A1YA 1B0OA 5EZ2A 4YBPA 2AT6X 1AVGI 4LZUA 1X8OA 3P6DA 4TLJA 1NP4A 1BLRA 3DTQA 1IKJA 4IB8A 1KZXA 1SY0A 3APXA 1OEJA 2LBAA 2CM9A 1PMPA 1ZRYA 4ZCBA 3BU1A 4IMOA 4RUNA 5AQ6A 4N7DA 3SAOA 4HFOA 4IBAA 3ZUOA 4ZH6A 1TOWA 4XMCA 1DV9A 1YP7A 5LKEA 4NLIA 3B2JA 1KOIA 1A3YA 1SXWA 1SXYA 2HYSA 3UEWA 1OPAA 3KZAA 1GX8A 3B2IA 4ARHA 2GJ5A 4YBUA 2AT8X 3Q6LA 1HMSA 2HLVA 3KQ0A 2OFMX 2L67A 1EIOA 3MBTA 3KFGA 4YFRA 1YWCA 1GKAB 4QZUA 3G7XA 4YMYA 1TW4A 2X45A 1EPAA 3FA9A 2A3FX 4QZTA 2O62A 4NNTA 2QM9A 1GT1A 5F1EA 3B2KA 1YUPA 3TGBA 3AKMA 5F7GA 1IFCA 1LNMA 1O1VA 2P8GA 1R0UA 3HWEA 1B4MA 2KT4B 2DM5A 1BRPA 5D8JA 1CBSA 1EALA 1T8VA 2AT3X 4M7MA 2LBVA 4ODDA 1N0SA 4ZHFA 3BSZE 1E00A 1OPBA 3CQRA 4I3DA 3TF6A 1BM5A 1D3SA 2LFOA 3FEKA 2Q4NA 5HCEC 1DZMA 1CJ5A 3PPTA 3B2HA 2AMMX 4ZHDA 3TZSA 3C78X 2OVDA 2Q2PA 2WWPA 1T0VA 1ZNEA 2IFBA 1U0XA 5EDCA 5HZ9A 2A0AA 2LB6A 3U0DA 3CBSA 1X8PA 1JZUA 4YCHA 1G85A 3PEDA 1JJXA 4N7CA 4NYRA 4BOEA 3FR5A 3AKNA 1O8VA 1YWBA 3VG3A 4AZMA 1EW3A 4EXZA 3FW5A 3HWDA 3P6HA 2G7BA 4YKMA 3WJFA 1SXXA 4WFVA 5C0NA 4Y0PA 3ZQ3A 1FEMA 4HPAA 4ORRA 1I06A 2HNXA 1SY2A 3BRNA 3FR2A 3OJYC 5D45A 3EBWA 2JU3A 1X8QA 1ADLA 4YGHA 1JYJA 5LJKA 2QO5A 1IFBA 3NX1A 4ORUA 3FIQA 1BRQA 5HZQA 4AYHA 3CQNA 5DG4A 5L8NA 1ZNHA 3WJCA 4TQ2A 5L8OA 3KFIA 2WR6A 4YFQA 4TKJA 2E4JA 4NP1A 1GGLA 3BS2A 4IB6A 4KIIA 5DPQA 3NADA 3BX7A 1EIIA 2N93A 1G7NA 4ALOA 3WJDA 1VPRA 3BDRA 4LKPA 4K19A 2A13A 1KT5A 3VG7A 3TGAA 1IIUA 1UREA 4IAXA 4ORYA 3STNA 5HCCC 4QGWA 3QKGA 4OMXA 3FEPA 1HMRA 1Z24A 2FLJA 3FW4A 1E5PA 1DZPA 4AZQA 1I05A 2AKQA 1B8EA 2JU7A 4LKTA 1BJ7A 1CBQA 1FTPA 2HZQA 2AT0X 1JV4A 1PBOA 5EDBA 1LIEA 3WJEA 5HZ5A 4YCEA 2A2GA 3VG4A 5K06A 3APUA 2HZRA 1ERXA 1KXOA 3EM0A 2ACOA 4IB9A 5F58A 4O9SA 3STMX 4XMEA 1AB0A 1DC9A 5D48A 3FA8A 4QYPA 1NP1A 4Y0QA 1QFVA 2BLGA 4ES7A 4ZGUA 2WQAE 2A2UA 5EEEA 2JN3A 4NNSA 5JR8A 3D97A 1AQBA 1HQPA 1MUPA 4MVIA 4I3BA 5IO5A 1TVQA 1BWYA 2AH7X 1JJJA 4HPBA 2FS7A 3WVMA 2CM4A 5IO6A 1X89A 1QY1A 3ELZA 1X71A 5KHPA 5LKFA 5H9AA 2GTFX 5LJHA 4QYNA 1ICMA 4ORWA 2Q2MA 1RBPA 1MX8A 4M6SA 2W2BA 3HWGA 3TGCA 1B56A 4WBKA 3APWA 3O19A 2OFRX 3I17A 3P6CA 1OBQA 2YG2A 4Y0RA 2POAA 2W2FA 1VYFA 2NNQA 1L6MA 1LF7A 1XCAA 4I9RA 4NLJA 4ZH9A 2R56A 4WFUA 3FENA 1GT4A 5L8IA 3C77X 4RUUA 4ZHHA 1UZ2X 2RQ0A 3BY0A 4AZNA 3D95A 2MM3A 5HZ6A 1LIDA 3FA6A 1H91A 4A1HA 4AZOA 3CMPA 1EUOA 1P6PA 4GKCA 2QOSC 3VG2A 4YDBA 2NP1A 1G74A 4ZJ0A 1GT3A 1HBPA 1LIBA 1KT3A 1SY3A 1ZNGA 3GAQA 4GETA 1MX7A 3FR4A 1O1UA 2RCTA 3FELA
chains in the Genus database with same CATH superfamily
2CZTA 5LJBA 1N43A 3FMZA 2JOZA 1ZNKA 1KL4A 4AW8A 4GJSA 5CYBA 1Y53X 5HAEA 3NPOA 4B55A 1UYOX 1VWFB 1GXAA 4QQ1A 5D47A 1X8UA 4KCAA 5H9LA 3HK1A 1YWDA 4I9SA 3FLLA 5B27A 3RDSA 1NBXA 2ALLX 4YGZA 2AL0X 2IZDB 1SWDA 5F6ZA 1QY2A 3MX7A 4DQ3A 1CBRA 1VWHB 3ZW0B 4ALBA 4GRJA 2L9CA 4D6BA 4C5PA 3F6ZB 2X8FA 1LCVA 2X34A 2ZAIA 4EEJA 4I3CA 5B5FA 5H9KA 1SLFB 2OZQA 2RTMA 4OS0A 2WEXA 3HTYA 4OS8A 4GE1A 4O49A 1K24A 1ERBA 1I4UA 3B2LA 1PTSA 5B29A 1KFFA 2GC9A 5CE4A 1VWIB 3PH5A 3VGWA 3EBKA 1JBHA 2FS6A 2R74A 4CSBA 4XMDA 3RZYA 4AZPA 1ZNLA 1RAVA 2MO5A 2QOMA 2RD7C 4OEMA 3O22A 5LJDA 2FKGA 4MVKA 3WZOA 1SRJA 1YIVA 1JYDA 4YFPA 2PI3O 3ZZVA 1EPBA 2BS6A 4UU3A 5BVTA 1OBUA 4YGGA 3LV4A 1KGLA 4ZHCA 1FENA 1MVGA 2A8GA 2IZIA 5FQ6E 1S2PA 4MISA 1N9YA 1XKIA 2WSJA 4U3QA 4ZGFA 1ZNDA 2GTLN 4FGIB 2R73A 1BEBA 1MDCA 4AZRA 1EXSA 1FE3A 2NNEA 3ELXA 3F8AA 1BSOA 1ML7A 4JGLA 4YDAA 4BX6A 3I0AA 3VHIA 2WEWA 1SWBA 4QNIA 2ANSA 1OEEA 1SLGB 2G79A 2IZJA 1A2DA 3P02A 5IO7A 1BBPA 3C76X 1CRBA 1SWCA 2Z4HA 3KFHA 1QG5A 2FR3A 4IB7A 3PH6A 2IZGB 1S44A 3APVA 4GH7A 4PSQA 1RSUB 3BU9A 1QWDA 2K62A 1AVEA 1RSTB 3S26A 1DZJA 4L3RA 4BX5A 3BX8A 4BVMA 4FBRA 5EEDA 1SRGA 2Q9SA 1RLBE 5FENA 1SY1A 2L5PA 3PECA 1KQWA 2G78A 2AT5X 3SLJA 3QQ2A 4U9CA 3D96A 5L3YA 2RCQA 2OFBA 5BVSA 4A60A 4ZFXA 2RTOB 5H9NA 1FDQA 1N9MA 2F09A 2ZAGA 5CHKA 5HA0A 1GT5A 1TXLA 2IZBA 2OVEA 1E2TA 1LKEA 1ICNA 3F9DA 3UEXA 3WXQA 3JSQA 4TKBA 5HWZA 3CBCA 4UU2A 5HCDC 3WBGA 1SXUA 4OS3A 4ORXA 3WJGA 1KT6A 4IAWA 3STKA 1VYOA 5CSEA 1LDOA 2RA6A 3KFFA 3NX2A 4ML7B 2X56A 4Y5DA 3IFBA 3PDFA 4YKOA 1I04A 4D6AA 5AJBA 3ZW1A 3SOTA 4CDDA 1OBPA 3EYCA 2AVIA 1KT4A 2A5CA 2BS5A 2FGSA 2RTIB 3P6FA 3S5XA 3VE1A 1CBIA 4YH0A 3T1DA 5EPQA 1E02A 2G5LA 1E06A 2X46A 1GX3A 1HN2A 2IZEB 1PEEA 3FA7A 3NQ9A 1EQDA 3EW2A 3PP6A 2GH7A 2RTCB 4U8UN 4GUZA 4TNNA 1SWEA 4JNJA 4DQ4A 1VWEB 1YWAA 2C1QA 1LICA 1DZKA 4Y59A 2MF6A 4EQAC 4Z2PA 5KIDA 2CBRA 4TKHA 4EFGA 1FJ1E 1MM9A 1VWBB 3OE3A 2FT9A 1U17A 4XMFA 5H8TA 3RSWA 2FRSA 3WOVA 1HMTA 3K3LA 5LJGA 5LJEA 1HQQA 1QABE 3SLOA 3WZNA 1U18A 4NYQA 2OF9A 4GU8A 3KVNA 5JD2A 3P6GA 4O3ZA 4CDFA 1VWMB 3RE6A 3WZQA 5LJCA 2FKJA 1NC9A 2PY1A 1X8NA 4GGRA 2HMBA 1ALBA 3HWFA 4BX6B 2C1SA 3NQKA 2KTDA 2LKKA 2XSTA 4U8UO 4ZR2A 2F73A 4WHIA 1KL3A 3U03A 1HBQA 1N4JA 1QY0A 3T2WA 5HCCC 1KQXA 3VHHA 5FAZA 3WJBA 2OY5O 4BBOA 3CR6A 2JW1A 4MEEA 3O2YA 1DF3A 2ASNX 5HBSA 4XMHA 3VE2A 2XKLA 2RTQB 5FFHA 4EDEA 2JMBA 4GNYA 3WYQA 2CBSA 3L4RA 1N7YA 2FR2A 1SLDB 3BLGA 4Z2VA 2WQ9A 1IKEA 3JQOA 2EU7X 2IZCB 4QRLA 5B3MO 4BX5B 1QQSA 1LDQA 3RBYA 1KT7A 1BSYA 3UEVA 5IRAA 3ZI8A 4GNWA 1LPJA 3MVFA 1GM6A 5D4AA 2ACPX 4KC7A 4TJZA 1JMZA 3NP1A 4GDAA 5IRUA 3RY2A 4MVLA 1OEKA 1VWDB 1T68X 1SWAA 3V8UA 4A8ZA 3U9PC 2OVAA 1WBIA 4QAEA 1PM1X 1GX9A 4Z2OA 2FWVA 3MG5A 2DJFA 1A57A 1A18A 1TOUA 4HPDA 5F6BA 1RXHA 3EMMA 4GGTA 4ORSA 4CDEA 2X55A 2HKDA 4O4UA 3SLTA 3CWKA 4BCSA 4LZVA 2BSZA 4IMNA 4QGXA 2CZUA 1GKAA 4O3WA 3ZUIA 4O4XA 2FTBA 1WUBA 2GTLM 1HY2A 1PBYA 1SMPI 1SWOA 1D2UA 1LIFA 5BVQA 3ZW1B 5HZ8A 5KICA 4CK4A 2Q39A 4ZHGA 3T6FA 1KZWA 4R0BA 2RTJA 2CAMA 3VG6A 1AVDA 4FBVA 2QO4A 3S60A 1AELA 1YP6A 3PQUA 2RTPB 2MWHA 1ACDA 1QFTA 1Y0GA 2WUTA 3HPEA 1S7DA 4GDZA 4BQUA 2L68A 1BSQA 2X8SA 1LFOA 2UZ2A 1FELA 1VWPB 5HA1A 1SREA 4Y0SA 5HTEA 2JU8A 4OMWA 4HPCA 3T6LA 2QO6A 4YVBA 4XMGA 2KD2A 2X32A 1IW2A 1G5WA 4MIRA 1Y52X 4QGVA 5HTDA 3D9WA 4EKVA 3IA8A 2NNDA 1UYNX 2RTFB 2MJIA 2K23A 3JS1A 3NQ3A 3UEUA 2OVSA 1DFVA 1IJ8A 1NGLA 3SZHA 3P6EA 1VYGA 2W2AA 4ON1A 1SA8A 2A5BA 3DSZA 3NR3A 4NW4A 2OY7A 1B0OA 3VG5A 5EZ2A 3VHMA 4A1YA 4YBPA 2AT6X 1AVGI 4LZUA 1X8OA 3P6DA 4TLJA 1MEPA 1NP4A 1STRB 1BLRA 3DTQA 1IKJA 4IB8A 2C4IA 1KZXA 1SY0A 3APXA 5FQ8E 1OEJA 2LBAA 2CM9A 1PMPA 2IZAA 1ZRYA 4ZCBA 3BU1A 4IMOA 4RUNA 5BYPA 4NV7A 5AQ6A 1LCZA 4N7DA 3SAOA 4HFOA 2RTHB 4I6SA 4IBAA 3ZUOA 1VWAB 1TOWA 4ZH6A 1SWRA 2OL6O 4XMCA 1DV9A 4KH8A 1YP7A 5LKEA 2VFBA 4NLIA 2MHDA 2ZSCA 3B2JA 1KOIA 1A3YA 1SXWA 2X4MA 1SXYA 2HYSA 4DCBA 3UEWA 1OPAA 3KZAA 1GX8A 3B2IA 4ARHA 2GJ5A 4YBUA 2AT8X 3Q6LA 3FDCA 1RXJA 1SRHA 1VWGB 1HMSA 2HLVA 2Y3EA 3KQ0A 2OFMX 1SWUA 4O3YA 2L67A 1EIOA 3MBTA 3KFGA 2RTKA 2RN4A 4YFRA 1YWCA 1GKAB 1VWNB 2X8TA 3G7XA 4QZUA 4YMYA 5B5GA 1VWQB 1TW4A 2X45A 1EPAA 3FA9A 2A3FX 1NQMA 2O62A 4NNTA 2QM9A 4FQBB 4QZTA 4COTA 1GT1A 4KC8A 4PJ2A 5F1EA 4BX7A 3B2KA 1YUPA 3TGBA 3AKMA 5F7GA 1IFCA 1LNMA 1O1VA 2P8GA 1R0UA 3HWEA 3LTWA 1B4MA 2KT4B 2DM5A 1BRPA 5D8JA 1CBSA 1EALA 1T8VA 2Y32A 4O4SA 1SWLA 2AT3X 5IRWA 2IZLB 4M7MA 2VDFA 2LBVA 2OYBO 4ODDA 1N0SA 4ZHFA 3BSZE 3HOEA 4CDCA 1E00A 1OPBA 3CQRA 4I3DA 3TF6A 1BM5A 3S5VA 1D3SA 2LFOA 1Y55X 3FEKA 4OELA 2F01A 1SWSA 2Q4NA 3LHNA 3Q34A 1SWTA 2RTAA 2OY8A 5HCEC 2UYWA 1DZMA 1CJ5A 3PPTA 2IZFB 1STSB 3B2HA 2AMMX 4ZHDA 1W5RA 3TZSA 3C78X 2OVDA 5AJCA 1KL5A 2Q2PA 2VFCA 1NQNA 2WWPA 1RXKA 1SWJA 1T0VA 1NDJA 2FHLA 1ZNEA 2IFBA 1U0XA 2RTBB 5EDCA 5HZ9A 2A0AA 2QMIA 2LB6A 3MM0A 4INNA 3U0DA 1EI5A 2RTGB 3CBSA 1X8PA 1JZUA 3RDXA 1W4TA 3HOLA 1G85A 2RTNB 3PEDA 4YCHA 1JJXA 1VWJB 4N7CA 4NYRA 4BOEA 2KTSA 3FR5A 4Z6JA 2M4LA 3AKNA 1O8VA 1SWGA 1YWBA 1SWFA 3VG3A 4AZMA 1EW3A 4EXZA 3FW5A 3HWDA 3P6HA 2G7BA 4YKMA 3WJFA 1SXXA 4WFVA 3D4RA 5C0NA 4Y0PA 3ZQ3A 1FEMA 4HPAA 4ORRA 1I06A 2HNXA 1SY2A 3BRNA 3FR2A 3OJYC 4GK9A 5D45A 3EBWA 2JU3A 1X8QA 1ADLA 4YGHA 1JYJA 3UAQA 5LJKA 3P24A 2OFAA 2QO5A 1IFBA 1STPA 3N91A 3NX1A 4ORUA 4CPIA 3FIQA 1BRQA 5HZQA 1HXLA 1W6FA 4I95A 4AYHA 3CQNA 4CPHA 3PK2A 4LQZA 5DG4A 4CV7A 5L8NA 1ZNHA 3WJCA 4IABA 4TQ2A 2JGSA 5L8OA 3VU1A 3KFIA 1HXZA 1SLEB 2WR6A 4YFQA 4TKJA 4FBOA 4Z28A 3AUMO 1OSPO 2E4JA 4NP1A 1GGLA 3BS2A 4IB6A 2OF8A 4KIIA 5DPQA 4BX7B 1SWPA 3NADA 4ID2A 3BX7A 4O3XB 1EIIA 2N93A 1G7NA 3T2XA 4ALOA 3WJDA 1VPRA 3BDRA 1VWRB 2FHNX 2OY1O 4LKPA 3RDMA 4L1NA 1SWKA 4K19A 2A13A 1KT5A 3VG7A 3TGAA 1IIUA 1JQPA 1UREA 4IAXA 4ORYA 4U46A 4QGWA 1I9HA 3STNA 3ZW2A 3QKGA 4GJVA 1SWQA 4OMXA 5B11O 4GD9A 1LCWA 2I5ZO 3FEPA 1HMRA 4CPEA 4I60A 1Z24A 2FLJA 4DNEA 3FW4A 1E5PA 1DZPA 4AZQA 1I05A 2AKQA 1B8EA 2JU7A 4LKTA 1BJ7A 1CBQA 1FTPA 2HZQA 4GGZA 2AT0X 1JV4A 1PBOA 5EDBA 3EC5A 1LIEA 3AEHA 3VPJE 3WJEA 5HZ5A 4YCEA 1Y9LA 2A2GA 3RDOA 3WYPA 3CKGA 3VG4A 5K06A 3APUA 2HZRA 1DF8A 4BGFA 1ERXA 1KXOA 3EM0A 2Z4IA 2ACOA 4IB9A 5F58A 3RWXA 4O9SA 5AEOA 3STMX 4XMEA 5K68A 3CKFA 1AB0A 1DC9A 2GTLO 3FA8A 4QYPA 1NP1A 4Y0QA 1QFVA 2BLGA 5D48A 4ES7A 4ZGUA 2WQAE 2A2UA 2I5VO 2JN3A 4GZVA 5EEEA 1SWNA 4U8UM 1VWLB 2QCBA 2RTDB 2YMSA 4NNSA 5JR8A 2BC3A 3D97A 2IZHB 2LA7A 5F2BA 3ZW0A 1AQBA 1HQPA 1MUPA 4MVIA 4I3BA 3RY1A 5IO5A 1SWHA 1JMXA 3FYFA 3X00A 3WZPA 1TVQA 1BWYA 2AH7X 2OL8O 1JJJA 1JIWI 2FS7A 4HPBA 2WPUA 3WVMA 4Z27A 2CM4A 5IO6A 1X89A 1QY1A 3ELZA 1X71A 3RDQA 1MK5A 3OBLA 5KHPA 1LELA 1JJUA 5LKFA 5H9AA 2GTFX 2IZKA 5LJHA 2BHVA 3PQSA 4QYNA 1ICMA 4JO6A 4ORWA 2Q2MA 4CPHB 3EW1A 1RBPA 1MX8A 4M6SA 3ZWEA 2W2BA 3HWGA 3TGCA 1B56A 4WBKA 3RKGA 3APWA 3O19A 2OFRX 3I17A 4JHQA 3P6CA 3RDUA 4CPFA 1SRFA 5FQ7E 3NBXX 1OBQA 2YG2A 3GE2A 3RE5A 1MOYA 4Y0RA 2RTEB 2POAA 2W2FA 1VYFA 2NNQA 4IRWA 2RTLA 1L6MA 1LF7A 1XCAA 4I9RA 4NLJA 5K67A 4ZH9A 2R56A 2Y3FA 1K3BA 4WFUA 4BJ8A 2DJGA 1GT4A 2KW1A 3FENA 4HWMA 3C77X 4OKAA 5L8IA 4RUUA 5IXGA 1LUQA 2AF5A 3OD9A 4ZHHA 4KT5A 4O4OA 1UZ2X 2RQ0A 3BY0A 4AZNA 3D95A 2MM3A 2OL7A 3H3IA 5HZ6A 1LIDA 3FA6A 3SZJA 1H91A 1Y9TA 4A1HA 1I78A 4AZOA 5B10O 3CMPA 3SZIA 1VWCB 1EUOA 1P6PA 4GKCA 5B2AO 2QOSC 3VG2A 1VWOB 1VWKB 2BT9A 1G74A 2NP1A 4YDBA 4MVEA 4ZJ0A 4NV8A 1GT3A 1HBPA 1LIBA 1KT3A 1SY3A 1ZNGA 2RTRB 3E3CA 3GAQA 1MX7A 2G8CO 3FR4A 1SRIA 4GETA 1O1UA 2RCTA 3FELA 3FIDA
chains in the Genus database with same CATH topology
2CZTA 5LJBA 3FMZA 2JOZA 1ZNKA 4AW8A 5CYBA 5HAEA 3NPOA 5D47A 1GXAA 4QQ1A 1X8UA 4KCAA 5H9LA 3HK1A 1YWDA 4I9SA 3FLLA 5B27A 2ALLX 4YGZA 2AL0X 5F6ZA 1QY2A 3MX7A 4DQ3A 1CBRA 3ZW0B 4ALBA 4D6BA 4GRJA 2L9CA 3F6ZB 2X8FA 2ZAIA 4EEJA 4I3CA 5H9KA 2OZQA 4OS0A 2WEXA 3HTYA 4OS8A 4GE1A 4O49A 1ERBA 1I4UA 3B2LA 5B29A 2GC9A 5CE4A 3PH5A 3EBKA 1JBHA 2FS6A 2R74A 4CSBA 4XMDA 3RZYA 4AZPA 1ZNLA 2MO5A 2RD7C 5LJDA 3O22A 4MVKA 1YIVA 1JYDA 4YFPA 3ZZVA 1EPBA 2BS6A 4UU3A 5BVTA 1OBUA 4YGGA 3LV4A 1KGLA 4ZHCA 1FENA 1MVGA 5FQ6E 1S2PA 4MISA 2WSJA 1XKIA 4ZGFA 4U3QA 1ZNDA 2GTLN 4FGIB 2R73A 1BEBA 1MDCA 4AZRA 1EXSA 1FE3A 2NNEA 3ELXA 3F8AA 1BSOA 1ML7A 4JGLA 4YDAA 3I0AA 2WEWA 4QNIA 2ANSA 1OEEA 2G79A 5IO7A 1A2DA 3P02A 1BBPA 3C76X 1CRBA 2Z4HA 3KFHA 1QG5A 2FR3A 4IB7A 3PH6A 3APVA 1S44A 4GH7A 4PSQA 3BU9A 1QWDA 2K62A 3S26A 1DZJA 4L3RA 3BX8A 4BVMA 4FBRA 5EEDA 2Q9SA 1RLBE 5FENA 1SY1A 2L5PA 3PECA 1KQWA 2G78A 2AT5X 4U9CA 3D96A 2RCQA 5BVSA 4A60A 4ZFXA 5H9NA 1FDQA 2F09A 2ZAGA 5HA0A 1GT5A 1TXLA 2OVEA 1LKEA 1ICNA 3F9DA 3UEXA 3WXQA 3JSQA 4TKBA 5HWZA 3CBCA 4UU2A 5HCDC 3WBGA 1SXUA 4OS3A 4ORXA 3WJGA 1KT6A 4IAWA 3STKA 3NX2A 2RA6A 3KFFA 4ML7B 3IFBA 4YKOA 1I04A 4D6AA 5AJBA 3ZW1A 3SOTA 1OBPA 3EYCA 2BS5A 1KT4A 3P6FA 3S5XA 3VE1A 1CBIA 4YH0A 3T1DA 5EPQA 1E02A 1E06A 2X46A 1PEEA 1HN2A 3FA7A 3NQ9A 1EQDA 3PP6A 4U8UN 4TNNA 4DQ4A 4EQAC 1YWAA 1LICA 1DZKA 5KIDA 2CBRA 4TKHA 4EFGA 5H8TA 3OE3A 4XMFA 2FT9A 1U17A 3RSWA 3WOVA 2FRSA 1HMTA 3K3LA 5LJGA 5LJEA 1QABE 1U18A 4NYQA 4GU8A 3P6GA 4O3ZA 5LJCA 2PY1A 1X8NA 2HMBA 1ALBA 3HWFA 3NQKA 2KTDA 2LKKA 2XSTA 4U8UO 4ZR2A 2F73A 4WHIA 3U03A 1HBQA 1QY0A 1KQXA 3WJBA 5FAZA 1DF3A 3CR6A 2JW1A 3O2YA 2ASNX 5HBSA 4XMHA 3VE2A 2XKLA 5FFHA 4EDEA 2JMBA 4GNYA 2CBSA 3L4RA 2FR2A 3BLGA 2WQ9A 1IKEA 3JQOA 2EU7X 4QRLA 1QQSA 3RBYA 1KT7A 1BSYA 3UEVA 3ZI8A 4GNWA 1LPJA 3MVFA 1GM6A 5D4AA 2ACPX 4KC7A 4TJZA 3NP1A 4MVLA 1OEKA 1T68X 3V8UA 4A8ZA 3U9PC 2OVAA 4QAEA 1PM1X 1GX9A 2FWVA 1A57A 1A18A 1TOUA 4HPDA 5F6BA 3EMMA 4ORSA 4O4UA 3CWKA 4LZVA 4IMNA 4QGXA 2CZUA 1GKAA 4O3WA 3ZUIA 4O4XA 2FTBA 2GTLM 1SMPI 1D2UA 1LIFA 5BVQA 3ZW1B 5HZ8A 5KICA 4CK4A 2Q39A 4ZHGA 1KZWA 4R0BA 3VG6A 4FBVA 2QO4A 3S60A 1AELA 1YP6A 3PQUA 2MWHA 1ACDA 1QFTA 4GDZA 2WUTA 1S7DA 4BQUA 2L68A 1BSQA 2X8SA 1LFOA 1FELA 5HA1A 4Y0SA 5HTEA 2JU8A 4OMWA 4HPCA 2QO6A 4XMGA 2KD2A 1G5WA 1IW2A 4MIRA 4QGVA 5HTDA 3IA8A 2NNDA 2MJIA 2K23A 3JS1A 3NQ3A 3UEUA 2OVSA 1DFVA 1NGLA 3P6EA 1VYGA 2W2AA 4ON1A 1SA8A 3DSZA 3NR3A 4NW4A 3VG5A 4A1YA 1B0OA 5EZ2A 4YBPA 2AT6X 1AVGI 4LZUA 1X8OA 3P6DA 4TLJA 1NP4A 1BLRA 3DTQA 1IKJA 4IB8A 1KZXA 1SY0A 3APXA 5FQ8E 1OEJA 2LBAA 2CM9A 1PMPA 1ZRYA 4ZCBA 3BU1A 4IMOA 4RUNA 5BYPA 5AQ6A 4N7DA 3SAOA 4HFOA 4I6SA 4IBAA 3ZUOA 4ZH6A 1TOWA 4XMCA 1DV9A 4KH8A 1YP7A 5LKEA 4NLIA 2MHDA 3B2JA 1KOIA 1A3YA 1SXWA 1SXYA 2HYSA 3UEWA 1OPAA 3KZAA 1GX8A 3B2IA 4ARHA 2GJ5A 4YBUA 2AT8X 3Q6LA 1HMSA 2HLVA 3KQ0A 2OFMX 4O3YA 2L67A 1EIOA 3MBTA 3KFGA 2RN4A 4YFRA 1YWCA 1GKAB 2X8TA 3G7XA 4QZUA 4YMYA 1TW4A 2X45A 1EPAA 3FA9A 2A3FX 4QZTA 2O62A 4NNTA 2QM9A 4FQBB 4COTA 1GT1A 4KC8A 4PJ2A 5F1EA 3B2KA 1YUPA 3TGBA 3AKMA 5F7GA 2P8GA 1IFCA 1LNMA 1O1VA 1R0UA 3HWEA 1B4MA 2KT4B 2DM5A 1BRPA 5D8JA 1CBSA 1EALA 1T8VA 4O4SA 2AT3X 4M7MA 2LBVA 4ODDA 1N0SA 4ZHFA 3BSZE 3HOEA 1E00A 1OPBA 3CQRA 4I3DA 3TF6A 1BM5A 3S5VA 1D3SA 2LFOA 3FEKA 3LHNA 2Q4NA 5HCEC 1DZMA 1CJ5A 3PPTA 3B2HA 2AMMX 4ZHDA 3TZSA 3C78X 2OVDA 5AJCA 2Q2PA 2WWPA 1T0VA 1ZNEA 2IFBA 1U0XA 5EDCA 5HZ9A 2A0AA 2QMIA 2LB6A 4INNA 3U0DA 1EI5A 3CBSA 1X8PA 1JZUA 3HOLA 1G85A 4YCHA 3PEDA 1JJXA 4N7CA 4NYRA 4BOEA 2KTSA 3FR5A 2M4LA 3AKNA 1O8VA 1YWBA 3VG3A 4AZMA 1EW3A 4EXZA 3FW5A 3HWDA 3P6HA 2G7BA 4YKMA 3WJFA 1SXXA 4WFVA 3D4RA 5C0NA 4Y0PA 3ZQ3A 1FEMA 4HPAA 4ORRA 1I06A 2HNXA 1SY2A 3BRNA 3FR2A 3OJYC 4GK9A 5D45A 3EBWA 2JU3A 1X8QA 1ADLA 4YGHA 1JYJA 3UAQA 5LJKA 3P24A 2QO5A 1IFBA 3NX1A 3N91A 4ORUA 3FIQA 1BRQA 5HZQA 4I95A 4AYHA 3CQNA 4LQZA 5DG4A 4CV7A 5L8NA 1ZNHA 3WJCA 4IABA 4TQ2A 5L8OA 3VU1A 3KFIA 2WR6A 4YFQA 4TKJA 4FBOA 2E4JA 4NP1A 1GGLA 3BS2A 4IB6A 4KIIA 5DPQA 3NADA 4ID2A 3BX7A 4O3XB 1EIIA 2N93A 1G7NA 4ALOA 3WJDA 1VPRA 3BDRA 4LKPA 4L1NA 4K19A 2A13A 1KT5A 3VG7A 3TGAA 1IIUA 1UREA 4IAXA 4ORYA 3STNA 5HCCC 4QGWA 3ZW2A 3QKGA 4OMXA 3FEPA 1HMRA 1Z24A 2FLJA 3FW4A 1E5PA 1DZPA 4AZQA 1I05A 2AKQA 1B8EA 2JU7A 4LKTA 1BJ7A 1CBQA 1FTPA 2HZQA 2AT0X 1JV4A 1PBOA 5EDBA 1LIEA 3VPJE 3WJEA 5HZ5A 4YCEA 1Y9LA 2A2GA 3VG4A 5K06A 3APUA 2HZRA 1ERXA 1KXOA 3EM0A 2Z4IA 2ACOA 4IB9A 5F58A 3RWXA 4O9SA 5AEOA 3STMX 4XMEA 1AB0A 1DC9A 2GTLO 3FA8A 4QYPA 1NP1A 4Y0QA 1QFVA 2BLGA 5D48A 4ES7A 4ZGUA 2WQAE 2A2UA 4GZVA 2JN3A 5EEEA 4U8UM 4NNSA 5JR8A 2YMSA 3D97A 2LA7A 3ZW0A 1AQBA 1HQPA 1MUPA 4MVIA 4I3BA 5IO5A 3FYFA 1TVQA 1BWYA 2AH7X 1JJJA 1JIWI 2FS7A 4HPBA 3WVMA 2CM4A 5IO6A 1X89A 1QY1A 3ELZA 1X71A 5KHPA 3OBLA 5LKFA 5H9AA 2GTFX 5LJHA 2BHVA 3PQSA 4QYNA 1ICMA 4ORWA 2Q2MA 1RBPA 1MX8A 4M6SA 3ZWEA 2W2BA 3HWGA 3TGCA 1B56A 4WBKA 3RKGA 3APWA 3O19A 2OFRX 3I17A 3P6CA 5FQ7E 3NBXX 1OBQA 2YG2A 3GE2A 4Y0RA 2POAA 2W2FA 1VYFA 2NNQA 1L6MA 1LF7A 1XCAA 4I9RA 4NLJA 4ZH9A 2R56A 4WFUA 3FENA 1GT4A 2KW1A 5L8IA 4HWMA 3C77X 4RUUA 3OD9A 4ZHHA 4KT5A 4O4OA 1UZ2X 2RQ0A 3BY0A 4AZNA 3D95A 2MM3A 5HZ6A 3H3IA 1LIDA 3FA6A 1H91A 1Y9TA 4A1HA 4AZOA 3CMPA 1EUOA 1P6PA 4GKCA 2QOSC 3VG2A 4YDBA 2BT9A 1G74A 2NP1A 4MVEA 4ZJ0A 1GT3A 1HBPA 1LIBA 1KT3A 1SY3A 1ZNGA 3E3CA 3GAQA 4GETA 1MX7A 3FR4A 1O1UA 2RCTA 3FELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZT A;  5LJB A;  3FMZ A;  2JOZ A;  1ZNK A;  4AW8 A;  5HAE A;  3NPO A;  5D47 A;  1GXA A;  1X8U A;  5H9L A;  3HK1 A;  1YWD A;  4I9S A;  3FLL A;  5B27 A;  2ALL X;  4YGZ A;  2AL0 X;  5F6Z A;  1QY2 A;  4DQ3 A;  1CBR A;  4D6B A;  4ALB A;  4GRJ A;  2L9C A;  4EEJ A;  4I3C A;  5H9K A;  2OZQ A;  4OS0 A;  2WEX A;  4OS8 A;  4GE1 A;  1ERB A;  1I4U A;  3B2L A;  5B29 A;  2GC9 A;  5CE4 A;  3PH5 A;  3EBK A;  1JBH A;  2FS6 A;  2R74 A;  4XMD A;  3RZY A;  4AZP A;  1ZNL A;  2MO5 A;  2RD7 C;  5LJD A;  3O22 A;  4MVK A;  1YIV A;  1JYD A;  4YFP A;  1EPB A;  4UU3 A;  5BVT A;  1OBU A;  4YGG A;  1KGL A;  4ZHC A;  1FEN A;  1MVG A;  1S2P A;  2WSJ A;  1XKI A;  1ZND A;  4AZR A;  2R73 A;  1BEB A;  1MDC A;  1EXS A;  1FE3 A;  2NNE A;  3ELX A;  3F8A A;  1BSO A;  1ML7 A;  4YDA A;  3I0A A;  2WEW A;  2ANS A;  1OEE A;  2G79 A;  5IO7 A;  1A2D A;  1BBP A;  3C76 X;  1CRB A;  3KFH A;  1QG5 A;  2FR3 A;  4IB7 A;  3PH6 A;  3APV A;  1S44 A;  4GH7 A;  4PSQ A;  3BU9 A;  1QWD A;  2K62 A;  3S26 A;  1DZJ A;  3BX8 A;  4BVM A;  5EED A;  2Q9S A;  1RLB E;  5FEN A;  1SY1 A;  2L5P A;  3PEC A;  1KQW A;  2G78 A;  2AT5 X;  3D96 A;  2RCQ A;  5BVS A;  4A60 A;  4ZFX A;  5H9N A;  1FDQ A;  5HA0 A;  1GT5 A;  1TXL A;  2OVE A;  1LKE A;  1ICN A;  3F9D A;  3UEX A;  3WXQ A;  3JSQ A;  4TKB A;  5HWZ A;  3CBC A;  4UU2 A;  5HCD C;  3WBG A;  1SXU A;  4OS3 A;  4ORX A;  3WJG A;  1KT6 A;  4IAW A;  3STK A;  3NX2 A;  2RA6 A;  3KFF A;  3IFB A;  4YKO A;  1I04 A;  4D6A A;  1OBP A;  3EYC A;  1KT4 A;  3P6F A;  1CBI A;  4YH0 A;  3T1D A;  5EPQ A;  1E02 A;  1E06 A;  2X46 A;  1PEE A;  1HN2 A;  3FA7 A;  3NQ9 A;  1EQD A;  3PP6 A;  4TNN A;  4DQ4 A;  1YWA A;  1LIC A;  1DZK A;  5KID A;  2CBR A;  4TKH A;  4EFG A;  5H8T A;  4XMF A;  2FT9 A;  1U17 A;  3RSW A;  2FRS A;  1HMT A;  3K3L A;  5LJG A;  5LJE A;  1QAB E;  1U18 A;  4NYQ A;  3P6G A;  5LJC A;  2PY1 A;  1X8N A;  2HMB A;  1ALB A;  3HWF A;  2KTD A;  2LKK A;  2XST A;  4ZR2 A;  2F73 A;  3U03 A;  1HBQ A;  1QY0 A;  1KQX A;  3WJB A;  5FAZ A;  1DF3 A;  3CR6 A;  3O2Y A;  2ASN X;  5HBS A;  4XMH A;  4EDE A;  2XKL A;  5FFH A;  4GNY A;  2CBS A;  3L4R A;  2FR2 A;  3BLG A;  2WQ9 A;  1IKE A;  2EU7 X;  1QQS A;  1KT7 A;  1BSY A;  3UEV A;  4GNW A;  1LPJ A;  3MVF A;  1GM6 A;  5D4A A;  2ACP X;  4TJZ A;  3NP1 A;  4MVL A;  1OEK A;  1T68 X;  4A8Z A;  3U9P C;  2OVA A;  4QAE A;  1PM1 X;  1GX9 A;  2FWV A;  1A57 A;  1A18 A;  1TOU A;  4HPD A;  5F6B A;  3EMM A;  4ORS A;  3CWK A;  4LZV A;  4IMN A;  4QGX A;  2CZU A;  1GKA A;  3ZUI A;  2FTB A;  1D2U A;  1LIF A;  5BVQ A;  5HZ8 A;  5KIC A;  1KZW A;  4CK4 A;  2Q39 A;  4ZHG A;  4R0B A;  3VG6 A;  2QO4 A;  1AEL A;  1YP6 A;  1ACD A;  1QFT A;  2WUT A;  1S7D A;  4BQU A;  2L68 A;  1BSQ A;  1LFO A;  1FEL A;  5HA1 A;  4Y0S A;  5HTE A;  2JU8 A;  4OMW A;  4HPC A;  2QO6 A;  4XMG A;  1G5W A;  1IW2 A;  4QGV A;  5HTD A;  3IA8 A;  2NND A;  2MJI A;  2K23 A;  3JS1 A;  3NQ3 A;  3UEU A;  1DFV A;  1NGL A;  3P6E A;  1VYG A;  2W2A A;  1SA8 A;  3DSZ A;  3NR3 A;  3VG5 A;  4A1Y A;  1B0O A;  5EZ2 A;  4YBP A;  2AT6 X;  1AVG I;  4LZU A;  1X8O A;  3P6D A;  4TLJ A;  1NP4 A;  1BLR A;  3DTQ A;  1IKJ A;  4IB8 A;  1KZX A;  1SY0 A;  3APX A;  1OEJ A;  2LBA A;  2CM9 A;  1PMP A;  1ZRY A;  4ZCB A;  3BU1 A;  4IMO A;  4RUN A;  5AQ6 A;  4N7D A;  3SAO A;  4HFO A;  4IBA A;  3ZUO A;  4ZH6 A;  1TOW A;  4XMC A;  1DV9 A;  1YP7 A;  5LKE A;  4NLI A;  3B2J A;  1KOI A;  1A3Y A;  1SXW A;  1SXY A;  2HYS A;  3UEW A;  1OPA A;  3KZA A;  1GX8 A;  3B2I A;  4ARH A;  2GJ5 A;  4YBU A;  2AT8 X;  3Q6L A;  1HMS A;  2HLV A;  3KQ0 A;  2OFM X;  2L67 A;  1EIO A;  3MBT A;  3KFG A;  4YFR A;  1YWC A;  1GKA B;  4QZU A;  3G7X A;  4YMY A;  1TW4 A;  2X45 A;  1EPA A;  3FA9 A;  2A3F X;  4QZT A;  2O62 A;  4NNT A;  2QM9 A;  1GT1 A;  5F1E A;  3B2K A;  1YUP A;  3TGB A;  3AKM A;  5F7G A;  1IFC A;  1LNM A;  1O1V A;  2P8G A;  1R0U A;  3HWE A;  1B4M A;  2KT4 B;  2DM5 A;  1BRP A;  5D8J A;  1CBS A;  1EAL A;  1T8V A;  2AT3 X;  4M7M A;  2LBV A;  4ODD A;  1N0S A;  4ZHF A;  3BSZ E;  1E00 A;  1OPB A;  3CQR A;  4I3D A;  3TF6 A;  1BM5 A;  1D3S A;  2LFO A;  3FEK A;  2Q4N A;  5HCE C;  1DZM A;  1CJ5 A;  3PPT A;  3B2H A;  2AMM X;  4ZHD A;  3TZS A;  3C78 X;  2OVD A;  2Q2P A;  2WWP A;  1T0V A;  1ZNE A;  2IFB A;  1U0X A;  5EDC A;  5HZ9 A;  2A0A A;  2LB6 A;  3U0D A;  3CBS A;  1X8P A;  1JZU A;  4YCH A;  1G85 A;  3PED A;  1JJX A;  4N7C A;  4NYR A;  4BOE A;  3FR5 A;  3AKN A;  1O8V A;  1YWB A;  3VG3 A;  4AZM A;  1EW3 A;  4EXZ A;  3FW5 A;  3HWD A;  3P6H A;  2G7B A;  4YKM A;  3WJF A;  1SXX A;  4WFV A;  5C0N A;  4Y0P A;  3ZQ3 A;  1FEM A;  4HPA A;  4ORR A;  1I06 A;  2HNX A;  1SY2 A;  3BRN A;  3FR2 A;  3OJY C;  5D45 A;  3EBW A;  2JU3 A;  1X8Q A;  1ADL A;  4YGH A;  1JYJ A;  5LJK A;  2QO5 A;  1IFB A;  3NX1 A;  4ORU A;  3FIQ A;  1BRQ A;  5HZQ A;  4AYH A;  3CQN A;  5DG4 A;  5L8N A;  1ZNH A;  3WJC A;  4TQ2 A;  5L8O A;  3KFI A;  2WR6 A;  4YFQ A;  4TKJ A;  2E4J A;  4NP1 A;  1GGL A;  3BS2 A;  4IB6 A;  4KII A;  5DPQ A;  3NAD A;  3BX7 A;  1EII A;  2N93 A;  1G7N A;  4ALO A;  3WJD A;  1VPR A;  3BDR A;  4LKP A;  4K19 A;  2A13 A;  1KT5 A;  3VG7 A;  3TGA A;  1IIU A;  1URE A;  4IAX A;  4ORY A;  3STN A;  5HCC C;  4QGW A;  3QKG A;  4OMX A;  3FEP A;  1HMR A;  1Z24 A;  2FLJ A;  3FW4 A;  1E5P A;  1DZP A;  4AZQ A;  1I05 A;  2AKQ A;  1B8E A;  2JU7 A;  4LKT A;  1BJ7 A;  1CBQ A;  1FTP A;  2HZQ A;  2AT0 X;  1JV4 A;  1PBO A;  5EDB A;  1LIE A;  3WJE A;  5HZ5 A;  4YCE A;  2A2G A;  3VG4 A;  5K06 A;  3APU A;  2HZR A;  1ERX A;  1KXO A;  3EM0 A;  2ACO A;  4IB9 A;  5F58 A;  4O9S A;  3STM X;  4XME A;  1AB0 A;  1DC9 A;  5D48 A;  3FA8 A;  4QYP A;  1NP1 A;  4Y0Q A;  1QFV A;  2BLG A;  4ES7 A;  4ZGU A;  2WQA E;  2A2U A;  5EEE A;  2JN3 A;  4NNS A;  5JR8 A;  3D97 A;  1AQB A;  1HQP A;  1MUP A;  4MVI A;  4I3B A;  5IO5 A;  1TVQ A;  1BWY A;  2AH7 X;  1JJJ A;  4HPB A;  2FS7 A;  3WVM A;  2CM4 A;  5IO6 A;  1X89 A;  1QY1 A;  3ELZ A;  1X71 A;  5KHP A;  5LKF A;  5H9A A;  2GTF X;  5LJH A;  4QYN A;  1ICM A;  4ORW A;  2Q2M A;  1RBP A;  1MX8 A;  4M6S A;  2W2B A;  3HWG A;  3TGC A;  1B56 A;  4WBK A;  3APW A;  3O19 A;  2OFR X;  3I17 A;  3P6C A;  1OBQ A;  2YG2 A;  4Y0R A;  2POA A;  2W2F A;  1VYF A;  2NNQ A;  1L6M A;  1LF7 A;  1XCA A;  4I9R A;  4NLJ A;  4ZH9 A;  2R56 A;  4WFU A;  3FEN A;  1GT4 A;  5L8I A;  3C77 X;  4RUU A;  4ZHH A;  1UZ2 X;  2RQ0 A;  3BY0 A;  4AZN A;  3D95 A;  2MM3 A;  5HZ6 A;  1LID A;  3FA6 A;  1H91 A;  4A1H A;  4AZO A;  3CMP A;  1EUO A;  1P6P A;  4GKC A;  2QOS C;  3VG2 A;  4YDB A;  2NP1 A;  1G74 A;  4ZJ0 A;  1GT3 A;  1HBP A;  1LIB A;  1KT3 A;  1SY3 A;  1ZNG A;  3GAQ A;  4GET A;  1MX7 A;  3FR4 A;  1O1U A;  2RCT A;  3FEL A; 
#chains in the Genus database with same CATH topology
 2CZT A;  5LJB A;  1N43 A;  3FMZ A;  2JOZ A;  1ZNK A;  1KL4 A;  4AW8 A;  4GJS A;  5CYB A;  1Y53 X;  5HAE A;  3NPO A;  4B55 A;  1UYO X;  1VWF B;  1GXA A;  4QQ1 A;  5D47 A;  1X8U A;  4KCA A;  5H9L A;  3HK1 A;  1YWD A;  4I9S A;  3FLL A;  5B27 A;  3RDS A;  1NBX A;  2ALL X;  4YGZ A;  2AL0 X;  2IZD B;  1SWD A;  5F6Z A;  1QY2 A;  3MX7 A;  4DQ3 A;  1CBR A;  1VWH B;  3ZW0 B;  4ALB A;  4GRJ A;  2L9C A;  4D6B A;  4C5P A;  3F6Z B;  2X8F A;  1LCV A;  2X34 A;  2ZAI A;  4EEJ A;  4I3C A;  5B5F A;  5H9K A;  1SLF B;  2OZQ A;  2RTM A;  4OS0 A;  2WEX A;  3HTY A;  4OS8 A;  4GE1 A;  4O49 A;  1K24 A;  1ERB A;  1I4U A;  3B2L A;  1PTS A;  5B29 A;  1KFF A;  2GC9 A;  5CE4 A;  1VWI B;  3PH5 A;  3VGW A;  3EBK A;  1JBH A;  2FS6 A;  2R74 A;  4CSB A;  4XMD A;  3RZY A;  4AZP A;  1ZNL A;  1RAV A;  2MO5 A;  2QOM A;  2RD7 C;  4OEM A;  3O22 A;  5LJD A;  2FKG A;  4MVK A;  3WZO A;  1SRJ A;  1YIV A;  1JYD A;  4YFP A;  2PI3 O;  3ZZV A;  1EPB A;  2BS6 A;  4UU3 A;  5BVT A;  1OBU A;  4YGG A;  3LV4 A;  1KGL A;  4ZHC A;  1FEN A;  1MVG A;  2A8G A;  2IZI A;  5FQ6 E;  1S2P A;  4MIS A;  1N9Y A;  1XKI A;  2WSJ A;  4U3Q A;  4ZGF A;  1ZND A;  2GTL N;  4FGI B;  2R73 A;  1BEB A;  1MDC A;  4AZR A;  1EXS A;  1FE3 A;  2NNE A;  3ELX A;  3F8A A;  1BSO A;  1ML7 A;  4JGL A;  4YDA A;  4BX6 A;  3I0A A;  3VHI A;  2WEW A;  1SWB A;  4QNI A;  2ANS A;  1OEE A;  1SLG B;  2G79 A;  2IZJ A;  1A2D A;  3P02 A;  5IO7 A;  1BBP A;  3C76 X;  1CRB A;  1SWC A;  2Z4H A;  3KFH A;  1QG5 A;  2FR3 A;  4IB7 A;  3PH6 A;  2IZG B;  1S44 A;  3APV A;  4GH7 A;  4PSQ A;  1RSU B;  3BU9 A;  1QWD A;  2K62 A;  1AVE A;  1RST B;  3S26 A;  1DZJ A;  4L3R A;  4BX5 A;  3BX8 A;  4BVM A;  4FBR A;  5EED A;  1SRG A;  2Q9S A;  1RLB E;  5FEN A;  1SY1 A;  2L5P A;  3PEC A;  1KQW A;  2G78 A;  2AT5 X;  3SLJ A;  3QQ2 A;  4U9C A;  3D96 A;  5L3Y A;  2RCQ A;  2OFB A;  5BVS A;  4A60 A;  4ZFX A;  2RTO B;  5H9N A;  1FDQ A;  1N9M A;  2F09 A;  2ZAG A;  5CHK A;  5HA0 A;  1GT5 A;  1TXL A;  2IZB A;  2OVE A;  1E2T A;  1LKE A;  1ICN A;  3F9D A;  3UEX A;  3WXQ A;  3JSQ A;  4TKB A;  5HWZ A;  3CBC A;  4UU2 A;  5HCD C;  3WBG A;  1SXU A;  4OS3 A;  4ORX A;  3WJG A;  1KT6 A;  4IAW A;  3STK A;  1VYO A;  5CSE A;  1LDO A;  2RA6 A;  3KFF A;  3NX2 A;  4ML7 B;  2X56 A;  4Y5D A;  3IFB A;  3PDF A;  4YKO A;  1I04 A;  4D6A A;  5AJB A;  3ZW1 A;  3SOT A;  4CDD A;  1OBP A;  3EYC A;  2AVI A;  1KT4 A;  2A5C A;  2BS5 A;  2FGS A;  2RTI B;  3P6F A;  3S5X A;  3VE1 A;  1CBI A;  4YH0 A;  3T1D A;  5EPQ A;  1E02 A;  2G5L A;  1E06 A;  2X46 A;  1GX3 A;  1HN2 A;  2IZE B;  1PEE A;  3FA7 A;  3NQ9 A;  1EQD A;  3EW2 A;  3PP6 A;  2GH7 A;  2RTC B;  4U8U N;  4GUZ A;  4TNN A;  1SWE A;  4JNJ A;  4DQ4 A;  1VWE B;  1YWA A;  2C1Q A;  1LIC A;  1DZK A;  4Y59 A;  2MF6 A;  4EQA C;  4Z2P A;  5KID A;  2CBR A;  4TKH A;  4EFG A;  1FJ1 E;  1MM9 A;  1VWB B;  3OE3 A;  2FT9 A;  1U17 A;  4XMF A;  5H8T A;  3RSW A;  2FRS A;  3WOV A;  1HMT A;  3K3L A;  5LJG A;  5LJE A;  1HQQ A;  1QAB E;  3SLO A;  3WZN A;  1U18 A;  4NYQ A;  2OF9 A;  4GU8 A;  3KVN A;  5JD2 A;  3P6G A;  4O3Z A;  4CDF A;  1VWM B;  3RE6 A;  3WZQ A;  5LJC A;  2FKJ A;  1NC9 A;  2PY1 A;  1X8N A;  4GGR A;  2HMB A;  1ALB A;  3HWF A;  4BX6 B;  2C1S A;  3NQK A;  2KTD A;  2LKK A;  2XST A;  4U8U O;  4ZR2 A;  2F73 A;  4WHI A;  1KL3 A;  3U03 A;  1HBQ A;  1N4J A;  1QY0 A;  3T2W A;  5HCC C;  1KQX A;  3VHH A;  5FAZ A;  3WJB A;  2OY5 O;  4BBO A;  3CR6 A;  2JW1 A;  4MEE A;  3O2Y A;  1DF3 A;  2ASN X;  5HBS A;  4XMH A;  3VE2 A;  2XKL A;  2RTQ B;  5FFH A;  4EDE A;  2JMB A;  4GNY A;  3WYQ A;  2CBS A;  3L4R A;  1N7Y A;  2FR2 A;  1SLD B;  3BLG A;  4Z2V A;  2WQ9 A;  1IKE A;  3JQO A;  2EU7 X;  2IZC B;  4QRL A;  5B3M O;  4BX5 B;  1QQS A;  1LDQ A;  3RBY A;  1KT7 A;  1BSY A;  3UEV A;  5IRA A;  3ZI8 A;  4GNW A;  1LPJ A;  3MVF A;  1GM6 A;  5D4A A;  2ACP X;  4KC7 A;  4TJZ A;  1JMZ A;  3NP1 A;  4GDA A;  5IRU A;  3RY2 A;  4MVL A;  1OEK A;  1VWD B;  1T68 X;  1SWA A;  3V8U A;  4A8Z A;  3U9P C;  2OVA A;  1WBI A;  4QAE A;  1PM1 X;  1GX9 A;  4Z2O A;  2FWV A;  3MG5 A;  2DJF A;  1A57 A;  1A18 A;  1TOU A;  4HPD A;  5F6B A;  1RXH A;  3EMM A;  4GGT A;  4ORS A;  4CDE A;  2X55 A;  2HKD A;  4O4U A;  3SLT A;  3CWK A;  4BCS A;  4LZV A;  2BSZ A;  4IMN A;  4QGX A;  2CZU A;  1GKA A;  4O3W A;  3ZUI A;  4O4X A;  2FTB A;  1WUB A;  2GTL M;  1HY2 A;  1PBY A;  1SMP I;  1SWO A;  1D2U A;  1LIF A;  5BVQ A;  3ZW1 B;  5HZ8 A;  5KIC A;  4CK4 A;  2Q39 A;  4ZHG A;  3T6F A;  1KZW A;  4R0B A;  2RTJ A;  2CAM A;  3VG6 A;  1AVD A;  4FBV A;  2QO4 A;  3S60 A;  1AEL A;  1YP6 A;  3PQU A;  2RTP B;  2MWH A;  1ACD A;  1QFT A;  1Y0G A;  2WUT A;  3HPE A;  1S7D A;  4GDZ A;  4BQU A;  2L68 A;  1BSQ A;  2X8S A;  1LFO A;  2UZ2 A;  1FEL A;  1VWP B;  5HA1 A;  1SRE A;  4Y0S A;  5HTE A;  2JU8 A;  4OMW A;  4HPC A;  3T6L A;  2QO6 A;  4YVB A;  4XMG A;  2KD2 A;  2X32 A;  1IW2 A;  1G5W A;  4MIR A;  1Y52 X;  4QGV A;  5HTD A;  3D9W A;  4EKV A;  3IA8 A;  2NND A;  1UYN X;  2RTF B;  2MJI A;  2K23 A;  3JS1 A;  3NQ3 A;  3UEU A;  2OVS A;  1DFV A;  1IJ8 A;  1NGL A;  3SZH A;  3P6E A;  1VYG A;  2W2A A;  4ON1 A;  1SA8 A;  2A5B A;  3DSZ A;  3NR3 A;  4NW4 A;  2OY7 A;  1B0O A;  3VG5 A;  5EZ2 A;  3VHM A;  4A1Y A;  4YBP A;  2AT6 X;  1AVG I;  4LZU A;  1X8O A;  3P6D A;  4TLJ A;  1MEP A;  1NP4 A;  1STR B;  1BLR A;  3DTQ A;  1IKJ A;  4IB8 A;  2C4I A;  1KZX A;  1SY0 A;  3APX A;  5FQ8 E;  1OEJ A;  2LBA A;  2CM9 A;  1PMP A;  2IZA A;  1ZRY A;  4ZCB A;  3BU1 A;  4IMO A;  4RUN A;  5BYP A;  4NV7 A;  5AQ6 A;  1LCZ A;  4N7D A;  3SAO A;  4HFO A;  2RTH B;  4I6S A;  4IBA A;  3ZUO A;  1VWA B;  1TOW A;  4ZH6 A;  1SWR A;  2OL6 O;  4XMC A;  1DV9 A;  4KH8 A;  1YP7 A;  5LKE A;  2VFB A;  4NLI A;  2MHD A;  2ZSC A;  3B2J A;  1KOI A;  1A3Y A;  1SXW A;  2X4M A;  1SXY A;  2HYS A;  4DCB A;  3UEW A;  1OPA A;  3KZA A;  1GX8 A;  3B2I A;  4ARH A;  2GJ5 A;  4YBU A;  2AT8 X;  3Q6L A;  3FDC A;  1RXJ A;  1SRH A;  1VWG B;  1HMS A;  2HLV A;  2Y3E A;  3KQ0 A;  2OFM X;  1SWU A;  4O3Y A;  2L67 A;  1EIO A;  3MBT A;  3KFG A;  2RTK A;  2RN4 A;  4YFR A;  1YWC A;  1GKA B;  1VWN B;  2X8T A;  3G7X A;  4QZU A;  4YMY A;  5B5G A;  1VWQ B;  1TW4 A;  2X45 A;  1EPA A;  3FA9 A;  2A3F X;  1NQM A;  2O62 A;  4NNT A;  2QM9 A;  4FQB B;  4QZT A;  4COT A;  1GT1 A;  4KC8 A;  4PJ2 A;  5F1E A;  4BX7 A;  3B2K A;  1YUP A;  3TGB A;  3AKM A;  5F7G A;  1IFC A;  1LNM A;  1O1V A;  2P8G A;  1R0U A;  3HWE A;  3LTW A;  1B4M A;  2KT4 B;  2DM5 A;  1BRP A;  5D8J A;  1CBS A;  1EAL A;  1T8V A;  2Y32 A;  4O4S A;  1SWL A;  2AT3 X;  5IRW A;  2IZL B;  4M7M A;  2VDF A;  2LBV A;  2OYB O;  4ODD A;  1N0S A;  4ZHF A;  3BSZ E;  3HOE A;  4CDC A;  1E00 A;  1OPB A;  3CQR A;  4I3D A;  3TF6 A;  1BM5 A;  3S5V A;  1D3S A;  2LFO A;  1Y55 X;  3FEK A;  4OEL A;  2F01 A;  1SWS A;  2Q4N A;  3LHN A;  3Q34 A;  1SWT A;  2RTA A;  2OY8 A;  5HCE C;  2UYW A;  1DZM A;  1CJ5 A;  3PPT A;  2IZF B;  1STS B;  3B2H A;  2AMM X;  4ZHD A;  1W5R A;  3TZS A;  3C78 X;  2OVD A;  5AJC A;  1KL5 A;  2Q2P A;  2VFC A;  1NQN A;  2WWP A;  1RXK A;  1SWJ A;  1T0V A;  1NDJ A;  2FHL A;  1ZNE A;  2IFB A;  1U0X A;  2RTB B;  5EDC A;  5HZ9 A;  2A0A A;  2QMI A;  2LB6 A;  3MM0 A;  4INN A;  3U0D A;  1EI5 A;  2RTG B;  3CBS A;  1X8P A;  1JZU A;  3RDX A;  1W4T A;  3HOL A;  1G85 A;  2RTN B;  3PED A;  4YCH A;  1JJX A;  1VWJ B;  4N7C A;  4NYR A;  4BOE A;  2KTS A;  3FR5 A;  4Z6J A;  2M4L A;  3AKN A;  1O8V A;  1SWG A;  1YWB A;  1SWF A;  3VG3 A;  4AZM A;  1EW3 A;  4EXZ A;  3FW5 A;  3HWD A;  3P6H A;  2G7B A;  4YKM A;  3WJF A;  1SXX A;  4WFV A;  3D4R A;  5C0N A;  4Y0P A;  3ZQ3 A;  1FEM A;  4HPA A;  4ORR A;  1I06 A;  2HNX A;  1SY2 A;  3BRN A;  3FR2 A;  3OJY C;  4GK9 A;  5D45 A;  3EBW A;  2JU3 A;  1X8Q A;  1ADL A;  4YGH A;  1JYJ A;  3UAQ A;  5LJK A;  3P24 A;  2OFA A;  2QO5 A;  1IFB A;  1STP A;  3N91 A;  3NX1 A;  4ORU A;  4CPI A;  3FIQ A;  1BRQ A;  5HZQ A;  1HXL A;  1W6F A;  4I95 A;  4AYH A;  3CQN A;  4CPH A;  3PK2 A;  4LQZ A;  5DG4 A;  4CV7 A;  5L8N A;  1ZNH A;  3WJC A;  4IAB A;  4TQ2 A;  2JGS A;  5L8O A;  3VU1 A;  3KFI A;  1HXZ A;  1SLE B;  2WR6 A;  4YFQ A;  4TKJ A;  4FBO A;  4Z28 A;  3AUM O;  1OSP O;  2E4J A;  4NP1 A;  1GGL A;  3BS2 A;  4IB6 A;  2OF8 A;  4KII A;  5DPQ A;  4BX7 B;  1SWP A;  3NAD A;  4ID2 A;  3BX7 A;  4O3X B;  1EII A;  2N93 A;  1G7N A;  3T2X A;  4ALO A;  3WJD A;  1VPR A;  3BDR A;  1VWR B;  2FHN X;  2OY1 O;  4LKP A;  3RDM A;  4L1N A;  1SWK A;  4K19 A;  2A13 A;  1KT5 A;  3VG7 A;  3TGA A;  1IIU A;  1JQP A;  1URE A;  4IAX A;  4ORY A;  4U46 A;  4QGW A;  1I9H A;  3STN A;  3ZW2 A;  3QKG A;  4GJV A;  1SWQ A;  4OMX A;  5B11 O;  4GD9 A;  1LCW A;  2I5Z O;  3FEP A;  1HMR A;  4CPE A;  4I60 A;  1Z24 A;  2FLJ A;  4DNE A;  3FW4 A;  1E5P A;  1DZP A;  4AZQ A;  1I05 A;  2AKQ A;  1B8E A;  2JU7 A;  4LKT A;  1BJ7 A;  1CBQ A;  1FTP A;  2HZQ A;  4GGZ A;  2AT0 X;  1JV4 A;  1PBO A;  5EDB A;  3EC5 A;  1LIE A;  3AEH A;  3VPJ E;  3WJE A;  5HZ5 A;  4YCE A;  1Y9L A;  2A2G A;  3RDO A;  3WYP A;  3CKG A;  3VG4 A;  5K06 A;  3APU A;  2HZR A;  1DF8 A;  4BGF A;  1ERX A;  1KXO A;  3EM0 A;  2Z4I A;  2ACO A;  4IB9 A;  5F58 A;  3RWX A;  4O9S A;  5AEO A;  3STM X;  4XME A;  5K68 A;  3CKF A;  1AB0 A;  1DC9 A;  2GTL O;  3FA8 A;  4QYP A;  1NP1 A;  4Y0Q A;  1QFV A;  2BLG A;  5D48 A;  4ES7 A;  4ZGU A;  2WQA E;  2A2U A;  2I5V O;  2JN3 A;  4GZV A;  5EEE A;  1SWN A;  4U8U M;  1VWL B;  2QCB A;  2RTD B;  2YMS A;  4NNS A;  5JR8 A;  2BC3 A;  3D97 A;  2IZH B;  2LA7 A;  5F2B A;  3ZW0 A;  1AQB A;  1HQP A;  1MUP A;  4MVI A;  4I3B A;  3RY1 A;  5IO5 A;  1SWH A;  1JMX A;  3FYF A;  3X00 A;  3WZP A;  1TVQ A;  1BWY A;  2AH7 X;  2OL8 O;  1JJJ A;  1JIW I;  2FS7 A;  4HPB A;  2WPU A;  3WVM A;  4Z27 A;  2CM4 A;  5IO6 A;  1X89 A;  1QY1 A;  3ELZ A;  1X71 A;  3RDQ A;  1MK5 A;  3OBL A;  5KHP A;  1LEL A;  1JJU A;  5LKF A;  5H9A A;  2GTF X;  2IZK A;  5LJH A;  2BHV A;  3PQS A;  4QYN A;  1ICM A;  4JO6 A;  4ORW A;  2Q2M A;  4CPH B;  3EW1 A;  1RBP A;  1MX8 A;  4M6S A;  3ZWE A;  2W2B A;  3HWG A;  3TGC A;  1B56 A;  4WBK A;  3RKG A;  3APW A;  3O19 A;  2OFR X;  3I17 A;  4JHQ A;  3P6C A;  3RDU A;  4CPF A;  1SRF A;  5FQ7 E;  3NBX X;  1OBQ A;  2YG2 A;  3GE2 A;  3RE5 A;  1MOY A;  4Y0R A;  2RTE B;  2POA A;  2W2F A;  1VYF A;  2NNQ A;  4IRW A;  2RTL A;  1L6M A;  1LF7 A;  1XCA A;  4I9R A;  4NLJ A;  5K67 A;  4ZH9 A;  2R56 A;  2Y3F A;  1K3B A;  4WFU A;  4BJ8 A;  2DJG A;  1GT4 A;  2KW1 A;  3FEN A;  4HWM A;  3C77 X;  4OKA A;  5L8I A;  4RUU A;  5IXG A;  1LUQ A;  2AF5 A;  3OD9 A;  4ZHH A;  4KT5 A;  4O4O A;  1UZ2 X;  2RQ0 A;  3BY0 A;  4AZN A;  3D95 A;  2MM3 A;  2OL7 A;  3H3I A;  5HZ6 A;  1LID A;  3FA6 A;  3SZJ A;  1H91 A;  1Y9T A;  4A1H A;  1I78 A;  4AZO A;  5B10 O;  3CMP A;  3SZI A;  1VWC B;  1EUO A;  1P6P A;  4GKC A;  5B2A O;  2QOS C;  3VG2 A;  1VWO B;  1VWK B;  2BT9 A;  1G74 A;  2NP1 A;  4YDB A;  4MVE A;  4ZJ0 A;  4NV8 A;  1GT3 A;  1HBP A;  1LIB A;  1KT3 A;  1SY3 A;  1ZNG A;  2RTR B;  3E3C A;  3GAQ A;  1MX7 A;  2G8C O;  3FR4 A;  1SRI A;  4GET A;  1O1U A;  2RCT A;  3FEL A;  3FID A; 
#chains in the Genus database with same CATH homology
 2CZT A;  5LJB A;  3FMZ A;  2JOZ A;  1ZNK A;  4AW8 A;  5CYB A;  5HAE A;  3NPO A;  5D47 A;  1GXA A;  4QQ1 A;  1X8U A;  4KCA A;  5H9L A;  3HK1 A;  1YWD A;  4I9S A;  3FLL A;  5B27 A;  2ALL X;  4YGZ A;  2AL0 X;  5F6Z A;  1QY2 A;  3MX7 A;  4DQ3 A;  1CBR A;  3ZW0 B;  4ALB A;  4D6B A;  4GRJ A;  2L9C A;  3F6Z B;  2X8F A;  2ZAI A;  4EEJ A;  4I3C A;  5H9K A;  2OZQ A;  4OS0 A;  2WEX A;  3HTY A;  4OS8 A;  4GE1 A;  4O49 A;  1ERB A;  1I4U A;  3B2L A;  5B29 A;  2GC9 A;  5CE4 A;  3PH5 A;  3EBK A;  1JBH A;  2FS6 A;  2R74 A;  4CSB A;  4XMD A;  3RZY A;  4AZP A;  1ZNL A;  2MO5 A;  2RD7 C;  5LJD A;  3O22 A;  4MVK A;  1YIV A;  1JYD A;  4YFP A;  3ZZV A;  1EPB A;  2BS6 A;  4UU3 A;  5BVT A;  1OBU A;  4YGG A;  3LV4 A;  1KGL A;  4ZHC A;  1FEN A;  1MVG A;  5FQ6 E;  1S2P A;  4MIS A;  2WSJ A;  1XKI A;  4ZGF A;  4U3Q A;  1ZND A;  2GTL N;  4FGI B;  2R73 A;  1BEB A;  1MDC A;  4AZR A;  1EXS A;  1FE3 A;  2NNE A;  3ELX A;  3F8A A;  1BSO A;  1ML7 A;  4JGL A;  4YDA A;  3I0A A;  2WEW A;  4QNI A;  2ANS A;  1OEE A;  2G79 A;  5IO7 A;  1A2D A;  3P02 A;  1BBP A;  3C76 X;  1CRB A;  2Z4H A;  3KFH A;  1QG5 A;  2FR3 A;  4IB7 A;  3PH6 A;  3APV A;  1S44 A;  4GH7 A;  4PSQ A;  3BU9 A;  1QWD A;  2K62 A;  3S26 A;  1DZJ A;  4L3R A;  3BX8 A;  4BVM A;  4FBR A;  5EED A;  2Q9S A;  1RLB E;  5FEN A;  1SY1 A;  2L5P A;  3PEC A;  1KQW A;  2G78 A;  2AT5 X;  4U9C A;  3D96 A;  2RCQ A;  5BVS A;  4A60 A;  4ZFX A;  5H9N A;  1FDQ A;  2F09 A;  2ZAG A;  5HA0 A;  1GT5 A;  1TXL A;  2OVE A;  1LKE A;  1ICN A;  3F9D A;  3UEX A;  3WXQ A;  3JSQ A;  4TKB A;  5HWZ A;  3CBC A;  4UU2 A;  5HCD C;  3WBG A;  1SXU A;  4OS3 A;  4ORX A;  3WJG A;  1KT6 A;  4IAW A;  3STK A;  3NX2 A;  2RA6 A;  3KFF A;  4ML7 B;  3IFB A;  4YKO A;  1I04 A;  4D6A A;  5AJB A;  3ZW1 A;  3SOT A;  1OBP A;  3EYC A;  2BS5 A;  1KT4 A;  3P6F A;  3S5X A;  3VE1 A;  1CBI A;  4YH0 A;  3T1D A;  5EPQ A;  1E02 A;  1E06 A;  2X46 A;  1PEE A;  1HN2 A;  3FA7 A;  3NQ9 A;  1EQD A;  3PP6 A;  4U8U N;  4TNN A;  4DQ4 A;  4EQA C;  1YWA A;  1LIC A;  1DZK A;  5KID A;  2CBR A;  4TKH A;  4EFG A;  5H8T A;  3OE3 A;  4XMF A;  2FT9 A;  1U17 A;  3RSW A;  3WOV A;  2FRS A;  1HMT A;  3K3L A;  5LJG A;  5LJE A;  1QAB E;  1U18 A;  4NYQ A;  4GU8 A;  3P6G A;  4O3Z A;  5LJC A;  2PY1 A;  1X8N A;  2HMB A;  1ALB A;  3HWF A;  3NQK A;  2KTD A;  2LKK A;  2XST A;  4U8U O;  4ZR2 A;  2F73 A;  4WHI A;  3U03 A;  1HBQ A;  1QY0 A;  1KQX A;  3WJB A;  5FAZ A;  1DF3 A;  3CR6 A;  2JW1 A;  3O2Y A;  2ASN X;  5HBS A;  4XMH A;  3VE2 A;  2XKL A;  5FFH A;  4EDE A;  2JMB A;  4GNY A;  2CBS A;  3L4R A;  2FR2 A;  3BLG A;  2WQ9 A;  1IKE A;  3JQO A;  2EU7 X;  4QRL A;  1QQS A;  3RBY A;  1KT7 A;  1BSY A;  3UEV A;  3ZI8 A;  4GNW A;  1LPJ A;  3MVF A;  1GM6 A;  5D4A A;  2ACP X;  4KC7 A;  4TJZ A;  3NP1 A;  4MVL A;  1OEK A;  1T68 X;  3V8U A;  4A8Z A;  3U9P C;  2OVA A;  4QAE A;  1PM1 X;  1GX9 A;  2FWV A;  1A57 A;  1A18 A;  1TOU A;  4HPD A;  5F6B A;  3EMM A;  4ORS A;  4O4U A;  3CWK A;  4LZV A;  4IMN A;  4QGX A;  2CZU A;  1GKA A;  4O3W A;  3ZUI A;  4O4X A;  2FTB A;  2GTL M;  1SMP I;  1D2U A;  1LIF A;  5BVQ A;  3ZW1 B;  5HZ8 A;  5KIC A;  4CK4 A;  2Q39 A;  4ZHG A;  1KZW A;  4R0B A;  3VG6 A;  4FBV A;  2QO4 A;  3S60 A;  1AEL A;  1YP6 A;  3PQU A;  2MWH A;  1ACD A;  1QFT A;  4GDZ A;  2WUT A;  1S7D A;  4BQU A;  2L68 A;  1BSQ A;  2X8S A;  1LFO A;  1FEL A;  5HA1 A;  4Y0S A;  5HTE A;  2JU8 A;  4OMW A;  4HPC A;  2QO6 A;  4XMG A;  2KD2 A;  1G5W A;  1IW2 A;  4MIR A;  4QGV A;  5HTD A;  3IA8 A;  2NND A;  2MJI A;  2K23 A;  3JS1 A;  3NQ3 A;  3UEU A;  2OVS A;  1DFV A;  1NGL A;  3P6E A;  1VYG A;  2W2A A;  4ON1 A;  1SA8 A;  3DSZ A;  3NR3 A;  4NW4 A;  3VG5 A;  4A1Y A;  1B0O A;  5EZ2 A;  4YBP A;  2AT6 X;  1AVG I;  4LZU A;  1X8O A;  3P6D A;  4TLJ A;  1NP4 A;  1BLR A;  3DTQ A;  1IKJ A;  4IB8 A;  1KZX A;  1SY0 A;  3APX A;  5FQ8 E;  1OEJ A;  2LBA A;  2CM9 A;  1PMP A;  1ZRY A;  4ZCB A;  3BU1 A;  4IMO A;  4RUN A;  5BYP A;  5AQ6 A;  4N7D A;  3SAO A;  4HFO A;  4I6S A;  4IBA A;  3ZUO A;  4ZH6 A;  1TOW A;  4XMC A;  1DV9 A;  4KH8 A;  1YP7 A;  5LKE A;  4NLI A;  2MHD A;  3B2J A;  1KOI A;  1A3Y A;  1SXW A;  1SXY A;  2HYS A;  3UEW A;  1OPA A;  3KZA A;  1GX8 A;  3B2I A;  4ARH A;  2GJ5 A;  4YBU A;  2AT8 X;  3Q6L A;  1HMS A;  2HLV A;  3KQ0 A;  2OFM X;  4O3Y A;  2L67 A;  1EIO A;  3MBT A;  3KFG A;  2RN4 A;  4YFR A;  1YWC A;  1GKA B;  2X8T A;  3G7X A;  4QZU A;  4YMY A;  1TW4 A;  2X45 A;  1EPA A;  3FA9 A;  2A3F X;  4QZT A;  2O62 A;  4NNT A;  2QM9 A;  4FQB B;  4COT A;  1GT1 A;  4KC8 A;  4PJ2 A;  5F1E A;  3B2K A;  1YUP A;  3TGB A;  3AKM A;  5F7G A;  2P8G A;  1IFC A;  1LNM A;  1O1V A;  1R0U A;  3HWE A;  1B4M A;  2KT4 B;  2DM5 A;  1BRP A;  5D8J A;  1CBS A;  1EAL A;  1T8V A;  4O4S A;  2AT3 X;  4M7M A;  2LBV A;  4ODD A;  1N0S A;  4ZHF A;  3BSZ E;  3HOE A;  1E00 A;  1OPB A;  3CQR A;  4I3D A;  3TF6 A;  1BM5 A;  3S5V A;  1D3S A;  2LFO A;  3FEK A;  3LHN A;  2Q4N A;  5HCE C;  1DZM A;  1CJ5 A;  3PPT A;  3B2H A;  2AMM X;  4ZHD A;  3TZS A;  3C78 X;  2OVD A;  5AJC A;  2Q2P A;  2WWP A;  1T0V A;  1ZNE A;  2IFB A;  1U0X A;  5EDC A;  5HZ9 A;  2A0A A;  2QMI A;  2LB6 A;  4INN A;  3U0D A;  1EI5 A;  3CBS A;  1X8P A;  1JZU A;  3HOL A;  1G85 A;  4YCH A;  3PED A;  1JJX A;  4N7C A;  4NYR A;  4BOE A;  2KTS A;  3FR5 A;  2M4L A;  3AKN A;  1O8V A;  1YWB A;  3VG3 A;  4AZM A;  1EW3 A;  4EXZ A;  3FW5 A;  3HWD A;  3P6H A;  2G7B A;  4YKM A;  3WJF A;  1SXX A;  4WFV A;  3D4R A;  5C0N A;  4Y0P A;  3ZQ3 A;  1FEM A;  4HPA A;  4ORR A;  1I06 A;  2HNX A;  1SY2 A;  3BRN A;  3FR2 A;  3OJY C;  4GK9 A;  5D45 A;  3EBW A;  2JU3 A;  1X8Q A;  1ADL A;  4YGH A;  1JYJ A;  3UAQ A;  5LJK A;  3P24 A;  2QO5 A;  1IFB A;  3NX1 A;  3N91 A;  4ORU A;  3FIQ A;  1BRQ A;  5HZQ A;  4I95 A;  4AYH A;  3CQN A;  4LQZ A;  5DG4 A;  4CV7 A;  5L8N A;  1ZNH A;  3WJC A;  4IAB A;  4TQ2 A;  5L8O A;  3VU1 A;  3KFI A;  2WR6 A;  4YFQ A;  4TKJ A;  4FBO A;  2E4J A;  4NP1 A;  1GGL A;  3BS2 A;  4IB6 A;  4KII A;  5DPQ A;  3NAD A;  4ID2 A;  3BX7 A;  4O3X B;  1EII A;  2N93 A;  1G7N A;  4ALO A;  3WJD A;  1VPR A;  3BDR A;  4LKP A;  4L1N A;  4K19 A;  2A13 A;  1KT5 A;  3VG7 A;  3TGA A;  1IIU A;  1URE A;  4IAX A;  4ORY A;  3STN A;  5HCC C;  4QGW A;  3ZW2 A;  3QKG A;  4OMX A;  3FEP A;  1HMR A;  1Z24 A;  2FLJ A;  3FW4 A;  1E5P A;  1DZP A;  4AZQ A;  1I05 A;  2AKQ A;  1B8E A;  2JU7 A;  4LKT A;  1BJ7 A;  1CBQ A;  1FTP A;  2HZQ A;  2AT0 X;  1JV4 A;  1PBO A;  5EDB A;  1LIE A;  3VPJ E;  3WJE A;  5HZ5 A;  4YCE A;  1Y9L A;  2A2G A;  3VG4 A;  5K06 A;  3APU A;  2HZR A;  1ERX A;  1KXO A;  3EM0 A;  2Z4I A;  2ACO A;  4IB9 A;  5F58 A;  3RWX A;  4O9S A;  5AEO A;  3STM X;  4XME A;  1AB0 A;  1DC9 A;  2GTL O;  3FA8 A;  4QYP A;  1NP1 A;  4Y0Q A;  1QFV A;  2BLG A;  5D48 A;  4ES7 A;  4ZGU A;  2WQA E;  2A2U A;  4GZV A;  2JN3 A;  5EEE A;  4U8U M;  4NNS A;  5JR8 A;  2YMS A;  3D97 A;  2LA7 A;  3ZW0 A;  1AQB A;  1HQP A;  1MUP A;  4MVI A;  4I3B A;  5IO5 A;  3FYF A;  1TVQ A;  1BWY A;  2AH7 X;  1JJJ A;  1JIW I;  2FS7 A;  4HPB A;  3WVM A;  2CM4 A;  5IO6 A;  1X89 A;  1QY1 A;  3ELZ A;  1X71 A;  5KHP A;  3OBL A;  5LKF A;  5H9A A;  2GTF X;  5LJH A;  2BHV A;  3PQS A;  4QYN A;  1ICM A;  4ORW A;  2Q2M A;  1RBP A;  1MX8 A;  4M6S A;  3ZWE A;  2W2B A;  3HWG A;  3TGC A;  1B56 A;  4WBK A;  3RKG A;  3APW A;  3O19 A;  2OFR X;  3I17 A;  3P6C A;  5FQ7 E;  3NBX X;  1OBQ A;  2YG2 A;  3GE2 A;  4Y0R A;  2POA A;  2W2F A;  1VYF A;  2NNQ A;  1L6M A;  1LF7 A;  1XCA A;  4I9R A;  4NLJ A;  4ZH9 A;  2R56 A;  4WFU A;  3FEN A;  1GT4 A;  2KW1 A;  5L8I A;  4HWM A;  3C77 X;  4RUU A;  3OD9 A;  4ZHH A;  4KT5 A;  4O4O A;  1UZ2 X;  2RQ0 A;  3BY0 A;  4AZN A;  3D95 A;  2MM3 A;  5HZ6 A;  3H3I A;  1LID A;  3FA6 A;  1H91 A;  1Y9T A;  4A1H A;  4AZO A;  3CMP A;  1EUO A;  1P6P A;  4GKC A;  2QOS C;  3VG2 A;  4YDB A;  2BT9 A;  1G74 A;  2NP1 A;  4MVE A;  4ZJ0 A;  1GT3 A;  1HBP A;  1LIB A;  1KT3 A;  1SY3 A;  1ZNG A;  3E3C A;  3GAQ A;  4GET A;  1MX7 A;  3FR4 A;  1O1U A;  2RCT A;  3FEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...