1B5HA

Oligo-peptide binding protein complexed with lysyl-diaminopropanoic acid-lysine
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 194
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b5hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b5hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b5hA02
4H5GA 4BLAA 3QAXA 4KHZE 2QS3A 3SEUA 4ECFA 4XKNA 1Y1ZA 3HO7A 2CZLA 1LAXA 4YB5A 3N94A 3MVXA 3K02A 3CVGA 4KD5A 5DEXB 4QFKA 3SETA 4NF8B 2F8DA 3EF7A 4ISUA 5KDTB 3QXMA 2Y7WA 3FTOA 4JXIA 3VXCA 4OZ9A 4GIZA 2DE2A 5TP9A 2GHAA 3K4UA 1MY3A 2XXIA 3PD9A 1LAHE 4GFRA 3SKPA 4I62A 2XD2A 4PFYA 3F11A 1USYE 1FTKA 3U1OA 4JDFA 4U21A 1VFEA 1UQWA 1D9YA 1II5A 1URDA 2GH9A 2XXYA 1GV8A 4HW8A 4IO6A 4M1VA 3K6XA 1A8FA 1OMPA 3ONMA 5AE4A 1DPPA 3USDA 4KR5A 1B05A 3KGCA 3T9VA 3UORA 4F3GA 1QULA 4GF8A 4QFPA 4NE4A 5CMKA 1MDP1 2HZLA 4H67A 4OESA 1NH8A 4ESXA 2YJPA 4DDDA 1SBPA 3K01A 1MQIA 4N13A 1NNPA 3MW0A 5DVFA 5I56A 3PAMA 2GFEA 3HV1A 4I1DA 2H25A 2GRVA 5H8QA 4ZZEA 3C34A 3T9XB 3TTLA 3BFUA 4RK9A 1B3GA 1MY2A 4YB7A 3DRIA 1HSJA 4QF9A 5ITPA 5I57A 3BKIB 1LB9A 4F31B 5FHMA 4X1DA 4F2QA 1MQDA 2P0SA 2Y7KA 4U2RA 3PD8A 4WEPA 3DRKA 1B1HA 4ZZAA 2ZNTA 4IO7A 3VV5A 4NF6A 2R9JA 1B9JA 4OFLA 3C31A 4OENA 3OO9A 4I8CA 2Y7RA 3G3IA 3RPWA 2O84X 1M5EA 1WVJA 1POTA 3OEKA 2DVZA 3VDFA 1MY4A 4MH5A 5L9MA 1MH4A 3SEWA 4H8JA 5CMMA 2QSXA 4DCYA 4F3BA 3KFMA 2OCUA 4YMBA 4ELPA 3FXQA 3DRHA 2V3TA 4HCYA 1YTVA 1DTZA 4EXKA 1Z7ME 2WOLA 1Y20A 2ZYMA 2NOOA 1WODA 1PC3A 4PETA 1M5FA 1O7TA 1LGBC 3H6TA 3O28A 3C32A 4MF3A 1PBPA 2V93A 5K2XA 2Q9TA 4ESWA 3O6IA 2ZYOA 3H7MA 4YICA 3G3JA 4FORA 3H6WA 3T9UA 2B65A 3S9NC 1P1WA 1MPDA 2REGA 3SDFA 1ZU0A 3VLWA 1EZOA 3K1PA 4QFLA 5AA2D 3TTNA 5J1DA 2HAVA 5I2KB 3MVZA 4OFOA 4LZ5A 3S4UA 2Q89A 3FVOA 4RY1A 5KCJA 1BP5A 4BDMA 4P11A 3RT6B 1ELJA 4ZEIA 3HSTA 4OMBA 3PUYE 4IO2A 3C4MA 4LP2B 1A54A 3OO8A 3U8QA 2NVUB 4BDRA 2O1LA 1B3LA 3IO4A 3SESA 5CRYA 5CC2A 3MPLA 3HN0A 4G8HA 2I48A 3DP8A 4QRZA 1OLAA 3C35A 3JZJA 3TKDA 3FVGA 1AIVA 4PE5B 3EHTA 5H8HB 4EQ9A 1B7HA 3MQ9A 4U1OA 3ZS6A 5AA2B 2I58A 3SEYA 1JQFA 4OEVA 3R6UA 3KEIA 4IO4A 2Q88A 1VSOA 2I0CA 3O6HA 2A5SA 3MPKA 1SQYA 5HBCA 1JW4A 3DRFA 2NUVA 2VOZA 3LC8A 1M5DA 3CFZA 5JTYB 1FQCA 1B4HA 3FV1A 3ILTB 4ZDMA 3AXFA 5H8FA 1MXVA 4BDQA 1FW0A 2E0SA 2HAUA 5EYFA 3KZGA 3G3KA 3K6UA 4LZ7A 3T66A 3TMGA 1NKXA 4BDLA 4JB7A 4WKMA 1IITA 2I3VA 5DVIA 3IR1A 1ANFA 1FTLA 4EF1A 5TP9B 1XOCA 4EXLA 4PP0A 3WAEA 3IOWA 5I2NB 3OO7A 3SERA 2F6PA 2O6AA 3FASA 1QUKA 2F78A 4NF5A 2F34A 4O3BA 4KYEA 1MQGA 1MDQA 4FIMA 1EZ9A 5DYHA 4GQOA 3Q26A 4H65A 4LQ2A 3ZSFA 1QJMA 2H4IA 2OBGA 1JEUA 1N7XA 1R9QA 1IEJA 4C1UA 2I0BA 1PBQA 3DRGA 3ECRA 5TPAB 1MXZA 3I5OA 4YKKA 2YLNA 1FTJA 1LB8A 4KCCA 1PEBA 1P99A 3RY3A 1S9TA 4DZ1A 1A8EA 5B70A 4KYDA 3GBBA 1MPCA 3OMBA 3KSXA 3KJ7A 4POWA 4DLDA 4F2OA 3UIFA 1BTJA 3VXBA 5H8NB 2RINA 3TUSA 1SYHA 3K0VA 1M5CA 2RC7A 1PDAA 1MXYA 1XVYA 4POXA 1QVSA 2I49A 2VHAA 4F1VA 4G68B 2KLFA 4IO5A 4H1XA 1QUIA 2WKYA 3TQLA 5JEIA 3IJOB 4OQOA 2DQVA 1ZKBA 3IORA 1B4ZA 2XX9A 1R6ZA 1SW1A 3KG2A 2V25A 2DXYA 2QS1A 2V84A 3TEPA 2UVGA 4MFIA 3K2DA 1OVTA 3TQWA 5CMBA 3IOUA 4PQJA 3MP1A 2ZNSA 3CFLA 3W9VA 1B0HA 3IO6A 1VE4A 3KBRA 3RN8A 2ZMBA 1XT8A 2Z23A 4E0XA 3PMXA 4L17A 3ZKLA 4Q8RA 3IJXB 1N7WA 1NNTA 4IY5A 3CSGA 4NEDA 3S9MC 4KYSA 1ATGA 1N84A 3U72A 1XC1A 1TXFA 2ZYNA 1LCTA 2I4CA 3I6VA 5CI5A 2Y7IA 5I59A 4EUOA 3M8UA 3ILUB 1MH3A 4XTCQ 2FYIA 2DXRA 3H3GA 2THIA 4AQ4A 1UTHB 4GL8A 1MXXA 4P0IA 3RTFB 5I84A 4GL0A 2OWSA 1IZ1A 1XS5A 4TLMB 5AA3A 2AIXA 2ONKE 3LR1A 4JBZA 1AH5A 1BIYA 2F97A 4OHNA 2QRYA 3LBSA 1I6QA 1QKAA 4QHQA 2Y7PA 3HHFA 3JV9A 3CSBA 1POY1 3GLBA 5FTHA 1IXCA 1D9VA 2H98A 4G4PA 4KPTA 1JNFA 3TZAA 3FJGA 3IL1B 4M4GA 1S7YA 3U94A 3U93A 2B4MA 2OWTA 2I3WA 1ZTYA 2ONRA 2XXVA 3MZ9A 3EN3A 1LSTA 2IA4A 4R74A 3G3GA 4QSEA 3CG1A 1N3WA 3IOVA 4OWDA 3QK6A 1RYXA 5HM4B 1LAGE 5KZTA 2NWJA 2HCAA 1GR2A 2CMOA 1DMBA 1QUJA 3S2VA 1B7ZA 3FVKA 4LZ8A 4IB2A 2PVUA 4U4SA 4OTEA 3QIMA 1M5BA 2IEEA 1JVYA 3MVWA 3K1MA 4F18A 1Y3NA 1Y1MA 4HCWA 4KQPA 5A5XA 2E1SA 4C0RA 1JETA 3A3CA 3VVDA 3VVFA 1P1OA 4MBPA 3SEXA 4H8IA 2O1MA 3N6UA 2UVJA 4U4XA 3TODA 3V83A 2FNCA 3GBAA 2ONSA 1SD3A 3PMVA 3G3HA 1EU8A 2HQ0A 2P1SA 1UIUA 4ELRA 1UTBB 3L6GA 1J1NA 3UN6A 3CRBA 3V89B 4PFWA 5DEXA 3OELA 1SVXB 4NF4B 4JSDA 4RA1A 4NF8A 3DP4A 2X7QA 2RKMA 2UVHA 5KDTA 3PGFA 2WOPA 4F19A 5CBSA 1PB7A 1QKBA 1ZLQA 4LATA 1CE2A 4YKPA 4R6YA 1RKMA 1IIWA 2H5YA 4GD5A 1IXHA 1CB6A 1URSA 5AA1A 3B6WA 1USYH 1MQHA 1A7LA 1P1UA 1S50A 5DTBA 1B7UA 3PV0E 4XKQA 5FHNA 5L9OA 4LONB 3BFTA 2DWAA 1MXWA 2A5TB 3B7DA 3T93B 1FTOA 4TOZA 3O6PA 3DLNA 5L9SA 1YAEA 3LVUA 4HTGA 2UYFA 4ELOA 2UYEA 4RNSA 2ESNA 4X48A 2O69A 3OSQA 4QFOA 1NFTA 2Z22A 3IX1A 3UK4A 3C9HA 5JK4A 2PYYA 5F1QA 2XD3A 1SI0A 4YAHX 4U22A 1N76A 1P1NA 3QUFA 4NWDA 1B58A 1B5JA 3MZ1A 4IGRA 1FQDA 1AL3A 5I58B 2XXHA 2G29A 3QUJA 4QSDA 3EHUA 4JWOA 3A09A 3W15C 5BWJA 4FECA 1IQ7A 3S9LC 1OIBA 1I69A 1ZMGA 1B5HA 3M3LA 1ZJLA 4FEDA 3DP6A 3LSLA 2D3IA 4GLIA 4ZE9A 3Q29A 4GOTA 5ICQA 1H3DA 4ND9A 5IAIA 3VFJA 4F39A 4ZECA 3HHGA 4NWCA 3ZKKA 4C1TA 4DIGA 4GRKA 4THIA 2XXWA 5DVJA 4JWXA 3FIRA 4EQBA 5L8DA 3MJNA 4TQUQ 3PU5A 3H6UA 2OZZA 3TCHA 5FTIA 4OXVA 1BKAA 4DCXA 1OQHA 2NXOA 3OOAA 1PB9A 4DXCA 3Q25A 2M8CA 2ZNUA 3TTMA 4ZEBA 1US4A 3PUVE 4XKPA 3VLUA 3PPRA 3P7IA 3M3FA 3OO6A 1BLFA 2OJTA 4EQ7A 1O63A 1H45A 1LFIA 1XHYA 4YKJA 2PMSA 3N6TA 2DWHA 4OEUA 3RTWB 2PT2A 3SEVA 1D4NA 3K00A 1A99A 2QL3A 3K6VA 2VD2A 5CBRA 2O68A 4AB6A 3CR9A 5I56B 4GVOA 3PPNA 1Q1KA 2VP1A 5H8QB 2DOJA 3E4RA 1Y4CA 2RCAA 5TU0A 1URGA 1NMUA 2HZKA 4X1BA 4Z0IA 1ZIUA 3MC2A 3QSLA 2DP8A 1LFHA 3THIA 2XXQA 4Q0CA 1NH7A 5I57B 3OXNA 1AMFA 3FZVA 1B2HA 1TFDA 4E0WA 1IXGA 4WEDA 4NF6B 2AL5A 4R75A 2XXRA 3T96B 4G77A 3CFXA 2QMWA 1NNFA 2ABHA 3PUWE 1HSEA 1JEVA 5AA4A 3EPEA 4DXBA 3RUMA 2QS2A 1FQBA 1R9LA 3VVEA 3WAFA 1B46A 3DELB 2FA7A 3C33A 3OEMA 5H8HA 4IO3A 5BUUA 3OD7A 5AA2A 3PPPA 5F7VA 1DSNA 3Q27A 1N04A 4WXJA 4RPNA 1MG1A 3MAMA 3EQ1A 3KN8A 4R6KA 4O3CA 4JSOA 1P1QA 4XKRA 4LUBA 1B0LA 3JYRA 1NNKA 5JTYA 3FGSA 4UACA 4PFTA 3H06B 2F7CA 4AB5A 2F35A 1AOVA 1LAFE 1PB8A 2R6GE 2B3FA 4PFUA 4XIGQ 1HSLA 4MLQA 4YZZA 4GWOA 3TELA 3IAZA 3RQTA 2DVCA 2F5XA 4DE8A 3FATA 2I4BA 2VGQA 3VLVA 3KSJA 3D4CA 1SI1A 1F9BA 3S9EA 4BDOA 5I2NA 3IB1A 2UXAA 1GTKA 1R1NA 3H4ZA 3M3KA 5KCJB 4OFJA 1LFGA 5DT6A 2PBWA 3H03A 4KCDA 2Z8EA 1US5A 3R26A 1YPNA 2D21A 5M2VA 1MPBA 3K6WA 3CI8A 2XX8A 3CG3A 3TDJA 3IOTA 4QFNA 3RLFE 4G8NA 2XX7A 5ITOA 1Q35A 5TPAA 3O2AA 2X7PA 4MLVA 3RGYA 2O7IA 1RYOA 1I6BA 3RYBA 3C36A 4H6DA 4UA8A 3FV2A 2H99A 3O66A 3V8XB 1B6HA 3TTRA 3VE1B 3CIJA 3UGWA 4EDPA 3N5LA 4IGTA 2ANJA 1T0KA 2HXWA 4ZEKA 2ALUA 5FHOA 3O9PA 4ZEDA 1B1XA 1FQAA 4F22A 3DRJA 1B5IA 5H8NA 3W9WA 1YCJA 3TFLA 3QYTA 1Y4TA 2R71A 4XXUA 2Z8FA 4RXLA 4GXAA 4F1YA 4G68A 1B3EA 2V3UA 3U92A 2QJEA 2WOKA 1I6AA 3OENA 1B51A 5ICTA 4ZEFA 4ONYA 5H8FB 2DWJA 2I6EA 4N07A 1WDNA 5HPQA 2D5WA 3UA8A 3MVYA 4R2BA 2OLBA 2F7AA 1LBBA 4EF2A 2O51A 1Y3QA 3FJ7A 1OLCA 3L6HA 1LLSA 4R73A 2XHDA 2OK2A 1Z7NE 1Y3PA 2AL4A 1GVCA 1L5TA 2XXUA 1SDXA 4F3PA 2Z8DA 5K2YA 4ZS9A 3HPIA 1FQFA 2RCBA 1B40A 3RT8A 4NF5B 3O29A 2YPNA 2O7UA 4YMAA 4G2ZA 2Q8JA 2HEUA 3PPQA 5B7DA 4YKIA 4FATA 2RC9A 1LBCA 3I3VA 2REJA 3KOSA 2DE3A 4Z7EA 4FEBA 3LUYA 1ZBMA 3PUXE 3MBPA 2XXTA 1IUDA 3G7WA 1O64A 4F29A 3TCGA 1D3KA 2HFBA 1VFDA 5EHSA 2ZXTA 4KI0E 1A40A 2RC8A 4GXSB 1UTHA 1FTMA 4Q5TA 1N0TA 1Y9UA 2PT1A 4H0WA 4LA9A 2DYXA 4U1ZA 3D4GA 3TPAA 2QMXA 3MP6A 3B6TA 3TTKA 3E13X 5ELVA 2B4LA 4I9DA 1KWHA 2BJJX 4FE8A 4OERA 3KJTA 4DXUA 5CM6A 1DOTA 1JW1A 3GZGA 4RK2A 3FUZA 3OSRA 4RYAA 3EHSA 4X9TA 1UIVA 1OQGA 1B3FA 3RNNA 3MUQA 4OYVA 3O97A 1H43A 5H8SA 5AA4B 2H9BA 3V5AA 3LSFB 3TYHA 3FJMA 3G3FA 4F1UA 2PX1A 1IXIA 2UVIA 3IK6B 1MM7A 4R9GA 4K3FA 3GXAA 2Y84A 1H76A 4P0GA 2XXPA 3IB0A 3FVNA 3MWBA 1SW4A 3FXRA 1SYIA 4JWYA 1TWYA 4KFQA 1JW5A 3T9HB 3LSXA 1MXUA 4F3SA 3HCQA 3E9XA 4NMYA 4R72A 2DWIA 3KN3A 4R6HA 4RJZA 1H44A 3PMWA 4N6PA 4OVJA 2W7YA 1A55A 4R2FA 3CHGA 1XVXA 5EHMA 1MY1A 3MZBA 4ELQA 3E3KA 1B32A 3Q28A 5I59B 5ISUA 1TT1A 2X26A 3PPOA 1DPEA 3R7XA 2F6GA 3MP8A 3FXUA 3UP9A 5CMCA 2GHBA 4R9FA 5IKBA 3H6VA 3N26A 3LSWA 4FAJA 3PUZE 1UTBA 1TFAA 3T22A 4IY6A 4NTLA 1OVBA 2ZYKA 1MM6A 1GGGA 1FQEA 3K1NA 4NF4A 1QW0A 4QSCA 2P2AA 4U23A 4YU0A 2QPQA 4Q30B 4ZE8A 1B52A 4YB6A 4HS7A 4FJPA 4O3AA 1N3XA 3ODBA 4TLLB 2RF1A 5LOMA 2V3QA 4LQ5A 4G68C 2F7BA 1LCFA 1MY0A 1NL5A 5I2KA 4BDNA 4LVQA 2LAOA 1EZPA 3KN7A 3O6GA 3A3UA 2XXXA 3IB2A 2AYSA 3DM0A 2Q2CA 3RYAA 2A5TA 4G8MA 2B3BA 1DTGA 2DS9A 4OETA 2QS4A 1SW2A 3B6QA 3FD3A 3BBRA 4H5FA 1MRPA 1JVXA 2G93A 1MQJA 2Q2AA 2VD3A 1EH3A 3TAJA 4RPOA 3KOTA 2DE4A 2F36A 5A5XB 1SW5A 3TCFA 2DSFA 1MS7A 5I58A 1VR5A 1B3HA 1FCKA
chains in the Genus database with same CATH superfamily
4H5GA 4BLAA 3QAXA 4KHZE 2QS3A 3SEUA 4ECFA 4XKNA 1Y1ZA 3HO7A 2CZLA 1LAXA 4YB5A 3N94A 3MVXA 3K02A 3CVGA 4KD5A 5DEXB 4QFKA 3SETA 4NF8B 2F8DA 3EF7A 4ISUA 4O7IA 5KDTB 3QXMA 2Y7WA 3FTOA 4JXIA 3VXCA 4OZ9A 4GIZA 2DE2A 5TP9A 2GHAA 4PAIA 3K4UA 1IMCA 1MY3A 2XXIA 3PD9A 1LAHE 4I3EA 4GFRA 3SKPA 4I62A 2XD2A 4PFYA 3F11A 2KQZA 1USYE 2V4CA 3ROJA 1FTKA 3U1OA 4JDFA 4U21A 1VFEA 1UQWA 1D9YA 1II5A 1URDA 2GH9A 1FBGA 2XXYA 4MNIA 4MHFA 1GV8A 4JVCA 4HW8A 4IO6A 4M1VA 3K6XA 1A8FA 1OMPA 3ONMA 5AE4A 1DPPA 3USDA 4KR5A 1B05A 3KGCA 3T9VA 3UORA 4F3GA 1QULA 2QVVA 4GF8A 4QFPA 4NE4A 1FPFA 5CMKA 3EKIA 1MDP1 2HZLA 4H67A 4N6KA 4NG7A 4OESA 1NH8A 4ESXA 2YJPA 4DDDA 1SBPA 3K01A 1MQIA 4N13A 1NNPA 3MW0A 5DVFA 5I56A 3PAMA 2GFEA 3HV1A 4I1DA 3FXBA 2H25A 2GRVA 5H8QA 4ZZEA 3C34A 3T9XB 4P1LA 3TTLA 3BFUA 4RK9A 1B3GA 1MY2A 4YB7A 3LV0A 3DRIA 1HSJA 4QF9A 3MSTA 5ITPA 5I57A 3BKIB 1LB9A 1INPA 4F31B 4QXDA 5FHMA 1RDZA 1FBDA 4X1DA 4F2QA 2WYKA 1MQDA 2P0SA 2Y7KA 4U2RA 3PD8A 4WEPA 3DRKA 1B1HA 4ZZAA 2ZNTA 4IO7A 3VV5A 4NF6A 2R9JA 1B9JA 2PFZA 4OFLA 1DCUA 3C31A 4OENA 3OO9A 4I8CA 2Y7RA 1EYJA 3G3IA 3RPWA 2O84X 1M5EA 1WVJA 1POTA 3OEKA 2DVZA 4KXPA 3VDFA 1MY4A 2CZIA 3FBPA 1FBEA 4MH5A 5L9MA 1MH4A 3SEWA 4PCDA 4H8JA 5CMMA 2QSXA 4DCYA 4F3BA 3KFMA 2OCUA 4YMBA 4ELPA 3FXQA 3DRHA 4XEQA 1XI6A 5ET5A 2V3TA 4HCYA 1YTVA 1DTZA 4EXKA 1FPDA 1Z7ME 2WOLA 1Y20A 2ZYMA 2NOOA 1WODA 5EQ9A 1PC3A 4PETA 4P47A 2FIXA 4PF8A 1M5FA 1JP4A 2WBDA 1O7TA 2HXRA 4UABA 1LGBC 3H6TA 3O28A 4QBAA 3C32A 4MF3A 1PBPA 2V93A 5K2XA 2Q9TA 4X8RA 4ESWA 3O6IA 2ZYOA 4PAKA 4GWZA 4PFRA 3H7MA 4YICA 3G3JA 4GBWA 4FORA 4PDHA 3H6WA 3T9UA 2B65A 3S9NC 1P1WA 1MPDA 2REGA 4O94A 1ZU0A 3SDFA 3VLWA 1EZOA 3K1PA 4QFLA 5AA2D 3TTNA 5J1DA 1SPIA 2HAVA 5I2KB 5I3SA 3MVZA 4OFOA 4LZ5A 3S4UA 2Q89A 2VPOA 3FVOA 4HE0A 4RY1A 5KCJA 1BP5A 4BDMA 3LUZA 4P11A 3RT6B 5IZ3A 1ELJA 4ZEIA 3HSTA 4OMBA 3PUYE 4IO2A 3C4MA 4LP2B 4PBQA 1A54A 3OO8A 3U8QA 3GYYA 2NVUB 4BDRA 2O1LA 1B3LA 3IO4A 3SESA 5CRYA 5CC2A 3MPLA 3HN0A 4G8HA 2I48A 3DP8A 4QRZA 1OLAA 3C35A 3JZJA 4GWUA 3TKDA 3FVGA 1AIVA 4PE5B 4DI3D 3EHTA 5H8HB 4EQ9A 1B7HA 3MQ9A 4U1OA 3ZS6A 5AA2B 2I58A 3SEYA 1JQFA 4OEVA 3R6UA 3KEIA 4IO4A 2Q88A 1VSOA 2I0CA 3O6HA 2A5SA 3MPKA 1SQYA 5HBCA 1JW4A 3DRFA 2NUVA 2VOZA 3LC8A 1M5DA 1KA0A 3CFZA 5JTYB 2Q8MA 1FQCA 1B4HA 4NGUA 3FV1A 2FHYA 1IMAA 1DK4A 1RDXA 3ILTB 4ZDMA 3AXFA 5H8FA 1MXVA 4BDQA 1FW0A 2E0SA 2HAUA 5EYFA 3RPLA 3KZGA 3G3KA 3ISPA 3K6UA 4LZ7A 4MEVA 3T66A 1G0HA 3TMGA 1NKXA 4MIJA 4BDLA 4JB7A 1KZ8A 4WKMA 1IITA 2WBBA 2I3VA 5DVIA 4OVTA 1D9QA 3IR1A 1ANFA 1FTLA 4EF1A 5TP9B 4OA4A 2P3VA 1XOCA 4EXLA 4PBHA 4PP0A 3WAEA 3IOWA 5I2NB 3OO7A 3SERA 2F6PA 2O6AA 3FASA 1QUKA 2F78A 4NF5A 5A5LA 2F34A 5FBPA 4O3BA 2Y5KA 4KYEA 4P8BA 1MQGA 1MDQA 4FIMA 2OWZA 5EQ8A 1EZ9A 5DYHA 4GQOA 3Q26A 4H65A 4LQ2A 3ZSFA 1QJMA 1FBFA 2H4IA 2OBGA 1JEUA 1N7XA 1R9QA 1IEJA 4C1UA 2I0BA 1PBQA 3DRGA 3ECRA 5TPAB 1FTAA 1MXZA 3I5OA 4YKKA 2YLNA 1FTJA 1LB8A 4KCCA 1PEBA 1P99A 3RY3A 1S9TA 4DZ1A 2PFYA 4NN3A 1A8EA 5B70A 5DW8A 4KYDA 3GBBA 1MPCA 3OMBA 3KSXA 3KJ7A 4POWA 4DLDA 4F2OA 3UIFA 1BTJA 3VXBA 5H8NB 2RINA 3TUSA 1SYHA 3K0VA 1M5CA 2RC7A 1PDAA 1MXYA 4N8YA 1XVYA 4POXA 1QVSA 2I49A 2VHAA 4F1VA 1NUYA 4G68B 2KLFA 4IO5A 4H1XA 3MYUA 1QUIA 2WKYA 4GWWA 1FBPA 3TQLA 5JEIA 3IJOB 4OQOA 2DQVA 1ZKBA 5EQAA 3IORA 1B4ZA 2XX9A 1R6ZA 1SW1A 3KG2A 2V25A 2DXYA 2QS1A 2R8TA 5LTCA 1NV0A 2V84A 4OVSA 3TEPA 2UVGA 4MFIA 3K2DA 1OVTA 5CMBA 3TQWA 3IOUA 4PQJA 3KC1A 3MP1A 2ZNSA 3CFLA 3W9VA 1B0HA 3IO6A 1VE4A 3KBRA 3RN8A 2ZMBA 2CEXA 1XT8A 2Z23A 4E0XA 3PMXA 4L17A 1EYIA 3ZKLA 4Q8RA 2KR0A 3IJXB 1N7WA 1NNTA 4IY5A 3CSGA 4NEDA 3S9MC 4KYSA 5ET6A 1ATGA 1N84A 3U72A 1XC1A 1TXFA 2ZYNA 4NHBA 1LCTA 2I4CA 3I6VA 5CI5A 2Y7IA 1NI9A 2XA5A 5I59A 4EUOA 3M8UA 1NV7A 3ILUB 1MH3A 4XTCQ 2FYIA 4PC9A 2DXRA 3H3GA 2THIA 4AQ4A 3IFCA 1UTHB 4GL8A 2XWKA 1MXXA 4P0IA 4XFEA 3RTFB 5I84A 4GL0A 4LN5A 2OWSA 1IZ1A 1XS5A 4TLMB 5AA3A 2AIXA 2ONKE 3LR1A 4JBZA 1AH5A 1BIYA 2F97A 4OHNA 2QRYA 3LBSA 1I6QA 1QKAA 4QHQA 2Y7PA 5IZ1A 3HHFA 3RYDA 3JV9A 3CSBA 1POY1 3GLBA 5FTHA 1IXCA 1D9VA 2H98A 4G4PA 4KPTA 2ZZVA 1JNFA 3TZAA 4MX6A 3FJGA 3IL1B 4M4GA 3E78A 5I7IA 1S7YA 3U94A 3U93A 2B4MA 2OWTA 2I3WA 1ZTYA 2ONRA 2XXVA 3MZ9A 3EN3A 1LSTA 2IA4A 4R74A 4MCOA 3G3GA 4QSEA 3CG1A 1N3WA 3IOVA 4OWDA 1FPLA 3QK6A 1RYXA 1NUXA 5HM4B 2WX9A 1LAGE 4XF5A 5KZTA 1DBZA 2NWJA 2HCAA 1GR2A 2CMOA 1DMBA 1QUJA 3S2VA 1B7ZA 3FVKA 4LZ8A 4IB2A 2HPGA 2PVUA 4U4SA 4OTEA 3QIMA 1M5BA 2IEEA 1JVYA 3MVWA 3K1MA 4HE1A 4NF0A 3RPLB 4F18A 1Y3NA 1Y1MA 4HCWA 4KQPA 5A5XA 2E1SA 4C0RA 1JETA 3A3CA 3VVDA 3VVFA 1P1OA 4N91A 4MBPA 3SEXA 4H8IA 2O1MA 3A29A 3N6UA 2UVJA 4U4XA 3TODA 3V83A 2FNCA 2ZZXA 3GBAA 5ESYA 2ONSA 1SD3A 5J16A 3PMVA 3G3HA 1EU8A 2HQ0A 4PAFA 2P1SA 1UIUA 1LBZA 1NUWA 4ELRA 1FPEA 1UTBB 3L6GA 1J1NA 3UN6A 3CRBA 3V89B 4PFWA 5DEXA 3OELA 1AWBA 1SVXB 4NF4B 4JSDA 4RA1A 4NF8A 3DP4A 4I3YA 2X7QA 2RKMA 2UVHA 5KDTA 3PGFA 4OANA 2WOPA 4F19A 5CBSA 1G0IA 1PB7A 1QKBA 1NV5A 1ZLQA 4LATA 1CE2A 4YKPA 4R6YA 1RKMA 2XXKA 1IIWA 2H5YA 4GD5A 1IXHA 1CB6A 1URSA 5AA1A 3B6WA 1USYH 1MQHA 1A7LA 1P1UA 1S50A 5DTBA 1B7UA 3PV0E 4XKQA 5FHNA 4MAGA 5L9OA 4LONB 3BFTA 2DWAA 1MXWA 4GBVA 2A5TB 3B7DA 3T93B 1FTOA 4TOZA 3O6PA 3DLNA 5L9SA 1NV6A 4MNPA 1YAEA 3LVUA 4HTGA 2UYFA 4ELOA 2UYEA 5I5PA 2XWVA 4RNSA 2CEYA 2ESNA 4X48A 2O69A 3OSQA 4QFOA 1NFTA 2Z22A 3IX1A 3UK4A 3C9HA 5JK4A 2PYYA 5F1QA 2XD3A 1SI0A 4YAHX 4U22A 1N76A 2PCRA 1P1NA 3QUFA 4NWDA 1B58A 1B5JA 4PFBA 3MZ1A 4IGRA 1FQDA 1AL3A 5I58B 2XXHA 2G29A 3QUJA 4QSDA 3EHUA 4JWOA 3A09A 4GWXA 3W15C 5BWJA 3SZPA 4FECA 1IQ7A 4FBPA 3S9LC 1OIBA 1I69A 1ZMGA 1B5HA 3M3LA 1ZJLA 4FEDA 3DP6A 3LSLA 5ET7A 4P1EA 2D3IA 4GLIA 4OVRA 4ZE9A 3NOHA 2DDKA 1FPKA 3Q29A 4GOTA 5ICQA 1H3DA 4ND9A 5IAIA 3VFJA 4F39A 4ZECA 3HHGA 4NWCA 3ZKKA 4N6DA 4C1TA 4NX1A 1YXIA 4GRKA 4DIGA 4THIA 2XXWA 5DVJA 4JWXA 3FIRA 4EQBA 3BIGA 5L8DA 3MJNA 4TQUQ 3D1RA 3PU5A 2VPNA 3H6UA 2OZZA 3TCHA 5FTIA 4OXVA 1BKAA 4DCXA 1OQHA 2NXOA 3OOAA 1PB9A 4DXCA 3Q25A 1LBVA 2M8CA 2OX3A 2ZNUA 3TTMA 4ZEBA 1US4A 3PUVE 4XKPA 3VLUA 3PPRA 3P7IA 1K9ZA 3M3FA 3OO6A 1BLFA 2OJTA 4EQ7A 1O63A 1H45A 1LFIA 1XHYA 4YKJA 2PMSA 3N6TA 2DWHA 4OEUA 3RTWB 2PT2A 3SEVA 4MNCA 1D4NA 3K00A 1A99A 2QL3A 3K6VA 2VD2A 4GWSA 5CBRA 1IMBA 2O68A 4AB6A 3CR9A 5I56B 4GVOA 3PPNA 1Q1KA 2VP1A 5H8QB 2DOJA 3E4RA 1Y4CA 4G61A 2RCAA 5TU0A 1URGA 1NMUA 2HZKA 4X1BA 4Z0IA 4PGPA 1ZIUA 4OVQA 2XWIA 3MC2A 3QSLA 2DP8A 1LFHA 1VDWA 2XXQA 3THIA 4Q0CA 1NH7A 5I57B 4PF6A 2HHMA 1LBYA 3OXNA 1AMFA 3FZVA 1B2HA 1TFDA 4E0WA 1IXGA 4WEDA 4NF6B 2AL5A 4R75A 2XXRA 3T96B 4G77A 3CFXA 2QMWA 1NNFA 2ABHA 5IGAA 3PUWE 1FPGA 1HSEA 1LBXA 1FRPA 1JEVA 3KC0A 2CZHA 5AA4A 3EPEA 4DXBA 3RUMA 2QS2A 1FQBA 1R9LA 3VVEA 3WAFA 1B46A 3DELB 2FA7A 3C33A 3OEMA 5H8HA 1QGXA 4IO3A 5BUUA 1NV2A 3OD7A 3PPPA 5AA2A 5F7VA 1DSNA 3Q27A 1N04A 4WXJA 4RPNA 1MG1A 3MAMA 3EQ1A 3KN8A 4R6KA 3KBZA 5LDZA 4O3CA 4JSOA 1P1QA 4XKRA 4LUBA 1B0LA 3JYRA 1NNKA 4PE3A 5JTYA 3FGSA 4UACA 4PFTA 3H06B 2F7CA 4AB5A 2F35A 1AOVA 1LAFE 1PB8A 2R6GE 4OVPA 2B3FA 4PFUA 4XIGQ 4N4UA 1FBHA 1HSLA 4MLQA 4YZZA 2F3DA 4GWOA 1FPBA 3TELA 3IAZA 4JVIA 3RQTA 4GX6A 2DVCA 2F5XA 4DE8A 3FATA 4MMPA 2I4BA 2VGQA 3VLVA 3KSJA 3D4CA 5IZZA 1SI1A 2Q74A 1F9BA 3S9EA 4BDOA 5I2NA 3IB1A 1IMEA 2UXAA 1GTKA 1R1NA 1FJ6A 3BIHA 3H4ZA 3M3KA 5KCJB 4OFJA 1LFGA 5DT6A 2PBWA 3H03A 2WYPA 4KCDA 5IZ3B 2Z8EA 1US5A 3R26A 5EYHA 1YPNA 2D21A 5M2VA 1MPBA 3PTYA 2MKZA 3K6WA 4I40A 3CI8A 2XX8A 1FSAA 3CG3A 3TDJA 3IOTA 4QFNA 2L5VA 1IMDA 3RLFE 4G8NA 2XX7A 5ITOA 1Q35A 5TPAA 3O2AA 2X7PA 4MLVA 4X04A 3RGYA 2O7IA 1RYOA 1I6BA 3RYBA 3C36A 4H6DA 4UA8A 3FV2A 2H99A 3E79A 3O66A 3V8XB 1B6HA 3TTRA 4AS5A 3VE1B 3CIJA 2VT5A 3UGWA 3IFAA 4EDPA 3N5LA 4IGTA 2ANJA 1T0KA 2HXWA 4ZEKA 2ALUA 4JVDA 5FHOA 3T0JA 3O9PA 4ZEDA 1B1XA 1FQAA 4F22A 3DRJA 1B5IA 5H8NA 3W9WA 1YCJA 3TFLA 3QYTA 1Y4TA 2R71A 4XXUA 1RDYA 2Z8FA 4RXLA 4GXAA 2QVUA 4F1YA 2XWOA 4G68A 1YZ0A 1B3EA 2V3UA 3U92A 2QJEA 2WOKA 1I6AA 3OENA 1B51A 5ICTA 4ZEFA 4ONYA 5H8FB 2DWJA 2I6EA 4AS4A 3QMFA 4N07A 1WDNA 5HPQA 2D5WA 3UA8A 3MVYA 4R2BA 2OLBA 2F7AA 1LBBA 4EF2A 3U65A 1EYKA 2O51A 1Y3QA 3FJ7A 1OLCA 3L6HA 1LLSA 4R73A 2XHDA 2OK2A 1Z7NE 4O8MA 1Y3PA 2AL4A 1GVCA 1L5TA 2XXUA 1SDXA 4F3PA 2Z8DA 5K2YA 4ZS9A 3HPIA 1FQFA 1K9YA 2RCBA 1LBWA 1B40A 3RT8A 4NF5B 5IM2A 3O29A 2YPNA 2O7UA 4YMAA 4G2ZA 2Q8JA 4PFIA 2HEUA 3PPQA 5B7DA 4YKIA 1NV4A 4FATA 2RC9A 1KA1A 1LBCA 3I3VA 2REJA 1FPJA 3KOSA 2DE3A 4Z7EA 4FEBA 3LUYA 1ZBMA 5ET8A 3PUXE 3MBPA 2XXTA 1IUDA 4PGNA 4P56A 3G7WA 1O64A 4O7MA 4F29A 3TCGA 1D3KA 2HFBA 1VFDA 5EHSA 3B50A 2ZXTA 3T1BA 4N81A 4KI0E 1A40A 2RC8A 4GXSB 1UTHA 1FTMA 2FVZA 4Q5TA 1N0TA 1Y9UA 2PT1A 4GWYA 4N8GA 4H0WA 4LA9A 4N17A 2DYXA 4U1ZA 3D4GA 3TPAA 2QMXA 3MP6A 3B6TA 3TTKA 3E13X 2WEFA 5ELVA 2B4LA 4I9DA 1KWHA 2BJJX 4FE8A 1FPIA 4OERA 3KJTA 4DXUA 5CM6A 1DOTA 1JW1A 3GZGA 4RK2A 3FUZA 3HFUA 3OSRA 4H46A 4RYAA 3EHSA 4X9TA 1UIVA 1OQGA 4HXVA 4MJOA 1B3FA 3RNNA 3MUQA 4OYVA 3O97A 1FJ9A 5F24A 1H43A 5H8SA 5AA4B 2H9BA 3V5AA 3B8BA 2CZKA 3LSFB 3TYHA 3FJMA 4GX3A 1LEVA 3G3FA 4F1UA 4NAPA 2PX1A 1IXIA 2UVIA 3IK6B 1MM7A 4R9GA 4K3FA 3GXAA 2JJKA 2Y84A 5EQ7A 1H76A 4P0GA 2XXPA 3IB0A 3FVNA 3MWBA 1SW4A 3FXRA 1SYIA 4JWYA 4PTKA 1TWYA 4KFQA 1JW5A 3T9HB 3LSXA 1MXUA 4F3SA 3HCQA 3E9XA 4NMYA 4R72A 1BK4A 2DWIA 3KN3A 4R6HA 4RJZA 1H44A 3PMWA 4N6PA 4OVJA 2W7YA 2GQ1A 1A55A 5T3JA 4R2FA 3CHGA 1XVXA 5EHMA 1MY1A 3MZBA 4ELQA 3E3KA 1B32A 3Q28A 5I59B 2ZZWA 4DI4B 5ISUA 1TT1A 2X26A 3PPOA 1DPEA 3R7XA 2F6GA 3MP8A 3FXUA 3UP9A 5CMCA 5EYGA 2GHBA 4R9FA 5IKBA 3H6VA 1YYZA 3N26A 1FBCA 3LSWA 4FAJA 3PUZE 1UTBA 1TFAA 3T22A 4IY6A 4P3LA 4NTLA 1OVBA 2ZYKA 1Q9DA 1MM6A 1GGGA 1FQEA 3K1NA 4NF4A 1QW0A 4NQ8A 4QSCA 2P2AA 4U23A 4YU0A 2QPQA 4Q30B 4ZE8A 1B52A 2QVRA 4YB6A 4HS7A 4FJPA 4O3AA 1N3XA 2BJIA 3ODBA 4TLLB 2RF1A 5LOMA 2V3QA 4LQ5A 4G68C 2F7BA 1LCFA 1MY0A 2FBPA 1NL5A 5I2KA 4BDNA 1CNQA 4LVQA 4N15A 2LAOA 1EZPA 3KN7A 4IR8A 2Y5LA 1NV1A 3O6GA 1NUZA 3A3UA 2XXXA 3IB2A 2AYSA 3DM0A 2Q2CA 4H45A 4HE2A 3RYAA 2A5TA 4G8MA 2B3BA 4PDDA 1DTGA 2DS9A 4OETA 1NV3A 2QS4A 4P9KA 4GX4A 1SW2A 3B6QA 3FD3A 3BBRA 4H5FA 1MRPA 1JVXA 2F3BA 2G93A 1MQJA 2FIEA 2QFLA 2Q2AA 2VD3A 1EH3A 3TAJA 4RPOA 2P3NA 3KOTA 2DE4A 2F36A 5A5XB 1SW5A 3TCFA 2DSFA 1MS7A 5I58A 1IMFA 1VR5A 1B3HA 1FCKA
chains in the Genus database with same CATH topology
4H5GA 4BLAA 3QAXA 4KHZE 2QS3A 3SEUA 4ECFA 4XKNA 1Y1ZA 3HO7A 2CZLA 1LAXA 4YB5A 3N94A 3MVXA 3K02A 3CVGA 4KD5A 5DEXB 4QFKA 3SETA 4NF8B 2F8DA 3EF7A 4ISUA 5KDTB 3QXMA 2Y7WA 3FTOA 4JXIA 3VXCA 4OZ9A 4GIZA 2DE2A 5TP9A 2GHAA 3K4UA 1MY3A 2XXIA 3PD9A 1LAHE 4GFRA 3SKPA 4I62A 2XD2A 4PFYA 3F11A 1USYE 1FTKA 3U1OA 4JDFA 4U21A 1VFEA 1UQWA 1D9YA 1II5A 1URDA 2GH9A 2XXYA 1GV8A 4HW8A 4IO6A 4M1VA 3K6XA 1A8FA 1OMPA 3ONMA 5AE4A 1DPPA 3USDA 4KR5A 1B05A 3KGCA 3T9VA 3UORA 4F3GA 1QULA 4GF8A 4QFPA 4NE4A 5CMKA 1MDP1 2HZLA 4H67A 4OESA 1NH8A 4ESXA 2YJPA 4DDDA 1SBPA 3K01A 1MQIA 4N13A 1NNPA 3MW0A 5DVFA 5I56A 3PAMA 2GFEA 3HV1A 4I1DA 2H25A 2GRVA 5H8QA 4ZZEA 3C34A 3T9XB 3TTLA 3BFUA 4RK9A 1B3GA 1MY2A 4YB7A 3DRIA 1HSJA 4QF9A 5ITPA 5I57A 3BKIB 1LB9A 4F31B 5FHMA 4X1DA 4F2QA 1MQDA 2P0SA 2Y7KA 4U2RA 3PD8A 4WEPA 3DRKA 1B1HA 4ZZAA 2ZNTA 4IO7A 3VV5A 4NF6A 2R9JA 1B9JA 4OFLA 3C31A 4OENA 3OO9A 4I8CA 2Y7RA 3G3IA 3RPWA 2O84X 1M5EA 1WVJA 1POTA 3OEKA 2DVZA 3VDFA 1MY4A 4MH5A 5L9MA 1MH4A 3SEWA 4H8JA 5CMMA 2QSXA 4DCYA 4F3BA 3KFMA 2OCUA 4YMBA 4ELPA 3FXQA 3DRHA 2V3TA 4HCYA 1YTVA 1DTZA 4EXKA 1Z7ME 2WOLA 1Y20A 2ZYMA 2NOOA 1WODA 1PC3A 4PETA 1M5FA 1O7TA 1LGBC 3H6TA 3O28A 3C32A 4MF3A 1PBPA 2V93A 5K2XA 2Q9TA 4ESWA 3O6IA 2ZYOA 3H7MA 4YICA 3G3JA 4FORA 3H6WA 3T9UA 2B65A 3S9NC 1P1WA 1MPDA 2REGA 3SDFA 1ZU0A 3VLWA 1EZOA 3K1PA 4QFLA 5AA2D 3TTNA 5J1DA 2HAVA 5I2KB 3MVZA 4OFOA 4LZ5A 3S4UA 2Q89A 3FVOA 4RY1A 5KCJA 1BP5A 4BDMA 4P11A 3RT6B 1ELJA 4ZEIA 3HSTA 4OMBA 3PUYE 4IO2A 3C4MA 4LP2B 1A54A 3OO8A 3U8QA 2NVUB 4BDRA 2O1LA 1B3LA 3IO4A 3SESA 5CRYA 5CC2A 3MPLA 3HN0A 4G8HA 2I48A 3DP8A 4QRZA 1OLAA 3C35A 3JZJA 3TKDA 3FVGA 1AIVA 4PE5B 3EHTA 5H8HB 4EQ9A 1B7HA 3MQ9A 4U1OA 3ZS6A 5AA2B 2I58A 3SEYA 1JQFA 4OEVA 3R6UA 3KEIA 4IO4A 2Q88A 1VSOA 2I0CA 3O6HA 2A5SA 3MPKA 1SQYA 5HBCA 1JW4A 3DRFA 2NUVA 2VOZA 3LC8A 1M5DA 3CFZA 5JTYB 1FQCA 1B4HA 3FV1A 3ILTB 4ZDMA 3AXFA 5H8FA 1MXVA 4BDQA 1FW0A 2E0SA 2HAUA 5EYFA 3KZGA 3G3KA 3K6UA 4LZ7A 3T66A 3TMGA 1NKXA 4BDLA 4JB7A 4WKMA 1IITA 2I3VA 5DVIA 3IR1A 1ANFA 1FTLA 4EF1A 5TP9B 1XOCA 4EXLA 4PP0A 3WAEA 3IOWA 5I2NB 3OO7A 3SERA 2F6PA 2O6AA 3FASA 1QUKA 2F78A 4NF5A 2F34A 4O3BA 4KYEA 1MQGA 1MDQA 4FIMA 1EZ9A 5DYHA 4GQOA 3Q26A 4H65A 4LQ2A 3ZSFA 1QJMA 2H4IA 2OBGA 1JEUA 1N7XA 1R9QA 1IEJA 4C1UA 2I0BA 1PBQA 3DRGA 3ECRA 5TPAB 1MXZA 3I5OA 4YKKA 2YLNA 1FTJA 1LB8A 4KCCA 1PEBA 1P99A 3RY3A 1S9TA 4DZ1A 1A8EA 5B70A 4KYDA 3GBBA 1MPCA 3OMBA 3KSXA 3KJ7A 4POWA 4DLDA 4F2OA 3UIFA 1BTJA 3VXBA 5H8NB 2RINA 3TUSA 1SYHA 3K0VA 1M5CA 2RC7A 1PDAA 1MXYA 1XVYA 4POXA 1QVSA 2I49A 2VHAA 4F1VA 4G68B 2KLFA 4IO5A 4H1XA 1QUIA 2WKYA 3TQLA 5JEIA 3IJOB 4OQOA 2DQVA 1ZKBA 3IORA 1B4ZA 2XX9A 1R6ZA 1SW1A 3KG2A 2V25A 2DXYA 2QS1A 2V84A 3TEPA 2UVGA 4MFIA 3K2DA 1OVTA 3TQWA 5CMBA 3IOUA 4PQJA 3MP1A 2ZNSA 3CFLA 3W9VA 1B0HA 3IO6A 1VE4A 3KBRA 3RN8A 2ZMBA 1XT8A 2Z23A 4E0XA 3PMXA 4L17A 3ZKLA 4Q8RA 3IJXB 1N7WA 1NNTA 4IY5A 3CSGA 4NEDA 3S9MC 4KYSA 1ATGA 1N84A 3U72A 1XC1A 1TXFA 2ZYNA 1LCTA 2I4CA 3I6VA 5CI5A 2Y7IA 5I59A 4EUOA 3M8UA 3ILUB 1MH3A 4XTCQ 2FYIA 2DXRA 3H3GA 2THIA 4AQ4A 1UTHB 4GL8A 1MXXA 4P0IA 3RTFB 5I84A 4GL0A 2OWSA 1IZ1A 1XS5A 4TLMB 5AA3A 2AIXA 2ONKE 3LR1A 4JBZA 1AH5A 1BIYA 2F97A 4OHNA 2QRYA 3LBSA 1I6QA 1QKAA 4QHQA 2Y7PA 3HHFA 3JV9A 3CSBA 1POY1 3GLBA 5FTHA 1IXCA 1D9VA 2H98A 4G4PA 4KPTA 1JNFA 3TZAA 3FJGA 3IL1B 4M4GA 1S7YA 3U94A 3U93A 2B4MA 2OWTA 2I3WA 1ZTYA 2ONRA 2XXVA 3MZ9A 3EN3A 1LSTA 2IA4A 4R74A 3G3GA 4QSEA 3CG1A 1N3WA 3IOVA 4OWDA 3QK6A 1RYXA 5HM4B 1LAGE 5KZTA 2NWJA 2HCAA 1GR2A 2CMOA 1DMBA 1QUJA 3S2VA 1B7ZA 3FVKA 4LZ8A 4IB2A 2PVUA 4U4SA 4OTEA 3QIMA 1M5BA 2IEEA 1JVYA 3MVWA 3K1MA 4F18A 1Y3NA 1Y1MA 4HCWA 4KQPA 5A5XA 2E1SA 4C0RA 1JETA 3A3CA 3VVDA 3VVFA 1P1OA 4MBPA 3SEXA 4H8IA 2O1MA 3N6UA 2UVJA 4U4XA 3TODA 3V83A 2FNCA 3GBAA 2ONSA 1SD3A 3PMVA 3G3HA 1EU8A 2HQ0A 2P1SA 1UIUA 4ELRA 1UTBB 3L6GA 1J1NA 3UN6A 3CRBA 3V89B 4PFWA 5DEXA 3OELA 1SVXB 4NF4B 4JSDA 4RA1A 4NF8A 3DP4A 2X7QA 2RKMA 2UVHA 5KDTA 3PGFA 2WOPA 4F19A 5CBSA 1PB7A 1QKBA 1ZLQA 4LATA 1CE2A 4YKPA 4R6YA 1RKMA 1IIWA 2H5YA 4GD5A 1IXHA 1CB6A 1URSA 5AA1A 3B6WA 1USYH 1MQHA 1A7LA 1P1UA 1S50A 5DTBA 1B7UA 3PV0E 4XKQA 5FHNA 5L9OA 4LONB 3BFTA 2DWAA 1MXWA 2A5TB 3B7DA 3T93B 1FTOA 4TOZA 3O6PA 3DLNA 5L9SA 1YAEA 3LVUA 4HTGA 2UYFA 4ELOA 2UYEA 4RNSA 2ESNA 4X48A 2O69A 3OSQA 4QFOA 1NFTA 2Z22A 3IX1A 3UK4A 3C9HA 5JK4A 2PYYA 5F1QA 2XD3A 1SI0A 4YAHX 4U22A 1N76A 1P1NA 3QUFA 4NWDA 1B58A 1B5JA 3MZ1A 4IGRA 1FQDA 1AL3A 5I58B 2XXHA 2G29A 3QUJA 4QSDA 3EHUA 4JWOA 3A09A 3W15C 5BWJA 4FECA 1IQ7A 3S9LC 1OIBA 1I69A 1ZMGA 1B5HA 3M3LA 1ZJLA 4FEDA 3DP6A 3LSLA 2D3IA 4GLIA 4ZE9A 3Q29A 4GOTA 5ICQA 1H3DA 4ND9A 5IAIA 3VFJA 4F39A 4ZECA 3HHGA 4NWCA 3ZKKA 4C1TA 4DIGA 4GRKA 4THIA 2XXWA 5DVJA 4JWXA 3FIRA 4EQBA 5L8DA 3MJNA 4TQUQ 3PU5A 3H6UA 2OZZA 3TCHA 5FTIA 4OXVA 1BKAA 4DCXA 1OQHA 2NXOA 3OOAA 1PB9A 4DXCA 3Q25A 2M8CA 2ZNUA 3TTMA 4ZEBA 1US4A 3PUVE 4XKPA 3VLUA 3PPRA 3P7IA 3M3FA 3OO6A 1BLFA 2OJTA 4EQ7A 1O63A 1H45A 1LFIA 1XHYA 4YKJA 2PMSA 3N6TA 2DWHA 4OEUA 3RTWB 2PT2A 3SEVA 1D4NA 3K00A 1A99A 2QL3A 3K6VA 2VD2A 5CBRA 2O68A 4AB6A 3CR9A 5I56B 4GVOA 3PPNA 1Q1KA 2VP1A 5H8QB 2DOJA 3E4RA 1Y4CA 2RCAA 5TU0A 1URGA 1NMUA 2HZKA 4X1BA 4Z0IA 1ZIUA 3MC2A 3QSLA 2DP8A 1LFHA 3THIA 2XXQA 4Q0CA 1NH7A 5I57B 3OXNA 1AMFA 3FZVA 1B2HA 1TFDA 4E0WA 1IXGA 4WEDA 4NF6B 2AL5A 4R75A 2XXRA 3T96B 4G77A 3CFXA 2QMWA 1NNFA 2ABHA 3PUWE 1HSEA 1JEVA 5AA4A 3EPEA 4DXBA 3RUMA 2QS2A 1FQBA 1R9LA 3VVEA 3WAFA 1B46A 3DELB 2FA7A 3C33A 3OEMA 5H8HA 4IO3A 5BUUA 3OD7A 5AA2A 3PPPA 5F7VA 1DSNA 3Q27A 1N04A 4WXJA 4RPNA 1MG1A 3MAMA 3EQ1A 3KN8A 4R6KA 4O3CA 4JSOA 1P1QA 4XKRA 4LUBA 1B0LA 3JYRA 1NNKA 5JTYA 3FGSA 4UACA 4PFTA 3H06B 2F7CA 4AB5A 2F35A 1AOVA 1LAFE 1PB8A 2R6GE 2B3FA 4PFUA 4XIGQ 1HSLA 4MLQA 4YZZA 4GWOA 3TELA 3IAZA 3RQTA 2DVCA 2F5XA 4DE8A 3FATA 2I4BA 2VGQA 3VLVA 3KSJA 3D4CA 1SI1A 1F9BA 3S9EA 4BDOA 5I2NA 3IB1A 2UXAA 1GTKA 1R1NA 3H4ZA 3M3KA 5KCJB 4OFJA 1LFGA 5DT6A 2PBWA 3H03A 4KCDA 2Z8EA 1US5A 3R26A 1YPNA 2D21A 5M2VA 1MPBA 3K6WA 3CI8A 2XX8A 3CG3A 3TDJA 3IOTA 4QFNA 3RLFE 4G8NA 2XX7A 5ITOA 1Q35A 5TPAA 3O2AA 2X7PA 4MLVA 3RGYA 2O7IA 1RYOA 1I6BA 3RYBA 3C36A 4H6DA 4UA8A 3FV2A 2H99A 3O66A 3V8XB 1B6HA 3TTRA 3VE1B 3CIJA 3UGWA 4EDPA 3N5LA 4IGTA 2ANJA 1T0KA 2HXWA 4ZEKA 2ALUA 5FHOA 3O9PA 4ZEDA 1B1XA 1FQAA 4F22A 3DRJA 1B5IA 5H8NA 3W9WA 1YCJA 3TFLA 3QYTA 1Y4TA 2R71A 4XXUA 2Z8FA 4RXLA 4GXAA 4F1YA 4G68A 1B3EA 2V3UA 3U92A 2QJEA 2WOKA 1I6AA 3OENA 1B51A 5ICTA 4ZEFA 4ONYA 5H8FB 2DWJA 2I6EA 4N07A 1WDNA 5HPQA 2D5WA 3UA8A 3MVYA 4R2BA 2OLBA 2F7AA 1LBBA 4EF2A 2O51A 1Y3QA 3FJ7A 1OLCA 3L6HA 1LLSA 4R73A 2XHDA 2OK2A 1Z7NE 1Y3PA 2AL4A 1GVCA 1L5TA 2XXUA 1SDXA 4F3PA 2Z8DA 5K2YA 4ZS9A 3HPIA 1FQFA 2RCBA 1B40A 3RT8A 4NF5B 3O29A 2YPNA 2O7UA 4YMAA 4G2ZA 2Q8JA 2HEUA 3PPQA 5B7DA 4YKIA 4FATA 2RC9A 1LBCA 3I3VA 2REJA 3KOSA 2DE3A 4Z7EA 4FEBA 3LUYA 1ZBMA 3PUXE 3MBPA 2XXTA 1IUDA 3G7WA 1O64A 4F29A 3TCGA 1D3KA 2HFBA 1VFDA 5EHSA 2ZXTA 4KI0E 1A40A 2RC8A 4GXSB 1UTHA 1FTMA 4Q5TA 1N0TA 1Y9UA 2PT1A 4H0WA 4LA9A 2DYXA 4U1ZA 3D4GA 3TPAA 2QMXA 3MP6A 3B6TA 3TTKA 3E13X 5ELVA 2B4LA 4I9DA 1KWHA 2BJJX 4FE8A 4OERA 3KJTA 4DXUA 5CM6A 1DOTA 1JW1A 3GZGA 4RK2A 3FUZA 3OSRA 4RYAA 3EHSA 4X9TA 1UIVA 1OQGA 1B3FA 3RNNA 3MUQA 4OYVA 3O97A 1H43A 5H8SA 5AA4B 2H9BA 3V5AA 3LSFB 3TYHA 3FJMA 3G3FA 4F1UA 2PX1A 1IXIA 2UVIA 3IK6B 1MM7A 4R9GA 4K3FA 3GXAA 2Y84A 1H76A 4P0GA 2XXPA 3IB0A 3FVNA 3MWBA 1SW4A 3FXRA 1SYIA 4JWYA 1TWYA 4KFQA 1JW5A 3T9HB 3LSXA 1MXUA 4F3SA 3HCQA 3E9XA 4NMYA 4R72A 2DWIA 3KN3A 4R6HA 4RJZA 1H44A 3PMWA 4N6PA 4OVJA 2W7YA 1A55A 4R2FA 3CHGA 1XVXA 5EHMA 1MY1A 3MZBA 4ELQA 3E3KA 1B32A 3Q28A 5I59B 5ISUA 1TT1A 2X26A 3PPOA 1DPEA 3R7XA 2F6GA 3MP8A 3FXUA 3UP9A 5CMCA 2GHBA 4R9FA 5IKBA 3H6VA 3N26A 3LSWA 4FAJA 3PUZE 1UTBA 1TFAA 3T22A 4IY6A 4NTLA 1OVBA 2ZYKA 1MM6A 1GGGA 1FQEA 3K1NA 4NF4A 1QW0A 4QSCA 2P2AA 4U23A 4YU0A 2QPQA 4Q30B 4ZE8A 1B52A 4YB6A 4HS7A 4FJPA 4O3AA 1N3XA 3ODBA 4TLLB 2RF1A 5LOMA 2V3QA 4LQ5A 4G68C 2F7BA 1LCFA 1MY0A 1NL5A 5I2KA 4BDNA 4LVQA 2LAOA 1EZPA 3KN7A 3O6GA 3A3UA 2XXXA 3IB2A 2AYSA 3DM0A 2Q2CA 3RYAA 2A5TA 4G8MA 2B3BA 1DTGA 2DS9A 4OETA 2QS4A 1SW2A 3B6QA 3FD3A 3BBRA 4H5FA 1MRPA 1JVXA 2G93A 1MQJA 2Q2AA 2VD3A 1EH3A 3TAJA 4RPOA 3KOTA 2DE4A 2F36A 5A5XB 1SW5A 3TCFA 2DSFA 1MS7A 5I58A 1VR5A 1B3HA 1FCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H5G A;  4BLA A;  3QAX A;  4KHZ E;  2QS3 A;  3SEU A;  4ECF A;  4XKN A;  1Y1Z A;  3HO7 A;  2CZL A;  1LAX A;  4YB5 A;  3N94 A;  3MVX A;  3K02 A;  3CVG A;  4KD5 A;  5DEX B;  4QFK A;  3SET A;  4NF8 B;  2F8D A;  3EF7 A;  4ISU A;  5KDT B;  3QXM A;  2Y7W A;  3FTO A;  4JXI A;  3VXC A;  4OZ9 A;  4GIZ A;  2DE2 A;  5TP9 A;  2GHA A;  3K4U A;  1MY3 A;  2XXI A;  3PD9 A;  1LAH E;  4GFR A;  3SKP A;  4I62 A;  2XD2 A;  4PFY A;  3F11 A;  1USY E;  1FTK A;  3U1O A;  4JDF A;  4U21 A;  1VFE A;  1UQW A;  1D9Y A;  1II5 A;  1URD A;  2GH9 A;  2XXY A;  1GV8 A;  4HW8 A;  4IO6 A;  4M1V A;  3K6X A;  1A8F A;  1OMP A;  3ONM A;  5AE4 A;  1DPP A;  3USD A;  4KR5 A;  1B05 A;  3KGC A;  3T9V A;  3UOR A;  4F3G A;  1QUL A;  4GF8 A;  4QFP A;  4NE4 A;  5CMK A;  1MDP 1;  2HZL A;  4H67 A;  4OES A;  1NH8 A;  4ESX A;  2YJP A;  4DDD A;  1SBP A;  3K01 A;  1MQI A;  4N13 A;  1NNP A;  3MW0 A;  5DVF A;  5I56 A;  3PAM A;  2GFE A;  3HV1 A;  4I1D A;  2H25 A;  2GRV A;  5H8Q A;  4ZZE A;  3C34 A;  3T9X B;  3TTL A;  3BFU A;  4RK9 A;  1B3G A;  1MY2 A;  4YB7 A;  3DRI A;  1HSJ A;  4QF9 A;  5ITP A;  5I57 A;  3BKI B;  1LB9 A;  4F31 B;  5FHM A;  4X1D A;  4F2Q A;  1MQD A;  2P0S A;  2Y7K A;  4U2R A;  3PD8 A;  4WEP A;  3DRK A;  1B1H A;  4ZZA A;  2ZNT A;  4IO7 A;  3VV5 A;  4NF6 A;  2R9J A;  1B9J A;  4OFL A;  3C31 A;  4OEN A;  3OO9 A;  4I8C A;  2Y7R A;  3G3I A;  3RPW A;  2O84 X;  1M5E A;  1WVJ A;  1POT A;  3OEK A;  2DVZ A;  3VDF A;  1MY4 A;  4MH5 A;  5L9M A;  1MH4 A;  3SEW A;  4H8J A;  5CMM A;  2QSX A;  4DCY A;  4F3B A;  3KFM A;  2OCU A;  4YMB A;  4ELP A;  3FXQ A;  3DRH A;  2V3T A;  4HCY A;  1YTV A;  1DTZ A;  4EXK A;  1Z7M E;  2WOL A;  1Y20 A;  2ZYM A;  2NOO A;  1WOD A;  1PC3 A;  4PET A;  1M5F A;  1O7T A;  1LGB C;  3H6T A;  3O28 A;  3C32 A;  4MF3 A;  1PBP A;  2V93 A;  5K2X A;  2Q9T A;  4ESW A;  3O6I A;  2ZYO A;  3H7M A;  4YIC A;  3G3J A;  4FOR A;  3H6W A;  3T9U A;  2B65 A;  3S9N C;  1P1W A;  1MPD A;  2REG A;  3SDF A;  1ZU0 A;  3VLW A;  1EZO A;  3K1P A;  4QFL A;  5AA2 D;  3TTN A;  5J1D A;  2HAV A;  5I2K B;  3MVZ A;  4OFO A;  4LZ5 A;  3S4U A;  2Q89 A;  3FVO A;  4RY1 A;  5KCJ A;  1BP5 A;  4BDM A;  4P11 A;  3RT6 B;  1ELJ A;  4ZEI A;  3HST A;  4OMB A;  3PUY E;  4IO2 A;  3C4M A;  4LP2 B;  1A54 A;  3OO8 A;  3U8Q A;  2NVU B;  4BDR A;  2O1L A;  1B3L A;  3IO4 A;  3SES A;  5CRY A;  5CC2 A;  3MPL A;  3HN0 A;  4G8H A;  2I48 A;  3DP8 A;  4QRZ A;  1OLA A;  3C35 A;  3JZJ A;  3TKD A;  3FVG A;  1AIV A;  4PE5 B;  3EHT A;  5H8H B;  4EQ9 A;  1B7H A;  3MQ9 A;  4U1O A;  3ZS6 A;  5AA2 B;  2I58 A;  3SEY A;  1JQF A;  4OEV A;  3R6U A;  3KEI A;  4IO4 A;  2Q88 A;  1VSO A;  2I0C A;  3O6H A;  2A5S A;  3MPK A;  1SQY A;  5HBC A;  1JW4 A;  3DRF A;  2NUV A;  2VOZ A;  3LC8 A;  1M5D A;  3CFZ A;  5JTY B;  1FQC A;  1B4H A;  3FV1 A;  3ILT B;  4ZDM A;  3AXF A;  5H8F A;  1MXV A;  4BDQ A;  1FW0 A;  2E0S A;  2HAU A;  5EYF A;  3KZG A;  3G3K A;  3K6U A;  4LZ7 A;  3T66 A;  3TMG A;  1NKX A;  4BDL A;  4JB7 A;  4WKM A;  1IIT A;  2I3V A;  5DVI A;  3IR1 A;  1ANF A;  1FTL A;  4EF1 A;  5TP9 B;  1XOC A;  4EXL A;  4PP0 A;  3WAE A;  3IOW A;  5I2N B;  3OO7 A;  3SER A;  2F6P A;  2O6A A;  3FAS A;  1QUK A;  2F78 A;  4NF5 A;  2F34 A;  4O3B A;  4KYE A;  1MQG A;  1MDQ A;  4FIM A;  1EZ9 A;  5DYH A;  4GQO A;  3Q26 A;  4H65 A;  4LQ2 A;  3ZSF A;  1QJM A;  2H4I A;  2OBG A;  1JEU A;  1N7X A;  1R9Q A;  1IEJ A;  4C1U A;  2I0B A;  1PBQ A;  3DRG A;  3ECR A;  5TPA B;  1MXZ A;  3I5O A;  4YKK A;  2YLN A;  1FTJ A;  1LB8 A;  4KCC A;  1PEB A;  1P99 A;  3RY3 A;  1S9T A;  4DZ1 A;  1A8E A;  5B70 A;  4KYD A;  3GBB A;  1MPC A;  3OMB A;  3KSX A;  3KJ7 A;  4POW A;  4DLD A;  4F2O A;  3UIF A;  1BTJ A;  3VXB A;  5H8N B;  2RIN A;  3TUS A;  1SYH A;  3K0V A;  1M5C A;  2RC7 A;  1PDA A;  1MXY A;  1XVY A;  4POX A;  1QVS A;  2I49 A;  2VHA A;  4F1V A;  4G68 B;  2KLF A;  4IO5 A;  4H1X A;  1QUI A;  2WKY A;  3TQL A;  5JEI A;  3IJO B;  4OQO A;  2DQV A;  1ZKB A;  3IOR A;  1B4Z A;  2XX9 A;  1R6Z A;  1SW1 A;  3KG2 A;  2V25 A;  2DXY A;  2QS1 A;  2V84 A;  3TEP A;  2UVG A;  4MFI A;  3K2D A;  1OVT A;  3TQW A;  5CMB A;  3IOU A;  4PQJ A;  3MP1 A;  2ZNS A;  3CFL A;  3W9V A;  1B0H A;  3IO6 A;  1VE4 A;  3KBR A;  3RN8 A;  2ZMB A;  1XT8 A;  2Z23 A;  4E0X A;  3PMX A;  4L17 A;  3ZKL A;  4Q8R A;  3IJX B;  1N7W A;  1NNT A;  4IY5 A;  3CSG A;  4NED A;  3S9M C;  4KYS A;  1ATG A;  1N84 A;  3U72 A;  1XC1 A;  1TXF A;  2ZYN A;  1LCT A;  2I4C A;  3I6V A;  5CI5 A;  2Y7I A;  5I59 A;  4EUO A;  3M8U A;  3ILU B;  1MH3 A;  4XTC Q;  2FYI A;  2DXR A;  3H3G A;  2THI A;  4AQ4 A;  1UTH B;  4GL8 A;  1MXX A;  4P0I A;  3RTF B;  5I84 A;  4GL0 A;  2OWS A;  1IZ1 A;  1XS5 A;  4TLM B;  5AA3 A;  2AIX A;  2ONK E;  3LR1 A;  4JBZ A;  1AH5 A;  1BIY A;  2F97 A;  4OHN A;  2QRY A;  3LBS A;  1I6Q A;  1QKA A;  4QHQ A;  2Y7P A;  3HHF A;  3JV9 A;  3CSB A;  1POY 1;  3GLB A;  5FTH A;  1IXC A;  1D9V A;  2H98 A;  4G4P A;  4KPT A;  1JNF A;  3TZA A;  3FJG A;  3IL1 B;  4M4G A;  1S7Y A;  3U94 A;  3U93 A;  2B4M A;  2OWT A;  2I3W A;  1ZTY A;  2ONR A;  2XXV A;  3MZ9 A;  3EN3 A;  1LST A;  2IA4 A;  4R74 A;  3G3G A;  4QSE A;  3CG1 A;  1N3W A;  3IOV A;  4OWD A;  3QK6 A;  1RYX A;  5HM4 B;  1LAG E;  5KZT A;  2NWJ A;  2HCA A;  1GR2 A;  2CMO A;  1DMB A;  1QUJ A;  3S2V A;  1B7Z A;  3FVK A;  4LZ8 A;  4IB2 A;  2PVU A;  4U4S A;  4OTE A;  3QIM A;  1M5B A;  2IEE A;  1JVY A;  3MVW A;  3K1M A;  4F18 A;  1Y3N A;  1Y1M A;  4HCW A;  4KQP A;  5A5X A;  2E1S A;  4C0R A;  1JET A;  3A3C A;  3VVD A;  3VVF A;  1P1O A;  4MBP A;  3SEX A;  4H8I A;  2O1M A;  3N6U A;  2UVJ A;  4U4X A;  3TOD A;  3V83 A;  2FNC A;  3GBA A;  2ONS A;  1SD3 A;  3PMV A;  3G3H A;  1EU8 A;  2HQ0 A;  2P1S A;  1UIU A;  4ELR A;  1UTB B;  3L6G A;  1J1N A;  3UN6 A;  3CRB A;  3V89 B;  4PFW A;  5DEX A;  3OEL A;  1SVX B;  4NF4 B;  4JSD A;  4RA1 A;  4NF8 A;  3DP4 A;  2X7Q A;  2RKM A;  2UVH A;  5KDT A;  3PGF A;  2WOP A;  4F19 A;  5CBS A;  1PB7 A;  1QKB A;  1ZLQ A;  4LAT A;  1CE2 A;  4YKP A;  4R6Y A;  1RKM A;  1IIW A;  2H5Y A;  4GD5 A;  1IXH A;  1CB6 A;  1URS A;  5AA1 A;  3B6W A;  1USY H;  1MQH A;  1A7L A;  1P1U A;  1S50 A;  5DTB A;  1B7U A;  3PV0 E;  4XKQ A;  5FHN A;  5L9O A;  4LON B;  3BFT A;  2DWA A;  1MXW A;  2A5T B;  3B7D A;  3T93 B;  1FTO A;  4TOZ A;  3O6P A;  3DLN A;  5L9S A;  1YAE A;  3LVU A;  4HTG A;  2UYF A;  4ELO A;  2UYE A;  4RNS A;  2ESN A;  4X48 A;  2O69 A;  3OSQ A;  4QFO A;  1NFT A;  2Z22 A;  3IX1 A;  3UK4 A;  3C9H A;  5JK4 A;  2PYY A;  5F1Q A;  2XD3 A;  1SI0 A;  4YAH X;  4U22 A;  1N76 A;  1P1N A;  3QUF A;  4NWD A;  1B58 A;  1B5J A;  3MZ1 A;  4IGR A;  1FQD A;  1AL3 A;  5I58 B;  2XXH A;  2G29 A;  3QUJ A;  4QSD A;  3EHU A;  4JWO A;  3A09 A;  3W15 C;  5BWJ A;  4FEC A;  1IQ7 A;  3S9L C;  1OIB A;  1I69 A;  1ZMG A;  1B5H A;  3M3L A;  1ZJL A;  4FED A;  3DP6 A;  3LSL A;  2D3I A;  4GLI A;  4ZE9 A;  3Q29 A;  4GOT A;  5ICQ A;  1H3D A;  4ND9 A;  5IAI A;  3VFJ A;  4F39 A;  4ZEC A;  3HHG A;  4NWC A;  3ZKK A;  4C1T A;  4DIG A;  4GRK A;  4THI A;  2XXW A;  5DVJ A;  4JWX A;  3FIR A;  4EQB A;  5L8D A;  3MJN A;  4TQU Q;  3PU5 A;  3H6U A;  2OZZ A;  3TCH A;  5FTI A;  4OXV A;  1BKA A;  4DCX A;  1OQH A;  2NXO A;  3OOA A;  1PB9 A;  4DXC A;  3Q25 A;  2M8C A;  2ZNU A;  3TTM A;  4ZEB A;  1US4 A;  3PUV E;  4XKP A;  3VLU A;  3PPR A;  3P7I A;  3M3F A;  3OO6 A;  1BLF A;  2OJT A;  4EQ7 A;  1O63 A;  1H45 A;  1LFI A;  1XHY A;  4YKJ A;  2PMS A;  3N6T A;  2DWH A;  4OEU A;  3RTW B;  2PT2 A;  3SEV A;  1D4N A;  3K00 A;  1A99 A;  2QL3 A;  3K6V A;  2VD2 A;  5CBR A;  2O68 A;  4AB6 A;  3CR9 A;  5I56 B;  4GVO A;  3PPN A;  1Q1K A;  2VP1 A;  5H8Q B;  2DOJ A;  3E4R A;  1Y4C A;  2RCA A;  5TU0 A;  1URG A;  1NMU A;  2HZK A;  4X1B A;  4Z0I A;  1ZIU A;  3MC2 A;  3QSL A;  2DP8 A;  1LFH A;  3THI A;  2XXQ A;  4Q0C A;  1NH7 A;  5I57 B;  3OXN A;  1AMF A;  3FZV A;  1B2H A;  1TFD A;  4E0W A;  1IXG A;  4WED A;  4NF6 B;  2AL5 A;  4R75 A;  2XXR A;  3T96 B;  4G77 A;  3CFX A;  2QMW A;  1NNF A;  2ABH A;  3PUW E;  1HSE A;  1JEV A;  5AA4 A;  3EPE A;  4DXB A;  3RUM A;  2QS2 A;  1FQB A;  1R9L A;  3VVE A;  3WAF A;  1B46 A;  3DEL B;  2FA7 A;  3C33 A;  3OEM A;  5H8H A;  4IO3 A;  5BUU A;  3OD7 A;  5AA2 A;  3PPP A;  5F7V A;  1DSN A;  3Q27 A;  1N04 A;  4WXJ A;  4RPN A;  1MG1 A;  3MAM A;  3EQ1 A;  3KN8 A;  4R6K A;  4O3C A;  4JSO A;  1P1Q A;  4XKR A;  4LUB A;  1B0L A;  3JYR A;  1NNK A;  5JTY A;  3FGS A;  4UAC A;  4PFT A;  3H06 B;  2F7C A;  4AB5 A;  2F35 A;  1AOV A;  1LAF E;  1PB8 A;  2R6G E;  2B3F A;  4PFU A;  4XIG Q;  1HSL A;  4MLQ A;  4YZZ A;  4GWO A;  3TEL A;  3IAZ A;  3RQT A;  2DVC A;  2F5X A;  4DE8 A;  3FAT A;  2I4B A;  2VGQ A;  3VLV A;  3KSJ A;  3D4C A;  1SI1 A;  1F9B A;  3S9E A;  4BDO A;  5I2N A;  3IB1 A;  2UXA A;  1GTK A;  1R1N A;  3H4Z A;  3M3K A;  5KCJ B;  4OFJ A;  1LFG A;  5DT6 A;  2PBW A;  3H03 A;  4KCD A;  2Z8E A;  1US5 A;  3R26 A;  1YPN A;  2D21 A;  5M2V A;  1MPB A;  3K6W A;  3CI8 A;  2XX8 A;  3CG3 A;  3TDJ A;  3IOT A;  4QFN A;  3RLF E;  4G8N A;  2XX7 A;  5ITO A;  1Q35 A;  5TPA A;  3O2A A;  2X7P A;  4MLV A;  3RGY A;  2O7I A;  1RYO A;  1I6B A;  3RYB A;  3C36 A;  4H6D A;  4UA8 A;  3FV2 A;  2H99 A;  3O66 A;  3V8X B;  1B6H A;  3TTR A;  3VE1 B;  3CIJ A;  3UGW A;  4EDP A;  3N5L A;  4IGT A;  2ANJ A;  1T0K A;  2HXW A;  4ZEK A;  2ALU A;  5FHO A;  3O9P A;  4ZED A;  1B1X A;  1FQA A;  4F22 A;  3DRJ A;  1B5I A;  5H8N A;  3W9W A;  1YCJ A;  3TFL A;  3QYT A;  1Y4T A;  2R71 A;  4XXU A;  2Z8F A;  4RXL A;  4GXA A;  4F1Y A;  4G68 A;  1B3E A;  2V3U A;  3U92 A;  2QJE A;  2WOK A;  1I6A A;  3OEN A;  1B51 A;  5ICT A;  4ZEF A;  4ONY A;  5H8F B;  2DWJ A;  2I6E A;  4N07 A;  1WDN A;  5HPQ A;  2D5W A;  3UA8 A;  3MVY A;  4R2B A;  2OLB A;  2F7A A;  1LBB A;  4EF2 A;  2O51 A;  1Y3Q A;  3FJ7 A;  1OLC A;  3L6H A;  1LLS A;  4R73 A;  2XHD A;  2OK2 A;  1Z7N E;  1Y3P A;  2AL4 A;  1GVC A;  1L5T A;  2XXU A;  1SDX A;  4F3P A;  2Z8D A;  5K2Y A;  4ZS9 A;  3HPI A;  1FQF A;  2RCB A;  1B40 A;  3RT8 A;  4NF5 B;  3O29 A;  2YPN A;  2O7U A;  4YMA A;  4G2Z A;  2Q8J A;  2HEU A;  3PPQ A;  5B7D A;  4YKI A;  4FAT A;  2RC9 A;  1LBC A;  3I3V A;  2REJ A;  3KOS A;  2DE3 A;  4Z7E A;  4FEB A;  3LUY A;  1ZBM A;  3PUX E;  3MBP A;  2XXT A;  1IUD A;  3G7W A;  1O64 A;  4F29 A;  3TCG A;  1D3K A;  2HFB A;  1VFD A;  5EHS A;  2ZXT A;  4KI0 E;  1A40 A;  2RC8 A;  4GXS B;  1UTH A;  1FTM A;  4Q5T A;  1N0T A;  1Y9U A;  2PT1 A;  4H0W A;  4LA9 A;  2DYX A;  4U1Z A;  3D4G A;  3TPA A;  2QMX A;  3MP6 A;  3B6T A;  3TTK A;  3E13 X;  5ELV A;  2B4L A;  4I9D A;  1KWH A;  2BJJ X;  4FE8 A;  4OER A;  3KJT A;  4DXU A;  5CM6 A;  1DOT A;  1JW1 A;  3GZG A;  4RK2 A;  3FUZ A;  3OSR A;  4RYA A;  3EHS A;  4X9T A;  1UIV A;  1OQG A;  1B3F A;  3RNN A;  3MUQ A;  4OYV A;  3O97 A;  1H43 A;  5H8S A;  5AA4 B;  2H9B A;  3V5A A;  3LSF B;  3TYH A;  3FJM A;  3G3F A;  4F1U A;  2PX1 A;  1IXI A;  2UVI A;  3IK6 B;  1MM7 A;  4R9G A;  4K3F A;  3GXA A;  2Y84 A;  1H76 A;  4P0G A;  2XXP A;  3IB0 A;  3FVN A;  3MWB A;  1SW4 A;  3FXR A;  1SYI A;  4JWY A;  1TWY A;  4KFQ A;  1JW5 A;  3T9H B;  3LSX A;  1MXU A;  4F3S A;  3HCQ A;  3E9X A;  4NMY A;  4R72 A;  2DWI A;  3KN3 A;  4R6H A;  4RJZ A;  1H44 A;  3PMW A;  4N6P A;  4OVJ A;  2W7Y A;  1A55 A;  4R2F A;  3CHG A;  1XVX A;  5EHM A;  1MY1 A;  3MZB A;  4ELQ A;  3E3K A;  1B32 A;  3Q28 A;  5I59 B;  5ISU A;  1TT1 A;  2X26 A;  3PPO A;  1DPE A;  3R7X A;  2F6G A;  3MP8 A;  3FXU A;  3UP9 A;  5CMC A;  2GHB A;  4R9F A;  5IKB A;  3H6V A;  3N26 A;  3LSW A;  4FAJ A;  3PUZ E;  1UTB A;  1TFA A;  3T22 A;  4IY6 A;  4NTL A;  1OVB A;  2ZYK A;  1MM6 A;  1GGG A;  1FQE A;  3K1N A;  4NF4 A;  1QW0 A;  4QSC A;  2P2A A;  4U23 A;  4YU0 A;  2QPQ A;  4Q30 B;  4ZE8 A;  1B52 A;  4YB6 A;  4HS7 A;  4FJP A;  4O3A A;  1N3X A;  3ODB A;  4TLL B;  2RF1 A;  5LOM A;  2V3Q A;  4LQ5 A;  4G68 C;  2F7B A;  1LCF A;  1MY0 A;  1NL5 A;  5I2K A;  4BDN A;  4LVQ A;  2LAO A;  1EZP A;  3KN7 A;  3O6G A;  3A3U A;  2XXX A;  3IB2 A;  2AYS A;  3DM0 A;  2Q2C A;  3RYA A;  2A5T A;  4G8M A;  2B3B A;  1DTG A;  2DS9 A;  4OET A;  2QS4 A;  1SW2 A;  3B6Q A;  3FD3 A;  3BBR A;  4H5F A;  1MRP A;  1JVX A;  2G93 A;  1MQJ A;  2Q2A A;  2VD3 A;  1EH3 A;  3TAJ A;  4RPO A;  3KOT A;  2DE4 A;  2F36 A;  5A5X B;  1SW5 A;  3TCF A;  2DSF A;  1MS7 A;  5I58 A;  1VR5 A;  1B3H A;  1FCK A; 
#chains in the Genus database with same CATH topology
 4H5G A;  4BLA A;  3QAX A;  4KHZ E;  2QS3 A;  3SEU A;  4ECF A;  4XKN A;  1Y1Z A;  3HO7 A;  2CZL A;  1LAX A;  4YB5 A;  3N94 A;  3MVX A;  3K02 A;  3CVG A;  4KD5 A;  5DEX B;  4QFK A;  3SET A;  4NF8 B;  2F8D A;  3EF7 A;  4ISU A;  4O7I A;  5KDT B;  3QXM A;  2Y7W A;  3FTO A;  4JXI A;  3VXC A;  4OZ9 A;  4GIZ A;  2DE2 A;  5TP9 A;  2GHA A;  4PAI A;  3K4U A;  1IMC A;  1MY3 A;  2XXI A;  3PD9 A;  1LAH E;  4I3E A;  4GFR A;  3SKP A;  4I62 A;  2XD2 A;  4PFY A;  3F11 A;  2KQZ A;  1USY E;  2V4C A;  3ROJ A;  1FTK A;  3U1O A;  4JDF A;  4U21 A;  1VFE A;  1UQW A;  1D9Y A;  1II5 A;  1URD A;  2GH9 A;  1FBG A;  2XXY A;  4MNI A;  4MHF A;  1GV8 A;  4JVC A;  4HW8 A;  4IO6 A;  4M1V A;  3K6X A;  1A8F A;  1OMP A;  3ONM A;  5AE4 A;  1DPP A;  3USD A;  4KR5 A;  1B05 A;  3KGC A;  3T9V A;  3UOR A;  4F3G A;  1QUL A;  2QVV A;  4GF8 A;  4QFP A;  4NE4 A;  1FPF A;  5CMK A;  3EKI A;  1MDP 1;  2HZL A;  4H67 A;  4N6K A;  4NG7 A;  4OES A;  1NH8 A;  4ESX A;  2YJP A;  4DDD A;  1SBP A;  3K01 A;  1MQI A;  4N13 A;  1NNP A;  3MW0 A;  5DVF A;  5I56 A;  3PAM A;  2GFE A;  3HV1 A;  4I1D A;  3FXB A;  2H25 A;  2GRV A;  5H8Q A;  4ZZE A;  3C34 A;  3T9X B;  4P1L A;  3TTL A;  3BFU A;  4RK9 A;  1B3G A;  1MY2 A;  4YB7 A;  3LV0 A;  3DRI A;  1HSJ A;  4QF9 A;  3MST A;  5ITP A;  5I57 A;  3BKI B;  1LB9 A;  1INP A;  4F31 B;  4QXD A;  5FHM A;  1RDZ A;  1FBD A;  4X1D A;  4F2Q A;  2WYK A;  1MQD A;  2P0S A;  2Y7K A;  4U2R A;  3PD8 A;  4WEP A;  3DRK A;  1B1H A;  4ZZA A;  2ZNT A;  4IO7 A;  3VV5 A;  4NF6 A;  2R9J A;  1B9J A;  2PFZ A;  4OFL A;  1DCU A;  3C31 A;  4OEN A;  3OO9 A;  4I8C A;  2Y7R A;  1EYJ A;  3G3I A;  3RPW A;  2O84 X;  1M5E A;  1WVJ A;  1POT A;  3OEK A;  2DVZ A;  4KXP A;  3VDF A;  1MY4 A;  2CZI A;  3FBP A;  1FBE A;  4MH5 A;  5L9M A;  1MH4 A;  3SEW A;  4PCD A;  4H8J A;  5CMM A;  2QSX A;  4DCY A;  4F3B A;  3KFM A;  2OCU A;  4YMB A;  4ELP A;  3FXQ A;  3DRH A;  4XEQ A;  1XI6 A;  5ET5 A;  2V3T A;  4HCY A;  1YTV A;  1DTZ A;  4EXK A;  1FPD A;  1Z7M E;  2WOL A;  1Y20 A;  2ZYM A;  2NOO A;  1WOD A;  5EQ9 A;  1PC3 A;  4PET A;  4P47 A;  2FIX A;  4PF8 A;  1M5F A;  1JP4 A;  2WBD A;  1O7T A;  2HXR A;  4UAB A;  1LGB C;  3H6T A;  3O28 A;  4QBA A;  3C32 A;  4MF3 A;  1PBP A;  2V93 A;  5K2X A;  2Q9T A;  4X8R A;  4ESW A;  3O6I A;  2ZYO A;  4PAK A;  4GWZ A;  4PFR A;  3H7M A;  4YIC A;  3G3J A;  4GBW A;  4FOR A;  4PDH A;  3H6W A;  3T9U A;  2B65 A;  3S9N C;  1P1W A;  1MPD A;  2REG A;  4O94 A;  1ZU0 A;  3SDF A;  3VLW A;  1EZO A;  3K1P A;  4QFL A;  5AA2 D;  3TTN A;  5J1D A;  1SPI A;  2HAV A;  5I2K B;  5I3S A;  3MVZ A;  4OFO A;  4LZ5 A;  3S4U A;  2Q89 A;  2VPO A;  3FVO A;  4HE0 A;  4RY1 A;  5KCJ A;  1BP5 A;  4BDM A;  3LUZ A;  4P11 A;  3RT6 B;  5IZ3 A;  1ELJ A;  4ZEI A;  3HST A;  4OMB A;  3PUY E;  4IO2 A;  3C4M A;  4LP2 B;  4PBQ A;  1A54 A;  3OO8 A;  3U8Q A;  3GYY A;  2NVU B;  4BDR A;  2O1L A;  1B3L A;  3IO4 A;  3SES A;  5CRY A;  5CC2 A;  3MPL A;  3HN0 A;  4G8H A;  2I48 A;  3DP8 A;  4QRZ A;  1OLA A;  3C35 A;  3JZJ A;  4GWU A;  3TKD A;  3FVG A;  1AIV A;  4PE5 B;  4DI3 D;  3EHT A;  5H8H B;  4EQ9 A;  1B7H A;  3MQ9 A;  4U1O A;  3ZS6 A;  5AA2 B;  2I58 A;  3SEY A;  1JQF A;  4OEV A;  3R6U A;  3KEI A;  4IO4 A;  2Q88 A;  1VSO A;  2I0C A;  3O6H A;  2A5S A;  3MPK A;  1SQY A;  5HBC A;  1JW4 A;  3DRF A;  2NUV A;  2VOZ A;  3LC8 A;  1M5D A;  1KA0 A;  3CFZ A;  5JTY B;  2Q8M A;  1FQC A;  1B4H A;  4NGU A;  3FV1 A;  2FHY A;  1IMA A;  1DK4 A;  1RDX A;  3ILT B;  4ZDM A;  3AXF A;  5H8F A;  1MXV A;  4BDQ A;  1FW0 A;  2E0S A;  2HAU A;  5EYF A;  3RPL A;  3KZG A;  3G3K A;  3ISP A;  3K6U A;  4LZ7 A;  4MEV A;  3T66 A;  1G0H A;  3TMG A;  1NKX A;  4MIJ A;  4BDL A;  4JB7 A;  1KZ8 A;  4WKM A;  1IIT A;  2WBB A;  2I3V A;  5DVI A;  4OVT A;  1D9Q A;  3IR1 A;  1ANF A;  1FTL A;  4EF1 A;  5TP9 B;  4OA4 A;  2P3V A;  1XOC A;  4EXL A;  4PBH A;  4PP0 A;  3WAE A;  3IOW A;  5I2N B;  3OO7 A;  3SER A;  2F6P A;  2O6A A;  3FAS A;  1QUK A;  2F78 A;  4NF5 A;  5A5L A;  2F34 A;  5FBP A;  4O3B A;  2Y5K A;  4KYE A;  4P8B A;  1MQG A;  1MDQ A;  4FIM A;  2OWZ A;  5EQ8 A;  1EZ9 A;  5DYH A;  4GQO A;  3Q26 A;  4H65 A;  4LQ2 A;  3ZSF A;  1QJM A;  1FBF A;  2H4I A;  2OBG A;  1JEU A;  1N7X A;  1R9Q A;  1IEJ A;  4C1U A;  2I0B A;  1PBQ A;  3DRG A;  3ECR A;  5TPA B;  1FTA A;  1MXZ A;  3I5O A;  4YKK A;  2YLN A;  1FTJ A;  1LB8 A;  4KCC A;  1PEB A;  1P99 A;  3RY3 A;  1S9T A;  4DZ1 A;  2PFY A;  4NN3 A;  1A8E A;  5B70 A;  5DW8 A;  4KYD A;  3GBB A;  1MPC A;  3OMB A;  3KSX A;  3KJ7 A;  4POW A;  4DLD A;  4F2O A;  3UIF A;  1BTJ A;  3VXB A;  5H8N B;  2RIN A;  3TUS A;  1SYH A;  3K0V A;  1M5C A;  2RC7 A;  1PDA A;  1MXY A;  4N8Y A;  1XVY A;  4POX A;  1QVS A;  2I49 A;  2VHA A;  4F1V A;  1NUY A;  4G68 B;  2KLF A;  4IO5 A;  4H1X A;  3MYU A;  1QUI A;  2WKY A;  4GWW A;  1FBP A;  3TQL A;  5JEI A;  3IJO B;  4OQO A;  2DQV A;  1ZKB A;  5EQA A;  3IOR A;  1B4Z A;  2XX9 A;  1R6Z A;  1SW1 A;  3KG2 A;  2V25 A;  2DXY A;  2QS1 A;  2R8T A;  5LTC A;  1NV0 A;  2V84 A;  4OVS A;  3TEP A;  2UVG A;  4MFI A;  3K2D A;  1OVT A;  5CMB A;  3TQW A;  3IOU A;  4PQJ A;  3KC1 A;  3MP1 A;  2ZNS A;  3CFL A;  3W9V A;  1B0H A;  3IO6 A;  1VE4 A;  3KBR A;  3RN8 A;  2ZMB A;  2CEX A;  1XT8 A;  2Z23 A;  4E0X A;  3PMX A;  4L17 A;  1EYI A;  3ZKL A;  4Q8R A;  2KR0 A;  3IJX B;  1N7W A;  1NNT A;  4IY5 A;  3CSG A;  4NED A;  3S9M C;  4KYS A;  5ET6 A;  1ATG A;  1N84 A;  3U72 A;  1XC1 A;  1TXF A;  2ZYN A;  4NHB A;  1LCT A;  2I4C A;  3I6V A;  5CI5 A;  2Y7I A;  1NI9 A;  2XA5 A;  5I59 A;  4EUO A;  3M8U A;  1NV7 A;  3ILU B;  1MH3 A;  4XTC Q;  2FYI A;  4PC9 A;  2DXR A;  3H3G A;  2THI A;  4AQ4 A;  3IFC A;  1UTH B;  4GL8 A;  2XWK A;  1MXX A;  4P0I A;  4XFE A;  3RTF B;  5I84 A;  4GL0 A;  4LN5 A;  2OWS A;  1IZ1 A;  1XS5 A;  4TLM B;  5AA3 A;  2AIX A;  2ONK E;  3LR1 A;  4JBZ A;  1AH5 A;  1BIY A;  2F97 A;  4OHN A;  2QRY A;  3LBS A;  1I6Q A;  1QKA A;  4QHQ A;  2Y7P A;  5IZ1 A;  3HHF A;  3RYD A;  3JV9 A;  3CSB A;  1POY 1;  3GLB A;  5FTH A;  1IXC A;  1D9V A;  2H98 A;  4G4P A;  4KPT A;  2ZZV A;  1JNF A;  3TZA A;  4MX6 A;  3FJG A;  3IL1 B;  4M4G A;  3E78 A;  5I7I A;  1S7Y A;  3U94 A;  3U93 A;  2B4M A;  2OWT A;  2I3W A;  1ZTY A;  2ONR A;  2XXV A;  3MZ9 A;  3EN3 A;  1LST A;  2IA4 A;  4R74 A;  4MCO A;  3G3G A;  4QSE A;  3CG1 A;  1N3W A;  3IOV A;  4OWD A;  1FPL A;  3QK6 A;  1RYX A;  1NUX A;  5HM4 B;  2WX9 A;  1LAG E;  4XF5 A;  5KZT A;  1DBZ A;  2NWJ A;  2HCA A;  1GR2 A;  2CMO A;  1DMB A;  1QUJ A;  3S2V A;  1B7Z A;  3FVK A;  4LZ8 A;  4IB2 A;  2HPG A;  2PVU A;  4U4S A;  4OTE A;  3QIM A;  1M5B A;  2IEE A;  1JVY A;  3MVW A;  3K1M A;  4HE1 A;  4NF0 A;  3RPL B;  4F18 A;  1Y3N A;  1Y1M A;  4HCW A;  4KQP A;  5A5X A;  2E1S A;  4C0R A;  1JET A;  3A3C A;  3VVD A;  3VVF A;  1P1O A;  4N91 A;  4MBP A;  3SEX A;  4H8I A;  2O1M A;  3A29 A;  3N6U A;  2UVJ A;  4U4X A;  3TOD A;  3V83 A;  2FNC A;  2ZZX A;  3GBA A;  5ESY A;  2ONS A;  1SD3 A;  5J16 A;  3PMV A;  3G3H A;  1EU8 A;  2HQ0 A;  4PAF A;  2P1S A;  1UIU A;  1LBZ A;  1NUW A;  4ELR A;  1FPE A;  1UTB B;  3L6G A;  1J1N A;  3UN6 A;  3CRB A;  3V89 B;  4PFW A;  5DEX A;  3OEL A;  1AWB A;  1SVX B;  4NF4 B;  4JSD A;  4RA1 A;  4NF8 A;  3DP4 A;  4I3Y A;  2X7Q A;  2RKM A;  2UVH A;  5KDT A;  3PGF A;  4OAN A;  2WOP A;  4F19 A;  5CBS A;  1G0I A;  1PB7 A;  1QKB A;  1NV5 A;  1ZLQ A;  4LAT A;  1CE2 A;  4YKP A;  4R6Y A;  1RKM A;  2XXK A;  1IIW A;  2H5Y A;  4GD5 A;  1IXH A;  1CB6 A;  1URS A;  5AA1 A;  3B6W A;  1USY H;  1MQH A;  1A7L A;  1P1U A;  1S50 A;  5DTB A;  1B7U A;  3PV0 E;  4XKQ A;  5FHN A;  4MAG A;  5L9O A;  4LON B;  3BFT A;  2DWA A;  1MXW A;  4GBV A;  2A5T B;  3B7D A;  3T93 B;  1FTO A;  4TOZ A;  3O6P A;  3DLN A;  5L9S A;  1NV6 A;  4MNP A;  1YAE A;  3LVU A;  4HTG A;  2UYF A;  4ELO A;  2UYE A;  5I5P A;  2XWV A;  4RNS A;  2CEY A;  2ESN A;  4X48 A;  2O69 A;  3OSQ A;  4QFO A;  1NFT A;  2Z22 A;  3IX1 A;  3UK4 A;  3C9H A;  5JK4 A;  2PYY A;  5F1Q A;  2XD3 A;  1SI0 A;  4YAH X;  4U22 A;  1N76 A;  2PCR A;  1P1N A;  3QUF A;  4NWD A;  1B58 A;  1B5J A;  4PFB A;  3MZ1 A;  4IGR A;  1FQD A;  1AL3 A;  5I58 B;  2XXH A;  2G29 A;  3QUJ A;  4QSD A;  3EHU A;  4JWO A;  3A09 A;  4GWX A;  3W15 C;  5BWJ A;  3SZP A;  4FEC A;  1IQ7 A;  4FBP A;  3S9L C;  1OIB A;  1I69 A;  1ZMG A;  1B5H A;  3M3L A;  1ZJL A;  4FED A;  3DP6 A;  3LSL A;  5ET7 A;  4P1E A;  2D3I A;  4GLI A;  4OVR A;  4ZE9 A;  3NOH A;  2DDK A;  1FPK A;  3Q29 A;  4GOT A;  5ICQ A;  1H3D A;  4ND9 A;  5IAI A;  3VFJ A;  4F39 A;  4ZEC A;  3HHG A;  4NWC A;  3ZKK A;  4N6D A;  4C1T A;  4NX1 A;  1YXI A;  4GRK A;  4DIG A;  4THI A;  2XXW A;  5DVJ A;  4JWX A;  3FIR A;  4EQB A;  3BIG A;  5L8D A;  3MJN A;  4TQU Q;  3D1R A;  3PU5 A;  2VPN A;  3H6U A;  2OZZ A;  3TCH A;  5FTI A;  4OXV A;  1BKA A;  4DCX A;  1OQH A;  2NXO A;  3OOA A;  1PB9 A;  4DXC A;  3Q25 A;  1LBV A;  2M8C A;  2OX3 A;  2ZNU A;  3TTM A;  4ZEB A;  1US4 A;  3PUV E;  4XKP A;  3VLU A;  3PPR A;  3P7I A;  1K9Z A;  3M3F A;  3OO6 A;  1BLF A;  2OJT A;  4EQ7 A;  1O63 A;  1H45 A;  1LFI A;  1XHY A;  4YKJ A;  2PMS A;  3N6T A;  2DWH A;  4OEU A;  3RTW B;  2PT2 A;  3SEV A;  4MNC A;  1D4N A;  3K00 A;  1A99 A;  2QL3 A;  3K6V A;  2VD2 A;  4GWS A;  5CBR A;  1IMB A;  2O68 A;  4AB6 A;  3CR9 A;  5I56 B;  4GVO A;  3PPN A;  1Q1K A;  2VP1 A;  5H8Q B;  2DOJ A;  3E4R A;  1Y4C A;  4G61 A;  2RCA A;  5TU0 A;  1URG A;  1NMU A;  2HZK A;  4X1B A;  4Z0I A;  4PGP A;  1ZIU A;  4OVQ A;  2XWI A;  3MC2 A;  3QSL A;  2DP8 A;  1LFH A;  1VDW A;  2XXQ A;  3THI A;  4Q0C A;  1NH7 A;  5I57 B;  4PF6 A;  2HHM A;  1LBY A;  3OXN A;  1AMF A;  3FZV A;  1B2H A;  1TFD A;  4E0W A;  1IXG A;  4WED A;  4NF6 B;  2AL5 A;  4R75 A;  2XXR A;  3T96 B;  4G77 A;  3CFX A;  2QMW A;  1NNF A;  2ABH A;  5IGA A;  3PUW E;  1FPG A;  1HSE A;  1LBX A;  1FRP A;  1JEV A;  3KC0 A;  2CZH A;  5AA4 A;  3EPE A;  4DXB A;  3RUM A;  2QS2 A;  1FQB A;  1R9L A;  3VVE A;  3WAF A;  1B46 A;  3DEL B;  2FA7 A;  3C33 A;  3OEM A;  5H8H A;  1QGX A;  4IO3 A;  5BUU A;  1NV2 A;  3OD7 A;  3PPP A;  5AA2 A;  5F7V A;  1DSN A;  3Q27 A;  1N04 A;  4WXJ A;  4RPN A;  1MG1 A;  3MAM A;  3EQ1 A;  3KN8 A;  4R6K A;  3KBZ A;  5LDZ A;  4O3C A;  4JSO A;  1P1Q A;  4XKR A;  4LUB A;  1B0L A;  3JYR A;  1NNK A;  4PE3 A;  5JTY A;  3FGS A;  4UAC A;  4PFT A;  3H06 B;  2F7C A;  4AB5 A;  2F35 A;  1AOV A;  1LAF E;  1PB8 A;  2R6G E;  4OVP A;  2B3F A;  4PFU A;  4XIG Q;  4N4U A;  1FBH A;  1HSL A;  4MLQ A;  4YZZ A;  2F3D A;  4GWO A;  1FPB A;  3TEL A;  3IAZ A;  4JVI A;  3RQT A;  4GX6 A;  2DVC A;  2F5X A;  4DE8 A;  3FAT A;  4MMP A;  2I4B A;  2VGQ A;  3VLV A;  3KSJ A;  3D4C A;  5IZZ A;  1SI1 A;  2Q74 A;  1F9B A;  3S9E A;  4BDO A;  5I2N A;  3IB1 A;  1IME A;  2UXA A;  1GTK A;  1R1N A;  1FJ6 A;  3BIH A;  3H4Z A;  3M3K A;  5KCJ B;  4OFJ A;  1LFG A;  5DT6 A;  2PBW A;  3H03 A;  2WYP A;  4KCD A;  5IZ3 B;  2Z8E A;  1US5 A;  3R26 A;  5EYH A;  1YPN A;  2D21 A;  5M2V A;  1MPB A;  3PTY A;  2MKZ A;  3K6W A;  4I40 A;  3CI8 A;  2XX8 A;  1FSA A;  3CG3 A;  3TDJ A;  3IOT A;  4QFN A;  2L5V A;  1IMD A;  3RLF E;  4G8N A;  2XX7 A;  5ITO A;  1Q35 A;  5TPA A;  3O2A A;  2X7P A;  4MLV A;  4X04 A;  3RGY A;  2O7I A;  1RYO A;  1I6B A;  3RYB A;  3C36 A;  4H6D A;  4UA8 A;  3FV2 A;  2H99 A;  3E79 A;  3O66 A;  3V8X B;  1B6H A;  3TTR A;  4AS5 A;  3VE1 B;  3CIJ A;  2VT5 A;  3UGW A;  3IFA A;  4EDP A;  3N5L A;  4IGT A;  2ANJ A;  1T0K A;  2HXW A;  4ZEK A;  2ALU A;  4JVD A;  5FHO A;  3T0J A;  3O9P A;  4ZED A;  1B1X A;  1FQA A;  4F22 A;  3DRJ A;  1B5I A;  5H8N A;  3W9W A;  1YCJ A;  3TFL A;  3QYT A;  1Y4T A;  2R71 A;  4XXU A;  1RDY A;  2Z8F A;  4RXL A;  4GXA A;  2QVU A;  4F1Y A;  2XWO A;  4G68 A;  1YZ0 A;  1B3E A;  2V3U A;  3U92 A;  2QJE A;  2WOK A;  1I6A A;  3OEN A;  1B51 A;  5ICT A;  4ZEF A;  4ONY A;  5H8F B;  2DWJ A;  2I6E A;  4AS4 A;  3QMF A;  4N07 A;  1WDN A;  5HPQ A;  2D5W A;  3UA8 A;  3MVY A;  4R2B A;  2OLB A;  2F7A A;  1LBB A;  4EF2 A;  3U65 A;  1EYK A;  2O51 A;  1Y3Q A;  3FJ7 A;  1OLC A;  3L6H A;  1LLS A;  4R73 A;  2XHD A;  2OK2 A;  1Z7N E;  4O8M A;  1Y3P A;  2AL4 A;  1GVC A;  1L5T A;  2XXU A;  1SDX A;  4F3P A;  2Z8D A;  5K2Y A;  4ZS9 A;  3HPI A;  1FQF A;  1K9Y A;  2RCB A;  1LBW A;  1B40 A;  3RT8 A;  4NF5 B;  5IM2 A;  3O29 A;  2YPN A;  2O7U A;  4YMA A;  4G2Z A;  2Q8J A;  4PFI A;  2HEU A;  3PPQ A;  5B7D A;  4YKI A;  1NV4 A;  4FAT A;  2RC9 A;  1KA1 A;  1LBC A;  3I3V A;  2REJ A;  1FPJ A;  3KOS A;  2DE3 A;  4Z7E A;  4FEB A;  3LUY A;  1ZBM A;  5ET8 A;  3PUX E;  3MBP A;  2XXT A;  1IUD A;  4PGN A;  4P56 A;  3G7W A;  1O64 A;  4O7M A;  4F29 A;  3TCG A;  1D3K A;  2HFB A;  1VFD A;  5EHS A;  3B50 A;  2ZXT A;  3T1B A;  4N81 A;  4KI0 E;  1A40 A;  2RC8 A;  4GXS B;  1UTH A;  1FTM A;  2FVZ A;  4Q5T A;  1N0T A;  1Y9U A;  2PT1 A;  4GWY A;  4N8G A;  4H0W A;  4LA9 A;  4N17 A;  2DYX A;  4U1Z A;  3D4G A;  3TPA A;  2QMX A;  3MP6 A;  3B6T A;  3TTK A;  3E13 X;  2WEF A;  5ELV A;  2B4L A;  4I9D A;  1KWH A;  2BJJ X;  4FE8 A;  1FPI A;  4OER A;  3KJT A;  4DXU A;  5CM6 A;  1DOT A;  1JW1 A;  3GZG A;  4RK2 A;  3FUZ A;  3HFU A;  3OSR A;  4H46 A;  4RYA A;  3EHS A;  4X9T A;  1UIV A;  1OQG A;  4HXV A;  4MJO A;  1B3F A;  3RNN A;  3MUQ A;  4OYV A;  3O97 A;  1FJ9 A;  5F24 A;  1H43 A;  5H8S A;  5AA4 B;  2H9B A;  3V5A A;  3B8B A;  2CZK A;  3LSF B;  3TYH A;  3FJM A;  4GX3 A;  1LEV A;  3G3F A;  4F1U A;  4NAP A;  2PX1 A;  1IXI A;  2UVI A;  3IK6 B;  1MM7 A;  4R9G A;  4K3F A;  3GXA A;  2JJK A;  2Y84 A;  5EQ7 A;  1H76 A;  4P0G A;  2XXP A;  3IB0 A;  3FVN A;  3MWB A;  1SW4 A;  3FXR A;  1SYI A;  4JWY A;  4PTK A;  1TWY A;  4KFQ A;  1JW5 A;  3T9H B;  3LSX A;  1MXU A;  4F3S A;  3HCQ A;  3E9X A;  4NMY A;  4R72 A;  1BK4 A;  2DWI A;  3KN3 A;  4R6H A;  4RJZ A;  1H44 A;  3PMW A;  4N6P A;  4OVJ A;  2W7Y A;  2GQ1 A;  1A55 A;  5T3J A;  4R2F A;  3CHG A;  1XVX A;  5EHM A;  1MY1 A;  3MZB A;  4ELQ A;  3E3K A;  1B32 A;  3Q28 A;  5I59 B;  2ZZW A;  4DI4 B;  5ISU A;  1TT1 A;  2X26 A;  3PPO A;  1DPE A;  3R7X A;  2F6G A;  3MP8 A;  3FXU A;  3UP9 A;  5CMC A;  5EYG A;  2GHB A;  4R9F A;  5IKB A;  3H6V A;  1YYZ A;  3N26 A;  1FBC A;  3LSW A;  4FAJ A;  3PUZ E;  1UTB A;  1TFA A;  3T22 A;  4IY6 A;  4P3L A;  4NTL A;  1OVB A;  2ZYK A;  1Q9D A;  1MM6 A;  1GGG A;  1FQE A;  3K1N A;  4NF4 A;  1QW0 A;  4NQ8 A;  4QSC A;  2P2A A;  4U23 A;  4YU0 A;  2QPQ A;  4Q30 B;  4ZE8 A;  1B52 A;  2QVR A;  4YB6 A;  4HS7 A;  4FJP A;  4O3A A;  1N3X A;  2BJI A;  3ODB A;  4TLL B;  2RF1 A;  5LOM A;  2V3Q A;  4LQ5 A;  4G68 C;  2F7B A;  1LCF A;  1MY0 A;  2FBP A;  1NL5 A;  5I2K A;  4BDN A;  1CNQ A;  4LVQ A;  4N15 A;  2LAO A;  1EZP A;  3KN7 A;  4IR8 A;  2Y5L A;  1NV1 A;  3O6G A;  1NUZ A;  3A3U A;  2XXX A;  3IB2 A;  2AYS A;  3DM0 A;  2Q2C A;  4H45 A;  4HE2 A;  3RYA A;  2A5T A;  4G8M A;  2B3B A;  4PDD A;  1DTG A;  2DS9 A;  4OET A;  1NV3 A;  2QS4 A;  4P9K A;  4GX4 A;  1SW2 A;  3B6Q A;  3FD3 A;  3BBR A;  4H5F A;  1MRP A;  1JVX A;  2F3B A;  2G93 A;  1MQJ A;  2FIE A;  2QFL A;  2Q2A A;  2VD3 A;  1EH3 A;  3TAJ A;  4RPO A;  2P3N A;  3KOT A;  2DE4 A;  2F36 A;  5A5X B;  1SW5 A;  3TCF A;  2DSF A;  1MS7 A;  5I58 A;  1IMF A;  1VR5 A;  1B3H A;  1FCK A; 
#chains in the Genus database with same CATH homology
 4H5G A;  4BLA A;  3QAX A;  4KHZ E;  2QS3 A;  3SEU A;  4ECF A;  4XKN A;  1Y1Z A;  3HO7 A;  2CZL A;  1LAX A;  4YB5 A;  3N94 A;  3MVX A;  3K02 A;  3CVG A;  4KD5 A;  5DEX B;  4QFK A;  3SET A;  4NF8 B;  2F8D A;  3EF7 A;  4ISU A;  5KDT B;  3QXM A;  2Y7W A;  3FTO A;  4JXI A;  3VXC A;  4OZ9 A;  4GIZ A;  2DE2 A;  5TP9 A;  2GHA A;  3K4U A;  1MY3 A;  2XXI A;  3PD9 A;  1LAH E;  4GFR A;  3SKP A;  4I62 A;  2XD2 A;  4PFY A;  3F11 A;  1USY E;  1FTK A;  3U1O A;  4JDF A;  4U21 A;  1VFE A;  1UQW A;  1D9Y A;  1II5 A;  1URD A;  2GH9 A;  2XXY A;  1GV8 A;  4HW8 A;  4IO6 A;  4M1V A;  3K6X A;  1A8F A;  1OMP A;  3ONM A;  5AE4 A;  1DPP A;  3USD A;  4KR5 A;  1B05 A;  3KGC A;  3T9V A;  3UOR A;  4F3G A;  1QUL A;  4GF8 A;  4QFP A;  4NE4 A;  5CMK A;  1MDP 1;  2HZL A;  4H67 A;  4OES A;  1NH8 A;  4ESX A;  2YJP A;  4DDD A;  1SBP A;  3K01 A;  1MQI A;  4N13 A;  1NNP A;  3MW0 A;  5DVF A;  5I56 A;  3PAM A;  2GFE A;  3HV1 A;  4I1D A;  2H25 A;  2GRV A;  5H8Q A;  4ZZE A;  3C34 A;  3T9X B;  3TTL A;  3BFU A;  4RK9 A;  1B3G A;  1MY2 A;  4YB7 A;  3DRI A;  1HSJ A;  4QF9 A;  5ITP A;  5I57 A;  3BKI B;  1LB9 A;  4F31 B;  5FHM A;  4X1D A;  4F2Q A;  1MQD A;  2P0S A;  2Y7K A;  4U2R A;  3PD8 A;  4WEP A;  3DRK A;  1B1H A;  4ZZA A;  2ZNT A;  4IO7 A;  3VV5 A;  4NF6 A;  2R9J A;  1B9J A;  4OFL A;  3C31 A;  4OEN A;  3OO9 A;  4I8C A;  2Y7R A;  3G3I A;  3RPW A;  2O84 X;  1M5E A;  1WVJ A;  1POT A;  3OEK A;  2DVZ A;  3VDF A;  1MY4 A;  4MH5 A;  5L9M A;  1MH4 A;  3SEW A;  4H8J A;  5CMM A;  2QSX A;  4DCY A;  4F3B A;  3KFM A;  2OCU A;  4YMB A;  4ELP A;  3FXQ A;  3DRH A;  2V3T A;  4HCY A;  1YTV A;  1DTZ A;  4EXK A;  1Z7M E;  2WOL A;  1Y20 A;  2ZYM A;  2NOO A;  1WOD A;  1PC3 A;  4PET A;  1M5F A;  1O7T A;  1LGB C;  3H6T A;  3O28 A;  3C32 A;  4MF3 A;  1PBP A;  2V93 A;  5K2X A;  2Q9T A;  4ESW A;  3O6I A;  2ZYO A;  3H7M A;  4YIC A;  3G3J A;  4FOR A;  3H6W A;  3T9U A;  2B65 A;  3S9N C;  1P1W A;  1MPD A;  2REG A;  3SDF A;  1ZU0 A;  3VLW A;  1EZO A;  3K1P A;  4QFL A;  5AA2 D;  3TTN A;  5J1D A;  2HAV A;  5I2K B;  3MVZ A;  4OFO A;  4LZ5 A;  3S4U A;  2Q89 A;  3FVO A;  4RY1 A;  5KCJ A;  1BP5 A;  4BDM A;  4P11 A;  3RT6 B;  1ELJ A;  4ZEI A;  3HST A;  4OMB A;  3PUY E;  4IO2 A;  3C4M A;  4LP2 B;  1A54 A;  3OO8 A;  3U8Q A;  2NVU B;  4BDR A;  2O1L A;  1B3L A;  3IO4 A;  3SES A;  5CRY A;  5CC2 A;  3MPL A;  3HN0 A;  4G8H A;  2I48 A;  3DP8 A;  4QRZ A;  1OLA A;  3C35 A;  3JZJ A;  3TKD A;  3FVG A;  1AIV A;  4PE5 B;  3EHT A;  5H8H B;  4EQ9 A;  1B7H A;  3MQ9 A;  4U1O A;  3ZS6 A;  5AA2 B;  2I58 A;  3SEY A;  1JQF A;  4OEV A;  3R6U A;  3KEI A;  4IO4 A;  2Q88 A;  1VSO A;  2I0C A;  3O6H A;  2A5S A;  3MPK A;  1SQY A;  5HBC A;  1JW4 A;  3DRF A;  2NUV A;  2VOZ A;  3LC8 A;  1M5D A;  3CFZ A;  5JTY B;  1FQC A;  1B4H A;  3FV1 A;  3ILT B;  4ZDM A;  3AXF A;  5H8F A;  1MXV A;  4BDQ A;  1FW0 A;  2E0S A;  2HAU A;  5EYF A;  3KZG A;  3G3K A;  3K6U A;  4LZ7 A;  3T66 A;  3TMG A;  1NKX A;  4BDL A;  4JB7 A;  4WKM A;  1IIT A;  2I3V A;  5DVI A;  3IR1 A;  1ANF A;  1FTL A;  4EF1 A;  5TP9 B;  1XOC A;  4EXL A;  4PP0 A;  3WAE A;  3IOW A;  5I2N B;  3OO7 A;  3SER A;  2F6P A;  2O6A A;  3FAS A;  1QUK A;  2F78 A;  4NF5 A;  2F34 A;  4O3B A;  4KYE A;  1MQG A;  1MDQ A;  4FIM A;  1EZ9 A;  5DYH A;  4GQO A;  3Q26 A;  4H65 A;  4LQ2 A;  3ZSF A;  1QJM A;  2H4I A;  2OBG A;  1JEU A;  1N7X A;  1R9Q A;  1IEJ A;  4C1U A;  2I0B A;  1PBQ A;  3DRG A;  3ECR A;  5TPA B;  1MXZ A;  3I5O A;  4YKK A;  2YLN A;  1FTJ A;  1LB8 A;  4KCC A;  1PEB A;  1P99 A;  3RY3 A;  1S9T A;  4DZ1 A;  1A8E A;  5B70 A;  4KYD A;  3GBB A;  1MPC A;  3OMB A;  3KSX A;  3KJ7 A;  4POW A;  4DLD A;  4F2O A;  3UIF A;  1BTJ A;  3VXB A;  5H8N B;  2RIN A;  3TUS A;  1SYH A;  3K0V A;  1M5C A;  2RC7 A;  1PDA A;  1MXY A;  1XVY A;  4POX A;  1QVS A;  2I49 A;  2VHA A;  4F1V A;  4G68 B;  2KLF A;  4IO5 A;  4H1X A;  1QUI A;  2WKY A;  3TQL A;  5JEI A;  3IJO B;  4OQO A;  2DQV A;  1ZKB A;  3IOR A;  1B4Z A;  2XX9 A;  1R6Z A;  1SW1 A;  3KG2 A;  2V25 A;  2DXY A;  2QS1 A;  2V84 A;  3TEP A;  2UVG A;  4MFI A;  3K2D A;  1OVT A;  3TQW A;  5CMB A;  3IOU A;  4PQJ A;  3MP1 A;  2ZNS A;  3CFL A;  3W9V A;  1B0H A;  3IO6 A;  1VE4 A;  3KBR A;  3RN8 A;  2ZMB A;  1XT8 A;  2Z23 A;  4E0X A;  3PMX A;  4L17 A;  3ZKL A;  4Q8R A;  3IJX B;  1N7W A;  1NNT A;  4IY5 A;  3CSG A;  4NED A;  3S9M C;  4KYS A;  1ATG A;  1N84 A;  3U72 A;  1XC1 A;  1TXF A;  2ZYN A;  1LCT A;  2I4C A;  3I6V A;  5CI5 A;  2Y7I A;  5I59 A;  4EUO A;  3M8U A;  3ILU B;  1MH3 A;  4XTC Q;  2FYI A;  2DXR A;  3H3G A;  2THI A;  4AQ4 A;  1UTH B;  4GL8 A;  1MXX A;  4P0I A;  3RTF B;  5I84 A;  4GL0 A;  2OWS A;  1IZ1 A;  1XS5 A;  4TLM B;  5AA3 A;  2AIX A;  2ONK E;  3LR1 A;  4JBZ A;  1AH5 A;  1BIY A;  2F97 A;  4OHN A;  2QRY A;  3LBS A;  1I6Q A;  1QKA A;  4QHQ A;  2Y7P A;  3HHF A;  3JV9 A;  3CSB A;  1POY 1;  3GLB A;  5FTH A;  1IXC A;  1D9V A;  2H98 A;  4G4P A;  4KPT A;  1JNF A;  3TZA A;  3FJG A;  3IL1 B;  4M4G A;  1S7Y A;  3U94 A;  3U93 A;  2B4M A;  2OWT A;  2I3W A;  1ZTY A;  2ONR A;  2XXV A;  3MZ9 A;  3EN3 A;  1LST A;  2IA4 A;  4R74 A;  3G3G A;  4QSE A;  3CG1 A;  1N3W A;  3IOV A;  4OWD A;  3QK6 A;  1RYX A;  5HM4 B;  1LAG E;  5KZT A;  2NWJ A;  2HCA A;  1GR2 A;  2CMO A;  1DMB A;  1QUJ A;  3S2V A;  1B7Z A;  3FVK A;  4LZ8 A;  4IB2 A;  2PVU A;  4U4S A;  4OTE A;  3QIM A;  1M5B A;  2IEE A;  1JVY A;  3MVW A;  3K1M A;  4F18 A;  1Y3N A;  1Y1M A;  4HCW A;  4KQP A;  5A5X A;  2E1S A;  4C0R A;  1JET A;  3A3C A;  3VVD A;  3VVF A;  1P1O A;  4MBP A;  3SEX A;  4H8I A;  2O1M A;  3N6U A;  2UVJ A;  4U4X A;  3TOD A;  3V83 A;  2FNC A;  3GBA A;  2ONS A;  1SD3 A;  3PMV A;  3G3H A;  1EU8 A;  2HQ0 A;  2P1S A;  1UIU A;  4ELR A;  1UTB B;  3L6G A;  1J1N A;  3UN6 A;  3CRB A;  3V89 B;  4PFW A;  5DEX A;  3OEL A;  1SVX B;  4NF4 B;  4JSD A;  4RA1 A;  4NF8 A;  3DP4 A;  2X7Q A;  2RKM A;  2UVH A;  5KDT A;  3PGF A;  2WOP A;  4F19 A;  5CBS A;  1PB7 A;  1QKB A;  1ZLQ A;  4LAT A;  1CE2 A;  4YKP A;  4R6Y A;  1RKM A;  1IIW A;  2H5Y A;  4GD5 A;  1IXH A;  1CB6 A;  1URS A;  5AA1 A;  3B6W A;  1USY H;  1MQH A;  1A7L A;  1P1U A;  1S50 A;  5DTB A;  1B7U A;  3PV0 E;  4XKQ A;  5FHN A;  5L9O A;  4LON B;  3BFT A;  2DWA A;  1MXW A;  2A5T B;  3B7D A;  3T93 B;  1FTO A;  4TOZ A;  3O6P A;  3DLN A;  5L9S A;  1YAE A;  3LVU A;  4HTG A;  2UYF A;  4ELO A;  2UYE A;  4RNS A;  2ESN A;  4X48 A;  2O69 A;  3OSQ A;  4QFO A;  1NFT A;  2Z22 A;  3IX1 A;  3UK4 A;  3C9H A;  5JK4 A;  2PYY A;  5F1Q A;  2XD3 A;  1SI0 A;  4YAH X;  4U22 A;  1N76 A;  1P1N A;  3QUF A;  4NWD A;  1B58 A;  1B5J A;  3MZ1 A;  4IGR A;  1FQD A;  1AL3 A;  5I58 B;  2XXH A;  2G29 A;  3QUJ A;  4QSD A;  3EHU A;  4JWO A;  3A09 A;  3W15 C;  5BWJ A;  4FEC A;  1IQ7 A;  3S9L C;  1OIB A;  1I69 A;  1ZMG A;  1B5H A;  3M3L A;  1ZJL A;  4FED A;  3DP6 A;  3LSL A;  2D3I A;  4GLI A;  4ZE9 A;  3Q29 A;  4GOT A;  5ICQ A;  1H3D A;  4ND9 A;  5IAI A;  3VFJ A;  4F39 A;  4ZEC A;  3HHG A;  4NWC A;  3ZKK A;  4C1T A;  4DIG A;  4GRK A;  4THI A;  2XXW A;  5DVJ A;  4JWX A;  3FIR A;  4EQB A;  5L8D A;  3MJN A;  4TQU Q;  3PU5 A;  3H6U A;  2OZZ A;  3TCH A;  5FTI A;  4OXV A;  1BKA A;  4DCX A;  1OQH A;  2NXO A;  3OOA A;  1PB9 A;  4DXC A;  3Q25 A;  2M8C A;  2ZNU A;  3TTM A;  4ZEB A;  1US4 A;  3PUV E;  4XKP A;  3VLU A;  3PPR A;  3P7I A;  3M3F A;  3OO6 A;  1BLF A;  2OJT A;  4EQ7 A;  1O63 A;  1H45 A;  1LFI A;  1XHY A;  4YKJ A;  2PMS A;  3N6T A;  2DWH A;  4OEU A;  3RTW B;  2PT2 A;  3SEV A;  1D4N A;  3K00 A;  1A99 A;  2QL3 A;  3K6V A;  2VD2 A;  5CBR A;  2O68 A;  4AB6 A;  3CR9 A;  5I56 B;  4GVO A;  3PPN A;  1Q1K A;  2VP1 A;  5H8Q B;  2DOJ A;  3E4R A;  1Y4C A;  2RCA A;  5TU0 A;  1URG A;  1NMU A;  2HZK A;  4X1B A;  4Z0I A;  1ZIU A;  3MC2 A;  3QSL A;  2DP8 A;  1LFH A;  3THI A;  2XXQ A;  4Q0C A;  1NH7 A;  5I57 B;  3OXN A;  1AMF A;  3FZV A;  1B2H A;  1TFD A;  4E0W A;  1IXG A;  4WED A;  4NF6 B;  2AL5 A;  4R75 A;  2XXR A;  3T96 B;  4G77 A;  3CFX A;  2QMW A;  1NNF A;  2ABH A;  3PUW E;  1HSE A;  1JEV A;  5AA4 A;  3EPE A;  4DXB A;  3RUM A;  2QS2 A;  1FQB A;  1R9L A;  3VVE A;  3WAF A;  1B46 A;  3DEL B;  2FA7 A;  3C33 A;  3OEM A;  5H8H A;  4IO3 A;  5BUU A;  3OD7 A;  5AA2 A;  3PPP A;  5F7V A;  1DSN A;  3Q27 A;  1N04 A;  4WXJ A;  4RPN A;  1MG1 A;  3MAM A;  3EQ1 A;  3KN8 A;  4R6K A;  4O3C A;  4JSO A;  1P1Q A;  4XKR A;  4LUB A;  1B0L A;  3JYR A;  1NNK A;  5JTY A;  3FGS A;  4UAC A;  4PFT A;  3H06 B;  2F7C A;  4AB5 A;  2F35 A;  1AOV A;  1LAF E;  1PB8 A;  2R6G E;  2B3F A;  4PFU A;  4XIG Q;  1HSL A;  4MLQ A;  4YZZ A;  4GWO A;  3TEL A;  3IAZ A;  3RQT A;  2DVC A;  2F5X A;  4DE8 A;  3FAT A;  2I4B A;  2VGQ A;  3VLV A;  3KSJ A;  3D4C A;  1SI1 A;  1F9B A;  3S9E A;  4BDO A;  5I2N A;  3IB1 A;  2UXA A;  1GTK A;  1R1N A;  3H4Z A;  3M3K A;  5KCJ B;  4OFJ A;  1LFG A;  5DT6 A;  2PBW A;  3H03 A;  4KCD A;  2Z8E A;  1US5 A;  3R26 A;  1YPN A;  2D21 A;  5M2V A;  1MPB A;  3K6W A;  3CI8 A;  2XX8 A;  3CG3 A;  3TDJ A;  3IOT A;  4QFN A;  3RLF E;  4G8N A;  2XX7 A;  5ITO A;  1Q35 A;  5TPA A;  3O2A A;  2X7P A;  4MLV A;  3RGY A;  2O7I A;  1RYO A;  1I6B A;  3RYB A;  3C36 A;  4H6D A;  4UA8 A;  3FV2 A;  2H99 A;  3O66 A;  3V8X B;  1B6H A;  3TTR A;  3VE1 B;  3CIJ A;  3UGW A;  4EDP A;  3N5L A;  4IGT A;  2ANJ A;  1T0K A;  2HXW A;  4ZEK A;  2ALU A;  5FHO A;  3O9P A;  4ZED A;  1B1X A;  1FQA A;  4F22 A;  3DRJ A;  1B5I A;  5H8N A;  3W9W A;  1YCJ A;  3TFL A;  3QYT A;  1Y4T A;  2R71 A;  4XXU A;  2Z8F A;  4RXL A;  4GXA A;  4F1Y A;  4G68 A;  1B3E A;  2V3U A;  3U92 A;  2QJE A;  2WOK A;  1I6A A;  3OEN A;  1B51 A;  5ICT A;  4ZEF A;  4ONY A;  5H8F B;  2DWJ A;  2I6E A;  4N07 A;  1WDN A;  5HPQ A;  2D5W A;  3UA8 A;  3MVY A;  4R2B A;  2OLB A;  2F7A A;  1LBB A;  4EF2 A;  2O51 A;  1Y3Q A;  3FJ7 A;  1OLC A;  3L6H A;  1LLS A;  4R73 A;  2XHD A;  2OK2 A;  1Z7N E;  1Y3P A;  2AL4 A;  1GVC A;  1L5T A;  2XXU A;  1SDX A;  4F3P A;  2Z8D A;  5K2Y A;  4ZS9 A;  3HPI A;  1FQF A;  2RCB A;  1B40 A;  3RT8 A;  4NF5 B;  3O29 A;  2YPN A;  2O7U A;  4YMA A;  4G2Z A;  2Q8J A;  2HEU A;  3PPQ A;  5B7D A;  4YKI A;  4FAT A;  2RC9 A;  1LBC A;  3I3V A;  2REJ A;  3KOS A;  2DE3 A;  4Z7E A;  4FEB A;  3LUY A;  1ZBM A;  3PUX E;  3MBP A;  2XXT A;  1IUD A;  3G7W A;  1O64 A;  4F29 A;  3TCG A;  1D3K A;  2HFB A;  1VFD A;  5EHS A;  2ZXT A;  4KI0 E;  1A40 A;  2RC8 A;  4GXS B;  1UTH A;  1FTM A;  4Q5T A;  1N0T A;  1Y9U A;  2PT1 A;  4H0W A;  4LA9 A;  2DYX A;  4U1Z A;  3D4G A;  3TPA A;  2QMX A;  3MP6 A;  3B6T A;  3TTK A;  3E13 X;  5ELV A;  2B4L A;  4I9D A;  1KWH A;  2BJJ X;  4FE8 A;  4OER A;  3KJT A;  4DXU A;  5CM6 A;  1DOT A;  1JW1 A;  3GZG A;  4RK2 A;  3FUZ A;  3OSR A;  4RYA A;  3EHS A;  4X9T A;  1UIV A;  1OQG A;  1B3F A;  3RNN A;  3MUQ A;  4OYV A;  3O97 A;  1H43 A;  5H8S A;  5AA4 B;  2H9B A;  3V5A A;  3LSF B;  3TYH A;  3FJM A;  3G3F A;  4F1U A;  2PX1 A;  1IXI A;  2UVI A;  3IK6 B;  1MM7 A;  4R9G A;  4K3F A;  3GXA A;  2Y84 A;  1H76 A;  4P0G A;  2XXP A;  3IB0 A;  3FVN A;  3MWB A;  1SW4 A;  3FXR A;  1SYI A;  4JWY A;  1TWY A;  4KFQ A;  1JW5 A;  3T9H B;  3LSX A;  1MXU A;  4F3S A;  3HCQ A;  3E9X A;  4NMY A;  4R72 A;  2DWI A;  3KN3 A;  4R6H A;  4RJZ A;  1H44 A;  3PMW A;  4N6P A;  4OVJ A;  2W7Y A;  1A55 A;  4R2F A;  3CHG A;  1XVX A;  5EHM A;  1MY1 A;  3MZB A;  4ELQ A;  3E3K A;  1B32 A;  3Q28 A;  5I59 B;  5ISU A;  1TT1 A;  2X26 A;  3PPO A;  1DPE A;  3R7X A;  2F6G A;  3MP8 A;  3FXU A;  3UP9 A;  5CMC A;  2GHB A;  4R9F A;  5IKB A;  3H6V A;  3N26 A;  3LSW A;  4FAJ A;  3PUZ E;  1UTB A;  1TFA A;  3T22 A;  4IY6 A;  4NTL A;  1OVB A;  2ZYK A;  1MM6 A;  1GGG A;  1FQE A;  3K1N A;  4NF4 A;  1QW0 A;  4QSC A;  2P2A A;  4U23 A;  4YU0 A;  2QPQ A;  4Q30 B;  4ZE8 A;  1B52 A;  4YB6 A;  4HS7 A;  4FJP A;  4O3A A;  1N3X A;  3ODB A;  4TLL B;  2RF1 A;  5LOM A;  2V3Q A;  4LQ5 A;  4G68 C;  2F7B A;  1LCF A;  1MY0 A;  1NL5 A;  5I2K A;  4BDN A;  4LVQ A;  2LAO A;  1EZP A;  3KN7 A;  3O6G A;  3A3U A;  2XXX A;  3IB2 A;  2AYS A;  3DM0 A;  2Q2C A;  3RYA A;  2A5T A;  4G8M A;  2B3B A;  1DTG A;  2DS9 A;  4OET A;  2QS4 A;  1SW2 A;  3B6Q A;  3FD3 A;  3BBR A;  4H5F A;  1MRP A;  1JVX A;  2G93 A;  1MQJ A;  2Q2A A;  2VD3 A;  1EH3 A;  3TAJ A;  4RPO A;  3KOT A;  2DE4 A;  2F36 A;  5A5X B;  1SW5 A;  3TCF A;  2DSF A;  1MS7 A;  5I58 A;  1VR5 A;  1B3H A;  1FCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...