1B5HA

Oligo-peptide binding protein complexed with lysyl-diaminopropanoic acid-lysine
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
total genus 194
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b5hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b5hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b5hA02
2RINA 2REGA 3SEWA 5CI5A 2Z22A 2ANJA 1MXYA 4OVJA 4WEDA 3OELA 2HXWA 2OJTA 1Y4TA 3FASA 1B46A 2XXYA 1IXHA 3OMBA 3PV0E 4QRZA 4G8HA 1FQEA 2THIA 1SW4A 3VLUA 4OERA 4X1BA 1PBPA 4XKRA 2F97A 1MH3A 3EQ1A 1PB7A 4H8IA 1ZU0A 1QUIA 4NF5B 4QSEA 3T22A 1RYOA 1URGA 3HHFA 4Q30B 3VVDA 5JEIA 1H3DA 1SI0A 4ZE9A 1DMBA 2AYSA 3KZGA 5CMBA 1A40A 4LP2B 4YB5A 3RTWB 3T9HB 3VVFA 4GD5A 3KSXA 4OETA 3N94A 1US5A 4I62A 3K01A 3QXMA 1MQGA 4RXLA 5I2KB 3RT6B 1EH3A 2B3BA 4F3PA 2QPQA 4P0GA 4R72A 3I5OA 1NNPA 1MPBA 2DSFA 2P1SA 1B3HA 3V8XB 3MZBA 2UXAA 3KJTA 4ESXA 1YPNA 1QW0A 2Q8JA 3K6VA 4ZDMA 4R75A 3QK6A 3U8QA 3RYBA 4ESWA 4EXKA 4POXA 1JW1A 4GOTA 2PT1A 5DTBA 3TELA 3PMVA 2ONSA 3PPNA 3T9XB 1NH7A 4EF1A 3K1PA 4IY5A 4NF4B 4OZ9A 4Z7EA 3PUWE 5DVIA 2HAUA 1SW1A 2DQVA 2HZKA 1FTLA 2OCUA 4G8MA 4ND9A 1NNTA 1DTZA 3QUFA 2HFBA 5K2YA 4LZ8A 5TP9A 2XX8A 4OMBA 2Y84A 1MXXA 4OHNA 5TU0A 3SEYA 3QUJA 3T66A 2F36A 3E3KA 1B7ZA 2QS2A 3F11A 4PP0A 4U22A 3THIA 4YMAA 3K1NA 3D4GA 4FEDA 4BDOA 1MH4A 4GF8A 1SBPA 4N07A 3IO4A 5CRYA 4F22A 5KZTA 3TDJA 1I6BA 4N6PA 3UGWA 2H99A 1JVXA 4KYSA 3B7DA 2E0SA 4RPOA 5DVFA 2WOPA 2WOLA 4X9TA 5I2KA 1MDQA 3UORA 4FJPA 3Q28A 4DDDA 2YJPA 1TFDA 2F78A 1MQHA 4GXSB 3VXCA 4DXUA 2ZMBA 3K1MA 3KOSA 3PMWA 1ZMGA 4M4GA 5KCJA 3QIMA 5I57B 3OO8A 3MVXA 3TCGA 4NF5A 4Q5TA 2IEEA 4R6HA 5CBRA 2XHDA 4TOZA 3N6UA 3TODA 5L9MA 3U94A 4MH5A 1EZ9A 3MVYA 1LGBC 2Q88A 3FGSA 4TLLB 1FQDA 2B3FA 1NNFA 2F34A 3MP1A 2VOZA 1EZPA 4QF9A 1R1NA 1AOVA 3CR9A 3IR1A 3QYTA 2X7QA 1A55A 1CE2A 3A09A 1DPPA 2VD3A 1BKAA 2B4MA 1WDNA 4WXJA 3TTLA 4F1YA 4K3FA 5DYHA 1JEUA 5LOMA 4LVQA 1QUJA 1Y20A 4YU0A 4DXCA 3N26A 5EHMA 3G3FA 2H98A 4OXVA 1SYIA 3K0VA 3PGFA 3WAFA 3W9WA 1HSJA 3RPWA 1A7LA 3H7MA 1B58A 3KJ7A 3LBSA 2AL4A 2XXQA 4KHZE 3PUXE 3FVNA 5I58B 3PAMA 4Q0CA 1B51A 3C32A 3QSLA 3T93B 5KCJB 1JNFA 5AA2B 1BLFA 4HTGA 1FTJA 3HPIA 2Q2CA 2I3VA 1B52A 1PB9A 4UA8A 5H8QB 5L9OA 3CFXA 2OK2A 3IORA 3IJOB 3G3JA 4XKPA 4H5GA 4GLIA 4IO3A 3RY3A 2OBGA 3MZ1A 1GTKA 4EF2A 1IXGA 4HS7A 1LB9A 4QSDA 4JSDA 1LAFE 3CIJA 4TQUQ 1B3GA 1JETA 3DP8A 1VFDA 4THIA 5DEXA 3SEXA 2DWHA 3MVZA 2IA4A 3KN3A 3HO7A 2VP1A 4LZ5A 5AE4A 1MS7A 1URDA 1OQGA 4YKIA 4PFTA 1B40A 2OLBA 1UTBA 3N5LA 3HSTA 3MPKA 3MUQA 5BUUA 1ZKBA 4F2OA 3IOVA 4GXAA 5HPQA 2ALUA 4R2FA 3CFZA 5I57A 1FQFA 1B4HA 1O63A 2UVJA 2Z8FA 5I2NA 1ZIUA 1B9JA 2VGQA 5EHSA 1AL3A 1H43A 2FA7A 3SEUA 4DE8A 2Z8EA 1DTGA 4LATA 1J1NA 3CG3A 1XC1A 4NWDA 1B1XA 1P1WA 1SI1A 5I84A 3OO9A 3W9VA 1XVYA 5AA3A 5H8QA 2RC9A 2DWAA 1CB6A 2XXXA 1BIYA 2FYIA 3TMGA 3GBAA 5JTYB 3TPAA 1MY1A 2O51A 3CVGA 1PEBA 3G3IA 3IAZA 4H5FA 4U23A 5ELVA 3KFMA 4KPTA 3RUMA 4F18A 1ZBMA 1SW5A 1EZOA 3EHTA 2V93A 3IOUA 3RYAA 5H8FB 3LSWA 1LAGE 4H65A 3TTKA 2ONKE 1B05A 2VHAA 3EPEA 4YB7A 3V83A 5DT6A 2DWJA 2G93A 4I1DA 4NWCA 4U2RA 2XXPA 1ZTYA 1Y9UA 2ZNSA 3C36A 2F8DA 2DS9A 1MRPA 2PYYA 2YPNA 1XVXA 4LZ7A 3AXFA 1H76A 1B5HA 3TQWA 1R9LA 5B7DA 2I0BA 2I58A 5TPAA 3MP6A 4JWXA 2I4CA 4IO2A 3MW0A 4G4PA 2R6GE 2Q9TA 1YTVA 3O9PA 2W7YA 1MXUA 3CRBA 3L6HA 2YLNA 2I0CA 3FZVA 4LQ2A 3FVKA 3H6TA 1I6AA 3D4CA 2UVHA 3IX1A 2XX9A 1AH5A 1EU8A 2O69A 2X26A 4U1OA 3GBBA 1QJMA 1GV8A 4C1TA 4XKNA 1N3XA 4R9GA 1FQAA 1VFEA 1FTKA 4GL0A 2PMSA 1OVBA 4RY1A 4EUOA 2UYEA 3DRHA 1R6ZA 1LAXA 3BBRA 1QKBA 3LSFB 3MJNA 1UIVA 4QFNA 1MM7A 2DVZA 3IO6A 3K6WA 3U1OA 2OWSA 3G3GA 4KCCA 2XX7A 5I2NB 4E0XA 1MPCA 1VSOA 4PE5B 2F7BA 3K2DA 3H6WA 3Q26A 3V89B 4BDQA 4F39A 2H9BA 1I69A 1Q1KA 1VE4A 1XHYA 3VDFA 3OEMA 1XT8A 4QFOA 4R6YA 4GFRA 3O28A 3VLVA 3KN7A 4KQPA 1GVCA 5AA4A 1WVJA 4ZZEA 4XKQA 1Y1MA 1SVXB 4BDNA 1URSA 3MVWA 3OOAA 2RCAA 1USYH 2NOOA 2OWTA 2ZYOA 5CM6A 4ZEKA 1JW5A 4WKMA 3GXAA 3IOTA 2R71A 5H8NA 4QHQA 3TYHA 3DRJA 5H8FA 3DELB 4U21A 3FIRA 4QFKA 3UIFA 2I48A 3MPLA 3OXNA 4RJZA 1D9YA 5KDTB 2ZNTA 2I3WA 4YKJA 4ZS9A 3ZKKA 1MM6A 1LCFA 2CZLA 1B1HA 1M5BA 1RKMA 2XXUA 2HEUA 3PD9A 3PUYE 1B0HA 5H8HB 3T9VA 4F3SA 3FTOA 1XOCA 4PFWA 1IZ1A 3R6UA 4JBZA 3W15C 2V25A 1FTOA 3RLFE 1QVSA 5TPAB 1Y3NA 3BFUA 2Z23A 3K6XA 3KG2A 3GZGA 2QS4A 3Q29A 1JEVA 3O6GA 3RT8A 3TFLA 1F9BA 3ECRA 3OD7A 4I8CA 4GL8A 3EHUA 4IO6A 4IO4A 1LFIA 2X7PA 5CMMA 5I56A 3SDFA 1TWYA 3UP9A 4R74A 2B4LA 2XD3A 3R26A 4NE4A 5BWJA 4P0IA 4RK9A 4NF6B 3SKPA 2RF1A 5TP9B 1NNKA 3CI8A 1OLAA 4QFLA 3IB2A 1LSTA 1LFHA 1NKXA 3MZ9A 3RQTA 3TZAA 3K02A 2ZYKA 4IY6A 2D21A 2H25A 3E4RA 4WEPA 4GWOA 2QL3A 3L6GA 4IO7A 3UK4A 1RYXA 3BFTA 1USYE 4DCXA 2O7UA 2XD2A 4OWDA 5H8HA 1BP5A 3GLBA 1ATGA 5F7VA 1US4A 4XIGQ 3O6PA 3PMXA 3VXBA 4KCDA 3T9UA 4LONB 3ILTB 4ELQA 3FUZA 3LVUA 4PQJA 5A5XA 4NF8B 4O3CA 3CG1A 1UTHA 4OENA 1VR5A 2F5XA 2UYFA 1D3KA 2V3TA 4ZEIA 4LUBA 3OEKA 3SESA 3UN6A 3V5AA 4YICA 2F6PA 1P1UA 4YMBA 3A3UA 5I56B 5F1QA 2M8CA 2HZLA 3JV9A 4ELOA 4EXLA 5ICQA 3B6WA 3S9LC 2XXHA 2DE4A 3I6VA 4N13A 1DPEA 4R6KA 3DP4A 2P2AA 4KYDA 5EYFA 5ITOA 4OQOA 1M5FA 1SYHA 4R9FA 1N04A 3SERA 1B32A 4OFLA 5AA2D 4JB7A 3KN8A 1OMPA 4F31B 2V3UA 3FVGA 3KEIA 3VFJA 4AB5A 2PX1A 3EF7A 4OEUA 1B3LA 4HCYA 3DRIA 2GHAA 4ZEDA 1IEJA 1N0TA 3FV2A 1A54A 2O84X 4G68B 1LLSA 1PBQA 3G7WA 3PPRA 4XTCQ 3VV5A 2DXYA 5HBCA 3H03A 4F1UA 4PETA 2Q89A 2XXIA 3FJ7A 4FECA 4GRKA 4UACA 1DSNA 1KWHA 5FTHA 2HCAA 2Z8DA 4IB2A 1I6QA 1MXVA 4F3BA 5CMKA 5I58A 2LAOA 5FHNA 2PVUA 4NTLA 3FATA 3USDA 1P1OA 2DVCA 5AA2A 5ITPA 3MAMA 2NVUB 2Y7RA 4JWOA 2XXRA 4GVOA 4YKPA 2REJA 3TQLA 1NFTA 1IXCA 1P1QA 3LC8A 1B7HA 2P0SA 3CFLA 2FNCA 3IOWA 3OSRA 1QUKA 4GIZA 4FATA 3S4UA 5DEXB 4POWA 2UVGA 4BDLA 1OIBA 2Y7KA 1YAEA 5B70A 5ICTA 1D9VA 4MF3A 4FAJA 4JWYA 4DIGA 3B6TA 1B0LA 4DXBA 2ZNUA 1OVTA 1JW4A 3LSLA 3TTRA 4H0WA 3SEVA 5JK4A 1DOTA 3H3GA 4NF8A 4OTEA 1PC3A 1B5JA 1UTHB 3K6UA 1A99A 3M3LA 2DYXA 4FIMA 4LA9A 2NUVA 4BDRA 3KBRA 3VE1B 1Y3QA 4DLDA 4AB6A 1B4ZA 2VD2A 2HAVA 1ELJA 4KFQA 1MY3A 1N7XA 5L8DA 3DLNA 2GFEA 2H4IA 1LFGA 4ONYA 4H8JA 5CMCA 3E9XA 2RC8A 4JSOA 1MG1A 1WODA 5FHOA 1FTMA 4G8NA 3OSQA 4MLVA 4G2ZA 4MLQA 3H6VA 3IB1A 1POTA 1Q35A 3FJGA 2RC7A 4ECFA 2F35A 2D3IA 4NEDA 2CMOA 4RK2A 5HM4B 1YCJA 4HW8A 2RKMA 5H8SA 1MXWA 1UTBB 2XXVA 4F2QA 4Z0IA 3MC2A 1L5TA 4G77A 3H6UA 5IKBA 3O66A 4G68A 3S2VA 4OESA 3M8UA 4H67A 1MPDA 2Y7PA 4EQ7A 1NL5A 3C9HA 1ZLQA 3G3KA 4NF4A 3TTNA 1HSEA 1TFAA 1R9QA 3PD8A 4NMYA 2DWIA 5CC2A 4BLAA 3ZKLA 1MQJA 4ZEFA 1UIUA 4DCYA 1N3WA 1LCTA 3FVOA 3H4ZA 1POY1 3LSXA 1B2HA 1FQBA 5IAIA 1JQFA 1ANFA 4JDFA 3TEPA 5JTYA 4YZZA 2PT2A 1H44A 1QKAA 2ONRA 3JZJA 4O3BA 1PDAA 4ISUA 3FV1A 3PUZE 2BJJX 4IO5A 4L17A 3R7XA 4Q8RA 3TCFA 1NMUA 3MP8A 2ABHA 3Q25A 4X1DA 4ZZAA 3FXQA 3O97A 1MXZA 3FXRA 4H6DA 1GGGA 3HCQA 3DRFA 1IITA 2NXOA 4AQ4A 4F29A 5CBSA 1Y1ZA 1MDP1 5AA1A 2XXWA 3HHGA 3CSGA 4DZ1A 4U4SA 4TLMB 5DVJA 2QMXA 2GRVA 2GHBA 3Q27A 3IL1B 3RN8A 3RTFB 2GH9A 4MBPA 4BDMA 1IUDA 2QJEA 2O6AA 4OFOA 2A5TB 2NWJA 3N6TA 2QS1A 1H45A 1N84A 3ONMA 1MY2A 1LBBA 3U93A 3KGCA 4KD5A 3LR1A 3BKIB 4QFPA 1O64A 3EN3A 4YAHX 4XXUA 2QRYA 2F7AA 3OO6A 1OQHA 2ESNA 3RNNA 3WAEA 1PB8A 1SW2A 4EQBA 3QAXA 3DRGA 1LAHE 5KDTA 2KLFA 2F7CA 1B5IA 2H5YA 2ZXTA 1IQ7A 4KI0E 3VVEA 3MBPA 3PUVE 1MQIA 3FXUA 1SDXA 1MY0A 3O2AA 1N76A 3FD3A 1Y3PA 3FJMA 4F1VA 3C34A 4P11A 4YKKA 1XS5A 2WKYA 1S7YA 2HQ0A 3SETA 1N7WA 2Q2AA 2I4BA 3IK6B 3C35A 3CSBA 3I3VA 4PFYA 4IGRA 3ZSFA 4E0WA 2WOKA 4OYVA 2A5TA 1AMFA 3K4UA 3OENA 5K2XA 5FTIA 1S50A 4ZE8A 3IB0A 1M5DA 1LB8A 2QMWA 3LUYA 4FORA 3M3FA 4GQOA 3MQ9A 3P7IA 4NF6A 4R2BA 4ZEBA 3UA8A 5I59B 5J1DA 2AL5A 2Y7IA 1AIVA 3DRKA 3U72A 3H06B 2AIXA 3KSJA 3TAJA 1B6HA 2XXTA 3KOTA 2O1LA 3HN0A 4O3AA 1JVYA 1SQYA 3HV1A 4I9DA 1A8FA 1P1NA 4U4XA 4OEVA 4C0RA 2ZYNA 3RGYA 5FHMA 1T0KA 2O7IA 2I6EA 1Y4CA 2I49A 1S9TA 2DXRA 3ILUB 3O6HA 4EDPA 5L9SA 4HCWA 1A8EA 4IGTA 3OO7A 1FCKA 4FEBA 4KR5A 4F3GA 4PFUA 2O1MA 3EHSA 2QSXA 2Y7WA 4R73A 3TKDA 3M3KA 2QS3A 1MQDA 3K00A 4YB6A 1Z7ME 2DE3A 1FW0A 1TT1A 1II5A 3MWBA 1Z7NE 1QULA 4ELPA 3CHGA 1OLCA 4MFIA 3G3HA 3T96B 4C1UA 3S9MC 3JYRA 4JXIA 4EQ9A 4U1ZA 3VLWA 1B3FA 2A5SA 5I59A 4LQ5A 1M5EA 3PU5A 1IIWA 1NH8A 4M1VA 2OZZA 2PBWA 1FQCA 1GR2A 2RCBA 4OFJA 3PPOA 3C31A 2DP8A 3O29A 3ZS6A 1B7UA 3B6QA 1B3EA 2DOJA 1BTJA 1O7TA 5A5XB 1P99A 1IXIA 3C4MA 1TXFA 2UVIA 3O6IA 2B65A 4X48A 3TCHA 2V3QA 4KYEA 2D5WA 5ISUA 3S9EA 4ZECA 2O68A 2R9JA 2F6GA 2ZYMA 3C33A 3IJXB 1HSLA 4RYAA 4ELRA 3TUSA 3DP6A 5AA4B 4RA1A 1D4NA 4H1XA 2V84A 1UQWA 3PPQA 4G68C 2DE2A 3S9NC 1MY4A 1M5CA 3E13X 5M2VA 4QSCA 3A3CA 5H8NB 2G29A 1LBCA 3PPPA 4RPNA 3U92A 4RNSA 2E1SA 3DM0A 3ODBA 4FE8A 3TTMA 1ZJLA 1SD3A 4F19A
chains in the Genus database with same CATH superfamily
3SEWA 3OELA 1B46A 2XXYA 1FQEA 1SW4A 3VLUA 4XF5A 1FPJA 3T22A 4NF5B 1H3DA 3RTWB 2AYSA 3T9HB 1KA0A 1A40A 3VVFA 5IZZA 4OETA 3N94A 4HXVA 5LDZA 4MNIA 3I5OA 1NNPA 2P1SA 2XWIA 3V8XB 3MZBA 2UXAA 3QK6A 4MNCA 2PT1A 5EQAA 2WX9A 4Z7EA 4IY5A 4NF4B 4OZ9A 1SW1A 2HZKA 1FTLA 3QUFA 2HFBA 4LZ8A 2Y84A 3T66A 2F36A 2QS2A 4YMAA 4U22A 3THIA 4GWYA 4BDOA 4GF8A 5EQ9A 3TDJA 3B8BA 4RPOA 2E0SA 1MDQA 4P1EA 4DDDA 2YJPA 4GXSB 4DXUA 3K1MA 3PMWA 4M4GA 5LTCA 5I57B 3TCGA 5I3SA 4R6HA 2XHDA 1EZ9A 1EZPA 1NNFA 4OVRA 2VPNA 3A09A 3A29A 1FBDA 1BKAA 4JVDA 1EYKA 2B4MA 1WDNA 3TTLA 4K3FA 4LVQA 1KZ8A 3N26A 1YZ0A 1A7LA 3H7MA 1B58A 3KJ7A 3LBSA 3PUXE 3PAMA 4Q0CA 3C32A 5KCJB 1JNFA 2Q2CA 2I3VA 1B52A 4UA8A 4H5GA 3RY3A 2OBGA 1IXGA 2HHMA 1JETA 1VFDA 4THIA 2DWHA 2IA4A 4LZ5A 1MS7A 4YKIA 4PFTA 2OLBA 3MUQA 3IOVA 4R2FA 1FQFA 4N8GA 2UVJA 2VGQA 3SEUA 1DTGA 4LATA 1B1XA 1XVYA 5H8QA 2KQZA 3GBAA 3TPAA 2O51A 5ELVA 3CVGA 3G3IA 4KPTA 3RUMA 1EZOA 3IOUA 4H65A 1B05A 3EPEA 2G93A 4NWCA 1ZTYA 1Y9UA 2DS9A 3AXFA 2I0BA 5I7IA 3MP6A 2I4CA 1BK4A 1MXUA 3L6HA 2YLNA 3VXCA 3FVKA 2O69A 3U65A 2PMSA 2QVVA 3BBRA 3DRHA 1R6ZA 1LAXA 3LSFB 4GWOA 4BDLA 4DIGA 1UIVA 4QFNA 2DVZA 3IO6A 5EQ7A 1MPCA 3K2DA 3H6WA 3V89B 4BDQA 2H9BA 1I69A 1XHYA 3VDFA 4XKQA 4BDNA 3OOAA 2RCAA 2OWTA 3IOTA 3UIFA 4DI3D 4YKJA 4ZS9A 1MM6A 2CZLA 1B1HA 4F3SA 1B0HA 4PFWA 1IZ1A 3R6UA 1IMEA 2V25A 4MHFA 1QVSA 5TPAB 1Y3NA 3K6XA 3TFLA 4PFBA 1FPEA 4I8CA 4GL8A 3RPLA 1LFIA 2B4LA 3R26A 3CI8A 1LFHA 1LSTA 3MZ9A 3RQTA 3TZAA 2ZYKA 2D21A 2XA5A 2WYKA 1NUXA 5H8HA 4KCDA 3LVUA 1UTHA 4OENA 2F5XA 4LUBA 3V5AA 4YMBA 3A3UA 4ELOA 4EXLA 5ICQA 1IMBA 4R6KA 3DP4A 4R9FA 3SERA 2FBPA 1OMPA 2PX1A 4OEUA 4ZEDA 3FV2A 2O84X 1LLSA 4GWSA 2DXYA 4PETA 2Q89A 4UACA 4GRKA 1DSNA 5CMKA 4IB2A 5AA2A 5ITPA 1P1OA 2Y7RA 2XWOA 2REJA 2DDKA 1P1QA 2P0SA 4X8RA 5ICTA 4MF3A 5T3JA 2ZNUA 3TTRA 4HE2A 1FBGA 5IGAA 1K9ZA 4OTEA 3M3LA 1A99A 4DLDA 1Y3QA 4AB6A 3U93A 2RC8A 4JSOA 4G8NA 4MLQA 1IMDA 4ECFA 2F35A 4HW8A 5HM4B 1YCJA 3KC0A 1UTBB 4F2QA 5IKBA 2Y7PA 1NL5A 1ZLQA 3G3KA 4NF4A 5CC2A 4BLAA 1N3WA 3H4ZA 1POY1 3LSXA 1B2HA 5JTYA 1EYIA 1QKAA 4N17A 3PUZE 4L17A 3R7XA 3TCFA 4ZZAA 1GGGA 1FBCA 1Y1ZA 4P47A 2P3VA 3HHGA 4PAFA 4TLMB 2GRVA 3Q27A 4BDMA 2A5TB 2NWJA 3N6TA 4AS5A 2CEXA 4PE3A 4QFPA 4YAHX 4HE0A 1NV7A 5I5PA 4EQBA 3ISPA 5KDTA 2ZXTA 4PFIA 2VT5A 2WBBA 4NHBA 4F1VA 2HXRA 1SPIA 3C35A 2WOKA 3IB0A 1M5DA 4GQOA 5I59B 3MQ9A 5J1DA 5EQ8A 1AIVA 1B6HA 1NV0A 4UABA 3KOTA 1JVYA 4I9DA 1FPFA 2FVZA 3RGYA 2DXRA 3O6HA 4EDPA 5L9SA 2FHYA 4IGTA 2QSXA 3K00A 1Z7ME 3MWBA 3CHGA 1OLCA 3G3HA 4U1ZA 2A5SA 1M5EA 3PU5A 1NH8A 2OZZA 1GR2A 4OFJA 3PPOA 3C31A 2WEFA 3ZS6A 5A5XB 1BTJA 4MX6A 1IXIA 1TXFA 4N81A 4ELRA 1NI9A 3ROJA 1HSLA 4RA1A 1UQWA 5H8NB 3U92A 1LBCA 1VDWA 2E1SA 3ODBA 4PC9A 2REGA 1MXYA 4OVJA 4QRZA 3FASA 3OMBA 4PBQA 4X1BA 1MH3A 1PB7A 1ZU0A 4QSEA 3VVDA 1SI0A 4ZE9A 5CMBA 4YB5A 1US5A 3K01A 3QXMA 4RXLA 1EH3A 2B3BA 4F3PA 2QPQA 4P0GA 3KJTA 2Q8MA 1YPNA 5J16A 2Q8JA 3K6VA 4ZDMA 4EXKA 3RYBA 4POXA 3RPLB 4DI4B 5DVIA 2DQVA 4HE1A 4ND9A 1DTZA 4GX4A 3K1NA 3D4GA 4GWUA 1SBPA 4N07A 4N6PA 5I2KA 2WOLA 5ET8A 5KCJA 1ZMGA 3OO8A 2IEEA 4N15A 4TOZA 3N6UA 3U94A 3MVYA 1LGBC 3FGSA 1AOVA 3CR9A 3QYTA 2X7QA 1A55A 4F1YA 1JEUA 1QUJA 4QBAA 5IZ3A 4OVSA 4YU0A 5EHMA 2H98A 3K0VA 4N6KA 3FVNA 3T93B 4NX1A 5AA2B 4I3YA 1FTJA 2CEYA 5H8QB 3IJOB 4GLIA 1GTKA 4QSDA 1LAFE 3DP8A 3SEXA 3MVZA 3HO7A 2VP1A 5AE4A 1URDA 1OQGA 1B40A 5BUUA 1ZKBA 4MNPA 2ALUA 1O63A 2Z8FA 1ZIUA 4XEQA 4NWDA 1P1WA 1SI1A 3OO9A 3W9VA 2DWAA 1BIYA 2FYIA 3TMGA 1MY1A 3IAZA 4PGNA 4U23A 5AA1A 3KFMA 3EHTA 1LAGE 3V83A 5A5LA 4I1DA 1FRPA 1MRPA 1XVXA 1B5HA 3TQWA 5B7DA 5TPAA 4G4PA 2Q9TA 1YTVA 3B50A 3CRBA 4LQ2A 2I0CA 2UVHA 4H46A 2XX9A 1AH5A 1EU8A 2X26A 3GBBA 1QJMA 4XKNA 4RY1A 1VFEA 1OVBA 1IMAA 3OEMA 3U1OA 2OWSA 3G3GA 4E0XA 4PE5B 1Q1KA 1QGXA 4R6YA 4QFOA 5AA4A 4N4UA 1Y1MA 1SVXB 4KXPA 2NOOA 4N91A 5CM6A 1JW5A 1NV5A 2OX3A 3FIRA 4RJZA 5KDTB 2ZNTA 2XXKA 2XXUA 3PD9A 3T9VA 5H8HB 1XOCA 1FTOA 3RLFE 3BFUA 2Z23A 1JEVA 3EHUA 4IO4A 4O7MA 4X04A 4NE4A 5BWJA 3IB2A 2QL3A 3UK4A 4DCXA 2O7UA 3GLBA 4PFRA 1US4A 3PMXA 3GYYA 3T9UA 3ILTB 4O3CA 3SESA 2V3TA 2F6PA 5I56B 2M8CA 2HZLA 3JV9A 1RDXA 4GWXA 2P2AA 1B32A 3KN8A 4F31B 2V3UA 3FVGA 3VFJA 3EF7A 4HCYA 3DRIA 3G7WA 3PPRA 3VV5A 4P8BA 5HBCA 5ESYA 1KWHA 5FTHA 2HCAA 2Z8DA 4O7IA 1MXVA 4F3BA 4N6DA 2LAOA 3MAMA 2NVUB 2XXRA 4YKPA 1FJ6A 1NFTA 1IXCA 2PCRA 4PCDA 4POWA 1OIBA 1G0IA 2L5VA 1D9VA 4JWYA 3B6TA 1FBFA 3H3GA 1PC3A 4LA9A 4BDRA 3VE1B 2HAVA 4U21A 1MY3A 1N7XA 2H4IA 4ONYA 4P1LA 1WODA 2ZZXA 1POTA 1Q35A 3FJGA 2RC7A 4NEDA 2RKMA 1MXWA 4G77A 4G68A 1MPDA 3C9HA 3T0JA 1TFAA 1MQJA 4ZEFA 1UIUA 1LCTA 3FVOA 1YYZA 1FQBA 5IAIA 3TEPA 4YZZA 1EYJA 3JZJA 1PDAA 4ISUA 2BJJX 4Q8RA 3MP8A 3Q25A 3O97A 3HCQA 4AQ4A 4F29A 3CSGA 4U4SA 5DVJA 3IL1B 3RN8A 2QJEA 4OFOA 1N84A 1MY2A 1LBBA 3EN3A 3WAEA 3OO6A 2ESNA 3RNNA 1PB8A 3QAXA 1LAHE 2KLFA 2F7CA 1B5IA 1IQ7A 1SDXA 1N76A 3FJMA 3HFUA 4YKKA 4P11A 2HQ0A 1N7WA 2I4BA 3ZSFA 4ZE8A 4NF6A 1LB8A 3LUYA 3M3FA 3P7IA 4ZEBA 3H06B 3KSJA 3TAJA 4AS4A 3HN0A 1SQYA 3HV1A 5EYHA 2ZYNA 2I6EA 2I49A 1S9TA 3ILUB 1FCKA 4KR5A 4F3GA 4PFUA 2Y7WA 3TKDA 4YB6A 1MQDA 1LBWA 4ELPA 4C1UA 2PBWA 1FQCA 1B7UA 1FSAA 3B6QA 1B3EA 2DOJA 3C4MA 1INPA 4KYEA 4ZECA 2F6GA 3C33A 3IJXB 3DP6A 4H1XA 1MY4A 4QSCA 4MCOA 2G29A 3DM0A 1SD3A 4F19A 1RDZA 2Z22A 4WEDA 2JJKA 1Y4TA 4G8HA 2THIA 4OERA 1PBPA 4GBVA 4H8IA 3QMFA 1URGA 3HHFA 1YXIA 3KZGA 4IR8A 3KSXA 4I62A 1MQGA 5I2KB 1B3HA 3U8QA 4GOTA 3PMVA 2ONSA 3PPNA 4EF1A 3K1PA 2FIEA 2HAUA 2OCUA 1IMFA 2XX8A 3SEYA 4OHNA 3QUJA 4PP0A 3E3KA 1G0HA 4FEDA 5CRYA 3IO4A 5KZTA 1I6BA 2R8TA 3B7DA 5DVFA 2WOPA 1TFDA 1MQHA 3KOSA 4MEVA 5CBRA 3TODA 2Q88A 2F34A 2VOZA 4QF9A 2VD3A 4WXJA 5LOMA 1Y20A 4OVQA 3WAFA 4OXVA 1SYIA 3PGFA 3W9WA 1HSJA 2AL4A 3QSLA 4HTGA 1XI6A 3HPIA 2CZIA 3CFXA 3G3JA 4XKPA 1FJ9A 1LB9A 4JSDA 3CIJA 4TQUQ 2Y5KA 4OVTA 4MMPA 4XFEA 4PAKA 1UTBA 3MPKA 4F2OA 4GXAA 1LEVA 5EHSA 1AL3A 1H43A 2F3BA 1J1NA 4MAGA 5I84A 5AA3A 1CB6A 1FPDA 5JTYB 5F24A 3RYDA 1SW5A 2V93A 3RYAA 3TTKA 2ONKE 2VHAA 5DT6A 2DWJA 4U2RA 2ZNSA 2F8DA 4LZ7A 1H76A 1R9LA 2I58A 4FBPA 4JWXA 3MW0A 2R6GE 4I3EA 1FQAA 1FTKA 4OVPA 4EUOA 4KCCA 2XX7A 5I2NB 1VSOA 2F7BA 3Q26A 4NGUA 4F39A 1FBHA 1VE4A 3EKIA 3O28A 3VLVA 3BIHA 1WVJA 4ZZEA 3MVWA 3GXAA 5H8FA 2R71A 4QHQA 3MPLA 3OXNA 1D9YA 3ZKKA 1M5BA 1RKMA 2HEUA 2Q74A 4PDHA 3KG2A 3GZGA 2QS4A 1F9BA 5CMMA 2X7PA 5I56A 3SDFA 4R74A 2XD3A 4RK9A 4NF6B 2RF1A 5TP9B 1NKXA 3K02A 2Y5LA 4GBWA 4NN3A 3E4RA 4WEPA 3L6GA 1RYXA 3BFTA 1USYE 2XD2A 2HPGA 4OWDA 1BP5A 5F7VA 3O6PA 3VXBA 4MJOA 4LONB 3PTYA 4PQJA 5A5XA 3CG1A 1VR5A 2UYFA 4ZEIA 3OEKA 1P1UA 2DE4A 3I6VA 5IM2A 4N13A 4P3LA 5EYFA 4OQOA 1M5FA 1SYHA 4P9KA 1N04A 1RDYA 3KEIA 1B3LA 2XWKA 4G68B 1IEJA 1N0TA 4GWZA 4XTCQ 4PF8A 4F1UA 3FJ7A 4FECA 5I58A 1I6QA 1K9YA 2PVUA 4NTLA 3FATA 2DVCA 4GX6A 4GVOA 1B7HA 3CFLA 3OSRA 4LN5A 1QUKA 1LBVA 4GIZA 5DEXB 2UVGA 2Y7KA 4GWWA 5B70A 1B0LA 2QVUA 1JW4A 3LSLA 4NF8A 1B4ZA 2VD2A 4KFQA 5L8DA 4H8JA 2GFEA 1LFGA 4NF0A 1MG1A 3NOHA 3LUZA 1FPLA 3IFCA 3H6VA 3IB1A 5H8SA 2XXVA 1NUYA 3KBZA 4Z0IA 1L5TA 3H6UA 3O66A 4OESA 4H67A 1FPIA 4EQ7A 1CNQA 3PD8A 2DWIA 3ZKLA 1FPBA 1ANFA 4JDFA 2PT2A 1H44A 2ONRA 3FV1A 1NMUA 2ABHA 1DCUA 3FXQA 1MXZA 4H6DA 4DZ1A 1FBEA 5FBPA 2GH9A 4MBPA 1H45A 3KGCA 1O64A 4XXUA 1FPGA 2QRYA 2F7AA 1SW2A 2H5YA 3O2AA 3FD3A 3C34A 2V4CA 1JP4A 1XS5A 2WKYA 3SETA 4GX3A 4PGPA 3CSBA 4E0WA 1AMFA 3K4UA 5FTIA 2QMWA 3UA8A 4QXDA 2AL5A 2Y7IA 3DRKA 1LBYA 2AIXA 2O1LA 4O3AA 4U4XA 4OEVA 4C0RA 4G61A 2O7IA 4HCWA 1A8EA 4R73A 2QS3A 2DE3A 1FW0A 1TT1A 1QULA 4H45A 3JYRA 4JXIA 4EQ9A 4LQ5A 4PBHA 1IIWA 1FTAA 2DP8A 2UVIA 3O6IA 2B65A 2V3QA 2D5WA 5ISUA 3S9EA 2O68A 2R9JA 4RYAA 2ZYMA 3TUSA 5AA4B 2DE2A 4P56A 3PPPA 4RPNA 4RNSA 3MSTA 3TTMA 4IO2A 2RINA 5CI5A 2ANJA 5EYGA 2HXWA 2OJTA 3PV0E 1IXHA 4PTKA 4XKRA 2F97A 3EQ1A 1QUIA 1RYOA 4Q30B 5JEIA 4O94A 1DMBA 4LP2B 4GD5A 3RT6B 4R72A 1MPBA 2DSFA 4ESXA 1QW0A 4ESWA 4R75A 1JW1A 5DTBA 3TELA 3T9XB 1NH7A 3PUWE 4G8MA 1NNTA 5K2YA 5TP9A 4OMBA 1MXXA 5TU0A 1B7ZA 3F11A 5IZ1A 1MH4A 4F22A 3UGWA 1NV6A 1JVXA 2H99A 4KYSA 1DBZA 4X9TA 3UORA 4FJPA 3Q28A 4OANA 2F78A 3E78A 2ZMBA 3QIMA 2VPOA 4NF5A 3MVXA 4NG7A 4Q5TA 3KC1A 5L9MA 4MH5A 4TLLB 1FQDA 2B3FA 3MP1A 1R1NA 3IR1A 1CE2A 1DPPA 5DYHA 1LBXA 4DXCA 3G3FA 3RPWA 2XXQA 4KHZE 1KA1A 5I58B 1B51A 1BLFA 1PB9A 3IORA 2OK2A 5ET6A 3BIGA 4IO3A 3MZ1A 4EF2A 4HS7A 1B3GA 5DEXA 3KN3A 3N5LA 3HSTA 5HPQA 3CFZA 5I57A 1B4HA 5I2NA 1B9JA 2FA7A 4DE8A 2Z8EA 3CG3A 1XC1A 1LBZA 2RC9A 2XXXA 1PEBA 4H5FA 4F18A 1ZBMA 5H8FB 2KR0A 2OWZA 3LSWA 4YB7A 2FIXA 2XXPA 3C36A 1D9QA 2PYYA 2YPNA 3FXBA 3O9PA 2W7YA 4O8MA 4OA4A 3FZVA 3H6TA 1I6AA 3D4CA 3IX1A 4U1OA 1GV8A 4C1TA 1N3XA 4R9GA 4GL0A 1Q9DA 2UYEA 3MJNA 1QKBA 1MM7A 3K6WA 3LV0A 4PAIA 1XT8A 4GFRA 3KN7A 4KQPA 1GVCA 4JVIA 1URSA 1USYH 2ZYOA 4ZEKA 4WKMA 3TYHA 5H8NA 3DRJA 3DELB 4QFKA 2I48A 2I3WA 1LCFA 3PUYE 3FTOA 4JBZA 3W15C 4NAPA 3Q29A 3O6GA 3RT8A 3ECRA 4IO6A 3OD7A 4PF6A 3UP9A 1TWYA 4P0IA 3SKPA 1NNKA 1OLAA 4QFLA 4IY6A 2H25A 4IO7A 2WYPA 4N8YA 1ATGA 4XIGQ 5ET5A 4ELQA 3FUZA 4NF8B 2QVRA 3UN6A 1D3KA 4YICA 5F1QA 3B6WA 3S9LC 2ZZVA 2XXHA 1DPEA 5ITOA 4KYDA 4OFLA 5AA2D 4JB7A 4PDDA 4AB5A 4I40A 2GHAA 5L9OA 1A54A 3E79A 1PBQA 3H03A 1AWBA 2XXIA 5FHNA 3USDA 1NV2A 4JWOA 3TQLA 3LC8A 1NV4A 2FNCA 3IOWA 2WBDA 4FATA 5IZ3B 3S4UA 1YAEA 4FAJA 4JVCA 4DXBA 1OVTA 4H0WA 3SEVA 5JK4A 1DOTA 1B5JA 1UTHB 2BJIA 2CZHA 3K6UA 2DYXA 4FIMA 2NUVA 3KBRA 1ELJA 3DLNA 5CMCA 3E9XA 5FHOA 1FTMA 3OSQA 4MLVA 4G2ZA 2D3IA 2CMOA 4NQ8A 4RK2A 2PFYA 2F3DA 1FPKA 2GQ1A 3MC2A 3S2VA 3M8UA 3D1RA 1NUZA 3TTNA 1HSEA 1R9QA 4NMYA 3MYUA 2CZKA 4DCYA 1JQFA 4O3BA 2QFLA 4IO5A 2XWVA 4X1DA 3FXRA 3DRFA 1IITA 2NXOA 5CBSA 2MKZA 5DW8A 1MDP1 2XXWA 2QMXA 2GHBA 3RTFB 1IUDA 2O6AA 2QS1A 1FBPA 3ONMA 1NUWA 3SZPA 4KD5A 3LR1A 3BKIB 1NV1A 1OQHA 3DRGA 3FBPA 4KI0E 1NV3A 3VVEA 3MBPA 3PUVE 1MQIA 3FXUA 1MY0A 1Y3PA 1S7YA 2Q2AA 3IK6B 1IMCA 4PFYA 1DK4A 3I3VA 4IGRA 4OYVA 2A5TA 3OENA 5K2XA 1S50A 4R2BA 4FORA 3IFAA 3U72A 2XXTA 1A8FA 1P1NA 4MIJA 5ET7A 5FHMA 1T0KA 1Y4CA 3OO7A 4FEBA 2O1MA 3EHSA 3M3KA 1II5A 1Z7NE 4MFIA 3T96B 3S9MC 3VLWA 1B3FA 5I59A 4M1VA 2RCBA 2PFZA 3O29A 2P3NA 1O7TA 1P99A 2ZZWA 4X48A 3TCHA 1D4NA 2V84A 3PPQA 4G68C 3S9NC 1M5CA 3E13X 5M2VA 3A3CA 3T1BA 4FE8A 1ZJLA
chains in the Genus database with same CATH topology
2RINA 2REGA 3SEWA 5CI5A 2Z22A 2ANJA 1MXYA 4OVJA 4WEDA 3OELA 2HXWA 2OJTA 1Y4TA 3FASA 1B46A 2XXYA 1IXHA 3OMBA 3PV0E 4QRZA 4G8HA 1FQEA 2THIA 1SW4A 3VLUA 4OERA 4X1BA 1PBPA 4XKRA 2F97A 1MH3A 3EQ1A 1PB7A 4H8IA 1ZU0A 1QUIA 4NF5B 4QSEA 3T22A 1RYOA 1URGA 3HHFA 4Q30B 3VVDA 5JEIA 1H3DA 1SI0A 4ZE9A 1DMBA 2AYSA 3KZGA 5CMBA 1A40A 4LP2B 4YB5A 3RTWB 3T9HB 3VVFA 4GD5A 3KSXA 4OETA 3N94A 1US5A 4I62A 3K01A 3QXMA 1MQGA 4RXLA 5I2KB 3RT6B 1EH3A 2B3BA 4F3PA 2QPQA 4P0GA 4R72A 3I5OA 1NNPA 1MPBA 2DSFA 2P1SA 1B3HA 3V8XB 3MZBA 2UXAA 3KJTA 4ESXA 1YPNA 1QW0A 2Q8JA 3K6VA 4ZDMA 4R75A 3QK6A 3U8QA 3RYBA 4ESWA 4EXKA 4POXA 1JW1A 4GOTA 2PT1A 5DTBA 3TELA 3PMVA 2ONSA 3PPNA 3T9XB 1NH7A 4EF1A 3K1PA 4IY5A 4NF4B 4OZ9A 4Z7EA 3PUWE 5DVIA 2HAUA 1SW1A 2DQVA 2HZKA 1FTLA 2OCUA 4G8MA 4ND9A 1NNTA 1DTZA 3QUFA 2HFBA 5K2YA 4LZ8A 5TP9A 2XX8A 4OMBA 2Y84A 1MXXA 4OHNA 5TU0A 3SEYA 3QUJA 3T66A 2F36A 3E3KA 1B7ZA 2QS2A 3F11A 4PP0A 4U22A 3THIA 4YMAA 3K1NA 3D4GA 4FEDA 4BDOA 1MH4A 4GF8A 1SBPA 4N07A 3IO4A 5CRYA 4F22A 5KZTA 3TDJA 1I6BA 4N6PA 3UGWA 2H99A 1JVXA 4KYSA 3B7DA 2E0SA 4RPOA 5DVFA 2WOPA 2WOLA 4X9TA 5I2KA 1MDQA 3UORA 4FJPA 3Q28A 4DDDA 2YJPA 1TFDA 2F78A 1MQHA 4GXSB 3VXCA 4DXUA 2ZMBA 3K1MA 3KOSA 3PMWA 1ZMGA 4M4GA 5KCJA 3QIMA 5I57B 3OO8A 3MVXA 3TCGA 4NF5A 4Q5TA 2IEEA 4R6HA 5CBRA 2XHDA 4TOZA 3N6UA 3TODA 5L9MA 3U94A 4MH5A 1EZ9A 3MVYA 1LGBC 2Q88A 3FGSA 4TLLB 1FQDA 2B3FA 1NNFA 2F34A 3MP1A 2VOZA 1EZPA 4QF9A 1R1NA 1AOVA 3CR9A 3IR1A 3QYTA 2X7QA 1A55A 1CE2A 3A09A 1DPPA 2VD3A 1BKAA 2B4MA 1WDNA 4WXJA 3TTLA 4F1YA 4K3FA 5DYHA 1JEUA 5LOMA 4LVQA 1QUJA 1Y20A 4YU0A 4DXCA 3N26A 5EHMA 3G3FA 2H98A 4OXVA 1SYIA 3K0VA 3PGFA 3WAFA 3W9WA 1HSJA 3RPWA 1A7LA 3H7MA 1B58A 3KJ7A 3LBSA 2AL4A 2XXQA 4KHZE 3PUXE 3FVNA 5I58B 3PAMA 4Q0CA 1B51A 3C32A 3QSLA 3T93B 5KCJB 1JNFA 5AA2B 1BLFA 4HTGA 1FTJA 3HPIA 2Q2CA 2I3VA 1B52A 1PB9A 4UA8A 5H8QB 5L9OA 3CFXA 2OK2A 3IORA 3IJOB 3G3JA 4XKPA 4H5GA 4GLIA 4IO3A 3RY3A 2OBGA 3MZ1A 1GTKA 4EF2A 1IXGA 4HS7A 1LB9A 4QSDA 4JSDA 1LAFE 3CIJA 4TQUQ 1B3GA 1JETA 3DP8A 1VFDA 4THIA 5DEXA 3SEXA 2DWHA 3MVZA 2IA4A 3KN3A 3HO7A 2VP1A 4LZ5A 5AE4A 1MS7A 1URDA 1OQGA 4YKIA 4PFTA 1B40A 2OLBA 1UTBA 3N5LA 3HSTA 3MPKA 3MUQA 5BUUA 1ZKBA 4F2OA 3IOVA 4GXAA 5HPQA 2ALUA 4R2FA 3CFZA 5I57A 1FQFA 1B4HA 1O63A 2UVJA 2Z8FA 5I2NA 1ZIUA 1B9JA 2VGQA 5EHSA 1AL3A 1H43A 2FA7A 3SEUA 4DE8A 2Z8EA 1DTGA 4LATA 1J1NA 3CG3A 1XC1A 4NWDA 1B1XA 1P1WA 1SI1A 5I84A 3OO9A 3W9VA 1XVYA 5AA3A 5H8QA 2RC9A 2DWAA 1CB6A 2XXXA 1BIYA 2FYIA 3TMGA 3GBAA 5JTYB 3TPAA 1MY1A 2O51A 3CVGA 1PEBA 3G3IA 3IAZA 4H5FA 4U23A 5ELVA 3KFMA 4KPTA 3RUMA 4F18A 1ZBMA 1SW5A 1EZOA 3EHTA 2V93A 3IOUA 3RYAA 5H8FB 3LSWA 1LAGE 4H65A 3TTKA 2ONKE 1B05A 2VHAA 3EPEA 4YB7A 3V83A 5DT6A 2DWJA 2G93A 4I1DA 4NWCA 4U2RA 2XXPA 1ZTYA 1Y9UA 2ZNSA 3C36A 2F8DA 2DS9A 1MRPA 2PYYA 2YPNA 1XVXA 4LZ7A 3AXFA 1H76A 1B5HA 3TQWA 1R9LA 5B7DA 2I0BA 2I58A 5TPAA 3MP6A 4JWXA 2I4CA 4IO2A 3MW0A 4G4PA 2R6GE 2Q9TA 1YTVA 3O9PA 2W7YA 1MXUA 3CRBA 3L6HA 2YLNA 2I0CA 3FZVA 4LQ2A 3FVKA 3H6TA 1I6AA 3D4CA 2UVHA 3IX1A 2XX9A 1AH5A 1EU8A 2O69A 2X26A 4U1OA 3GBBA 1QJMA 1GV8A 4C1TA 4XKNA 1N3XA 4R9GA 1FQAA 1VFEA 1FTKA 4GL0A 2PMSA 1OVBA 4RY1A 4EUOA 2UYEA 3DRHA 1R6ZA 1LAXA 3BBRA 1QKBA 3LSFB 3MJNA 1UIVA 4QFNA 1MM7A 2DVZA 3IO6A 3K6WA 3U1OA 2OWSA 3G3GA 4KCCA 2XX7A 5I2NB 4E0XA 1MPCA 1VSOA 4PE5B 2F7BA 3K2DA 3H6WA 3Q26A 3V89B 4BDQA 4F39A 2H9BA 1I69A 1Q1KA 1VE4A 1XHYA 3VDFA 3OEMA 1XT8A 4QFOA 4R6YA 4GFRA 3O28A 3VLVA 3KN7A 4KQPA 1GVCA 5AA4A 1WVJA 4ZZEA 4XKQA 1Y1MA 1SVXB 4BDNA 1URSA 3MVWA 3OOAA 2RCAA 1USYH 2NOOA 2OWTA 2ZYOA 5CM6A 4ZEKA 1JW5A 4WKMA 3GXAA 3IOTA 2R71A 5H8NA 4QHQA 3TYHA 3DRJA 5H8FA 3DELB 4U21A 3FIRA 4QFKA 3UIFA 2I48A 3MPLA 3OXNA 4RJZA 1D9YA 5KDTB 2ZNTA 2I3WA 4YKJA 4ZS9A 3ZKKA 1MM6A 1LCFA 2CZLA 1B1HA 1M5BA 1RKMA 2XXUA 2HEUA 3PD9A 3PUYE 1B0HA 5H8HB 3T9VA 4F3SA 3FTOA 1XOCA 4PFWA 1IZ1A 3R6UA 4JBZA 3W15C 2V25A 1FTOA 3RLFE 1QVSA 5TPAB 1Y3NA 3BFUA 2Z23A 3K6XA 3KG2A 3GZGA 2QS4A 3Q29A 1JEVA 3O6GA 3RT8A 3TFLA 1F9BA 3ECRA 3OD7A 4I8CA 4GL8A 3EHUA 4IO6A 4IO4A 1LFIA 2X7PA 5CMMA 5I56A 3SDFA 1TWYA 3UP9A 4R74A 2B4LA 2XD3A 3R26A 4NE4A 5BWJA 4P0IA 4RK9A 4NF6B 3SKPA 2RF1A 5TP9B 1NNKA 3CI8A 1OLAA 4QFLA 3IB2A 1LSTA 1LFHA 1NKXA 3MZ9A 3RQTA 3TZAA 3K02A 2ZYKA 4IY6A 2D21A 2H25A 3E4RA 4WEPA 4GWOA 2QL3A 3L6GA 4IO7A 3UK4A 1RYXA 3BFTA 1USYE 4DCXA 2O7UA 2XD2A 4OWDA 5H8HA 1BP5A 3GLBA 1ATGA 5F7VA 1US4A 4XIGQ 3O6PA 3PMXA 3VXBA 4KCDA 3T9UA 4LONB 3ILTB 4ELQA 3FUZA 3LVUA 4PQJA 5A5XA 4NF8B 4O3CA 3CG1A 1UTHA 4OENA 1VR5A 2F5XA 2UYFA 1D3KA 2V3TA 4ZEIA 4LUBA 3OEKA 3SESA 3UN6A 3V5AA 4YICA 2F6PA 1P1UA 4YMBA 3A3UA 5I56B 5F1QA 2M8CA 2HZLA 3JV9A 4ELOA 4EXLA 5ICQA 3B6WA 3S9LC 2XXHA 2DE4A 3I6VA 4N13A 1DPEA 4R6KA 3DP4A 2P2AA 4KYDA 5EYFA 5ITOA 4OQOA 1M5FA 1SYHA 4R9FA 1N04A 3SERA 1B32A 4OFLA 5AA2D 4JB7A 3KN8A 1OMPA 4F31B 2V3UA 3FVGA 3KEIA 3VFJA 4AB5A 2PX1A 3EF7A 4OEUA 1B3LA 4HCYA 3DRIA 2GHAA 4ZEDA 1IEJA 1N0TA 3FV2A 1A54A 2O84X 4G68B 1LLSA 1PBQA 3G7WA 3PPRA 4XTCQ 3VV5A 2DXYA 5HBCA 3H03A 4F1UA 4PETA 2Q89A 2XXIA 3FJ7A 4FECA 4GRKA 4UACA 1DSNA 1KWHA 5FTHA 2HCAA 2Z8DA 4IB2A 1I6QA 1MXVA 4F3BA 5CMKA 5I58A 2LAOA 5FHNA 2PVUA 4NTLA 3FATA 3USDA 1P1OA 2DVCA 5AA2A 5ITPA 3MAMA 2NVUB 2Y7RA 4JWOA 2XXRA 4GVOA 4YKPA 2REJA 3TQLA 1NFTA 1IXCA 1P1QA 3LC8A 1B7HA 2P0SA 3CFLA 2FNCA 3IOWA 3OSRA 1QUKA 4GIZA 4FATA 3S4UA 5DEXB 4POWA 2UVGA 4BDLA 1OIBA 2Y7KA 1YAEA 5B70A 5ICTA 1D9VA 4MF3A 4FAJA 4JWYA 4DIGA 3B6TA 1B0LA 4DXBA 2ZNUA 1OVTA 1JW4A 3LSLA 3TTRA 4H0WA 3SEVA 5JK4A 1DOTA 3H3GA 4NF8A 4OTEA 1PC3A 1B5JA 1UTHB 3K6UA 1A99A 3M3LA 2DYXA 4FIMA 4LA9A 2NUVA 4BDRA 3KBRA 3VE1B 1Y3QA 4DLDA 4AB6A 1B4ZA 2VD2A 2HAVA 1ELJA 4KFQA 1MY3A 1N7XA 5L8DA 3DLNA 2GFEA 2H4IA 1LFGA 4ONYA 4H8JA 5CMCA 3E9XA 2RC8A 4JSOA 1MG1A 1WODA 5FHOA 1FTMA 4G8NA 3OSQA 4MLVA 4G2ZA 4MLQA 3H6VA 3IB1A 1POTA 1Q35A 3FJGA 2RC7A 4ECFA 2F35A 2D3IA 4NEDA 2CMOA 4RK2A 5HM4B 1YCJA 4HW8A 2RKMA 5H8SA 1MXWA 1UTBB 2XXVA 4F2QA 4Z0IA 3MC2A 1L5TA 4G77A 3H6UA 5IKBA 3O66A 4G68A 3S2VA 4OESA 3M8UA 4H67A 1MPDA 2Y7PA 4EQ7A 1NL5A 3C9HA 1ZLQA 3G3KA 4NF4A 3TTNA 1HSEA 1TFAA 1R9QA 3PD8A 4NMYA 2DWIA 5CC2A 4BLAA 3ZKLA 1MQJA 4ZEFA 1UIUA 4DCYA 1N3WA 1LCTA 3FVOA 3H4ZA 1POY1 3LSXA 1B2HA 1FQBA 5IAIA 1JQFA 1ANFA 4JDFA 3TEPA 5JTYA 4YZZA 2PT2A 1H44A 1QKAA 2ONRA 3JZJA 4O3BA 1PDAA 4ISUA 3FV1A 3PUZE 2BJJX 4IO5A 4L17A 3R7XA 4Q8RA 3TCFA 1NMUA 3MP8A 2ABHA 3Q25A 4X1DA 4ZZAA 3FXQA 3O97A 1MXZA 3FXRA 4H6DA 1GGGA 3HCQA 3DRFA 1IITA 2NXOA 4AQ4A 4F29A 5CBSA 1Y1ZA 1MDP1 5AA1A 2XXWA 3HHGA 3CSGA 4DZ1A 4U4SA 4TLMB 5DVJA 2QMXA 2GRVA 2GHBA 3Q27A 3IL1B 3RN8A 3RTFB 2GH9A 4MBPA 4BDMA 1IUDA 2QJEA 2O6AA 4OFOA 2A5TB 2NWJA 3N6TA 2QS1A 1H45A 1N84A 3ONMA 1MY2A 1LBBA 3U93A 3KGCA 4KD5A 3LR1A 3BKIB 4QFPA 1O64A 3EN3A 4YAHX 4XXUA 2QRYA 2F7AA 3OO6A 1OQHA 2ESNA 3RNNA 3WAEA 1PB8A 1SW2A 4EQBA 3QAXA 3DRGA 1LAHE 5KDTA 2KLFA 2F7CA 1B5IA 2H5YA 2ZXTA 1IQ7A 4KI0E 3VVEA 3MBPA 3PUVE 1MQIA 3FXUA 1SDXA 1MY0A 3O2AA 1N76A 3FD3A 1Y3PA 3FJMA 4F1VA 3C34A 4P11A 4YKKA 1XS5A 2WKYA 1S7YA 2HQ0A 3SETA 1N7WA 2Q2AA 2I4BA 3IK6B 3C35A 3CSBA 3I3VA 4PFYA 4IGRA 3ZSFA 4E0WA 2WOKA 4OYVA 2A5TA 1AMFA 3K4UA 3OENA 5K2XA 5FTIA 1S50A 4ZE8A 3IB0A 1M5DA 1LB8A 2QMWA 3LUYA 4FORA 3M3FA 4GQOA 3MQ9A 3P7IA 4NF6A 4R2BA 4ZEBA 3UA8A 5I59B 5J1DA 2AL5A 2Y7IA 1AIVA 3DRKA 3U72A 3H06B 2AIXA 3KSJA 3TAJA 1B6HA 2XXTA 3KOTA 2O1LA 3HN0A 4O3AA 1JVYA 1SQYA 3HV1A 4I9DA 1A8FA 1P1NA 4U4XA 4OEVA 4C0RA 2ZYNA 3RGYA 5FHMA 1T0KA 2O7IA 2I6EA 1Y4CA 2I49A 1S9TA 2DXRA 3ILUB 3O6HA 4EDPA 5L9SA 4HCWA 1A8EA 4IGTA 3OO7A 1FCKA 4FEBA 4KR5A 4F3GA 4PFUA 2O1MA 3EHSA 2QSXA 2Y7WA 4R73A 3TKDA 3M3KA 2QS3A 1MQDA 3K00A 4YB6A 1Z7ME 2DE3A 1FW0A 1TT1A 1II5A 3MWBA 1Z7NE 1QULA 4ELPA 3CHGA 1OLCA 4MFIA 3G3HA 3T96B 4C1UA 3S9MC 3JYRA 4JXIA 4EQ9A 4U1ZA 3VLWA 1B3FA 2A5SA 5I59A 4LQ5A 1M5EA 3PU5A 1IIWA 1NH8A 4M1VA 2OZZA 2PBWA 1FQCA 1GR2A 2RCBA 4OFJA 3PPOA 3C31A 2DP8A 3O29A 3ZS6A 1B7UA 3B6QA 1B3EA 2DOJA 1BTJA 1O7TA 5A5XB 1P99A 1IXIA 3C4MA 1TXFA 2UVIA 3O6IA 2B65A 4X48A 3TCHA 2V3QA 4KYEA 2D5WA 5ISUA 3S9EA 4ZECA 2O68A 2R9JA 2F6GA 2ZYMA 3C33A 3IJXB 1HSLA 4RYAA 4ELRA 3TUSA 3DP6A 5AA4B 4RA1A 1D4NA 4H1XA 2V84A 1UQWA 3PPQA 4G68C 2DE2A 3S9NC 1MY4A 1M5CA 3E13X 5M2VA 4QSCA 3A3CA 5H8NB 2G29A 1LBCA 3PPPA 4RPNA 3U92A 4RNSA 2E1SA 3DM0A 3ODBA 4FE8A 3TTMA 1ZJLA 1SD3A 4F19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIN A;  2REG A;  3SEW A;  5CI5 A;  2Z22 A;  2ANJ A;  1MXY A;  4OVJ A;  4WED A;  3OEL A;  2HXW A;  2OJT A;  1Y4T A;  3FAS A;  1B46 A;  2XXY A;  1IXH A;  3OMB A;  3PV0 E;  4QRZ A;  4G8H A;  1FQE A;  2THI A;  1SW4 A;  3VLU A;  4OER A;  4X1B A;  1PBP A;  4XKR A;  2F97 A;  1MH3 A;  3EQ1 A;  1PB7 A;  4H8I A;  1ZU0 A;  1QUI A;  4NF5 B;  4QSE A;  3T22 A;  1RYO A;  1URG A;  3HHF A;  4Q30 B;  3VVD A;  5JEI A;  1H3D A;  1SI0 A;  4ZE9 A;  1DMB A;  2AYS A;  3KZG A;  5CMB A;  1A40 A;  4LP2 B;  4YB5 A;  3RTW B;  3T9H B;  3VVF A;  4GD5 A;  3KSX A;  4OET A;  3N94 A;  1US5 A;  4I62 A;  3K01 A;  3QXM A;  1MQG A;  4RXL A;  5I2K B;  3RT6 B;  1EH3 A;  2B3B A;  4F3P A;  2QPQ A;  4P0G A;  4R72 A;  3I5O A;  1NNP A;  1MPB A;  2DSF A;  2P1S A;  1B3H A;  3V8X B;  3MZB A;  2UXA A;  3KJT A;  4ESX A;  1YPN A;  1QW0 A;  2Q8J A;  3K6V A;  4ZDM A;  4R75 A;  3QK6 A;  3U8Q A;  3RYB A;  4ESW A;  4EXK A;  4POX A;  1JW1 A;  4GOT A;  2PT1 A;  5DTB A;  3TEL A;  3PMV A;  2ONS A;  3PPN A;  3T9X B;  1NH7 A;  4EF1 A;  3K1P A;  4IY5 A;  4NF4 B;  4OZ9 A;  4Z7E A;  3PUW E;  5DVI A;  2HAU A;  1SW1 A;  2DQV A;  2HZK A;  1FTL A;  2OCU A;  4G8M A;  4ND9 A;  1NNT A;  1DTZ A;  3QUF A;  2HFB A;  5K2Y A;  4LZ8 A;  5TP9 A;  2XX8 A;  4OMB A;  2Y84 A;  1MXX A;  4OHN A;  5TU0 A;  3SEY A;  3QUJ A;  3T66 A;  2F36 A;  3E3K A;  1B7Z A;  2QS2 A;  3F11 A;  4PP0 A;  4U22 A;  3THI A;  4YMA A;  3K1N A;  3D4G A;  4FED A;  4BDO A;  1MH4 A;  4GF8 A;  1SBP A;  4N07 A;  3IO4 A;  5CRY A;  4F22 A;  5KZT A;  3TDJ A;  1I6B A;  4N6P A;  3UGW A;  2H99 A;  1JVX A;  4KYS A;  3B7D A;  2E0S A;  4RPO A;  5DVF A;  2WOP A;  2WOL A;  4X9T A;  5I2K A;  1MDQ A;  3UOR A;  4FJP A;  3Q28 A;  4DDD A;  2YJP A;  1TFD A;  2F78 A;  1MQH A;  4GXS B;  3VXC A;  4DXU A;  2ZMB A;  3K1M A;  3KOS A;  3PMW A;  1ZMG A;  4M4G A;  5KCJ A;  3QIM A;  5I57 B;  3OO8 A;  3MVX A;  3TCG A;  4NF5 A;  4Q5T A;  2IEE A;  4R6H A;  5CBR A;  2XHD A;  4TOZ A;  3N6U A;  3TOD A;  5L9M A;  3U94 A;  4MH5 A;  1EZ9 A;  3MVY A;  1LGB C;  2Q88 A;  3FGS A;  4TLL B;  1FQD A;  2B3F A;  1NNF A;  2F34 A;  3MP1 A;  2VOZ A;  1EZP A;  4QF9 A;  1R1N A;  1AOV A;  3CR9 A;  3IR1 A;  3QYT A;  2X7Q A;  1A55 A;  1CE2 A;  3A09 A;  1DPP A;  2VD3 A;  1BKA A;  2B4M A;  1WDN A;  4WXJ A;  3TTL A;  4F1Y A;  4K3F A;  5DYH A;  1JEU A;  5LOM A;  4LVQ A;  1QUJ A;  1Y20 A;  4YU0 A;  4DXC A;  3N26 A;  5EHM A;  3G3F A;  2H98 A;  4OXV A;  1SYI A;  3K0V A;  3PGF A;  3WAF A;  3W9W A;  1HSJ A;  3RPW A;  1A7L A;  3H7M A;  1B58 A;  3KJ7 A;  3LBS A;  2AL4 A;  2XXQ A;  4KHZ E;  3PUX E;  3FVN A;  5I58 B;  3PAM A;  4Q0C A;  1B51 A;  3C32 A;  3QSL A;  3T93 B;  5KCJ B;  1JNF A;  5AA2 B;  1BLF A;  4HTG A;  1FTJ A;  3HPI A;  2Q2C A;  2I3V A;  1B52 A;  1PB9 A;  4UA8 A;  5H8Q B;  5L9O A;  3CFX A;  2OK2 A;  3IOR A;  3IJO B;  3G3J A;  4XKP A;  4H5G A;  4GLI A;  4IO3 A;  3RY3 A;  2OBG A;  3MZ1 A;  1GTK A;  4EF2 A;  1IXG A;  4HS7 A;  1LB9 A;  4QSD A;  4JSD A;  1LAF E;  3CIJ A;  4TQU Q;  1B3G A;  1JET A;  3DP8 A;  1VFD A;  4THI A;  5DEX A;  3SEX A;  2DWH A;  3MVZ A;  2IA4 A;  3KN3 A;  3HO7 A;  2VP1 A;  4LZ5 A;  5AE4 A;  1MS7 A;  1URD A;  1OQG A;  4YKI A;  4PFT A;  1B40 A;  2OLB A;  1UTB A;  3N5L A;  3HST A;  3MPK A;  3MUQ A;  5BUU A;  1ZKB A;  4F2O A;  3IOV A;  4GXA A;  5HPQ A;  2ALU A;  4R2F A;  3CFZ A;  5I57 A;  1FQF A;  1B4H A;  1O63 A;  2UVJ A;  2Z8F A;  5I2N A;  1ZIU A;  1B9J A;  2VGQ A;  5EHS A;  1AL3 A;  1H43 A;  2FA7 A;  3SEU A;  4DE8 A;  2Z8E A;  1DTG A;  4LAT A;  1J1N A;  3CG3 A;  1XC1 A;  4NWD A;  1B1X A;  1P1W A;  1SI1 A;  5I84 A;  3OO9 A;  3W9V A;  1XVY A;  5AA3 A;  5H8Q A;  2RC9 A;  2DWA A;  1CB6 A;  2XXX A;  1BIY A;  2FYI A;  3TMG A;  3GBA A;  5JTY B;  3TPA A;  1MY1 A;  2O51 A;  3CVG A;  1PEB A;  3G3I A;  3IAZ A;  4H5F A;  4U23 A;  5ELV A;  3KFM A;  4KPT A;  3RUM A;  4F18 A;  1ZBM A;  1SW5 A;  1EZO A;  3EHT A;  2V93 A;  3IOU A;  3RYA A;  5H8F B;  3LSW A;  1LAG E;  4H65 A;  3TTK A;  2ONK E;  1B05 A;  2VHA A;  3EPE A;  4YB7 A;  3V83 A;  5DT6 A;  2DWJ A;  2G93 A;  4I1D A;  4NWC A;  4U2R A;  2XXP A;  1ZTY A;  1Y9U A;  2ZNS A;  3C36 A;  2F8D A;  2DS9 A;  1MRP A;  2PYY A;  2YPN A;  1XVX A;  4LZ7 A;  3AXF A;  1H76 A;  1B5H A;  3TQW A;  1R9L A;  5B7D A;  2I0B A;  2I58 A;  5TPA A;  3MP6 A;  4JWX A;  2I4C A;  4IO2 A;  3MW0 A;  4G4P A;  2R6G E;  2Q9T A;  1YTV A;  3O9P A;  2W7Y A;  1MXU A;  3CRB A;  3L6H A;  2YLN A;  2I0C A;  3FZV A;  4LQ2 A;  3FVK A;  3H6T A;  1I6A A;  3D4C A;  2UVH A;  3IX1 A;  2XX9 A;  1AH5 A;  1EU8 A;  2O69 A;  2X26 A;  4U1O A;  3GBB A;  1QJM A;  1GV8 A;  4C1T A;  4XKN A;  1N3X A;  4R9G A;  1FQA A;  1VFE A;  1FTK A;  4GL0 A;  2PMS A;  1OVB A;  4RY1 A;  4EUO A;  2UYE A;  3DRH A;  1R6Z A;  1LAX A;  3BBR A;  1QKB A;  3LSF B;  3MJN A;  1UIV A;  4QFN A;  1MM7 A;  2DVZ A;  3IO6 A;  3K6W A;  3U1O A;  2OWS A;  3G3G A;  4KCC A;  2XX7 A;  5I2N B;  4E0X A;  1MPC A;  1VSO A;  4PE5 B;  2F7B A;  3K2D A;  3H6W A;  3Q26 A;  3V89 B;  4BDQ A;  4F39 A;  2H9B A;  1I69 A;  1Q1K A;  1VE4 A;  1XHY A;  3VDF A;  3OEM A;  1XT8 A;  4QFO A;  4R6Y A;  4GFR A;  3O28 A;  3VLV A;  3KN7 A;  4KQP A;  1GVC A;  5AA4 A;  1WVJ A;  4ZZE A;  4XKQ A;  1Y1M A;  1SVX B;  4BDN A;  1URS A;  3MVW A;  3OOA A;  2RCA A;  1USY H;  2NOO A;  2OWT A;  2ZYO A;  5CM6 A;  4ZEK A;  1JW5 A;  4WKM A;  3GXA A;  3IOT A;  2R71 A;  5H8N A;  4QHQ A;  3TYH A;  3DRJ A;  5H8F A;  3DEL B;  4U21 A;  3FIR A;  4QFK A;  3UIF A;  2I48 A;  3MPL A;  3OXN A;  4RJZ A;  1D9Y A;  5KDT B;  2ZNT A;  2I3W A;  4YKJ A;  4ZS9 A;  3ZKK A;  1MM6 A;  1LCF A;  2CZL A;  1B1H A;  1M5B A;  1RKM A;  2XXU A;  2HEU A;  3PD9 A;  3PUY E;  1B0H A;  5H8H B;  3T9V A;  4F3S A;  3FTO A;  1XOC A;  4PFW A;  1IZ1 A;  3R6U A;  4JBZ A;  3W15 C;  2V25 A;  1FTO A;  3RLF E;  1QVS A;  5TPA B;  1Y3N A;  3BFU A;  2Z23 A;  3K6X A;  3KG2 A;  3GZG A;  2QS4 A;  3Q29 A;  1JEV A;  3O6G A;  3RT8 A;  3TFL A;  1F9B A;  3ECR A;  3OD7 A;  4I8C A;  4GL8 A;  3EHU A;  4IO6 A;  4IO4 A;  1LFI A;  2X7P A;  5CMM A;  5I56 A;  3SDF A;  1TWY A;  3UP9 A;  4R74 A;  2B4L A;  2XD3 A;  3R26 A;  4NE4 A;  5BWJ A;  4P0I A;  4RK9 A;  4NF6 B;  3SKP A;  2RF1 A;  5TP9 B;  1NNK A;  3CI8 A;  1OLA A;  4QFL A;  3IB2 A;  1LST A;  1LFH A;  1NKX A;  3MZ9 A;  3RQT A;  3TZA A;  3K02 A;  2ZYK A;  4IY6 A;  2D21 A;  2H25 A;  3E4R A;  4WEP A;  4GWO A;  2QL3 A;  3L6G A;  4IO7 A;  3UK4 A;  1RYX A;  3BFT A;  1USY E;  4DCX A;  2O7U A;  2XD2 A;  4OWD A;  5H8H A;  1BP5 A;  3GLB A;  1ATG A;  5F7V A;  1US4 A;  4XIG Q;  3O6P A;  3PMX A;  3VXB A;  4KCD A;  3T9U A;  4LON B;  3ILT B;  4ELQ A;  3FUZ A;  3LVU A;  4PQJ A;  5A5X A;  4NF8 B;  4O3C A;  3CG1 A;  1UTH A;  4OEN A;  1VR5 A;  2F5X A;  2UYF A;  1D3K A;  2V3T A;  4ZEI A;  4LUB A;  3OEK A;  3SES A;  3UN6 A;  3V5A A;  4YIC A;  2F6P A;  1P1U A;  4YMB A;  3A3U A;  5I56 B;  5F1Q A;  2M8C A;  2HZL A;  3JV9 A;  4ELO A;  4EXL A;  5ICQ A;  3B6W A;  3S9L C;  2XXH A;  2DE4 A;  3I6V A;  4N13 A;  1DPE A;  4R6K A;  3DP4 A;  2P2A A;  4KYD A;  5EYF A;  5ITO A;  4OQO A;  1M5F A;  1SYH A;  4R9F A;  1N04 A;  3SER A;  1B32 A;  4OFL A;  5AA2 D;  4JB7 A;  3KN8 A;  1OMP A;  4F31 B;  2V3U A;  3FVG A;  3KEI A;  3VFJ A;  4AB5 A;  2PX1 A;  3EF7 A;  4OEU A;  1B3L A;  4HCY A;  3DRI A;  2GHA A;  4ZED A;  1IEJ A;  1N0T A;  3FV2 A;  1A54 A;  2O84 X;  4G68 B;  1LLS A;  1PBQ A;  3G7W A;  3PPR A;  4XTC Q;  3VV5 A;  2DXY A;  5HBC A;  3H03 A;  4F1U A;  4PET A;  2Q89 A;  2XXI A;  3FJ7 A;  4FEC A;  4GRK A;  4UAC A;  1DSN A;  1KWH A;  5FTH A;  2HCA A;  2Z8D A;  4IB2 A;  1I6Q A;  1MXV A;  4F3B A;  5CMK A;  5I58 A;  2LAO A;  5FHN A;  2PVU A;  4NTL A;  3FAT A;  3USD A;  1P1O A;  2DVC A;  5AA2 A;  5ITP A;  3MAM A;  2NVU B;  2Y7R A;  4JWO A;  2XXR A;  4GVO A;  4YKP A;  2REJ A;  3TQL A;  1NFT A;  1IXC A;  1P1Q A;  3LC8 A;  1B7H A;  2P0S A;  3CFL A;  2FNC A;  3IOW A;  3OSR A;  1QUK A;  4GIZ A;  4FAT A;  3S4U A;  5DEX B;  4POW A;  2UVG A;  4BDL A;  1OIB A;  2Y7K A;  1YAE A;  5B70 A;  5ICT A;  1D9V A;  4MF3 A;  4FAJ A;  4JWY A;  4DIG A;  3B6T A;  1B0L A;  4DXB A;  2ZNU A;  1OVT A;  1JW4 A;  3LSL A;  3TTR A;  4H0W A;  3SEV A;  5JK4 A;  1DOT A;  3H3G A;  4NF8 A;  4OTE A;  1PC3 A;  1B5J A;  1UTH B;  3K6U A;  1A99 A;  3M3L A;  2DYX A;  4FIM A;  4LA9 A;  2NUV A;  4BDR A;  3KBR A;  3VE1 B;  1Y3Q A;  4DLD A;  4AB6 A;  1B4Z A;  2VD2 A;  2HAV A;  1ELJ A;  4KFQ A;  1MY3 A;  1N7X A;  5L8D A;  3DLN A;  2GFE A;  2H4I A;  1LFG A;  4ONY A;  4H8J A;  5CMC A;  3E9X A;  2RC8 A;  4JSO A;  1MG1 A;  1WOD A;  5FHO A;  1FTM A;  4G8N A;  3OSQ A;  4MLV A;  4G2Z A;  4MLQ A;  3H6V A;  3IB1 A;  1POT A;  1Q35 A;  3FJG A;  2RC7 A;  4ECF A;  2F35 A;  2D3I A;  4NED A;  2CMO A;  4RK2 A;  5HM4 B;  1YCJ A;  4HW8 A;  2RKM A;  5H8S A;  1MXW A;  1UTB B;  2XXV A;  4F2Q A;  4Z0I A;  3MC2 A;  1L5T A;  4G77 A;  3H6U A;  5IKB A;  3O66 A;  4G68 A;  3S2V A;  4OES A;  3M8U A;  4H67 A;  1MPD A;  2Y7P A;  4EQ7 A;  1NL5 A;  3C9H A;  1ZLQ A;  3G3K A;  4NF4 A;  3TTN A;  1HSE A;  1TFA A;  1R9Q A;  3PD8 A;  4NMY A;  2DWI A;  5CC2 A;  4BLA A;  3ZKL A;  1MQJ A;  4ZEF A;  1UIU A;  4DCY A;  1N3W A;  1LCT A;  3FVO A;  3H4Z A;  1POY 1;  3LSX A;  1B2H A;  1FQB A;  5IAI A;  1JQF A;  1ANF A;  4JDF A;  3TEP A;  5JTY A;  4YZZ A;  2PT2 A;  1H44 A;  1QKA A;  2ONR A;  3JZJ A;  4O3B A;  1PDA A;  4ISU A;  3FV1 A;  3PUZ E;  2BJJ X;  4IO5 A;  4L17 A;  3R7X A;  4Q8R A;  3TCF A;  1NMU A;  3MP8 A;  2ABH A;  3Q25 A;  4X1D A;  4ZZA A;  3FXQ A;  3O97 A;  1MXZ A;  3FXR A;  4H6D A;  1GGG A;  3HCQ A;  3DRF A;  1IIT A;  2NXO A;  4AQ4 A;  4F29 A;  5CBS A;  1Y1Z A;  1MDP 1;  5AA1 A;  2XXW A;  3HHG A;  3CSG A;  4DZ1 A;  4U4S A;  4TLM B;  5DVJ A;  2QMX A;  2GRV A;  2GHB A;  3Q27 A;  3IL1 B;  3RN8 A;  3RTF B;  2GH9 A;  4MBP A;  4BDM A;  1IUD A;  2QJE A;  2O6A A;  4OFO A;  2A5T B;  2NWJ A;  3N6T A;  2QS1 A;  1H45 A;  1N84 A;  3ONM A;  1MY2 A;  1LBB A;  3U93 A;  3KGC A;  4KD5 A;  3LR1 A;  3BKI B;  4QFP A;  1O64 A;  3EN3 A;  4YAH X;  4XXU A;  2QRY A;  2F7A A;  3OO6 A;  1OQH A;  2ESN A;  3RNN A;  3WAE A;  1PB8 A;  1SW2 A;  4EQB A;  3QAX A;  3DRG A;  1LAH E;  5KDT A;  2KLF A;  2F7C A;  1B5I A;  2H5Y A;  2ZXT A;  1IQ7 A;  4KI0 E;  3VVE A;  3MBP A;  3PUV E;  1MQI A;  3FXU A;  1SDX A;  1MY0 A;  3O2A A;  1N76 A;  3FD3 A;  1Y3P A;  3FJM A;  4F1V A;  3C34 A;  4P11 A;  4YKK A;  1XS5 A;  2WKY A;  1S7Y A;  2HQ0 A;  3SET A;  1N7W A;  2Q2A A;  2I4B A;  3IK6 B;  3C35 A;  3CSB A;  3I3V A;  4PFY A;  4IGR A;  3ZSF A;  4E0W A;  2WOK A;  4OYV A;  2A5T A;  1AMF A;  3K4U A;  3OEN A;  5K2X A;  5FTI A;  1S50 A;  4ZE8 A;  3IB0 A;  1M5D A;  1LB8 A;  2QMW A;  3LUY A;  4FOR A;  3M3F A;  4GQO A;  3MQ9 A;  3P7I A;  4NF6 A;  4R2B A;  4ZEB A;  3UA8 A;  5I59 B;  5J1D A;  2AL5 A;  2Y7I A;  1AIV A;  3DRK A;  3U72 A;  3H06 B;  2AIX A;  3KSJ A;  3TAJ A;  1B6H A;  2XXT A;  3KOT A;  2O1L A;  3HN0 A;  4O3A A;  1JVY A;  1SQY A;  3HV1 A;  4I9D A;  1A8F A;  1P1N A;  4U4X A;  4OEV A;  4C0R A;  2ZYN A;  3RGY A;  5FHM A;  1T0K A;  2O7I A;  2I6E A;  1Y4C A;  2I49 A;  1S9T A;  2DXR A;  3ILU B;  3O6H A;  4EDP A;  5L9S A;  4HCW A;  1A8E A;  4IGT A;  3OO7 A;  1FCK A;  4FEB A;  4KR5 A;  4F3G A;  4PFU A;  2O1M A;  3EHS A;  2QSX A;  2Y7W A;  4R73 A;  3TKD A;  3M3K A;  2QS3 A;  1MQD A;  3K00 A;  4YB6 A;  1Z7M E;  2DE3 A;  1FW0 A;  1TT1 A;  1II5 A;  3MWB A;  1Z7N E;  1QUL A;  4ELP A;  3CHG A;  1OLC A;  4MFI A;  3G3H A;  3T96 B;  4C1U A;  3S9M C;  3JYR A;  4JXI A;  4EQ9 A;  4U1Z A;  3VLW A;  1B3F A;  2A5S A;  5I59 A;  4LQ5 A;  1M5E A;  3PU5 A;  1IIW A;  1NH8 A;  4M1V A;  2OZZ A;  2PBW A;  1FQC A;  1GR2 A;  2RCB A;  4OFJ A;  3PPO A;  3C31 A;  2DP8 A;  3O29 A;  3ZS6 A;  1B7U A;  3B6Q A;  1B3E A;  2DOJ A;  1BTJ A;  1O7T A;  5A5X B;  1P99 A;  1IXI A;  3C4M A;  1TXF A;  2UVI A;  3O6I A;  2B65 A;  4X48 A;  3TCH A;  2V3Q A;  4KYE A;  2D5W A;  5ISU A;  3S9E A;  4ZEC A;  2O68 A;  2R9J A;  2F6G A;  2ZYM A;  3C33 A;  3IJX B;  1HSL A;  4RYA A;  4ELR A;  3TUS A;  3DP6 A;  5AA4 B;  4RA1 A;  1D4N A;  4H1X A;  2V84 A;  1UQW A;  3PPQ A;  4G68 C;  2DE2 A;  3S9N C;  1MY4 A;  1M5C A;  3E13 X;  5M2V A;  4QSC A;  3A3C A;  5H8N B;  2G29 A;  1LBC A;  3PPP A;  4RPN A;  3U92 A;  4RNS A;  2E1S A;  3DM0 A;  3ODB A;  4FE8 A;  3TTM A;  1ZJL A;  1SD3 A;  4F19 A; 
#chains in the Genus database with same CATH topology
 3SEW A;  3OEL A;  1B46 A;  2XXY A;  1FQE A;  1SW4 A;  3VLU A;  4XF5 A;  1FPJ A;  3T22 A;  4NF5 B;  1H3D A;  3RTW B;  2AYS A;  3T9H B;  1KA0 A;  1A40 A;  3VVF A;  5IZZ A;  4OET A;  3N94 A;  4HXV A;  5LDZ A;  4MNI A;  3I5O A;  1NNP A;  2P1S A;  2XWI A;  3V8X B;  3MZB A;  2UXA A;  3QK6 A;  4MNC A;  2PT1 A;  5EQA A;  2WX9 A;  4Z7E A;  4IY5 A;  4NF4 B;  4OZ9 A;  1SW1 A;  2HZK A;  1FTL A;  3QUF A;  2HFB A;  4LZ8 A;  2Y84 A;  3T66 A;  2F36 A;  2QS2 A;  4YMA A;  4U22 A;  3THI A;  4GWY A;  4BDO A;  4GF8 A;  5EQ9 A;  3TDJ A;  3B8B A;  4RPO A;  2E0S A;  1MDQ A;  4P1E A;  4DDD A;  2YJP A;  4GXS B;  4DXU A;  3K1M A;  3PMW A;  4M4G A;  5LTC A;  5I57 B;  3TCG A;  5I3S A;  4R6H A;  2XHD A;  1EZ9 A;  1EZP A;  1NNF A;  4OVR A;  2VPN A;  3A09 A;  3A29 A;  1FBD A;  1BKA A;  4JVD A;  1EYK A;  2B4M A;  1WDN A;  3TTL A;  4K3F A;  4LVQ A;  1KZ8 A;  3N26 A;  1YZ0 A;  1A7L A;  3H7M A;  1B58 A;  3KJ7 A;  3LBS A;  3PUX E;  3PAM A;  4Q0C A;  3C32 A;  5KCJ B;  1JNF A;  2Q2C A;  2I3V A;  1B52 A;  4UA8 A;  4H5G A;  3RY3 A;  2OBG A;  1IXG A;  2HHM A;  1JET A;  1VFD A;  4THI A;  2DWH A;  2IA4 A;  4LZ5 A;  1MS7 A;  4YKI A;  4PFT A;  2OLB A;  3MUQ A;  3IOV A;  4R2F A;  1FQF A;  4N8G A;  2UVJ A;  2VGQ A;  3SEU A;  1DTG A;  4LAT A;  1B1X A;  1XVY A;  5H8Q A;  2KQZ A;  3GBA A;  3TPA A;  2O51 A;  5ELV A;  3CVG A;  3G3I A;  4KPT A;  3RUM A;  1EZO A;  3IOU A;  4H65 A;  1B05 A;  3EPE A;  2G93 A;  4NWC A;  1ZTY A;  1Y9U A;  2DS9 A;  3AXF A;  2I0B A;  5I7I A;  3MP6 A;  2I4C A;  1BK4 A;  1MXU A;  3L6H A;  2YLN A;  3VXC A;  3FVK A;  2O69 A;  3U65 A;  2PMS A;  2QVV A;  3BBR A;  3DRH A;  1R6Z A;  1LAX A;  3LSF B;  4GWO A;  4BDL A;  4DIG A;  1UIV A;  4QFN A;  2DVZ A;  3IO6 A;  5EQ7 A;  1MPC A;  3K2D A;  3H6W A;  3V89 B;  4BDQ A;  2H9B A;  1I69 A;  1XHY A;  3VDF A;  4XKQ A;  4BDN A;  3OOA A;  2RCA A;  2OWT A;  3IOT A;  3UIF A;  4DI3 D;  4YKJ A;  4ZS9 A;  1MM6 A;  2CZL A;  1B1H A;  4F3S A;  1B0H A;  4PFW A;  1IZ1 A;  3R6U A;  1IME A;  2V25 A;  4MHF A;  1QVS A;  5TPA B;  1Y3N A;  3K6X A;  3TFL A;  4PFB A;  1FPE A;  4I8C A;  4GL8 A;  3RPL A;  1LFI A;  2B4L A;  3R26 A;  3CI8 A;  1LFH A;  1LST A;  3MZ9 A;  3RQT A;  3TZA A;  2ZYK A;  2D21 A;  2XA5 A;  2WYK A;  1NUX A;  5H8H A;  4KCD A;  3LVU A;  1UTH A;  4OEN A;  2F5X A;  4LUB A;  3V5A A;  4YMB A;  3A3U A;  4ELO A;  4EXL A;  5ICQ A;  1IMB A;  4R6K A;  3DP4 A;  4R9F A;  3SER A;  2FBP A;  1OMP A;  2PX1 A;  4OEU A;  4ZED A;  3FV2 A;  2O84 X;  1LLS A;  4GWS A;  2DXY A;  4PET A;  2Q89 A;  4UAC A;  4GRK A;  1DSN A;  5CMK A;  4IB2 A;  5AA2 A;  5ITP A;  1P1O A;  2Y7R A;  2XWO A;  2REJ A;  2DDK A;  1P1Q A;  2P0S A;  4X8R A;  5ICT A;  4MF3 A;  5T3J A;  2ZNU A;  3TTR A;  4HE2 A;  1FBG A;  5IGA A;  1K9Z A;  4OTE A;  3M3L A;  1A99 A;  4DLD A;  1Y3Q A;  4AB6 A;  3U93 A;  2RC8 A;  4JSO A;  4G8N A;  4MLQ A;  1IMD A;  4ECF A;  2F35 A;  4HW8 A;  5HM4 B;  1YCJ A;  3KC0 A;  1UTB B;  4F2Q A;  5IKB A;  2Y7P A;  1NL5 A;  1ZLQ A;  3G3K A;  4NF4 A;  5CC2 A;  4BLA A;  1N3W A;  3H4Z A;  1POY 1;  3LSX A;  1B2H A;  5JTY A;  1EYI A;  1QKA A;  4N17 A;  3PUZ E;  4L17 A;  3R7X A;  3TCF A;  4ZZA A;  1GGG A;  1FBC A;  1Y1Z A;  4P47 A;  2P3V A;  3HHG A;  4PAF A;  4TLM B;  2GRV A;  3Q27 A;  4BDM A;  2A5T B;  2NWJ A;  3N6T A;  4AS5 A;  2CEX A;  4PE3 A;  4QFP A;  4YAH X;  4HE0 A;  1NV7 A;  5I5P A;  4EQB A;  3ISP A;  5KDT A;  2ZXT A;  4PFI A;  2VT5 A;  2WBB A;  4NHB A;  4F1V A;  2HXR A;  1SPI A;  3C35 A;  2WOK A;  3IB0 A;  1M5D A;  4GQO A;  5I59 B;  3MQ9 A;  5J1D A;  5EQ8 A;  1AIV A;  1B6H A;  1NV0 A;  4UAB A;  3KOT A;  1JVY A;  4I9D A;  1FPF A;  2FVZ A;  3RGY A;  2DXR A;  3O6H A;  4EDP A;  5L9S A;  2FHY A;  4IGT A;  2QSX A;  3K00 A;  1Z7M E;  3MWB A;  3CHG A;  1OLC A;  3G3H A;  4U1Z A;  2A5S A;  1M5E A;  3PU5 A;  1NH8 A;  2OZZ A;  1GR2 A;  4OFJ A;  3PPO A;  3C31 A;  2WEF A;  3ZS6 A;  5A5X B;  1BTJ A;  4MX6 A;  1IXI A;  1TXF A;  4N81 A;  4ELR A;  1NI9 A;  3ROJ A;  1HSL A;  4RA1 A;  1UQW A;  5H8N B;  3U92 A;  1LBC A;  1VDW A;  2E1S A;  3ODB A;  4PC9 A;  2REG A;  1MXY A;  4OVJ A;  4QRZ A;  3FAS A;  3OMB A;  4PBQ A;  4X1B A;  1MH3 A;  1PB7 A;  1ZU0 A;  4QSE A;  3VVD A;  1SI0 A;  4ZE9 A;  5CMB A;  4YB5 A;  1US5 A;  3K01 A;  3QXM A;  4RXL A;  1EH3 A;  2B3B A;  4F3P A;  2QPQ A;  4P0G A;  3KJT A;  2Q8M A;  1YPN A;  5J16 A;  2Q8J A;  3K6V A;  4ZDM A;  4EXK A;  3RYB A;  4POX A;  3RPL B;  4DI4 B;  5DVI A;  2DQV A;  4HE1 A;  4ND9 A;  1DTZ A;  4GX4 A;  3K1N A;  3D4G A;  4GWU A;  1SBP A;  4N07 A;  4N6P A;  5I2K A;  2WOL A;  5ET8 A;  5KCJ A;  1ZMG A;  3OO8 A;  2IEE A;  4N15 A;  4TOZ A;  3N6U A;  3U94 A;  3MVY A;  1LGB C;  3FGS A;  1AOV A;  3CR9 A;  3QYT A;  2X7Q A;  1A55 A;  4F1Y A;  1JEU A;  1QUJ A;  4QBA A;  5IZ3 A;  4OVS A;  4YU0 A;  5EHM A;  2H98 A;  3K0V A;  4N6K A;  3FVN A;  3T93 B;  4NX1 A;  5AA2 B;  4I3Y A;  1FTJ A;  2CEY A;  5H8Q B;  3IJO B;  4GLI A;  1GTK A;  4QSD A;  1LAF E;  3DP8 A;  3SEX A;  3MVZ A;  3HO7 A;  2VP1 A;  5AE4 A;  1URD A;  1OQG A;  1B40 A;  5BUU A;  1ZKB A;  4MNP A;  2ALU A;  1O63 A;  2Z8F A;  1ZIU A;  4XEQ A;  4NWD A;  1P1W A;  1SI1 A;  3OO9 A;  3W9V A;  2DWA A;  1BIY A;  2FYI A;  3TMG A;  1MY1 A;  3IAZ A;  4PGN A;  4U23 A;  5AA1 A;  3KFM A;  3EHT A;  1LAG E;  3V83 A;  5A5L A;  4I1D A;  1FRP A;  1MRP A;  1XVX A;  1B5H A;  3TQW A;  5B7D A;  5TPA A;  4G4P A;  2Q9T A;  1YTV A;  3B50 A;  3CRB A;  4LQ2 A;  2I0C A;  2UVH A;  4H46 A;  2XX9 A;  1AH5 A;  1EU8 A;  2X26 A;  3GBB A;  1QJM A;  4XKN A;  4RY1 A;  1VFE A;  1OVB A;  1IMA A;  3OEM A;  3U1O A;  2OWS A;  3G3G A;  4E0X A;  4PE5 B;  1Q1K A;  1QGX A;  4R6Y A;  4QFO A;  5AA4 A;  4N4U A;  1Y1M A;  1SVX B;  4KXP A;  2NOO A;  4N91 A;  5CM6 A;  1JW5 A;  1NV5 A;  2OX3 A;  3FIR A;  4RJZ A;  5KDT B;  2ZNT A;  2XXK A;  2XXU A;  3PD9 A;  3T9V A;  5H8H B;  1XOC A;  1FTO A;  3RLF E;  3BFU A;  2Z23 A;  1JEV A;  3EHU A;  4IO4 A;  4O7M A;  4X04 A;  4NE4 A;  5BWJ A;  3IB2 A;  2QL3 A;  3UK4 A;  4DCX A;  2O7U A;  3GLB A;  4PFR A;  1US4 A;  3PMX A;  3GYY A;  3T9U A;  3ILT B;  4O3C A;  3SES A;  2V3T A;  2F6P A;  5I56 B;  2M8C A;  2HZL A;  3JV9 A;  1RDX A;  4GWX A;  2P2A A;  1B32 A;  3KN8 A;  4F31 B;  2V3U A;  3FVG A;  3VFJ A;  3EF7 A;  4HCY A;  3DRI A;  3G7W A;  3PPR A;  3VV5 A;  4P8B A;  5HBC A;  5ESY A;  1KWH A;  5FTH A;  2HCA A;  2Z8D A;  4O7I A;  1MXV A;  4F3B A;  4N6D A;  2LAO A;  3MAM A;  2NVU B;  2XXR A;  4YKP A;  1FJ6 A;  1NFT A;  1IXC A;  2PCR A;  4PCD A;  4POW A;  1OIB A;  1G0I A;  2L5V A;  1D9V A;  4JWY A;  3B6T A;  1FBF A;  3H3G A;  1PC3 A;  4LA9 A;  4BDR A;  3VE1 B;  2HAV A;  4U21 A;  1MY3 A;  1N7X A;  2H4I A;  4ONY A;  4P1L A;  1WOD A;  2ZZX A;  1POT A;  1Q35 A;  3FJG A;  2RC7 A;  4NED A;  2RKM A;  1MXW A;  4G77 A;  4G68 A;  1MPD A;  3C9H A;  3T0J A;  1TFA A;  1MQJ A;  4ZEF A;  1UIU A;  1LCT A;  3FVO A;  1YYZ A;  1FQB A;  5IAI A;  3TEP A;  4YZZ A;  1EYJ A;  3JZJ A;  1PDA A;  4ISU A;  2BJJ X;  4Q8R A;  3MP8 A;  3Q25 A;  3O97 A;  3HCQ A;  4AQ4 A;  4F29 A;  3CSG A;  4U4S A;  5DVJ A;  3IL1 B;  3RN8 A;  2QJE A;  4OFO A;  1N84 A;  1MY2 A;  1LBB A;  3EN3 A;  3WAE A;  3OO6 A;  2ESN A;  3RNN A;  1PB8 A;  3QAX A;  1LAH E;  2KLF A;  2F7C A;  1B5I A;  1IQ7 A;  1SDX A;  1N76 A;  3FJM A;  3HFU A;  4YKK A;  4P11 A;  2HQ0 A;  1N7W A;  2I4B A;  3ZSF A;  4ZE8 A;  4NF6 A;  1LB8 A;  3LUY A;  3M3F A;  3P7I A;  4ZEB A;  3H06 B;  3KSJ A;  3TAJ A;  4AS4 A;  3HN0 A;  1SQY A;  3HV1 A;  5EYH A;  2ZYN A;  2I6E A;  2I49 A;  1S9T A;  3ILU B;  1FCK A;  4KR5 A;  4F3G A;  4PFU A;  2Y7W A;  3TKD A;  4YB6 A;  1MQD A;  1LBW A;  4ELP A;  4C1U A;  2PBW A;  1FQC A;  1B7U A;  1FSA A;  3B6Q A;  1B3E A;  2DOJ A;  3C4M A;  1INP A;  4KYE A;  4ZEC A;  2F6G A;  3C33 A;  3IJX B;  3DP6 A;  4H1X A;  1MY4 A;  4QSC A;  4MCO A;  2G29 A;  3DM0 A;  1SD3 A;  4F19 A;  1RDZ A;  2Z22 A;  4WED A;  2JJK A;  1Y4T A;  4G8H A;  2THI A;  4OER A;  1PBP A;  4GBV A;  4H8I A;  3QMF A;  1URG A;  3HHF A;  1YXI A;  3KZG A;  4IR8 A;  3KSX A;  4I62 A;  1MQG A;  5I2K B;  1B3H A;  3U8Q A;  4GOT A;  3PMV A;  2ONS A;  3PPN A;  4EF1 A;  3K1P A;  2FIE A;  2HAU A;  2OCU A;  1IMF A;  2XX8 A;  3SEY A;  4OHN A;  3QUJ A;  4PP0 A;  3E3K A;  1G0H A;  4FED A;  5CRY A;  3IO4 A;  5KZT A;  1I6B A;  2R8T A;  3B7D A;  5DVF A;  2WOP A;  1TFD A;  1MQH A;  3KOS A;  4MEV A;  5CBR A;  3TOD A;  2Q88 A;  2F34 A;  2VOZ A;  4QF9 A;  2VD3 A;  4WXJ A;  5LOM A;  1Y20 A;  4OVQ A;  3WAF A;  4OXV A;  1SYI A;  3PGF A;  3W9W A;  1HSJ A;  2AL4 A;  3QSL A;  4HTG A;  1XI6 A;  3HPI A;  2CZI A;  3CFX A;  3G3J A;  4XKP A;  1FJ9 A;  1LB9 A;  4JSD A;  3CIJ A;  4TQU Q;  2Y5K A;  4OVT A;  4MMP A;  4XFE A;  4PAK A;  1UTB A;  3MPK A;  4F2O A;  4GXA A;  1LEV A;  5EHS A;  1AL3 A;  1H43 A;  2F3B A;  1J1N A;  4MAG A;  5I84 A;  5AA3 A;  1CB6 A;  1FPD A;  5JTY B;  5F24 A;  3RYD A;  1SW5 A;  2V93 A;  3RYA A;  3TTK A;  2ONK E;  2VHA A;  5DT6 A;  2DWJ A;  4U2R A;  2ZNS A;  2F8D A;  4LZ7 A;  1H76 A;  1R9L A;  2I58 A;  4FBP A;  4JWX A;  3MW0 A;  2R6G E;  4I3E A;  1FQA A;  1FTK A;  4OVP A;  4EUO A;  4KCC A;  2XX7 A;  5I2N B;  1VSO A;  2F7B A;  3Q26 A;  4NGU A;  4F39 A;  1FBH A;  1VE4 A;  3EKI A;  3O28 A;  3VLV A;  3BIH A;  1WVJ A;  4ZZE A;  3MVW A;  3GXA A;  5H8F A;  2R71 A;  4QHQ A;  3MPL A;  3OXN A;  1D9Y A;  3ZKK A;  1M5B A;  1RKM A;  2HEU A;  2Q74 A;  4PDH A;  3KG2 A;  3GZG A;  2QS4 A;  1F9B A;  5CMM A;  2X7P A;  5I56 A;  3SDF A;  4R74 A;  2XD3 A;  4RK9 A;  4NF6 B;  2RF1 A;  5TP9 B;  1NKX A;  3K02 A;  2Y5L A;  4GBW A;  4NN3 A;  3E4R A;  4WEP A;  3L6G A;  1RYX A;  3BFT A;  1USY E;  2XD2 A;  2HPG A;  4OWD A;  1BP5 A;  5F7V A;  3O6P A;  3VXB A;  4MJO A;  4LON B;  3PTY A;  4PQJ A;  5A5X A;  3CG1 A;  1VR5 A;  2UYF A;  4ZEI A;  3OEK A;  1P1U A;  2DE4 A;  3I6V A;  5IM2 A;  4N13 A;  4P3L A;  5EYF A;  4OQO A;  1M5F A;  1SYH A;  4P9K A;  1N04 A;  1RDY A;  3KEI A;  1B3L A;  2XWK A;  4G68 B;  1IEJ A;  1N0T A;  4GWZ A;  4XTC Q;  4PF8 A;  4F1U A;  3FJ7 A;  4FEC A;  5I58 A;  1I6Q A;  1K9Y A;  2PVU A;  4NTL A;  3FAT A;  2DVC A;  4GX6 A;  4GVO A;  1B7H A;  3CFL A;  3OSR A;  4LN5 A;  1QUK A;  1LBV A;  4GIZ A;  5DEX B;  2UVG A;  2Y7K A;  4GWW A;  5B70 A;  1B0L A;  2QVU A;  1JW4 A;  3LSL A;  4NF8 A;  1B4Z A;  2VD2 A;  4KFQ A;  5L8D A;  4H8J A;  2GFE A;  1LFG A;  4NF0 A;  1MG1 A;  3NOH A;  3LUZ A;  1FPL A;  3IFC A;  3H6V A;  3IB1 A;  5H8S A;  2XXV A;  1NUY A;  3KBZ A;  4Z0I A;  1L5T A;  3H6U A;  3O66 A;  4OES A;  4H67 A;  1FPI A;  4EQ7 A;  1CNQ A;  3PD8 A;  2DWI A;  3ZKL A;  1FPB A;  1ANF A;  4JDF A;  2PT2 A;  1H44 A;  2ONR A;  3FV1 A;  1NMU A;  2ABH A;  1DCU A;  3FXQ A;  1MXZ A;  4H6D A;  4DZ1 A;  1FBE A;  5FBP A;  2GH9 A;  4MBP A;  1H45 A;  3KGC A;  1O64 A;  4XXU A;  1FPG A;  2QRY A;  2F7A A;  1SW2 A;  2H5Y A;  3O2A A;  3FD3 A;  3C34 A;  2V4C A;  1JP4 A;  1XS5 A;  2WKY A;  3SET A;  4GX3 A;  4PGP A;  3CSB A;  4E0W A;  1AMF A;  3K4U A;  5FTI A;  2QMW A;  3UA8 A;  4QXD A;  2AL5 A;  2Y7I A;  3DRK A;  1LBY A;  2AIX A;  2O1L A;  4O3A A;  4U4X A;  4OEV A;  4C0R A;  4G61 A;  2O7I A;  4HCW A;  1A8E A;  4R73 A;  2QS3 A;  2DE3 A;  1FW0 A;  1TT1 A;  1QUL A;  4H45 A;  3JYR A;  4JXI A;  4EQ9 A;  4LQ5 A;  4PBH A;  1IIW A;  1FTA A;  2DP8 A;  2UVI A;  3O6I A;  2B65 A;  2V3Q A;  2D5W A;  5ISU A;  3S9E A;  2O68 A;  2R9J A;  4RYA A;  2ZYM A;  3TUS A;  5AA4 B;  2DE2 A;  4P56 A;  3PPP A;  4RPN A;  4RNS A;  3MST A;  3TTM A;  4IO2 A;  2RIN A;  5CI5 A;  2ANJ A;  5EYG A;  2HXW A;  2OJT A;  3PV0 E;  1IXH A;  4PTK A;  4XKR A;  2F97 A;  3EQ1 A;  1QUI A;  1RYO A;  4Q30 B;  5JEI A;  4O94 A;  1DMB A;  4LP2 B;  4GD5 A;  3RT6 B;  4R72 A;  1MPB A;  2DSF A;  4ESX A;  1QW0 A;  4ESW A;  4R75 A;  1JW1 A;  5DTB A;  3TEL A;  3T9X B;  1NH7 A;  3PUW E;  4G8M A;  1NNT A;  5K2Y A;  5TP9 A;  4OMB A;  1MXX A;  5TU0 A;  1B7Z A;  3F11 A;  5IZ1 A;  1MH4 A;  4F22 A;  3UGW A;  1NV6 A;  1JVX A;  2H99 A;  4KYS A;  1DBZ A;  4X9T A;  3UOR A;  4FJP A;  3Q28 A;  4OAN A;  2F78 A;  3E78 A;  2ZMB A;  3QIM A;  2VPO A;  4NF5 A;  3MVX A;  4NG7 A;  4Q5T A;  3KC1 A;  5L9M A;  4MH5 A;  4TLL B;  1FQD A;  2B3F A;  3MP1 A;  1R1N A;  3IR1 A;  1CE2 A;  1DPP A;  5DYH A;  1LBX A;  4DXC A;  3G3F A;  3RPW A;  2XXQ A;  4KHZ E;  1KA1 A;  5I58 B;  1B51 A;  1BLF A;  1PB9 A;  3IOR A;  2OK2 A;  5ET6 A;  3BIG A;  4IO3 A;  3MZ1 A;  4EF2 A;  4HS7 A;  1B3G A;  5DEX A;  3KN3 A;  3N5L A;  3HST A;  5HPQ A;  3CFZ A;  5I57 A;  1B4H A;  5I2N A;  1B9J A;  2FA7 A;  4DE8 A;  2Z8E A;  3CG3 A;  1XC1 A;  1LBZ A;  2RC9 A;  2XXX A;  1PEB A;  4H5F A;  4F18 A;  1ZBM A;  5H8F B;  2KR0 A;  2OWZ A;  3LSW A;  4YB7 A;  2FIX A;  2XXP A;  3C36 A;  1D9Q A;  2PYY A;  2YPN A;  3FXB A;  3O9P A;  2W7Y A;  4O8M A;  4OA4 A;  3FZV A;  3H6T A;  1I6A A;  3D4C A;  3IX1 A;  4U1O A;  1GV8 A;  4C1T A;  1N3X A;  4R9G A;  4GL0 A;  1Q9D A;  2UYE A;  3MJN A;  1QKB A;  1MM7 A;  3K6W A;  3LV0 A;  4PAI A;  1XT8 A;  4GFR A;  3KN7 A;  4KQP A;  1GVC A;  4JVI A;  1URS A;  1USY H;  2ZYO A;  4ZEK A;  4WKM A;  3TYH A;  5H8N A;  3DRJ A;  3DEL B;  4QFK A;  2I48 A;  2I3W A;  1LCF A;  3PUY E;  3FTO A;  4JBZ A;  3W15 C;  4NAP A;  3Q29 A;  3O6G A;  3RT8 A;  3ECR A;  4IO6 A;  3OD7 A;  4PF6 A;  3UP9 A;  1TWY A;  4P0I A;  3SKP A;  1NNK A;  1OLA A;  4QFL A;  4IY6 A;  2H25 A;  4IO7 A;  2WYP A;  4N8Y A;  1ATG A;  4XIG Q;  5ET5 A;  4ELQ A;  3FUZ A;  4NF8 B;  2QVR A;  3UN6 A;  1D3K A;  4YIC A;  5F1Q A;  3B6W A;  3S9L C;  2ZZV A;  2XXH A;  1DPE A;  5ITO A;  4KYD A;  4OFL A;  5AA2 D;  4JB7 A;  4PDD A;  4AB5 A;  4I40 A;  2GHA A;  5L9O A;  1A54 A;  3E79 A;  1PBQ A;  3H03 A;  1AWB A;  2XXI A;  5FHN A;  3USD A;  1NV2 A;  4JWO A;  3TQL A;  3LC8 A;  1NV4 A;  2FNC A;  3IOW A;  2WBD A;  4FAT A;  5IZ3 B;  3S4U A;  1YAE A;  4FAJ A;  4JVC A;  4DXB A;  1OVT A;  4H0W A;  3SEV A;  5JK4 A;  1DOT A;  1B5J A;  1UTH B;  2BJI A;  2CZH A;  3K6U A;  2DYX A;  4FIM A;  2NUV A;  3KBR A;  1ELJ A;  3DLN A;  5CMC A;  3E9X A;  5FHO A;  1FTM A;  3OSQ A;  4MLV A;  4G2Z A;  2D3I A;  2CMO A;  4NQ8 A;  4RK2 A;  2PFY A;  2F3D A;  1FPK A;  2GQ1 A;  3MC2 A;  3S2V A;  3M8U A;  3D1R A;  1NUZ A;  3TTN A;  1HSE A;  1R9Q A;  4NMY A;  3MYU A;  2CZK A;  4DCY A;  1JQF A;  4O3B A;  2QFL A;  4IO5 A;  2XWV A;  4X1D A;  3FXR A;  3DRF A;  1IIT A;  2NXO A;  5CBS A;  2MKZ A;  5DW8 A;  1MDP 1;  2XXW A;  2QMX A;  2GHB A;  3RTF B;  1IUD A;  2O6A A;  2QS1 A;  1FBP A;  3ONM A;  1NUW A;  3SZP A;  4KD5 A;  3LR1 A;  3BKI B;  1NV1 A;  1OQH A;  3DRG A;  3FBP A;  4KI0 E;  1NV3 A;  3VVE A;  3MBP A;  3PUV E;  1MQI A;  3FXU A;  1MY0 A;  1Y3P A;  1S7Y A;  2Q2A A;  3IK6 B;  1IMC A;  4PFY A;  1DK4 A;  3I3V A;  4IGR A;  4OYV A;  2A5T A;  3OEN A;  5K2X A;  1S50 A;  4R2B A;  4FOR A;  3IFA A;  3U72 A;  2XXT A;  1A8F A;  1P1N A;  4MIJ A;  5ET7 A;  5FHM A;  1T0K A;  1Y4C A;  3OO7 A;  4FEB A;  2O1M A;  3EHS A;  3M3K A;  1II5 A;  1Z7N E;  4MFI A;  3T96 B;  3S9M C;  3VLW A;  1B3F A;  5I59 A;  4M1V A;  2RCB A;  2PFZ A;  3O29 A;  2P3N A;  1O7T A;  1P99 A;  2ZZW A;  4X48 A;  3TCH A;  1D4N A;  2V84 A;  3PPQ A;  4G68 C;  3S9N C;  1M5C A;  3E13 X;  5M2V A;  3A3C A;  3T1B A;  4FE8 A;  1ZJL A; 
#chains in the Genus database with same CATH homology
 2RIN A;  2REG A;  3SEW A;  5CI5 A;  2Z22 A;  2ANJ A;  1MXY A;  4OVJ A;  4WED A;  3OEL A;  2HXW A;  2OJT A;  1Y4T A;  3FAS A;  1B46 A;  2XXY A;  1IXH A;  3OMB A;  3PV0 E;  4QRZ A;  4G8H A;  1FQE A;  2THI A;  1SW4 A;  3VLU A;  4OER A;  4X1B A;  1PBP A;  4XKR A;  2F97 A;  1MH3 A;  3EQ1 A;  1PB7 A;  4H8I A;  1ZU0 A;  1QUI A;  4NF5 B;  4QSE A;  3T22 A;  1RYO A;  1URG A;  3HHF A;  4Q30 B;  3VVD A;  5JEI A;  1H3D A;  1SI0 A;  4ZE9 A;  1DMB A;  2AYS A;  3KZG A;  5CMB A;  1A40 A;  4LP2 B;  4YB5 A;  3RTW B;  3T9H B;  3VVF A;  4GD5 A;  3KSX A;  4OET A;  3N94 A;  1US5 A;  4I62 A;  3K01 A;  3QXM A;  1MQG A;  4RXL A;  5I2K B;  3RT6 B;  1EH3 A;  2B3B A;  4F3P A;  2QPQ A;  4P0G A;  4R72 A;  3I5O A;  1NNP A;  1MPB A;  2DSF A;  2P1S A;  1B3H A;  3V8X B;  3MZB A;  2UXA A;  3KJT A;  4ESX A;  1YPN A;  1QW0 A;  2Q8J A;  3K6V A;  4ZDM A;  4R75 A;  3QK6 A;  3U8Q A;  3RYB A;  4ESW A;  4EXK A;  4POX A;  1JW1 A;  4GOT A;  2PT1 A;  5DTB A;  3TEL A;  3PMV A;  2ONS A;  3PPN A;  3T9X B;  1NH7 A;  4EF1 A;  3K1P A;  4IY5 A;  4NF4 B;  4OZ9 A;  4Z7E A;  3PUW E;  5DVI A;  2HAU A;  1SW1 A;  2DQV A;  2HZK A;  1FTL A;  2OCU A;  4G8M A;  4ND9 A;  1NNT A;  1DTZ A;  3QUF A;  2HFB A;  5K2Y A;  4LZ8 A;  5TP9 A;  2XX8 A;  4OMB A;  2Y84 A;  1MXX A;  4OHN A;  5TU0 A;  3SEY A;  3QUJ A;  3T66 A;  2F36 A;  3E3K A;  1B7Z A;  2QS2 A;  3F11 A;  4PP0 A;  4U22 A;  3THI A;  4YMA A;  3K1N A;  3D4G A;  4FED A;  4BDO A;  1MH4 A;  4GF8 A;  1SBP A;  4N07 A;  3IO4 A;  5CRY A;  4F22 A;  5KZT A;  3TDJ A;  1I6B A;  4N6P A;  3UGW A;  2H99 A;  1JVX A;  4KYS A;  3B7D A;  2E0S A;  4RPO A;  5DVF A;  2WOP A;  2WOL A;  4X9T A;  5I2K A;  1MDQ A;  3UOR A;  4FJP A;  3Q28 A;  4DDD A;  2YJP A;  1TFD A;  2F78 A;  1MQH A;  4GXS B;  3VXC A;  4DXU A;  2ZMB A;  3K1M A;  3KOS A;  3PMW A;  1ZMG A;  4M4G A;  5KCJ A;  3QIM A;  5I57 B;  3OO8 A;  3MVX A;  3TCG A;  4NF5 A;  4Q5T A;  2IEE A;  4R6H A;  5CBR A;  2XHD A;  4TOZ A;  3N6U A;  3TOD A;  5L9M A;  3U94 A;  4MH5 A;  1EZ9 A;  3MVY A;  1LGB C;  2Q88 A;  3FGS A;  4TLL B;  1FQD A;  2B3F A;  1NNF A;  2F34 A;  3MP1 A;  2VOZ A;  1EZP A;  4QF9 A;  1R1N A;  1AOV A;  3CR9 A;  3IR1 A;  3QYT A;  2X7Q A;  1A55 A;  1CE2 A;  3A09 A;  1DPP A;  2VD3 A;  1BKA A;  2B4M A;  1WDN A;  4WXJ A;  3TTL A;  4F1Y A;  4K3F A;  5DYH A;  1JEU A;  5LOM A;  4LVQ A;  1QUJ A;  1Y20 A;  4YU0 A;  4DXC A;  3N26 A;  5EHM A;  3G3F A;  2H98 A;  4OXV A;  1SYI A;  3K0V A;  3PGF A;  3WAF A;  3W9W A;  1HSJ A;  3RPW A;  1A7L A;  3H7M A;  1B58 A;  3KJ7 A;  3LBS A;  2AL4 A;  2XXQ A;  4KHZ E;  3PUX E;  3FVN A;  5I58 B;  3PAM A;  4Q0C A;  1B51 A;  3C32 A;  3QSL A;  3T93 B;  5KCJ B;  1JNF A;  5AA2 B;  1BLF A;  4HTG A;  1FTJ A;  3HPI A;  2Q2C A;  2I3V A;  1B52 A;  1PB9 A;  4UA8 A;  5H8Q B;  5L9O A;  3CFX A;  2OK2 A;  3IOR A;  3IJO B;  3G3J A;  4XKP A;  4H5G A;  4GLI A;  4IO3 A;  3RY3 A;  2OBG A;  3MZ1 A;  1GTK A;  4EF2 A;  1IXG A;  4HS7 A;  1LB9 A;  4QSD A;  4JSD A;  1LAF E;  3CIJ A;  4TQU Q;  1B3G A;  1JET A;  3DP8 A;  1VFD A;  4THI A;  5DEX A;  3SEX A;  2DWH A;  3MVZ A;  2IA4 A;  3KN3 A;  3HO7 A;  2VP1 A;  4LZ5 A;  5AE4 A;  1MS7 A;  1URD A;  1OQG A;  4YKI A;  4PFT A;  1B40 A;  2OLB A;  1UTB A;  3N5L A;  3HST A;  3MPK A;  3MUQ A;  5BUU A;  1ZKB A;  4F2O A;  3IOV A;  4GXA A;  5HPQ A;  2ALU A;  4R2F A;  3CFZ A;  5I57 A;  1FQF A;  1B4H A;  1O63 A;  2UVJ A;  2Z8F A;  5I2N A;  1ZIU A;  1B9J A;  2VGQ A;  5EHS A;  1AL3 A;  1H43 A;  2FA7 A;  3SEU A;  4DE8 A;  2Z8E A;  1DTG A;  4LAT A;  1J1N A;  3CG3 A;  1XC1 A;  4NWD A;  1B1X A;  1P1W A;  1SI1 A;  5I84 A;  3OO9 A;  3W9V A;  1XVY A;  5AA3 A;  5H8Q A;  2RC9 A;  2DWA A;  1CB6 A;  2XXX A;  1BIY A;  2FYI A;  3TMG A;  3GBA A;  5JTY B;  3TPA A;  1MY1 A;  2O51 A;  3CVG A;  1PEB A;  3G3I A;  3IAZ A;  4H5F A;  4U23 A;  5ELV A;  3KFM A;  4KPT A;  3RUM A;  4F18 A;  1ZBM A;  1SW5 A;  1EZO A;  3EHT A;  2V93 A;  3IOU A;  3RYA A;  5H8F B;  3LSW A;  1LAG E;  4H65 A;  3TTK A;  2ONK E;  1B05 A;  2VHA A;  3EPE A;  4YB7 A;  3V83 A;  5DT6 A;  2DWJ A;  2G93 A;  4I1D A;  4NWC A;  4U2R A;  2XXP A;  1ZTY A;  1Y9U A;  2ZNS A;  3C36 A;  2F8D A;  2DS9 A;  1MRP A;  2PYY A;  2YPN A;  1XVX A;  4LZ7 A;  3AXF A;  1H76 A;  1B5H A;  3TQW A;  1R9L A;  5B7D A;  2I0B A;  2I58 A;  5TPA A;  3MP6 A;  4JWX A;  2I4C A;  4IO2 A;  3MW0 A;  4G4P A;  2R6G E;  2Q9T A;  1YTV A;  3O9P A;  2W7Y A;  1MXU A;  3CRB A;  3L6H A;  2YLN A;  2I0C A;  3FZV A;  4LQ2 A;  3FVK A;  3H6T A;  1I6A A;  3D4C A;  2UVH A;  3IX1 A;  2XX9 A;  1AH5 A;  1EU8 A;  2O69 A;  2X26 A;  4U1O A;  3GBB A;  1QJM A;  1GV8 A;  4C1T A;  4XKN A;  1N3X A;  4R9G A;  1FQA A;  1VFE A;  1FTK A;  4GL0 A;  2PMS A;  1OVB A;  4RY1 A;  4EUO A;  2UYE A;  3DRH A;  1R6Z A;  1LAX A;  3BBR A;  1QKB A;  3LSF B;  3MJN A;  1UIV A;  4QFN A;  1MM7 A;  2DVZ A;  3IO6 A;  3K6W A;  3U1O A;  2OWS A;  3G3G A;  4KCC A;  2XX7 A;  5I2N B;  4E0X A;  1MPC A;  1VSO A;  4PE5 B;  2F7B A;  3K2D A;  3H6W A;  3Q26 A;  3V89 B;  4BDQ A;  4F39 A;  2H9B A;  1I69 A;  1Q1K A;  1VE4 A;  1XHY A;  3VDF A;  3OEM A;  1XT8 A;  4QFO A;  4R6Y A;  4GFR A;  3O28 A;  3VLV A;  3KN7 A;  4KQP A;  1GVC A;  5AA4 A;  1WVJ A;  4ZZE A;  4XKQ A;  1Y1M A;  1SVX B;  4BDN A;  1URS A;  3MVW A;  3OOA A;  2RCA A;  1USY H;  2NOO A;  2OWT A;  2ZYO A;  5CM6 A;  4ZEK A;  1JW5 A;  4WKM A;  3GXA A;  3IOT A;  2R71 A;  5H8N A;  4QHQ A;  3TYH A;  3DRJ A;  5H8F A;  3DEL B;  4U21 A;  3FIR A;  4QFK A;  3UIF A;  2I48 A;  3MPL A;  3OXN A;  4RJZ A;  1D9Y A;  5KDT B;  2ZNT A;  2I3W A;  4YKJ A;  4ZS9 A;  3ZKK A;  1MM6 A;  1LCF A;  2CZL A;  1B1H A;  1M5B A;  1RKM A;  2XXU A;  2HEU A;  3PD9 A;  3PUY E;  1B0H A;  5H8H B;  3T9V A;  4F3S A;  3FTO A;  1XOC A;  4PFW A;  1IZ1 A;  3R6U A;  4JBZ A;  3W15 C;  2V25 A;  1FTO A;  3RLF E;  1QVS A;  5TPA B;  1Y3N A;  3BFU A;  2Z23 A;  3K6X A;  3KG2 A;  3GZG A;  2QS4 A;  3Q29 A;  1JEV A;  3O6G A;  3RT8 A;  3TFL A;  1F9B A;  3ECR A;  3OD7 A;  4I8C A;  4GL8 A;  3EHU A;  4IO6 A;  4IO4 A;  1LFI A;  2X7P A;  5CMM A;  5I56 A;  3SDF A;  1TWY A;  3UP9 A;  4R74 A;  2B4L A;  2XD3 A;  3R26 A;  4NE4 A;  5BWJ A;  4P0I A;  4RK9 A;  4NF6 B;  3SKP A;  2RF1 A;  5TP9 B;  1NNK A;  3CI8 A;  1OLA A;  4QFL A;  3IB2 A;  1LST A;  1LFH A;  1NKX A;  3MZ9 A;  3RQT A;  3TZA A;  3K02 A;  2ZYK A;  4IY6 A;  2D21 A;  2H25 A;  3E4R A;  4WEP A;  4GWO A;  2QL3 A;  3L6G A;  4IO7 A;  3UK4 A;  1RYX A;  3BFT A;  1USY E;  4DCX A;  2O7U A;  2XD2 A;  4OWD A;  5H8H A;  1BP5 A;  3GLB A;  1ATG A;  5F7V A;  1US4 A;  4XIG Q;  3O6P A;  3PMX A;  3VXB A;  4KCD A;  3T9U A;  4LON B;  3ILT B;  4ELQ A;  3FUZ A;  3LVU A;  4PQJ A;  5A5X A;  4NF8 B;  4O3C A;  3CG1 A;  1UTH A;  4OEN A;  1VR5 A;  2F5X A;  2UYF A;  1D3K A;  2V3T A;  4ZEI A;  4LUB A;  3OEK A;  3SES A;  3UN6 A;  3V5A A;  4YIC A;  2F6P A;  1P1U A;  4YMB A;  3A3U A;  5I56 B;  5F1Q A;  2M8C A;  2HZL A;  3JV9 A;  4ELO A;  4EXL A;  5ICQ A;  3B6W A;  3S9L C;  2XXH A;  2DE4 A;  3I6V A;  4N13 A;  1DPE A;  4R6K A;  3DP4 A;  2P2A A;  4KYD A;  5EYF A;  5ITO A;  4OQO A;  1M5F A;  1SYH A;  4R9F A;  1N04 A;  3SER A;  1B32 A;  4OFL A;  5AA2 D;  4JB7 A;  3KN8 A;  1OMP A;  4F31 B;  2V3U A;  3FVG A;  3KEI A;  3VFJ A;  4AB5 A;  2PX1 A;  3EF7 A;  4OEU A;  1B3L A;  4HCY A;  3DRI A;  2GHA A;  4ZED A;  1IEJ A;  1N0T A;  3FV2 A;  1A54 A;  2O84 X;  4G68 B;  1LLS A;  1PBQ A;  3G7W A;  3PPR A;  4XTC Q;  3VV5 A;  2DXY A;  5HBC A;  3H03 A;  4F1U A;  4PET A;  2Q89 A;  2XXI A;  3FJ7 A;  4FEC A;  4GRK A;  4UAC A;  1DSN A;  1KWH A;  5FTH A;  2HCA A;  2Z8D A;  4IB2 A;  1I6Q A;  1MXV A;  4F3B A;  5CMK A;  5I58 A;  2LAO A;  5FHN A;  2PVU A;  4NTL A;  3FAT A;  3USD A;  1P1O A;  2DVC A;  5AA2 A;  5ITP A;  3MAM A;  2NVU B;  2Y7R A;  4JWO A;  2XXR A;  4GVO A;  4YKP A;  2REJ A;  3TQL A;  1NFT A;  1IXC A;  1P1Q A;  3LC8 A;  1B7H A;  2P0S A;  3CFL A;  2FNC A;  3IOW A;  3OSR A;  1QUK A;  4GIZ A;  4FAT A;  3S4U A;  5DEX B;  4POW A;  2UVG A;  4BDL A;  1OIB A;  2Y7K A;  1YAE A;  5B70 A;  5ICT A;  1D9V A;  4MF3 A;  4FAJ A;  4JWY A;  4DIG A;  3B6T A;  1B0L A;  4DXB A;  2ZNU A;  1OVT A;  1JW4 A;  3LSL A;  3TTR A;  4H0W A;  3SEV A;  5JK4 A;  1DOT A;  3H3G A;  4NF8 A;  4OTE A;  1PC3 A;  1B5J A;  1UTH B;  3K6U A;  1A99 A;  3M3L A;  2DYX A;  4FIM A;  4LA9 A;  2NUV A;  4BDR A;  3KBR A;  3VE1 B;  1Y3Q A;  4DLD A;  4AB6 A;  1B4Z A;  2VD2 A;  2HAV A;  1ELJ A;  4KFQ A;  1MY3 A;  1N7X A;  5L8D A;  3DLN A;  2GFE A;  2H4I A;  1LFG A;  4ONY A;  4H8J A;  5CMC A;  3E9X A;  2RC8 A;  4JSO A;  1MG1 A;  1WOD A;  5FHO A;  1FTM A;  4G8N A;  3OSQ A;  4MLV A;  4G2Z A;  4MLQ A;  3H6V A;  3IB1 A;  1POT A;  1Q35 A;  3FJG A;  2RC7 A;  4ECF A;  2F35 A;  2D3I A;  4NED A;  2CMO A;  4RK2 A;  5HM4 B;  1YCJ A;  4HW8 A;  2RKM A;  5H8S A;  1MXW A;  1UTB B;  2XXV A;  4F2Q A;  4Z0I A;  3MC2 A;  1L5T A;  4G77 A;  3H6U A;  5IKB A;  3O66 A;  4G68 A;  3S2V A;  4OES A;  3M8U A;  4H67 A;  1MPD A;  2Y7P A;  4EQ7 A;  1NL5 A;  3C9H A;  1ZLQ A;  3G3K A;  4NF4 A;  3TTN A;  1HSE A;  1TFA A;  1R9Q A;  3PD8 A;  4NMY A;  2DWI A;  5CC2 A;  4BLA A;  3ZKL A;  1MQJ A;  4ZEF A;  1UIU A;  4DCY A;  1N3W A;  1LCT A;  3FVO A;  3H4Z A;  1POY 1;  3LSX A;  1B2H A;  1FQB A;  5IAI A;  1JQF A;  1ANF A;  4JDF A;  3TEP A;  5JTY A;  4YZZ A;  2PT2 A;  1H44 A;  1QKA A;  2ONR A;  3JZJ A;  4O3B A;  1PDA A;  4ISU A;  3FV1 A;  3PUZ E;  2BJJ X;  4IO5 A;  4L17 A;  3R7X A;  4Q8R A;  3TCF A;  1NMU A;  3MP8 A;  2ABH A;  3Q25 A;  4X1D A;  4ZZA A;  3FXQ A;  3O97 A;  1MXZ A;  3FXR A;  4H6D A;  1GGG A;  3HCQ A;  3DRF A;  1IIT A;  2NXO A;  4AQ4 A;  4F29 A;  5CBS A;  1Y1Z A;  1MDP 1;  5AA1 A;  2XXW A;  3HHG A;  3CSG A;  4DZ1 A;  4U4S A;  4TLM B;  5DVJ A;  2QMX A;  2GRV A;  2GHB A;  3Q27 A;  3IL1 B;  3RN8 A;  3RTF B;  2GH9 A;  4MBP A;  4BDM A;  1IUD A;  2QJE A;  2O6A A;  4OFO A;  2A5T B;  2NWJ A;  3N6T A;  2QS1 A;  1H45 A;  1N84 A;  3ONM A;  1MY2 A;  1LBB A;  3U93 A;  3KGC A;  4KD5 A;  3LR1 A;  3BKI B;  4QFP A;  1O64 A;  3EN3 A;  4YAH X;  4XXU A;  2QRY A;  2F7A A;  3OO6 A;  1OQH A;  2ESN A;  3RNN A;  3WAE A;  1PB8 A;  1SW2 A;  4EQB A;  3QAX A;  3DRG A;  1LAH E;  5KDT A;  2KLF A;  2F7C A;  1B5I A;  2H5Y A;  2ZXT A;  1IQ7 A;  4KI0 E;  3VVE A;  3MBP A;  3PUV E;  1MQI A;  3FXU A;  1SDX A;  1MY0 A;  3O2A A;  1N76 A;  3FD3 A;  1Y3P A;  3FJM A;  4F1V A;  3C34 A;  4P11 A;  4YKK A;  1XS5 A;  2WKY A;  1S7Y A;  2HQ0 A;  3SET A;  1N7W A;  2Q2A A;  2I4B A;  3IK6 B;  3C35 A;  3CSB A;  3I3V A;  4PFY A;  4IGR A;  3ZSF A;  4E0W A;  2WOK A;  4OYV A;  2A5T A;  1AMF A;  3K4U A;  3OEN A;  5K2X A;  5FTI A;  1S50 A;  4ZE8 A;  3IB0 A;  1M5D A;  1LB8 A;  2QMW A;  3LUY A;  4FOR A;  3M3F A;  4GQO A;  3MQ9 A;  3P7I A;  4NF6 A;  4R2B A;  4ZEB A;  3UA8 A;  5I59 B;  5J1D A;  2AL5 A;  2Y7I A;  1AIV A;  3DRK A;  3U72 A;  3H06 B;  2AIX A;  3KSJ A;  3TAJ A;  1B6H A;  2XXT A;  3KOT A;  2O1L A;  3HN0 A;  4O3A A;  1JVY A;  1SQY A;  3HV1 A;  4I9D A;  1A8F A;  1P1N A;  4U4X A;  4OEV A;  4C0R A;  2ZYN A;  3RGY A;  5FHM A;  1T0K A;  2O7I A;  2I6E A;  1Y4C A;  2I49 A;  1S9T A;  2DXR A;  3ILU B;  3O6H A;  4EDP A;  5L9S A;  4HCW A;  1A8E A;  4IGT A;  3OO7 A;  1FCK A;  4FEB A;  4KR5 A;  4F3G A;  4PFU A;  2O1M A;  3EHS A;  2QSX A;  2Y7W A;  4R73 A;  3TKD A;  3M3K A;  2QS3 A;  1MQD A;  3K00 A;  4YB6 A;  1Z7M E;  2DE3 A;  1FW0 A;  1TT1 A;  1II5 A;  3MWB A;  1Z7N E;  1QUL A;  4ELP A;  3CHG A;  1OLC A;  4MFI A;  3G3H A;  3T96 B;  4C1U A;  3S9M C;  3JYR A;  4JXI A;  4EQ9 A;  4U1Z A;  3VLW A;  1B3F A;  2A5S A;  5I59 A;  4LQ5 A;  1M5E A;  3PU5 A;  1IIW A;  1NH8 A;  4M1V A;  2OZZ A;  2PBW A;  1FQC A;  1GR2 A;  2RCB A;  4OFJ A;  3PPO A;  3C31 A;  2DP8 A;  3O29 A;  3ZS6 A;  1B7U A;  3B6Q A;  1B3E A;  2DOJ A;  1BTJ A;  1O7T A;  5A5X B;  1P99 A;  1IXI A;  3C4M A;  1TXF A;  2UVI A;  3O6I A;  2B65 A;  4X48 A;  3TCH A;  2V3Q A;  4KYE A;  2D5W A;  5ISU A;  3S9E A;  4ZEC A;  2O68 A;  2R9J A;  2F6G A;  2ZYM A;  3C33 A;  3IJX B;  1HSL A;  4RYA A;  4ELR A;  3TUS A;  3DP6 A;  5AA4 B;  4RA1 A;  1D4N A;  4H1X A;  2V84 A;  1UQW A;  3PPQ A;  4G68 C;  2DE2 A;  3S9N C;  1MY4 A;  1M5C A;  3E13 X;  5M2V A;  4QSC A;  3A3C A;  5H8N B;  2G29 A;  1LBC A;  3PPP A;  4RPN A;  3U92 A;  4RNS A;  2E1S A;  3DM0 A;  3ODB A;  4FE8 A;  3TTM A;  1ZJL A;  1SD3 A;  4F19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...